F479182

General Info

Members Datasets Scaffolds Average Seq Length
752 359 1504 330

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0038572|Ga0501070_0038572_1041_2168
Length 375
Sequence MNPMICQSSKDAVIIARCPGVVRLAAGSAGTTAIDADDGRAQRGGATMKHSTMRRGLIKAGASMLALGALSPVRAQGKVKLRFSSAFTEQDLRAEAYKAFAASISDHFDFEPYWNNTLFKQGTELVALQRGNLEMCNLAPADISKQIPAWSLMTSAYLFRDVDHLRKTFKSDVGREFTKMARDQLGIEVITPVYFGARHVNLRPDKTIRTPQDLAGIKLRMPPGEFWQFLGESIGVNPTPVAFAEVYTALQTGAIDGQDNPLLLSKLMKFDEVTSQFVLTGHVLGYDVMTVTTKVYDAMSKDEQARFRAAAEKAVDDYTTKFTGQERDVAEYFKKEGKKVYTPDVAAFRAFAQKKYVDKYGKDWPKGALERINAL

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
210 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
249 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
357 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
358 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
359 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0.13
Rhizoplane 5.19
Rhizosphere 90.43
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0038572 3300049586 Bacteria 3986
2 2214656052 2209111006 Bacteria 4793
3 ARcpr5oldR_c000133 3300000041 Bacteria 12591
4 ARSoilYngRDRAFT_c00421 3300000042 Bacteria 5404
5 ARSoilYngRDRAFT_c00534 3300000042 Bacteria 4306
6 ARcpr5yngRDRAFT_c000389 3300000043 Bacteria 5788
7 ARSoilOldRDRAFT_c000253 3300000044 Bacteria 7795
8 ARCol0yngRDRAFT_1000372 3300000652 Bacteria 6271
9 JGI24743J22301_10002037 3300001991 Bacteria 2963
10 JGI24744J21845_10014978 3300002077 Bacteria 1553
11 JGI24033J26618_1009182 3300002155 Bacteria 1148
12 JGI25405J52794_10006753 3300003911 Bacteria 2101
13 Ga0065716_1001666 3300005277 Bacteria 4363
14 Ga0065712_10086185 3300005290 Bacteria 2650
15 Ga0065715_10014727 3300005293 Bacteria 2028
16 Ga0070658_10011009 3300005327 Bacteria 7250
17 Ga0070658_10027338 3300005327 Bacteria 4578
18 Ga0070658_10067438 3300005327 Bacteria 2923
19 Ga0070676_10071704 3300005328 Bacteria 2081
20 Ga0070683_100001948 3300005329 Bacteria 16182
21 Ga0070683_100015594 3300005329 Bacteria 6679
22 Ga0070690_100001816 3300005330 Bacteria 11312
23 Ga0070670_100016743 3300005331 Bacteria 6292
24 Ga0070670_100119884 3300005331 Bacteria 2269
25 Ga0070670_100344232 3300005331 Bacteria 1309
26 Ga0070677_10001478 3300005333 Bacteria 7433
27 Ga0068869_100016119 3300005334 Bacteria 5032
28 Ga0068869_100028324 3300005334 Bacteria 3913
29 Ga0068869_100060213 3300005334 Bacteria 2782
30 Ga0070666_10001239 3300005335 Bacteria 15435
31 Ga0070680_100005698 3300005336 Bacteria 9443
32 Ga0070680_100021507 3300005336 Bacteria 5128
33 Ga0070680_100041625 3300005336 Bacteria 3725
34 Ga0070680_100108804 3300005336 Bacteria 2306
35 Ga0070682_100053114 3300005337 Bacteria 2538
36 Ga0068868_100001857 3300005338 Bacteria 14499
37 Ga0068868_100033519 3300005338 Bacteria 3958
38 Ga0068868_100329190 3300005338 Bacteria 1303
39 Ga0070660_100009686 3300005339 Bacteria 6787
40 Ga0070660_100073750 3300005339 Bacteria 2669
41 Ga0070660_100165419 3300005339 Bacteria 1784
42 Ga0070660_100302066 3300005339 Bacteria 1312
43 Ga0070689_100011580 3300005340 Bacteria 6321
44 Ga0070689_100070156 3300005340 Bacteria 2735
45 Ga0070687_100066598 3300005343 Bacteria 1919
46 Ga0070661_100016532 3300005344 Bacteria 5219
47 Ga0070661_100018763 3300005344 Bacteria 4922
48 Ga0070661_100054673 3300005344 Bacteria 2924
49 Ga0070661_100278747 3300005344 Bacteria 1296
50 Ga0070661_100427296 3300005344 Bacteria 1051
51 Ga0070692_10016884 3300005345 Bacteria 3479
52 Ga0070692_10047328 3300005345 Bacteria 2226
53 Ga0070692_10072405 3300005345 Bacteria 1839
54 Ga0070669_100164160 3300005353 Bacteria 1728
55 Ga0070669_100192862 3300005353 Bacteria 1599
56 Ga0070671_100003742 3300005355 Bacteria 11942
57 Ga0070671_100004294 3300005355 Bacteria 11280
58 Ga0070671_100007436 3300005355 Bacteria 8756
59 Ga0070671_100022305 3300005355 Bacteria 5171
60 Ga0070674_100024008 3300005356 Bacteria 3954
61 Ga0070673_100000654 3300005364 Bacteria 18985
62 Ga0070673_100459780 3300005364 Bacteria 1146
63 Ga0070688_100000458 3300005365 Bacteria 20699
64 Ga0070659_100016416 3300005366 Bacteria 5559
65 Ga0070659_100016451 3300005366 Bacteria 5554
66 Ga0070659_100346542 3300005366 Bacteria 1246
67 Ga0070667_100040838 3300005367 Bacteria 3891
68 Ga0070667_100344558 3300005367 Bacteria 1348
69 Ga0070709_10016674 3300005434 Bacteria 4199
70 Ga0070714_100039602 3300005435 Bacteria 3968
71 Ga0070714_100041336 3300005435 Bacteria 3890
72 Ga0070714_100074593 3300005435 Bacteria 2941
73 Ga0070714_100166258 3300005435 Bacteria 1999
74 Ga0070713_100000194 3300005436 Bacteria 40569
75 Ga0070713_100002402 3300005436 Bacteria 12211
76 Ga0070713_100016148 3300005436 Bacteria 5609
77 Ga0070713_100037700 3300005436 Bacteria 3909
78 Ga0070710_10015517 3300005437 Bacteria 3858
79 Ga0070710_10040068 3300005437 Bacteria 2581
80 Ga0070710_10218313 3300005437 Bacteria 1212
81 Ga0070711_100009245 3300005439 Bacteria 6060
82 Ga0070711_100146929 3300005439 Bacteria 1774
83 Ga0070705_100026640 3300005440 Bacteria 3148
84 Ga0070705_100260814 3300005440 Bacteria 1222
85 Ga0070700_100036838 3300005441 Bacteria 2970
86 Ga0070700_100228640 3300005441 Bacteria 1322
87 Ga0070708_100000735 3300005445 Bacteria 24829
88 Ga0070663_100013799 3300005455 Bacteria 5168
89 Ga0070663_100360165 3300005455 Bacteria 1180
90 Ga0070678_100005143 3300005456 Bacteria 7515
91 Ga0070678_100036123 3300005456 Bacteria 3456
92 Ga0070662_100020824 3300005457 Bacteria 4472
93 Ga0070662_100075826 3300005457 Bacteria 2491
94 Ga0070681_10002512 3300005458 Bacteria 16815
95 Ga0070681_10083705 3300005458 Bacteria 3143
96 Ga0070681_10086477 3300005458 Bacteria 3088
97 Ga0070681_10098405 3300005458 Bacteria 2871
98 Ga0070681_10343590 3300005458 Bacteria 1402
99 Ga0068867_100127671 3300005459 Bacteria 1972
100 Ga0068867_100250692 3300005459 Bacteria 1439
101 Ga0070685_10004837 3300005466 Bacteria 6815
102 Ga0070685_10005675 3300005466 Bacteria 6336
103 Ga0070707_100329240 3300005468 Bacteria 1484
104 Ga0070698_100031207 3300005471 Bacteria 5525
105 Ga0070698_100051706 3300005471 Bacteria 4184
106 Ga0070699_100014378 3300005518 Bacteria 6804
107 Ga0070699_100336805 3300005518 Unclassified 1357
108 Ga0070699_100419725 3300005518 Bacteria 1211
109 Ga0070679_100048304 3300005530 Bacteria 4240
110 Ga0070679_100284899 3300005530 Bacteria 1604
111 Ga0070684_100058019 3300005535 Bacteria 3382
112 Ga0070684_100298296 3300005535 Bacteria 1478
113 Ga0068853_100006418 3300005539 Bacteria 9346
114 Ga0068853_100010824 3300005539 Bacteria 7388
115 Ga0068853_100071331 3300005539 Bacteria 3025
116 Ga0068853_100150561 3300005539 Bacteria 2094
117 Ga0070672_100016645 3300005543 Bacteria 5271
118 Ga0070672_100039163 3300005543 Bacteria 3628
119 Ga0070686_100003930 3300005544 Bacteria 8176
120 Ga0070686_100229249 3300005544 Bacteria 1347
121 Ga0070696_100011674 3300005546 Bacteria 5886
122 Ga0070693_100013092 3300005547 Bacteria 4217
123 Ga0070665_100001524 3300005548 Bacteria 26828
124 Ga0070665_100028191 3300005548 Bacteria 5655
125 Ga0070704_100005483 3300005549 Bacteria 7396
126 Ga0070704_100006411 3300005549 Bacteria 6936
