F479120

General Info

Members Datasets Scaffolds Average Seq Length
751 356 1502 176

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10062742|Ga0316578_100627421
Length 196
Sequence MYGAVPASRPPAAPPYRRGMTEGTFLRLLNEQIGHEFHASQQYIAIAVYFDREALPQLAAHFYAQSVEERNHAMMLVQYLLDADARIEIPGTGEVVTSFDAYSEPVALALAQERQVTEQIKALVRAAREEGDLLGEQFLQWFLKEQVEEVATVSTLLRVMEHAGDTILQVEEYLSRQPGGAGGPDPTAPSAAGGAL

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
206 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
207 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
346 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
347 2643221572 Leifsonia sp. Root60 Isolate Unclassified
348 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
349 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
350 2643221711 Terrabacter sp. Root85 Isolate Unclassified
351 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
352 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
353 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
354 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
355 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
356 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0.67
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0
Rhizoplane 11.85
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 4.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10062742 3300031728 Bacteria 2191
2 Ga0006562J51391_1054243 3300003578 Bacteria 1660
3 Ga0006562J51391_1054246 3300003578 Bacteria 740
4 Ga0055540_1000038 3300003792 Bacteria 161988
5 Ga0065714_10065949 3300005288 Bacteria 7995
6 Ga0065714_10234720 3300005288 Bacteria 799
7 Ga0065704_10007708 3300005289 Bacteria 3447
8 Ga0065712_10130057 3300005290 Bacteria 1561
9 Ga0070658_11599062 3300005327 Bacteria 565
10 Ga0070676_10109091 3300005328 Bacteria 1721
11 Ga0070676_10256096 3300005328 Bacteria 1170
12 Ga0070683_100033279 3300005329 Bacteria 4700
13 Ga0070683_100062006 3300005329 Bacteria 3476
14 Ga0070683_100265550 3300005329 Bacteria 1633
15 Ga0070683_100381292 3300005329 Bacteria 1343
16 Ga0068869_100647728 3300005334 Bacteria 896
17 Ga0070666_10125833 3300005335 Bacteria 1779
18 Ga0070680_100002207 3300005336 Bacteria 14358
19 Ga0070682_100056553 3300005337 Bacteria 2468
20 Ga0070682_100384583 3300005337 Bacteria 1057
21 Ga0068868_100003823 3300005338 Bacteria 10512
22 Ga0068868_100342482 3300005338 Bacteria 1279
23 Ga0070660_100017052 3300005339 Bacteria 5288
24 Ga0070660_100391653 3300005339 Bacteria 1148
25 Ga0070660_101102758 3300005339 Bacteria 672
26 Ga0070689_100386850 3300005340 Bacteria 1180
27 Ga0070691_10008781 3300005341 Bacteria 4627
28 Ga0070661_100334778 3300005344 Bacteria 1185
29 Ga0070661_100654719 3300005344 Bacteria 853
30 Ga0070661_100662963 3300005344 Bacteria 848
31 Ga0070692_10251702 3300005345 Bacteria 1058
32 Ga0070669_100726443 3300005353 Unclassified 840
33 Ga0070675_100058936 3300005354 Bacteria 3167
34 Ga0070675_101388296 3300005354 Unclassified 648
35 Ga0070671_100114816 3300005355 Unclassified 2263
36 Ga0070674_100030552 3300005356 Bacteria 3562
37 Ga0070674_100533732 3300005356 Bacteria 982
38 Ga0070674_100541958 3300005356 Bacteria 975
39 Ga0070673_100044855 3300005364 Unclassified 3425
40 Ga0070688_100053182 3300005365 Bacteria 2532
41 Ga0070659_100047566 3300005366 Bacteria 3365
42 Ga0070659_100165797 3300005366 Bacteria 1808
43 Ga0070667_100000883 3300005367 Bacteria 27691
44 Ga0070667_101105116 3300005367 Bacteria 741
45 Ga0070709_10617895 3300005434 Unclassified 836
46 Ga0070709_10678365 3300005434 Bacteria 800
47 Ga0070714_100131092 3300005435 Bacteria 2240
48 Ga0070714_100133945 3300005435 Bacteria 2217
49 Ga0070714_100274598 3300005435 Bacteria 1564
50 Ga0070714_100364198 3300005435 Bacteria 1360
51 Ga0070713_100060640 3300005436 Bacteria 3163
52 Ga0070713_100146818 3300005436 Bacteria 2094
53 Ga0070713_100341876 3300005436 Bacteria 1387
54 Ga0070713_100611911 3300005436 Bacteria 1035
55 Ga0070713_101163817 3300005436 Bacteria 746
56 Ga0070710_10007389 3300005437 Bacteria 5319
57 Ga0070710_10832246 3300005437 Bacteria 661
58 Ga0070701_10237287 3300005438 Bacteria 1095
59 Ga0070701_10448048 3300005438 Bacteria 828
60 Ga0070711_100006496 3300005439 Bacteria 7051
61 Ga0070711_100107424 3300005439 Bacteria 2042
62 Ga0070711_100450918 3300005439 Bacteria 1053
63 Ga0070711_101183448 3300005439 Bacteria 661
64 Ga0070705_100075815 3300005440 Bacteria 2049
65 Ga0070700_100015971 3300005441 Bacteria 4268
66 Ga0070700_100206315 3300005441 Bacteria 1384
67 Ga0070708_100817478 3300005445 Bacteria 876
68 Ga0070663_100166980 3300005455 Bacteria 1698
69 Ga0070678_100057594 3300005456 Bacteria 2848
70 Ga0070678_100340357 3300005456 Bacteria 1287
71 Ga0070678_100357919 3300005456 Bacteria 1257
72 Ga0070681_10006968 3300005458 Bacteria 10999
73 Ga0070681_10502451 3300005458 Bacteria 1126
74 Ga0070685_10370658 3300005466 Bacteria 984
75 Ga0070685_10493610 3300005466 Bacteria 865
76 Ga0070706_100267419 3300005467 Bacteria 1596
77 Ga0070707_100104458 3300005468 Bacteria 2746
78 Ga0070707_101900625 3300005468 Bacteria 563
79 Ga0070698_100002676 3300005471 Bacteria 19643
80 Ga0070698_100780913 3300005471 Bacteria 899
81 Ga0070699_100046993 3300005518 Bacteria 3734
82 Ga0070679_100007549 3300005530 Bacteria 10170
83 Ga0070679_100199310 3300005530 Bacteria 1968
84 Ga0070684_100003771 3300005535 Bacteria 11441
85 Ga0070684_100010570 3300005535 Bacteria 7317
86 Ga0070684_100152849 3300005535 Bacteria 2092
87 Ga0070684_100291957 3300005535 Bacteria 1495
88 Ga0068853_100005415 3300005539 Bacteria 10002
89 Ga0070672_100781928 3300005543 Unclassified 839
90 Ga0070695_101046416 3300005545 Bacteria 666
91 Ga0070665_100685343 3300005548 Bacteria 1038
92 Ga0070665_100896553 3300005548 Bacteria 899
93 Ga0070665_101387822 3300005548 Unclassified 712
94 Ga0070704_100203784 3300005549 Bacteria 1599
95 Ga0070704_101096837 3300005549 Bacteria 723
96 Ga0068855_100435415 3300005563 Bacteria 1433
97 Ga0070664_100004514 3300005564 Bacteria 11165
98 Ga0070664_100160556 3300005564 Bacteria 1988
99 Ga0070664_100283633 3300005564 Bacteria 1494
100 Ga0068857_100002367 3300005577 Bacteria 15368
101 Ga0068857_100292232 3300005577 Bacteria 1501
102 Ga0068857_100505297 3300005577 Bacteria 1135
103 Ga0068857_101334084 3300005577 Bacteria 697
104 Ga0068854_100142996 3300005578 Bacteria 1838
105 Ga0068856_100026064 3300005614 Bacteria 5701