127 Ga0068855_100030044 3300005563 Bacteria 6500
128 Ga0068855_100037186 3300005563 Bacteria 5791
129 Ga0068855_100052315 3300005563 Bacteria 4809
130 Ga0068855_100073821 3300005563 Bacteria 3963
131 Ga0068855_100331962 3300005563 Bacteria 1678
132 Ga0070664_100004490 3300005564 Bacteria 11202
133 Ga0070664_100006787 3300005564 Bacteria 9230
134 Ga0070664_100025113 3300005564 Bacteria 4936
135 Ga0070664_100030004 3300005564 Bacteria 4535
136 Ga0070664_100072184 3300005564 Bacteria 2960
137 Ga0070664_100091111 3300005564 Bacteria 2639
138 Ga0070664_100165521 3300005564 Bacteria 1959
139 Ga0068857_100012109 3300005577 Bacteria 7501
140 Ga0068857_100047806 3300005577 Bacteria 3799
141 Ga0068854_100009405 3300005578 Bacteria 6312
142 Ga0068854_100020836 3300005578 Bacteria 4442
143 Ga0068854_100026164 3300005578 Bacteria 4007
144 Ga0068854_100027988 3300005578 Bacteria 3890
145 Ga0068854_100035484 3300005578 Bacteria 3490
146 Ga0068854_100197612 3300005578 Bacteria 1579
147 Ga0068856_100002133 3300005614 Bacteria 20512
148 Ga0068856_100037394 3300005614 Bacteria 4764
149 Ga0068856_100068728 3300005614 Bacteria 3502
150 Ga0070702_100003002 3300005615 Bacteria 7460
151 Ga0070702_100030410 3300005615 Bacteria 2944
152 Ga0068859_100004375 3300005617 Bacteria 14411
153 Ga0068859_100017681 3300005617 Bacteria 7168
154 Ga0068864_100000455 3300005618 Bacteria 35377
155 Ga0068864_100062776 3300005618 Bacteria 3219
156 Ga0068864_100108876 3300005618 Bacteria 2466
157 Ga0068866_10000548 3300005718 Bacteria 17150
158 Ga0068866_10008292 3300005718 Bacteria 4373
159 Ga0068851_10004615 3300005834 Bacteria 6216
160 Ga0068851_10010729 3300005834 Bacteria 4281
161 Ga0068870_10003494 3300005840 Bacteria 6666
162 Ga0068863_100016059 3300005841 Bacteria 7180
163 Ga0068863_100063450 3300005841 Bacteria 3494
164 Ga0068863_100156633 3300005841 Bacteria 2181
165 Ga0068863_100304208 3300005841 Bacteria 1547
166 Ga0068858_100000850 3300005842 Bacteria 31613
167 Ga0068858_100003813 3300005842 Bacteria 14901
168 Ga0068858_100070066 3300005842 Bacteria 3250
169 Ga0068860_100010860 3300005843 Bacteria 8982
170 Ga0068860_100012690 3300005843 Bacteria 8289
171 Ga0068860_100115277 3300005843 Bacteria 2569
172 Ga0068862_100070182 3300005844 Bacteria 3024
173 Ga0081455_10000007 3300005937 Bacteria 269394
174 Ga0081455_10056490 3300005937 Bacteria 3332
175 Ga0081455_10081380 3300005937 Bacteria 2652
176 Ga0081455_10149927 3300005937 Bacteria 1799
177 Ga0081538_10015025 3300005981 Bacteria 6022
178 Ga0081540_1021178 3300005983 Bacteria 3882
179 Ga0081540_1024162 3300005983 Bacteria 3532
180 Ga0081539_10098926 3300005985 Bacteria 1491
181 Ga0075368_10006180 3300006042 Bacteria 4169
182 Ga0075363_100037450 3300006048 Bacteria 2547
183 Ga0070712_100024506 3300006175 Bacteria 4000
184 Ga0070712_100033721 3300006175 Bacteria 3466
185 Ga0075362_10085420 3300006177 Bacteria 1459
186 Ga0075367_10045306 3300006178 Bacteria 2581
187 Ga0075366_10045687 3300006195 Bacteria 2595
188 Ga0075366_10053239 3300006195 Bacteria 2404
189 Ga0097621_100032076 3300006237 Bacteria 4174
190 Ga0097621_100334952 3300006237 Bacteria 1343
191 Ga0075370_10013284 3300006353 Bacteria 4373
192 Ga0068871_100012478 3300006358 Bacteria 6267
193 Ga0075428_100079075 3300006844 Bacteria 3589
194 Ga0075430_100000910 3300006846 Bacteria 23204
195 Ga0075430_100027341 3300006846 Bacteria 4847
196 Ga0075431_100012574 3300006847 Bacteria 8542
197 Ga0075431_100028736 3300006847 Bacteria 5717
198 Ga0075431_100044338 3300006847 Bacteria 4587
199 Ga0075433_10217813 3300006852 Bacteria 1696
200 Ga0075434_100231251 3300006871 Unclassified 1868
201 Ga0075429_100012725 3300006880 Bacteria 7300
202 Ga0075429_100028057 3300006880 Bacteria 4885
203 Ga0068865_100091731 3300006881 Bacteria 2205
204 Ga0075436_100049014 3300006914 Bacteria 2914
205 Ga0097620_100004375 3300006931 Bacteria 14411
206 Ga0097620_100017681 3300006931 Bacteria 7168
207 Ga0105240_10005733 3300009093 Bacteria 18422
208 Ga0105240_10006827 3300009093 Bacteria 16696
209 Ga0105240_10035030 3300009093 Bacteria 6473
210 Ga0105240_10179164 3300009093 Bacteria 2503
211 Ga0111539_10023230 3300009094 Bacteria 7617
212 Ga0111539_10037922 3300009094 Bacteria 5814
213 Ga0111539_10066813 3300009094 Bacteria 4247
214 Ga0105245_10005200 3300009098 Bacteria 11426
215 Ga0105245_10005498 3300009098 Bacteria 11129
216 Ga0105245_10010025 3300009098 Bacteria 8250
217 Ga0105245_10021206 3300009098 Bacteria 5696
218 Ga0105245_10408539 3300009098 Bacteria 1358
219 Ga0105247_10042311 3300009101 Bacteria 2790
220 Ga0105243_10020365 3300009148 Bacteria 5031
221 Ga0105243_10067824 3300009148 Bacteria 2873
222 Ga0105241_10000519 3300009174 Bacteria 29032
223 Ga0105241_10004014 3300009174 Bacteria 10884
224 Ga0105242_10015050 3300009176 Bacteria 5999
225 Ga0105248_10009820 3300009177 Bacteria 10542
226 Ga0105248_10017087 3300009177 Bacteria 7991
227 Ga0105248_10581879 3300009177 Bacteria 1263
228 Ga0105248_10593384 3300009177 Unclassified 1250
229 Ga0105237_10009010 3300009545 Bacteria 10731
230 Ga0105237_10022258 3300009545 Bacteria 6503
231 Ga0105237_10236357 3300009545 Bacteria 1828
232 Ga0105237_10305638 3300009545 Bacteria 1593
233 Ga0105238_10050500 3300009551 Bacteria 4187
234 Ga0105238_10432259 3300009551 Bacteria 1312
235 Ga0105249_10138387 3300009553 Bacteria 2332
236 Ga0105249_10383029 3300009553 Bacteria 1433
237 Ga0105239_10172265 3300010375 Unclassified 2420
238 Ga0105239_10173718 3300010375 Bacteria 2410
239 Ga0105239_10184567 3300010375 Bacteria 2334
240 Ga0105239_10270445 3300010375 Bacteria 1911
241 Ga0105239_10317920 3300010375 Unclassified 1755
242 Ga0105246_10346063 3300011119 Bacteria 1216
243 Ga0157373_10001957 3300013100 Bacteria 15609
244 Ga0157373_10082432 3300013100 Bacteria 2267
245 Ga0157373_10147993 3300013100 Bacteria 1652
246 Ga0157371_10025165 3300013102 Bacteria 4341
247 Ga0157371_10027089 3300013102 Bacteria 4161
248 Ga0157371_10027345 3300013102 Bacteria 4138
249 Ga0157371_10040021 3300013102 Bacteria 3350
250 Ga0157370_10002179 3300013104 Bacteria 23894
251 Ga0157370_10004050 3300013104 Bacteria 17012
252 Ga0157370_10005883 3300013104 Bacteria 13674
253 Ga0157370_10013193 3300013104 Bacteria 8522
254 Ga0157370_10064779 3300013104 Bacteria 3459
255 Ga0157370_10239549 3300013104 Bacteria 1679
256 Ga0157369_10009390 3300013105 Bacteria 11184
257 Ga0157369_10028665 3300013105 Bacteria 6159
258 Ga0157369_10143278 3300013105 Bacteria 2528
259 Ga0157369_10159500 3300013105 Bacteria 2381
260 Ga0157374_10035810 3300013296 Bacteria 4542
261 Ga0157374_10275578 3300013296 Bacteria 1660
262 Ga0157378_10007210 3300013297 Bacteria 9712
263 Ga0157378_10109592 3300013297 Unclassified 2529
264 Ga0157378_10160721 3300013297 Bacteria 2100
265 Ga0163162_10006833 3300013306 Bacteria 11068
266 Ga0163162_10066697 3300013306 Bacteria 3648
267 Ga0163162_10081396 3300013306 Bacteria 3309
268 Ga0163162_10115260 3300013306 Plasmid 2787
269 Ga0163162_10208950 3300013306 Bacteria 2081
270 Ga0163162_10233548 3300013306 Bacteria 1970