106 Ga0068856_100027660 3300005614 Bacteria 5532
107 Ga0068856_100149181 3300005614 Bacteria 2346
108 Ga0068856_100191186 3300005614 Bacteria 2061
109 Ga0068856_101316317 3300005614 Bacteria 738
110 Ga0070702_100045035 3300005615 Bacteria 2494
111 Ga0070702_100136076 3300005615 Bacteria 1559
112 Ga0068852_100003496 3300005616 Bacteria 10984
113 Ga0068852_100743500 3300005616 Bacteria 993
114 Ga0068859_100212846 3300005617 Bacteria 2019
115 Ga0068864_101522730 3300005618 Bacteria 672
116 Ga0068866_10049728 3300005718 Bacteria 2126
117 Ga0068861_100345193 3300005719 Bacteria 1304
118 Ga0068861_101185277 3300005719 Bacteria 738
119 Ga0068870_10087597 3300005840 Bacteria 1734
120 Ga0068870_10163395 3300005840 Bacteria 1323
121 Ga0068863_100840058 3300005841 Bacteria 917
122 Ga0068858_100490608 3300005842 Bacteria 1186
123 Ga0068860_101509749 3300005843 Bacteria 694
124 Ga0068862_100186950 3300005844 Bacteria 1862
125 Ga0081455_10086432 3300005937 Bacteria 2554
126 Ga0081455_10088231 3300005937 Bacteria 2521
127 Ga0081455_10161312 3300005937 Bacteria 1718
128 Ga0081538_10009498 3300005981 Bacteria 8108
129 Ga0081538_10071445 3300005981 Bacteria 1909
130 Ga0081539_10162709 3300005985 Bacteria 1062
131 Ga0070717_10014628 3300006028 Bacteria 6041
132 Ga0070717_10047508 3300006028 Bacteria 3517
133 Ga0070717_10051330 3300006028 Bacteria 3394
134 Ga0070717_10065295 3300006028 Bacteria 3025
135 Ga0070717_10139701 3300006028 Bacteria 2089
136 Ga0070717_11029303 3300006028 Unclassified 750
137 Ga0070717_11323312 3300006028 Bacteria 655
138 Ga0075365_10147340 3300006038 Bacteria 1636
139 Ga0075365_10407820 3300006038 Bacteria 959
140 Ga0075368_10246235 3300006042 Bacteria 763
141 Ga0075364_10274572 3300006051 Bacteria 1146
142 Ga0075432_10098563 3300006058 Bacteria 1078
143 Ga0075432_10243862 3300006058 Bacteria 727
144 Ga0070715_10205578 3300006163 Unclassified 1003
145 Ga0070716_100091454 3300006173 Bacteria 1842
146 Ga0070712_100105038 3300006175 Bacteria 2097
147 Ga0070712_100116652 3300006175 Bacteria 2003
148 Ga0075362_10032974 3300006177 Bacteria 2251
149 Ga0097621_100183932 3300006237 Bacteria 1807
150 Ga0075428_100031162 3300006844 Bacteria 5897
151 Ga0075428_100057799 3300006844 Bacteria 4246
152 Ga0075428_100217886 3300006844 Bacteria 2061
153 Ga0075428_100786772 3300006844 Bacteria 1011
154 Ga0075430_100016244 3300006846 Bacteria 6339
155 Ga0075430_100018217 3300006846 Bacteria 5976
156 Ga0075431_100010542 3300006847 Bacteria 9291
157 Ga0075431_100322892 3300006847 Bacteria 1556
158 Ga0075431_100759177 3300006847 Bacteria 945
159 Ga0075431_101144498 3300006847 Bacteria 742
160 Ga0075433_10004829 3300006852 Bacteria 10532
161 Ga0075434_100007632 3300006871 Bacteria 10010
162 Ga0075434_100021751 3300006871 Bacteria 6238
163 Ga0075434_100385796 3300006871 Bacteria 1422
164 Ga0075429_100018897 3300006880 Bacteria 5970
165 Ga0075429_100283630 3300006880 Bacteria 1450
166 Ga0068865_100199110 3300006881 Bacteria 1554
167 Ga0068865_100399829 3300006881 Bacteria 1125
168 Ga0075436_100027372 3300006914 Bacteria 3924
169 Ga0075436_100086490 3300006914 Unclassified 2177
170 Ga0075436_100108710 3300006914 Bacteria 1934