271 Ga0163162_10277903 3300013306 Bacteria 1806
272 Ga0163162_10418840 3300013306 Bacteria 1472
273 Ga0157372_10010915 3300013307 Bacteria 9668
274 Ga0157372_10083144 3300013307 Bacteria 3626
275 Ga0157372_10087269 3300013307 Bacteria 3540
276 Ga0157372_10103665 3300013307 Bacteria 3251
277 Ga0157372_10164659 3300013307 Bacteria 2564
278 Ga0157372_10185143 3300013307 Bacteria 2411
279 Ga0157375_10069414 3300013308 Bacteria 3530
280 Ga0157375_10110232 3300013308 Bacteria 2849
281 Ga0157375_10471157 3300013308 Bacteria 1421
282 Ga0163163_10000310 3300014325 Bacteria 47904
283 Ga0163163_10006815 3300014325 Bacteria 10018
284 Ga0157380_10000875 3300014326 Bacteria 18931
285 Ga0157380_10004597 3300014326 Bacteria 9584
286 Ga0157380_10006262 3300014326 Bacteria 8357
287 Ga0182008_10046675 3300014497 Bacteria 2153
288 Ga0157377_10006653 3300014745 Bacteria 5526
289 Ga0157379_10000626 3300014968 Bacteria 28509
290 Ga0157379_10022425 3300014968 Bacteria 5593
291 Ga0157379_10023713 3300014968 Bacteria 5447
292 Ga0157379_10026902 3300014968 Bacteria 5121
293 Ga0157379_10260919 3300014968 Bacteria 1574
294 Ga0157376_10003923 3300014969 Bacteria 10283
295 Ga0157376_10041627 3300014969 Bacteria 3762
296 Ga0157376_10078403 3300014969 Bacteria 2829
297 Ga0163161_10010171 3300017792 Bacteria 6512
298 Ga0163161_10017525 3300017792 Bacteria 5012
299 Ga0163161_10179567 3300017792 Bacteria 1622
300 Ga0209233_1002928 3300025261 Bacteria 6102
301 Ga0207426_1020952 3300025302 Bacteria 2265
302 Ga0207697_10003301 3300025315 Bacteria 8028
303 Ga0207656_10019955 3300025321 Bacteria 2656
304 Ga0207656_10047164 3300025321 Bacteria 1851
305 Ga0207682_10000588 3300025893 Bacteria 16868
306 Ga0207692_10017497 3300025898 Bacteria 3199
307 Ga0207642_10001634 3300025899 Bacteria 6902
308 Ga0207710_10020515 3300025900 Bacteria 2825
309 Ga0207710_10090371 3300025900 Bacteria 1432
310 Ga0207688_10004018 3300025901 Bacteria 8011
311 Ga0207680_10012587 3300025903 Bacteria 4314
312 Ga0207680_10098843 3300025903 Bacteria 1871
313 Ga0207699_10077201 3300025906 Bacteria 2054
314 Ga0207645_10024499 3300025907 Bacteria 3911
315 Ga0207643_10000258 3300025908 Bacteria 36684
316 Ga0207705_10055737 3300025909 Bacteria 2850
317 Ga0207705_10075035 3300025909 Bacteria 2455
318 Ga0207705_10134323 3300025909 Bacteria 1843
319 Ga0207705_10209611 3300025909 Bacteria 1478
320 Ga0207654_10028322 3300025911 Bacteria 3054
321 Ga0207654_10044840 3300025911 Plasmid 2514
322 Ga0207654_10049488 3300025911 Bacteria 2411
323 Ga0207707_10014843 3300025912 Bacteria 6784
324 Ga0207707_10017578 3300025912 Bacteria 6237
325 Ga0207707_10018391 3300025912 Bacteria 6092
326 Ga0207707_10091143 3300025912 Bacteria 2664
327 Ga0207707_10105547 3300025912 Bacteria 2462
328 Ga0207695_10025902 3300025913 Bacteria 6555
329 Ga0207695_10144100 3300025913 Bacteria 2328
330 Ga0207695_10204101 3300025913 Bacteria 1890
331 Ga0207671_10056032 3300025914 Bacteria 2920
332 Ga0207671_10109864 3300025914 Bacteria 2097
333 Ga0207671_10138264 3300025914 Bacteria 1875
334 Ga0207693_10046098 3300025915 Bacteria 3424
335 Ga0207693_10139919 3300025915 Bacteria 1903
336 Ga0207663_10009858 3300025916 Bacteria 5057
337 Ga0207663_10035380 3300025916 Bacteria 2995
338 Ga0207663_10041042 3300025916 Bacteria 2817
339 Ga0207660_10039319 3300025917 Bacteria 3306
340 Ga0207660_10091306 3300025917 Unclassified 2258
341 Ga0207660_10110224 3300025917 Bacteria 2070
342 Ga0207662_10010644 3300025918 Bacteria 5085
343 Ga0207662_10026411 3300025918 Bacteria 3349
344 Ga0207662_10133213 3300025918 Bacteria 1568
345 Ga0207657_10000674 3300025919 Bacteria 36386
346 Ga0207657_10012551 3300025919 Bacteria 8355
347 Ga0207657_10039540 3300025919 Bacteria 4190
348 Ga0207657_10059035 3300025919 Bacteria 3299
349 Ga0207657_10117101 3300025919 Bacteria 2194
350 Ga0207657_10133205 3300025919 Bacteria 2035
351 Ga0207649_10027890 3300025920 Bacteria 3319
352 Ga0207649_10060228 3300025920 Bacteria 2385
353 Ga0207649_10222879 3300025920 Bacteria 1344
354 Ga0207652_10061032 3300025921 Bacteria 3255
355 Ga0207652_10074689 3300025921 Bacteria 2952
356 Ga0207652_10125491 3300025921 Bacteria 2286
357 Ga0207652_10368681 3300025921 Unclassified 1296
358 Ga0207681_10102062 3300025923 Bacteria 2071
359 Ga0207681_10149870 3300025923 Bacteria 1747
360 Ga0207681_10163660 3300025923 Bacteria 1679
361 Ga0207694_10005465 3300025924 Bacteria 9764
362 Ga0207650_10001906 3300025925 Bacteria 14711
363 Ga0207650_10018316 3300025925 Bacteria 4913
364 Ga0207650_10116171 3300025925 Bacteria 2078
365 Ga0207650_10209923 3300025925 Bacteria 1563
366 Ga0207650_10224823 3300025925 Bacteria 1512
367 Ga0207650_10344574 3300025925 Bacteria 1224
368 Ga0207659_10017144 3300025926 Bacteria 4728
369 Ga0207687_10001774 3300025927 Bacteria 14835
370 Ga0207687_10003797 3300025927 Bacteria 10153
371 Ga0207700_10000176 3300025928 Bacteria 38407
372 Ga0207700_10009729 3300025928 Bacteria 6025
373 Ga0207700_10010411 3300025928 Bacteria 5867
374 Ga0207700_10105233 3300025928 Bacteria 2259
375 Ga0207664_10002044 3300025929 Bacteria 13290
376 Ga0207664_10044596 3300025929 Bacteria 3473
377 Ga0207664_10059693 3300025929 Bacteria 3038
378 Ga0207664_10092413 3300025929 Bacteria 2483
379 Ga0207664_10295957 3300025929 Bacteria 1423
380 Ga0207644_10009735 3300025931 Bacteria 6319
381 Ga0207644_10015741 3300025931 Bacteria 5082
382 Ga0207644_10019557 3300025931 Bacteria 4595
383 Ga0207644_10032890 3300025931 Bacteria 3621
384 Ga0207644_10086427 3300025931 Bacteria 2328
385 Ga0207690_10027505 3300025932 Bacteria 3594
386 Ga0207690_10038410 3300025932 Bacteria 3116
387 Ga0207690_10046218 3300025932 Bacteria 2882
388 Ga0207690_10164424 3300025932 Bacteria 1657
389 Ga0207706_10003913 3300025933 Bacteria 14134
390 Ga0207706_10010710 3300025933 Bacteria 8375
391 Ga0207706_10275229 3300025933 Bacteria 1469
392 Ga0207686_10003277 3300025934 Bacteria 8701
393 Ga0207709_10087859 3300025935 Bacteria 2022
394 Ga0207709_10092551 3300025935 Bacteria 1980
395 Ga0207670_10015951 3300025936 Bacteria 4501
396 Ga0207670_10030753 3300025936 Bacteria 3432
397 Ga0207670_10085378 3300025936 Bacteria 2218
398 Ga0207670_10109462 3300025936 Bacteria 1988
399 Ga0207669_10030823 3300025937 Bacteria 2986
400 Ga0207669_10116459 3300025937 Bacteria 1803
401 Ga0207704_10057394 3300025938 Bacteria 2391
402 Ga0207665_10011245 3300025939 Bacteria 5872
403 Ga0207691_10016130 3300025940 Bacteria 7096
404 Ga0207691_10017370 3300025940 Bacteria 6825
405 Ga0207691_10065687 3300025940 Bacteria 3283
406 Ga0207691_10082527 3300025940 Bacteria 2887
407 Ga0207691_10210579 3300025940 Bacteria 1688
408 Ga0207711_10000115 3300025941 Bacteria 83472
409 Ga0207711_10009087 3300025941 Bacteria 8299
410 Ga0207711_10010068 3300025941 Bacteria 7860
411 Ga0207711_10053291 3300025941 Bacteria 3469
412 Ga0207711_10267257 3300025941 Bacteria 1573
413 Ga0207711_10331097 3300025941 Bacteria 1408
414 Ga0207689_10013941 3300025942 Bacteria 6847
415 Ga0207689_10054364 3300025942 Bacteria 3297
416 Ga0207689_10160243 3300025942 Unclassified 1854
417 Ga0207689_10176242 3300025942 Bacteria 1763