171 Ga0075436_100127301 3300006914 Unclassified 1785
172 Ga0097620_100212841 3300006931 Bacteria 2019
173 Ga0075435_100193418 3300007076 Bacteria 1722
174 Ga0075435_100309782 3300007076 Bacteria 1351
175 Ga0105240_10015177 3300009093 Bacteria 10485
176 Ga0105240_11636768 3300009093 Unclassified 673
177 Ga0111539_10000579 3300009094 Bacteria 47092
178 Ga0111539_10297779 3300009094 Bacteria 1877
179 Ga0111539_10879192 3300009094 Bacteria 1042
180 Ga0105245_10010437 3300009098 Bacteria 8087
181 Ga0105245_10044550 3300009098 Bacteria 3960
182 Ga0105245_10068096 3300009098 Bacteria 3225
183 Ga0105245_10264072 3300009098 Bacteria 1676
184 Ga0105245_11449271 3300009098 Bacteria 737
185 Ga0105247_10248743 3300009101 Bacteria 1214
186 Ga0105247_10434336 3300009101 Bacteria 943
187 Ga0105247_10805117 3300009101 Bacteria 717
188 Ga0114129_10029595 3300009147 Bacteria 7755
189 Ga0114129_10133874 3300009147 Bacteria 3403
190 Ga0114129_10387452 3300009147 Bacteria 1844
191 Ga0114129_10455948 3300009147 Bacteria 1676
192 Ga0114129_10561943 3300009147 Bacteria 1482
193 Ga0105243_10040988 3300009148 Bacteria 3620
194 Ga0105243_10733966 3300009148 Bacteria 966
195 Ga0105242_10195029 3300009176 Bacteria 1795
196 Ga0105242_10344022 3300009176 Bacteria 1375
197 Ga0105248_10959609 3300009177 Bacteria 966
198 Ga0105237_10005032 3300009545 Bacteria 15049
199 Ga0105237_10018125 3300009545 Bacteria 7290
200 Ga0105237_10188049 3300009545 Bacteria 2065
201 Ga0105237_10570681 3300009545 Bacteria 1138
202 Ga0105238_10091818 3300009551 Bacteria 3023
203 Ga0105249_10126322 3300009553 Bacteria 2436
204 Ga0105239_10050146 3300010375 Bacteria 4579
205 Ga0105239_10051659 3300010375 Bacteria 4506
206 Ga0105239_10092372 3300010375 Bacteria 3341
207 Ga0105239_10206195 3300010375 Bacteria 2203
208 Ga0105239_10462035 3300010375 Bacteria 1441
209 Ga0105239_10501852 3300010375 Bacteria 1379
210 Ga0105246_10026821 3300011119 Bacteria 3770
211 Ga0105246_11004641 3300011119 Bacteria 755
212 Ga0105246_11228002 3300011119 Bacteria 691
213 Ga0105246_11373364 3300011119 Bacteria 658
214 Ga0157370_10003299 3300013104 Bacteria 19024
215 Ga0157370_10403331 3300013104 Bacteria 1258
216 Ga0157369_10511837 3300013105 Bacteria 1242
217 Ga0157374_10059513 3300013296 Bacteria 3572
218 Ga0157374_10107192 3300013296 Unclassified 2685
219 Ga0157374_10224869 3300013296 Bacteria 1843
220 Ga0157374_10226036 3300013296 Bacteria 1838
221 Ga0157374_10405275 3300013296 Bacteria 1361
222 Ga0157374_10534566 3300013296 Bacteria 1179
223 Ga0157378_10246139 3300013297 Bacteria 1710
224 Ga0157378_11000781 3300013297 Bacteria 870
225 Ga0163162_10695565 3300013306 Bacteria 1139
226 Ga0163162_10896747 3300013306 Bacteria 1000
227 Ga0163162_10905766 3300013306 Bacteria 995
228 Ga0157372_10023566 3300013307 Bacteria 6675
229 Ga0157372_10023707 3300013307 Bacteria 6656
230 Ga0157372_10544334 3300013307 Bacteria 1353
231 Ga0157372_10576489 3300013307 Bacteria 1311
232 Ga0157372_11463414 3300013307 Bacteria 787
233 Ga0157375_10135064 3300013308 Bacteria 2589
234 Ga0157375_10369649 3300013308 Bacteria 1600
235 Ga0157375_11364322 3300013308 Bacteria 834
236 Ga0163163_10310972 3300014325 Bacteria 1628
237 Ga0163163_10548220 3300014325 Bacteria 1219