418 Ga0207661_10030374 3300025944 Bacteria 4162
419 Ga0207661_10091958 3300025944 Bacteria 2528
420 Ga0207661_10186106 3300025944 Bacteria 1817
421 Ga0207679_10010973 3300025945 Bacteria 5846
422 Ga0207679_10048797 3300025945 Bacteria 3084
423 Ga0207679_10116052 3300025945 Bacteria 2122
424 Ga0207679_10250188 3300025945 Bacteria 1506
425 Ga0207667_10018946 3300025949 Bacteria 7695
426 Ga0207667_10028564 3300025949 Bacteria 6057
427 Ga0207667_10171353 3300025949 Bacteria 2231
428 Ga0207667_10200565 3300025949 Bacteria 2047
429 Ga0207651_10000427 3300025960 Bacteria 17939
430 Ga0207651_10074293 3300025960 Bacteria 2420
431 Ga0207712_10095091 3300025961 Bacteria 2203
432 Ga0207640_10012775 3300025981 Bacteria 4794
433 Ga0207640_10065767 3300025981 Bacteria 2420
434 Ga0207640_10073647 3300025981 Bacteria 2309
435 Ga0207658_10025880 3300025986 Bacteria 4110
436 Ga0207658_10059715 3300025986 Bacteria 2842
437 Ga0207658_10142325 3300025986 Bacteria 1942
438 Ga0207677_10000210 3300026023 Bacteria 47077
439 Ga0207677_10157760 3300026023 Bacteria 1759
440 Ga0207703_10000438 3300026035 Bacteria 43827
441 Ga0207703_10060873 3300026035 Bacteria 3089
442 Ga0207703_10268754 3300026035 Bacteria 1544
443 Ga0207703_10599957 3300026035 Bacteria 1041
444 Ga0207639_10010716 3300026041 Bacteria 6349
445 Ga0207639_10036840 3300026041 Bacteria 3628
446 Ga0207639_10042120 3300026041 Bacteria 3421
447 Ga0207639_10188178 3300026041 Bacteria 1761
448 Ga0207678_10026320 3300026067 Bacteria 5075
449 Ga0207678_10037008 3300026067 Bacteria 4248
450 Ga0207678_10048292 3300026067 Bacteria 3679
451 Ga0207708_10008723 3300026075 Bacteria 7505
452 Ga0207708_10285831 3300026075 Bacteria 1338
453 Ga0207702_10027542 3300026078 Bacteria 4719
454 Ga0207702_10032746 3300026078 Bacteria 4337
455 Ga0207702_10169639 3300026078 Unclassified 2000
456 Ga0207702_10180445 3300026078 Bacteria 1944
457 Ga0207641_10001573 3300026088 Bacteria 22307
458 Ga0207641_10038199 3300026088 Bacteria 4013
459 Ga0207641_10159089 3300026088 Bacteria 2052
460 Ga0207648_10014918 3300026089 Bacteria 7162
461 Ga0207648_10098637 3300026089 Bacteria 2558
462 Ga0207676_10000415 3300026095 Bacteria 36094
463 Ga0207676_10015218 3300026095 Bacteria 5548
464 Ga0207676_10097406 3300026095 Bacteria 2430
465 Ga0207676_10119021 3300026095 Bacteria 2224
466 Ga0207676_10549380 3300026095 Bacteria 1103
467 Ga0207674_10000993 3300026116 Bacteria 37011
468 Ga0207674_10009327 3300026116 Bacteria 11235
469 Ga0207674_10026860 3300026116 Bacteria 6106
470 Ga0207675_100016078 3300026118 Bacteria 6987
471 Ga0207675_100074177 3300026118 Bacteria 3184
472 Ga0207683_10003290 3300026121 Bacteria 14088
473 Ga0207683_10044064 3300026121 Bacteria 3900
474 Ga0207698_10003090 3300026142 Bacteria 9987
475 Ga0207698_10016041 3300026142 Bacteria 5038
476 Ga0207698_10103545 3300026142 Bacteria 2366
477 Ga0207698_10290505 3300026142 Bacteria 1517
478 Ga0210002_1001558 3300027617 Bacteria 3260
479 Ga0209966_1001497 3300027695 Bacteria 4060
480 Ga0209974_10008047 3300027876 Bacteria 3613
481 Ga0207428_10005855 3300027907 Bacteria 11396
482 Ga0268266_10015381 3300028379 Bacteria 6566
483 Ga0268266_10017880 3300028379 Bacteria 6041
484 Ga0268265_10075566 3300028380 Bacteria 2639
485 Ga0268264_10000030 3300028381 Bacteria 418542
486 Ga0268264_10001696 3300028381 Bacteria 20279
487 Ga0268264_10062269 3300028381 Bacteria 3132
488 Ga0268264_10081287 3300028381 Bacteria 2769
489 Ga0268264_10081625 3300028381 Bacteria 2764
490 Ga0268264_10194180 3300028381 Bacteria 1852
491 Ga0268264_10478007 3300028381 Bacteria 1211
492 Ga0307511_10070276 3300030521 Bacteria 2565
493 Ga0265313_10014353 3300031595 Bacteria 4685
494 Ga0307508_10198773 3300031616 Bacteria 1605
495 Ga0265314_10001782 3300031711 Bacteria 23250
496 Ga0265314_10010256 3300031711 Bacteria 7836
497 Ga0307516_10003295 3300031730 Bacteria 20897
498 Ga0307410_10155937 3300031852 Bacteria 1705
499 Ga0307411_10026412 3300032005 Bacteria 3497
500 Ga0307507_10008299 3300033179 Bacteria 14461
501 Ga0373930_0000714 3300034816 Bacteria 4685
502 Ga0373948_0000278 3300034817 Bacteria 6176
503 Ga0373950_0000561 3300034818 Bacteria 4553
504 Ga0373959_0012966 3300034820 Bacteria 1496
505 Ga0373938_0001504 3300034957 Bacteria 3743
506 Ga0373929_0000641 3300035085 Bacteria 6752
507 Ga0373934_0015744 3300035086 Bacteria 2871
508 Ga0373940_0000329 3300035088 Bacteria 6985
509 Ga0373944_0014895 3300035089 Bacteria 2176
510 Ga0373951_0001637 3300035091 Bacteria 5873
511 Ga0373952_0001086 3300035092 Bacteria 4966
512 Ga0373932_0000993 3300035112 Bacteria 8199
513 Ga0373939_0001707 3300035114 Bacteria 5296
514 Ga0373941_0001588 3300035115 Bacteria 4832
515 Ga0373945_0054018 3300035116 Bacteria 1484
516 Ga0373953_0026422 3300035117 Bacteria 2224
517 Ga0373960_0000819 3300035121 Bacteria 6536
518 Ga0373943_0005526 3300035170 Bacteria 5676
519 Ga0373943_0008825 3300035170 Bacteria 4516
520 Ga0373946_0044108 3300035171 Bacteria 1840
521 Ga0373955_0009714 3300035172 Bacteria 4518
522 Ga0373942_0001117 3300035207 Bacteria 7124
523 Ga0373961_0002029 3300035241 Bacteria 5418
524 Ga0373962_0002693 3300035242 Bacteria 4228
525 Ga0373924_0009579 3300035410 Bacteria 3554
526 Ga0373931_0013680 3300035691 Bacteria 3955
527 Ga0373935_0051730 3300035692 Bacteria 2609
528 Ga0373935_0055756 3300035692 Bacteria 2518
529 Ga0373935_0057103 3300035692 Bacteria 2490
530 Ga0373935_0090829 3300035692 Bacteria 1999
531 Ga0373927_0010954 3300035695 Bacteria 6037
532 Ga0373927_0019914 3300035695 Bacteria 4400
533 Ga0373927_0051034 3300035695 Bacteria 2675
534 Ga0373927_0061643 3300035695 Bacteria 2426
535 Ga0373933_0067987 3300035724 Bacteria 2163
536 Ga0373947_0038644 3300035725 Bacteria 2836
537 Ga0373947_0116331 3300035725 Bacteria 1695
538 Ga0373937_0007452 3300036401 Bacteria 9469
539 Ga0373937_0016948 3300036401 Bacteria 6479
540 Ga0373937_0028264 3300036401 Bacteria 5073
541 Ga0373937_0046326 3300036401 Bacteria 3976
542 Ga0373937_0049410 3300036401 Bacteria 3852
543 Ga0373937_0070123 3300036401 Bacteria 3233
544 Ga0373937_0641726 3300036401 Bacteria 1007
545 Ga0373937_0648310 3300036401 Bacteria 1001
546 Ga0316584_0166261 3300036712 Bacteria 1638
547 Ga0373925_0031704 3300037068 Bacteria 3886
548 Ga0373925_0059617 3300037068 Bacteria 2863
549 Ga0373925_0066119 3300037068 Bacteria 2725
550 Ga0373925_0067264 3300037068 Bacteria 2702
551 Ga0373925_0068648 3300037068 Bacteria 2676
552 Ga0373925_0309954 3300037068 Bacteria 1276
553 Ga0395899_0085650 3300037312 Bacteria 2290
554 Ga0395899_0229001 3300037312 Bacteria 1284
555 Ga0395900_0000660 3300037418 Bacteria 46104
556 Ga0395900_0270296 3300037418 Bacteria 1695
557 Ga0395898_0010332 3300037466 Bacteria 9765
558 Ga0395898_0242837 3300037466 Bacteria 1718
559 Ga0395905_0103703 3300037471 Bacteria 2670
560 Ga0395901_0015213 3300038443 Bacteria 7828
561 Ga0436365_1000353 3300039437 Bacteria 3454
562 Ga0439465_0045663 3300041413 Bacteria 1425
563 Ga0439441_003098 3300042001 Bacteria 2415
564 Ga0439463_003728 3300042016 Bacteria 3844
565 Ga0439435_0001664 3300042436 Bacteria 4183
566 Ga0439444_0001632 3300042437 Bacteria 2956
567 Ga0439464_0031626 3300042439 Bacteria 1485
568 Ga0439460_0003319 3300042461 Bacteria 3897
569 Ga0466963_0015157 3300044694 Bacteria 4767
570 Ga0466967_0183107 3300045976 Bacteria 1977
571 Ga0495592_0024943 3300046454 Bacteria 4543
572 Ga0495592_0165926 3300046454 Bacteria 1516
573 Ga0495603_0005621 3300046455 Bacteria 7494
574 Ga0495629_0003184 3300046459 Bacteria 12428
575 Ga0495629_0004812 3300046459 Bacteria 10127
576 Ga0495629_0055963 3300046459 Bacteria 2758
577 Ga0495629_0154221 3300046459 Bacteria 1596
578 Ga0495638_0002275 3300046460 Bacteria 15873
579 Ga0495641_0011903 3300046461 Bacteria 4911
580 Ga0495651_0001523 3300046462 Bacteria 17910
581 Ga0495653_0230996 3300046463 Bacteria 1238
582 Ga0495582_0189948 3300046473 Bacteria 1172
583 Ga0495639_0032423 3300046475 Bacteria 2330
584 Ga0495662_0001316 3300046476 Bacteria 12297
585 Ga0495662_0006313 3300046476 Bacteria 5925
586 Ga0495664_0003809 3300046477 Bacteria 8225
587 Ga0495585_0007779 3300046492 Bacteria 6530
588 Ga0495594_0096270 3300046499 Bacteria 1663
589 Ga0495607_0012402 3300046501 Bacteria 5630
590 Ga0495608_0052453 3300046511 Bacteria 2700
591 Ga0495618_0007916 3300046514 Bacteria 6431
592 Ga0495618_0010659 3300046514 Bacteria 5563
593 Ga0495630_0017381 3300046517 Bacteria 5268
594 Ga0495630_0146169 3300046517 Bacteria 1798
595 Ga0495644_0006663 3300046523 Bacteria 4473
596 Ga0495665_0012717 3300046531 Bacteria 4554
597 Ga0495640_0012123 3300046533 Bacteria 6600
598 Ga0495640_0045064 3300046533 Bacteria 3062
599 Ga0495645_0002851 3300046543 Bacteria 11729
600 Ga0495645_0039755 3300046543 Bacteria 3430
601 Ga0495645_0040378 3300046543 Bacteria 3404
602 Ga0495622_0020718 3300046557 Bacteria 3061
603 Ga0495633_0012359 3300046558 Bacteria 4545
604 Ga0495667_0002874 3300046559 Bacteria 11538
605 Ga0495667_0046983 3300046559 Bacteria 2853
606 Ga0495656_0000732 3300046615 Bacteria 10619
607 Ga0495668_0064940 3300046616 Bacteria 2009
608 Ga0495635_0002953 3300046663 Bacteria 11671
609 Ga0495635_0101298 3300046663 Bacteria 1968
610 Ga0495659_0014866 3300046664 Bacteria 2553
611 Ga0495599_0064905 3300046678 Bacteria 2281
612 Ga0495599_0202907 3300046678 Bacteria 1218
613 Ga0495646_0089002 3300046680 Bacteria 1787
614 Ga0495647_0028626 3300046681 Bacteria 2055
615 Ga0495647_0098550 3300046681 Bacteria 1208
616 Ga0495658_0004733 3300046683 Bacteria 6681
617 Ga0495658_0062082 3300046683 Bacteria 2147
618 Ga0495613_0042056 3300046689 Bacteria 3382
619 Ga0495613_0047441 3300046689 Bacteria 3173
620 Ga0495613_0071069 3300046689 Bacteria 2537
621 Ga0495624_0004999 3300046690 Bacteria 9602
622 Ga0495624_0022742 3300046690 Bacteria 4137
623 Ga0495670_0000601 3300046691 Bacteria 17188
624 Ga0495581_0020159 3300047315 Bacteria 3871
625 Ga0495581_0040522 3300047315 Bacteria 2695
626 Ga0495581_0155096 3300047315 Bacteria 1338
627 Ga0495581_0173378 3300047315 Bacteria 1261
628 Ga0495636_0004078 3300047318 Bacteria 5716
629 Ga0495674_0019965 3300047319 Bacteria 6210
630 Ga0495674_0039364 3300047319 Bacteria 4238
631 Ga0495680_0009001 3300047322 Bacteria 9020
632 Ga0495680_0020923 3300047322 Bacteria 5488
633 Ga0495684_0002180 3300047471 Bacteria 15670
634 Ga0495593_0005740 3300047673 Bacteria 7326
635 Ga0496100_0040161 3300048903 Bacteria 2975
636 Ga0496101_0043445 3300048904 Bacteria 3212
637 Ga0496102_0074021 3300048905 Bacteria 3131
638 Ga0496102_0299894 3300048905 Bacteria 1514
639 Ga0496103_0083672 3300048906 Unclassified 2009
640 Ga0496104_0014685 3300048907 Bacteria 7075
641 Ga0496104_0023522 3300048907 Bacteria 5665
642 Ga0496104_0178085 3300048907 Bacteria 2036
643 Ga0496104_0223955 3300048907 Bacteria 1793
644 Ga0496105_0019861 3300048908 Bacteria 5421
645 Ga0496105_0037439 3300048908 Bacteria 3994
646 Ga0496106_0002744 3300048909 Bacteria 13030
647 Ga0496106_0022003 3300048909 Bacteria 4737
648 Ga0496107_0260230 3300048910 Bacteria 1291
649 Ga0496108_0006795 3300048911 Bacteria 9263
650 Ga0496108_0009176 3300048911 Bacteria 8005
651 Ga0496108_0010758 3300048911 Bacteria 7428
652 Ga0496108_0080093 3300048911 Bacteria 2766
653 Ga0496109_0001752 3300048912 Bacteria 18075
654 Ga0496109_0021700 3300048912 Bacteria 5683
655 Ga0496109_0047277 3300048912 Bacteria 3912
656 Ga0496109_0073566 3300048912 Bacteria 3140
657 Ga0496109_0334824 3300048912 Bacteria 1429
658 Ga0496110_0004014 3300048913 Bacteria 11342
659 Ga0496110_0017212 3300048913 Bacteria 6044
660 Ga0496110_0030129 3300048913 Bacteria 4676
661 Ga0496110_0093003 3300048913 Bacteria 2699
662 Ga0496111_0013415 3300048914 Bacteria 5576
663 Ga0496111_0013428 3300048914 Bacteria 5574
664 Ga0496111_0083054 3300048914 Bacteria 2340
665 Ga0496112_0000505 3300048915 Bacteria 26413
666 Ga0496112_0005421 3300048915 Bacteria 11030
667 Ga0496112_0008414 3300048915 Bacteria 9238
668 Ga0496112_0116279 3300048915 Bacteria 2645
669 Ga0496112_0147484 3300048915 Unclassified 2321
670 Ga0496112_0444725 3300048915 Bacteria 1234
671 Ga0496113_0008678 3300048916 Bacteria 6632
672 Ga0496114_0017046 3300048917 Bacteria 5859
673 Ga0496115_0243528 3300048918 Bacteria 1482
674 Ga0496117_0023017 3300048920 Bacteria 4981
675 Ga0496118_0003784 3300048921 Bacteria 18679
676 Ga0496121_0000089 3300048924 Bacteria 219007
677 Ga0496124_0002829 3300048927 Bacteria 21960
678 Ga0496124_0034906 3300048927 Bacteria 4405
679 Ga0496125_0018347 3300048928 Bacteria 6648
680 Ga0496126_0004866 3300048929 Bacteria 15728
681 Ga0501031_0135997 3300049568 Bacteria 1606
682 Ga0501032_0084819 3300049569 Bacteria 2106
683 Ga0501033_0039139 3300049570 Bacteria 3542
684 Ga0501034_0067440 3300049571 Bacteria 3591
685 Ga0501037_0150433 3300049573 Bacteria 1664
686 Ga0501038_0141619 3300049574 Bacteria 1967
687 Ga0501043_0000059 3300049579 Bacteria 101444
688 Ga0501046_0000082 3300049580 Bacteria 101313
689 Ga0501046_0043046 3300049580 Bacteria 3597
690 Ga0501046_0148528 3300049580 Bacteria 1769
691 Ga0501047_0000050 3300049581 Bacteria 155628
692 Ga0501047_0080256 3300049581 Bacteria 3136
693 Ga0501047_0164647 3300049581 Bacteria 2088
694 Ga0501067_0005753 3300049583 Bacteria 6880
695 Ga0501070_0126300 3300049586 Bacteria 2114
696 Ga0501073_0001964 3300049589 Bacteria 15337
697 Ga0501073_0188094 3300049589 Bacteria 1429
698 Ga0501074_0077066 3300049590 Bacteria 2393
699 Ga0501076_0025821 3300049592 Bacteria 4548
700 Ga0501080_0001289 3300049742 Bacteria 20841
701 Ga0501080_0196156 3300049742 Bacteria 1854
702 Ga0501035_0000914 3300049822 Bacteria 31246
703 Ga0501035_0050210 3300049822 Bacteria 3739
704 Ga0501035_0065805 3300049822 Bacteria 3217
705 Ga0501035_0385179 3300049822 Bacteria 1169
706 Ga0501044_0036945 3300049823 Bacteria 5107
707 Ga0501044_0055188 3300049823 Bacteria 4081
708 Ga0501044_0221387 3300049823 Bacteria 1843
709 Ga0501045_0018076 3300049824 Bacteria 5009
710 nmdc:mga03683_6434_c1 3300050489 Bacteria 4021
711 nmdc:mga0k408_28336_c1 3300050493 Bacteria 3184
712 nmdc:mga07m45_65515_c1 3300050496 Bacteria 2063
713 nmdc:mga05p37_141601_c1 3300050507 Bacteria 2946
714 nmdc:mga05p37_182289_c1 3300050507 Bacteria 2554
715 nmdc:mga09592_22364_c1 3300050508 Bacteria 5217
716 nmdc:mga09592_49981_c1 3300050508 Bacteria 3526
717 nmdc:mga0qj67_139310_c1 3300050509 Bacteria 1967
718 nmdc:mga0qj67_284_c1 3300050509 Bacteria 35291
719 nmdc:mga0qj67_44808_c1 3300050509 Bacteria 3489
720 nmdc:mga06r32_10480_c1 3300050510 Bacteria 8360
721 nmdc:mga06r32_247387_c1 3300050510 Bacteria 1771
722 nmdc:mga08y16_35385_c1 3300050511 Bacteria 5244
723 nmdc:mga08y16_44771_c1 3300050511 Bacteria 4638
724 nmdc:mga08y16_68917_c1 3300050511 Bacteria 3688
725 nmdc:mga0n895_390737_c1 3300050512 Bacteria 1407
726 nmdc:mga0rr50_170645_c1 3300050513 Bacteria 1772
727 nmdc:mga0rr50_320093_c1 3300050513 Bacteria 1300
728 nmdc:mga08x19_28887_c1 3300050514 Bacteria 3476
729 nmdc:mga0a205_267047_c1 3300050515 Unclassified 1588
730 Ga0495601_0001306 3300053077 Bacteria 13674
731 Ga0495601_0002584 3300053077 Bacteria 10279
732 Ga0495601_0007558 3300053077 Bacteria 6378
733 Ga0495601_0036236 3300053077 Bacteria 3080
734 Ga0495601_0226626 3300053077 Bacteria 1221
735 Ga0495612_0040315 3300053078 Bacteria 1902
736 Ga0495595_0013179 3300053084 Bacteria 3488
737 Ga0495595_0019839 3300053084 Bacteria 2920
738 Ga0495595_0079617 3300053084 Bacteria 1559
739 Ga0495595_0153213 3300053084 Bacteria 1135
740 Ga0495619_0002390 3300053085 Bacteria 12327
741 Ga0495619_0003029 3300053085 Bacteria 10914
742 Ga0495619_0005560 3300053085 Bacteria 7998
743 Ga0495619_0228389 3300053085 Bacteria 1289
744 Ga0500646_0056427 3300053090 Bacteria 1145
745 Ga0500651_0001827 3300053093 Bacteria 10921
746 Ga0500566_0091099 3300053094 Bacteria 1685
747 Ga0500566_0122853 3300053094 Bacteria 1398
748 Ga0500641_0017419 3300053096 Bacteria 2686
749 Ga0500654_112485 3300053099 Bacteria 1108
750 Ga0500619_038261 3300053154 Bacteria 1503
751 Ga0500596_001075 3300053735 Bacteria 5505
752 3005723831 3005718088 Bacteria 8283608
753 Ga0501070_0038572
754 2214656052
755 ARcpr5oldR_c000133
756 ARSoilYngRDRAFT_c00421
757 ARSoilYngRDRAFT_c00534
758 ARcpr5yngRDRAFT_c000389
759 ARSoilOldRDRAFT_c000253
760 ARCol0yngRDRAFT_1000372
761 JGI24743J22301_10002037
762 JGI24744J21845_10014978
763 JGI24033J26618_1009182
764 JGI25405J52794_10006753
765 Ga0065716_1001666
766 Ga0065712_10086185
767 Ga0065715_10014727
768 Ga0070658_10011009
769 Ga0070658_10027338
770 Ga0070658_10067438
771 Ga0070676_10071704
772 Ga0070683_100001948
773 Ga0070683_100015594
774 Ga0070690_100001816
775 Ga0070670_100016743
776 Ga0070670_100119884
777 Ga0070670_100344232
778 Ga0070677_10001478
779 Ga0068869_100016119
780 Ga0068869_100028324
781 Ga0068869_100060213
782 Ga0070666_10001239
783 Ga0070680_100005698
784 Ga0070680_100021507
785 Ga0070680_100041625
786 Ga0070680_100108804
787 Ga0070682_100053114
788 Ga0068868_100001857
789 Ga0068868_100033519
790 Ga0068868_100329190
791 Ga0070660_100009686
792 Ga0070660_100073750
793 Ga0070660_100165419
794 Ga0070660_100302066
795 Ga0070689_100011580
796 Ga0070689_100070156
797 Ga0070687_100066598
798 Ga0070661_100016532
799 Ga0070661_100018763
800 Ga0070661_100054673
801 Ga0070661_100278747
802 Ga0070661_100427296
803 Ga0070692_10016884
804 Ga0070692_10047328
805 Ga0070692_10072405
806 Ga0070669_100164160
807 Ga0070669_100192862
808 Ga0070671_100003742
809 Ga0070671_100004294
810 Ga0070671_100007436
811 Ga0070671_100022305
812 Ga0070674_100024008
813 Ga0070673_100000654
814 Ga0070673_100459780
815 Ga0070688_100000458
816 Ga0070659_100016416
817 Ga0070659_100016451
818 Ga0070659_100346542
819 Ga0070667_100040838
820 Ga0070667_100344558
821 Ga0070709_10016674
822 Ga0070714_100039602
823 Ga0070714_100041336
824 Ga0070714_100074593
825 Ga0070714_100166258
826 Ga0070713_100000194
827 Ga0070713_100002402
828 Ga0070713_100016148
829 Ga0070713_100037700
830 Ga0070710_10015517
831 Ga0070710_10040068
832 Ga0070710_10218313
833 Ga0070711_100009245
834 Ga0070711_100146929
835 Ga0070705_100026640
836 Ga0070705_100260814
837 Ga0070700_100036838
838 Ga0070700_100228640
839 Ga0070708_100000735
840 Ga0070663_100013799
841 Ga0070663_100360165
842 Ga0070678_100005143
843 Ga0070678_100036123
844 Ga0070662_100020824
845 Ga0070662_100075826
846 Ga0070681_10002512
847 Ga0070681_10083705
848 Ga0070681_10086477
849 Ga0070681_10098405
850 Ga0070681_10343590
851 Ga0068867_100127671
852 Ga0068867_100250692
853 Ga0070685_10004837
854 Ga0070685_10005675
855 Ga0070707_100329240
856 Ga0070698_100031207
857 Ga0070698_100051706
858 Ga0070699_100014378
859 Ga0070699_100336805
860 Ga0070699_100419725
861 Ga0070679_100048304
862 Ga0070679_100284899
863 Ga0070684_100058019
864 Ga0070684_100298296
865 Ga0068853_100006418
866 Ga0068853_100010824
867 Ga0068853_100071331
868 Ga0068853_100150561
869 Ga0070672_100016645
870 Ga0070672_100039163
871 Ga0070686_100003930
872 Ga0070686_100229249
873 Ga0070696_100011674
874 Ga0070693_100013092
875 Ga0070665_100001524
876 Ga0070665_100028191
877 Ga0070704_100005483
878 Ga0070704_100006411
879 Ga0068855_100030044
880 Ga0068855_100037186
881 Ga0068855_100052315
882 Ga0068855_100073821
883 Ga0068855_100331962
884 Ga0070664_100004490
885 Ga0070664_100006787
886 Ga0070664_100025113
887 Ga0070664_100030004
888 Ga0070664_100072184
889 Ga0070664_100091111
890 Ga0070664_100165521
891 Ga0068857_100012109
892 Ga0068857_100047806
893 Ga0068854_100009405
894 Ga0068854_100020836
895 Ga0068854_100026164
896 Ga0068854_100027988
897 Ga0068854_100035484
898 Ga0068854_100197612
899 Ga0068856_100002133
900 Ga0068856_100037394
901 Ga0068856_100068728
902 Ga0070702_100003002
903 Ga0070702_100030410
904 Ga0068859_100004375
905 Ga0068859_100017681
906 Ga0068864_100000455
907 Ga0068864_100062776
908 Ga0068864_100108876
909 Ga0068866_10000548
910 Ga0068866_10008292
911 Ga0068851_10004615
912 Ga0068851_10010729
913 Ga0068870_10003494
914 Ga0068863_100016059
915 Ga0068863_100063450
916 Ga0068863_100156633
917 Ga0068863_100304208
918 Ga0068858_100000850
919 Ga0068858_100003813
920 Ga0068858_100070066
921 Ga0068860_100010860
922 Ga0068860_100012690
923 Ga0068860_100115277
924 Ga0068862_100070182
925 Ga0081455_10000007
926 Ga0081455_10056490
927 Ga0081455_10081380
928 Ga0081455_10149927
929 Ga0081538_10015025
930 Ga0081540_1021178
931 Ga0081540_1024162
932 Ga0081539_10098926
933 Ga0075368_10006180
934 Ga0075363_100037450
935 Ga0070712_100024506
936 Ga0070712_100033721
937 Ga0075362_10085420
938 Ga0075367_10045306
939 Ga0075366_10045687
940 Ga0075366_10053239
941 Ga0097621_100032076
942 Ga0097621_100334952
943 Ga0075370_10013284
944 Ga0068871_100012478
945 Ga0075428_100079075
946 Ga0075430_100000910
947 Ga0075430_100027341
948 Ga0075431_100012574
949 Ga0075431_100028736
950 Ga0075431_100044338
951 Ga0075433_10217813
952 Ga0075434_100231251
953 Ga0075429_100012725
954 Ga0075429_100028057
955 Ga0068865_100091731
956 Ga0075436_100049014
957 Ga0097620_100004375
958 Ga0097620_100017681
959 Ga0105240_10005733
960 Ga0105240_10006827
961 Ga0105240_10035030
962 Ga0105240_10179164
963 Ga0111539_10023230
964 Ga0111539_10037922
965 Ga0111539_10066813
966 Ga0105245_10005200
967 Ga0105245_10005498
968 Ga0105245_10010025
969 Ga0105245_10021206
970 Ga0105245_10408539
971 Ga0105247_10042311
972 Ga0105243_10020365
973 Ga0105243_10067824
974 Ga0105241_10000519
975 Ga0105241_10004014
976 Ga0105242_10015050
977 Ga0105248_10009820
978 Ga0105248_10017087
979 Ga0105248_10581879
980 Ga0105248_10593384
981 Ga0105237_10009010
982 Ga0105237_10022258
983 Ga0105237_10236357
984 Ga0105237_10305638
985 Ga0105238_10050500
986 Ga0105238_10432259
987 Ga0105249_10138387
988 Ga0105249_10383029
989 Ga0105239_10172265
990 Ga0105239_10173718
991 Ga0105239_10184567
992 Ga0105239_10270445
993 Ga0105239_10317920
994 Ga0105246_10346063
995 Ga0157373_10001957
996 Ga0157373_10082432
997 Ga0157373_10147993
998 Ga0157371_10025165
999 Ga0157371_10027089
1000 Ga0157371_10027345
1001 Ga0157371_10040021
1002 Ga0157370_10002179
1003 Ga0157370_10004050
1004 Ga0157370_10005883
1005 Ga0157370_10013193
1006 Ga0157370_10064779
1007 Ga0157370_10239549
1008 Ga0157369_10009390
1009 Ga0157369_10028665
1010 Ga0157369_10143278
1011 Ga0157369_10159500
1012 Ga0157374_10035810
1013 Ga0157374_10275578
1014 Ga0157378_10007210
1015 Ga0157378_10109592
1016 Ga0157378_10160721
1017 Ga0163162_10006833
1018 Ga0163162_10066697
1019 Ga0163162_10081396
1020 Ga0163162_10115260
1021 Ga0163162_10208950
1022 Ga0163162_10233548
1023 Ga0163162_10277903
1024 Ga0163162_10418840
1025 Ga0157372_10010915
1026 Ga0157372_10083144
1027 Ga0157372_10087269
1028 Ga0157372_10103665
1029 Ga0157372_10164659
1030 Ga0157372_10185143
1031 Ga0157375_10069414
1032 Ga0157375_10110232
1033 Ga0157375_10471157
1034 Ga0163163_10000310
1035 Ga0163163_10006815
1036 Ga0157380_10000875
1037 Ga0157380_10004597
1038 Ga0157380_10006262
1039 Ga0182008_10046675
1040 Ga0157377_10006653
1041 Ga0157379_10000626
1042 Ga0157379_10022425
1043 Ga0157379_10023713
1044 Ga0157379_10026902
1045 Ga0157379_10260919
1046 Ga0157376_10003923
1047 Ga0157376_10041627
1048 Ga0157376_10078403
1049 Ga0163161_10010171
1050 Ga0163161_10017525
1051 Ga0163161_10179567
1052 Ga0209233_1002928
1053 Ga0207426_1020952
1054 Ga0207697_10003301
1055 Ga0207656_10019955
1056 Ga0207656_10047164
1057 Ga0207682_10000588
1058 Ga0207692_10017497
1059 Ga0207642_10001634
1060 Ga0207710_10020515
1061 Ga0207710_10090371
1062 Ga0207688_10004018
1063 Ga0207680_10012587
1064 Ga0207680_10098843
1065 Ga0207699_10077201
1066 Ga0207645_10024499
1067 Ga0207643_10000258
1068 Ga0207705_10055737
1069 Ga0207705_10075035
1070 Ga0207705_10134323
1071 Ga0207705_10209611
1072 Ga0207654_10028322
1073 Ga0207654_10044840
1074 Ga0207654_10049488
1075 Ga0207707_10014843
1076 Ga0207707_10017578
1077 Ga0207707_10018391
1078 Ga0207707_10091143
1079 Ga0207707_10105547
1080 Ga0207695_10025902
1081 Ga0207695_10144100
1082 Ga0207695_10204101
1083 Ga0207671_10056032
1084 Ga0207671_10109864
1085 Ga0207671_10138264
1086 Ga0207693_10046098
1087 Ga0207693_10139919
1088 Ga0207663_10009858
1089 Ga0207663_10035380
1090 Ga0207663_10041042
1091 Ga0207660_10039319
1092 Ga0207660_10091306
1093 Ga0207660_10110224
1094 Ga0207662_10010644
1095 Ga0207662_10026411
1096 Ga0207662_10133213
1097 Ga0207657_10000674
1098 Ga0207657_10012551
1099 Ga0207657_10039540
1100 Ga0207657_10059035
1101 Ga0207657_10117101
1102 Ga0207657_10133205
1103 Ga0207649_10027890
1104 Ga0207649_10060228
1105 Ga0207649_10222879
1106 Ga0207652_10061032
1107 Ga0207652_10074689
1108 Ga0207652_10125491
1109 Ga0207652_10368681
1110 Ga0207681_10102062
1111 Ga0207681_10149870
1112 Ga0207681_10163660
1113 Ga0207694_10005465
1114 Ga0207650_10001906
1115 Ga0207650_10018316
1116 Ga0207650_10116171
1117 Ga0207650_10209923
1118 Ga0207650_10224823
1119 Ga0207650_10344574
1120 Ga0207659_10017144
1121 Ga0207687_10001774
1122 Ga0207687_10003797
1123 Ga0207700_10000176
1124 Ga0207700_10009729
1125 Ga0207700_10010411
1126 Ga0207700_10105233
1127 Ga0207664_10002044
1128 Ga0207664_10044596
1129 Ga0207664_10059693
1130 Ga0207664_10092413
1131 Ga0207664_10295957
1132 Ga0207644_10009735
1133 Ga0207644_10015741
1134 Ga0207644_10019557
1135 Ga0207644_10032890
1136 Ga0207644_10086427
1137 Ga0207690_10027505
1138 Ga0207690_10038410
1139 Ga0207690_10046218
1140 Ga0207690_10164424
1141 Ga0207706_10003913
1142 Ga0207706_10010710
1143 Ga0207706_10275229
1144 Ga0207686_10003277
1145 Ga0207709_10087859
1146 Ga0207709_10092551
1147 Ga0207670_10015951
1148 Ga0207670_10030753
1149 Ga0207670_10085378
1150 Ga0207670_10109462
1151 Ga0207669_10030823
1152 Ga0207669_10116459
1153 Ga0207704_10057394
1154 Ga0207665_10011245
1155 Ga0207691_10016130
1156 Ga0207691_10017370
1157 Ga0207691_10065687
1158 Ga0207691_10082527
1159 Ga0207691_10210579
1160 Ga0207711_10000115
1161 Ga0207711_10009087
1162 Ga0207711_10010068
1163 Ga0207711_10053291
1164 Ga0207711_10267257
1165 Ga0207711_10331097
1166 Ga0207689_10013941
1167 Ga0207689_10054364
1168 Ga0207689_10160243
1169 Ga0207689_10176242
1170 Ga0207661_10030374
1171 Ga0207661_10091958
1172 Ga0207661_10186106
1173 Ga0207679_10010973
1174 Ga0207679_10048797
1175 Ga0207679_10116052
1176 Ga0207679_10250188
1177 Ga0207667_10018946
1178 Ga0207667_10028564
1179 Ga0207667_10171353
1180 Ga0207667_10200565
1181 Ga0207651_10000427
1182 Ga0207651_10074293
1183 Ga0207712_10095091
1184 Ga0207640_10012775
1185 Ga0207640_10065767
1186 Ga0207640_10073647
1187 Ga0207658_10025880
1188 Ga0207658_10059715
1189 Ga0207658_10142325
1190 Ga0207677_10000210
1191 Ga0207677_10157760
1192 Ga0207703_10000438
1193 Ga0207703_10060873
1194 Ga0207703_10268754
1195 Ga0207703_10599957
1196 Ga0207639_10010716
1197 Ga0207639_10036840
1198 Ga0207639_10042120
1199 Ga0207639_10188178
1200 Ga0207678_10026320
1201 Ga0207678_10037008
1202 Ga0207678_10048292
1203 Ga0207708_10008723
1204 Ga0207708_10285831
1205 Ga0207702_10027542
1206 Ga0207702_10032746
1207 Ga0207702_10169639
1208 Ga0207702_10180445
1209 Ga0207641_10001573
1210 Ga0207641_10038199
1211 Ga0207641_10159089
1212 Ga0207648_10014918
1213 Ga0207648_10098637
1214 Ga0207676_10000415
1215 Ga0207676_10015218
1216 Ga0207676_10097406
1217 Ga0207676_10119021
1218 Ga0207676_10549380
1219 Ga0207674_10000993
1220 Ga0207674_10009327
1221 Ga0207674_10026860
1222 Ga0207675_100016078
1223 Ga0207675_100074177
1224 Ga0207683_10003290
1225 Ga0207683_10044064
1226 Ga0207698_10003090
1227 Ga0207698_10016041
1228 Ga0207698_10103545
1229 Ga0207698_10290505
1230 Ga0210002_1001558
1231 Ga0209966_1001497
1232 Ga0209974_10008047
1233 Ga0207428_10005855
1234 Ga0268266_10015381
1235 Ga0268266_10017880
1236 Ga0268265_10075566
1237 Ga0268264_10000030
1238 Ga0268264_10001696
1239 Ga0268264_10062269
1240 Ga0268264_10081287
1241 Ga0268264_10081625
1242 Ga0268264_10194180
1243 Ga0268264_10478007
1244 Ga0307511_10070276
1245 Ga0265313_10014353
1246 Ga0307508_10198773
1247 Ga0265314_10001782
1248 Ga0265314_10010256
1249 Ga0307516_10003295
1250 Ga0307410_10155937
1251 Ga0307411_10026412
1252 Ga0307507_10008299
1253 Ga0373930_0000714
1254 Ga0373948_0000278
1255 Ga0373950_0000561
1256 Ga0373959_0012966
1257 Ga0373938_0001504
1258 Ga0373929_0000641
1259 Ga0373934_0015744
1260 Ga0373940_0000329
1261 Ga0373944_0014895
1262 Ga0373951_0001637
1263 Ga0373952_0001086
1264 Ga0373932_0000993
1265 Ga0373939_0001707
1266 Ga0373941_0001588
1267 Ga0373945_0054018
1268 Ga0373953_0026422
1269 Ga0373960_0000819
1270 Ga0373943_0005526
1271 Ga0373943_0008825
1272 Ga0373946_0044108
1273 Ga0373955_0009714
1274 Ga0373942_0001117
1275 Ga0373961_0002029
1276 Ga0373962_0002693
1277 Ga0373924_0009579
1278 Ga0373931_0013680
1279 Ga0373935_0051730
1280 Ga0373935_0055756
1281 Ga0373935_0057103
1282 Ga0373935_0090829
1283 Ga0373927_0010954
1284 Ga0373927_0019914
1285 Ga0373927_0051034
1286 Ga0373927_0061643
1287 Ga0373933_0067987
1288 Ga0373947_0038644
1289 Ga0373947_0116331
1290 Ga0373937_0007452
1291 Ga0373937_0016948
1292 Ga0373937_0028264
1293 Ga0373937_0046326
1294 Ga0373937_0049410
1295 Ga0373937_0070123
1296 Ga0373937_0641726
1297 Ga0373937_0648310
1298 Ga0316584_0166261
1299 Ga0373925_0031704
1300 Ga0373925_0059617
1301 Ga0373925_0066119
1302 Ga0373925_0067264
1303 Ga0373925_0068648
1304 Ga0373925_0309954
1305 Ga0395899_0085650
1306 Ga0395899_0229001
1307 Ga0395900_0000660
1308 Ga0395900_0270296
1309 Ga0395898_0010332
1310 Ga0395898_0242837
1311 Ga0395905_0103703
1312 Ga0395901_0015213
1313 Ga0436365_1000353
1314 Ga0439465_0045663
1315 Ga0439441_003098
1316 Ga0439463_003728
1317 Ga0439435_0001664
1318 Ga0439444_0001632
1319 Ga0439464_0031626
1320 Ga0439460_0003319
1321 Ga0466963_0015157
1322 Ga0466967_0183107
1323 Ga0495592_0024943
1324 Ga0495592_0165926
1325 Ga0495603_0005621
1326 Ga0495629_0003184
1327 Ga0495629_0004812
1328 Ga0495629_0055963
1329 Ga0495629_0154221
1330 Ga0495638_0002275
1331 Ga0495641_0011903
1332 Ga0495651_0001523
1333 Ga0495653_0230996
1334 Ga0495582_0189948
1335 Ga0495639_0032423
1336 Ga0495662_0001316
1337 Ga0495662_0006313
1338 Ga0495664_0003809
1339 Ga0495585_0007779
1340 Ga0495594_0096270
1341 Ga0495607_0012402
1342 Ga0495608_0052453
1343 Ga0495618_0007916
1344 Ga0495618_0010659
1345 Ga0495630_0017381
1346 Ga0495630_0146169
1347 Ga0495644_0006663
1348 Ga0495665_0012717
1349 Ga0495640_0012123
1350 Ga0495640_0045064
1351 Ga0495645_0002851
1352 Ga0495645_0039755
1353 Ga0495645_0040378
1354 Ga0495622_0020718
1355 Ga0495633_0012359
1356 Ga0495667_0002874
1357 Ga0495667_0046983
1358 Ga0495656_0000732
1359 Ga0495668_0064940
1360 Ga0495635_0002953
1361 Ga0495635_0101298
1362 Ga0495659_0014866
1363 Ga0495599_0064905
1364 Ga0495599_0202907
1365 Ga0495646_0089002
1366 Ga0495647_0028626
1367 Ga0495647_0098550
1368 Ga0495658_0004733
1369 Ga0495658_0062082
1370 Ga0495613_0042056
1371 Ga0495613_0047441
1372 Ga0495613_0071069
1373 Ga0495624_0004999
1374 Ga0495624_0022742
1375 Ga0495670_0000601
1376 Ga0495581_0020159
1377 Ga0495581_0040522
1378 Ga0495581_0155096
1379 Ga0495581_0173378
1380 Ga0495636_0004078
1381 Ga0495674_0019965
1382 Ga0495674_0039364
1383 Ga0495680_0009001
1384 Ga0495680_0020923
1385 Ga0495684_0002180
1386 Ga0495593_0005740
1387 Ga0496100_0040161
1388 Ga0496101_0043445
1389 Ga0496102_0074021
1390 Ga0496102_0299894
1391 Ga0496103_0083672
1392 Ga0496104_0014685
1393 Ga0496104_0023522
1394 Ga0496104_0178085
1395 Ga0496104_0223955
1396 Ga0496105_0019861
1397 Ga0496105_0037439
1398 Ga0496106_0002744
1399 Ga0496106_0022003
1400 Ga0496107_0260230
1401 Ga0496108_0006795
1402 Ga0496108_0009176
1403 Ga0496108_0010758
1404 Ga0496108_0080093
1405 Ga0496109_0001752
1406 Ga0496109_0021700
1407 Ga0496109_0047277
1408 Ga0496109_0073566
1409 Ga0496109_0334824
1410 Ga0496110_0004014
1411 Ga0496110_0017212
1412 Ga0496110_0030129
1413 Ga0496110_0093003
1414 Ga0496111_0013415
1415 Ga0496111_0013428
1416 Ga0496111_0083054
1417 Ga0496112_0000505
1418 Ga0496112_0005421
1419 Ga0496112_0008414
1420 Ga0496112_0116279
1421 Ga0496112_0147484
1422 Ga0496112_0444725
1423 Ga0496113_0008678
1424 Ga0496114_0017046
1425 Ga0496115_0243528
1426 Ga0496117_0023017
1427 Ga0496118_0003784
1428 Ga0496121_0000089
1429 Ga0496124_0002829
1430 Ga0496124_0034906
1431 Ga0496125_0018347
1432 Ga0496126_0004866
1433 Ga0501031_0135997
1434 Ga0501032_0084819
1435 Ga0501033_0039139
1436 Ga0501034_0067440
1437 Ga0501037_0150433
1438 Ga0501038_0141619
1439 Ga0501043_0000059
1440 Ga0501046_0000082
1441 Ga0501046_0043046
1442 Ga0501046_0148528
1443 Ga0501047_0000050
1444 Ga0501047_0080256
1445 Ga0501047_0164647
1446 Ga0501067_0005753
1447 Ga0501070_0126300
1448 Ga0501073_0001964
1449 Ga0501073_0188094
1450 Ga0501074_0077066
1451 Ga0501076_0025821
1452 Ga0501080_0001289
1453 Ga0501080_0196156
1454 Ga0501035_0000914
1455 Ga0501035_0050210
1456 Ga0501035_0065805
1457 Ga0501035_0385179
1458 Ga0501044_0036945
1459 Ga0501044_0055188
1460 Ga0501044_0221387
1461 Ga0501045_0018076
1462 nmdc:mga03683_6434_c1
1463 nmdc:mga0k408_28336_c1
1464 nmdc:mga07m45_65515_c1
1465 nmdc:mga05p37_141601_c1
1466 nmdc:mga05p37_182289_c1
1467 nmdc:mga09592_22364_c1
1468 nmdc:mga09592_49981_c1
1469 nmdc:mga0qj67_139310_c1
1470 nmdc:mga0qj67_284_c1
1471 nmdc:mga0qj67_44808_c1
1472 nmdc:mga06r32_10480_c1
1473 nmdc:mga06r32_247387_c1
1474 nmdc:mga08y16_35385_c1
1475 nmdc:mga08y16_44771_c1
1476 nmdc:mga08y16_68917_c1
1477 nmdc:mga0n895_390737_c1
1478 nmdc:mga0rr50_170645_c1
1479 nmdc:mga0rr50_320093_c1
1480 nmdc:mga08x19_28887_c1
1481 nmdc:mga0a205_267047_c1
1482 Ga0495601_0001306
1483 Ga0495601_0002584
1484 Ga0495601_0007558
1485 Ga0495601_0036236
1486 Ga0495601_0226626
1487 Ga0495612_0040315
1488 Ga0495595_0013179
1489 Ga0495595_0019839
1490 Ga0495595_0079617
1491 Ga0495595_0153213
1492 Ga0495619_0002390
1493 Ga0495619_0003029
1494 Ga0495619_0005560
1495 Ga0495619_0228389
1496 Ga0500646_0056427
1497 Ga0500651_0001827
1498 Ga0500566_0091099
1499 Ga0500566_0122853
1500 Ga0500641_0017419
1501 Ga0500654_112485
1502 Ga0500619_038261
1503 Ga0500596_001075
1504 3005723831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

83

363

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ltc-assembly2.cif.gz_A crystal structure of doubly spin labelled vcsiap r125 0.8991 31 326
4p47-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket 0.8975 30 326
2cex-assembly1.cif.gz_A structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en 0.8952 31 328
4pfr-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered 0.8923 31 328
2cex-assembly3.cif.gz_C structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en 0.892 31 328
ID Description Score Start End Superfamily
4magA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9035 31 326 3.40.190.170
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8976 30 326 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.889 31 328 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8834 31 328 3.40.190.170
4magA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8702 31 326 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A356E0V8-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9117 21 327 GO:0055085
AF-A0A6N9T6D3-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.897 30 324 GO:0055085
AF-A0A3B8HFH5-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.8906 44 305 GO:0055085
AF-A0A1V5Z7M9-F1-model_v4 Sialic acid-binding periplasmic protein SiaP 0.878 82 328 GO:0055085
AF-A0A3B8HFH5-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.869 44 305 GO:0055085

Map