238 Ga0163163_11538417 3300014325 Bacteria 726
239 Ga0157380_10656510 3300014326 Bacteria 1047
240 Ga0157380_10703482 3300014326 Bacteria 1016
241 Ga0182008_10144438 3300014497 Bacteria 1192
242 Ga0157377_10113583 3300014745 Bacteria 1631
243 Ga0157377_10156337 3300014745 Bacteria 1414
244 Ga0157376_10312288 3300014969 Bacteria 1492
245 Ga0157376_10424341 3300014969 Bacteria 1291
246 Ga0157376_10457382 3300014969 Bacteria 1246
247 Ga0157376_11187525 3300014969 Bacteria 791
248 Ga0182007_10233051 3300015262 Bacteria 654
249 Ga0163161_10597071 3300017792 Unclassified 910
250 Ga0163161_11385325 3300017792 Bacteria 614
251 Ga0206354_11138832 3300020081 Bacteria 1556
252 Ga0206353_11108710 3300020082 Bacteria 4256
253 Ga0213876_10228740 3300021384 Bacteria 988
254 Ga0213876_10281937 3300021384 Bacteria 883
255 Ga0213875_10493710 3300021388 Bacteria 588
256 Ga0224712_10342064 3300022467 Bacteria 706
257 Ga0209051_1000014 3300025303 Bacteria 552732
258 Ga0207692_10002457 3300025898 Bacteria 7113
259 Ga0207642_10111283 3300025899 Bacteria 1395
260 Ga0207688_10002443 3300025901 Bacteria 10010
261 Ga0207680_10199019 3300025903 Bacteria 1364
262 Ga0207647_10206341 3300025904 Bacteria 1136
263 Ga0207685_10062440 3300025905 Bacteria 1480
264 Ga0207699_10007314 3300025906 Bacteria 5394
265 Ga0207645_10155323 3300025907 Bacteria 1495
266 Ga0207645_10304713 3300025907 Bacteria 1061
267 Ga0207643_10020603 3300025908 Bacteria 3620
268 Ga0207707_10002713 3300025912 Bacteria 15814
269 Ga0207707_10007903 3300025912 Bacteria 9251
270 Ga0207695_10636912 3300025913 Bacteria 947
271 Ga0207671_10005149 3300025914 Bacteria 12170
272 Ga0207671_10023865 3300025914 Bacteria 4607
273 Ga0207671_10620142 3300025914 Bacteria 862
274 Ga0207693_10011035 3300025915 Bacteria 7321
275 Ga0207693_10028083 3300025915 Bacteria 4446
276 Ga0207693_10166997 3300025915 Unclassified 1733
277 Ga0207663_10066194 3300025916 Bacteria 2312
278 Ga0207663_10426542 3300025916 Bacteria 1019
279 Ga0207663_10626745 3300025916 Unclassified 847
280 Ga0207657_10011545 3300025919 Bacteria 8768
281 Ga0207657_10413669 3300025919 Bacteria 1060
282 Ga0207649_10286670 3300025920 Bacteria 1199
283 Ga0207649_10395133 3300025920 Bacteria 1033
284 Ga0207652_10003071 3300025921 Bacteria 13937
285 Ga0207652_10004552 3300025921 Bacteria 11253
286 Ga0207646_10348879 3300025922 Bacteria 1337
287 Ga0207646_11450087 3300025922 Bacteria 596
288 Ga0207650_10789648 3300025925 Unclassified 804
289 Ga0207659_10024835 3300025926 Bacteria 4022
290 Ga0207687_10019472 3300025927 Bacteria 4496
291 Ga0207687_10024586 3300025927 Bacteria 4026
292 Ga0207687_10059992 3300025927 Bacteria 2681
293 Ga0207700_10014269 3300025928 Bacteria 5199
294 Ga0207700_10070893 3300025928 Bacteria 2681
295 Ga0207700_10144276 3300025928 Bacteria 1960
296 Ga0207664_10117439 3300025929 Bacteria 2221
297 Ga0207664_10237804 3300025929 Bacteria 1585
298 Ga0207664_10385604 3300025929 Bacteria 1244
299 Ga0207644_11323840 3300025931 Unclassified 605
300 Ga0207690_10020041 3300025932 Bacteria 4126
301 Ga0207690_10028430 3300025932 Bacteria 3544
302 Ga0207686_10201879 3300025934 Bacteria 1424
303 Ga0207686_10291045 3300025934 Bacteria 1209
304 Ga0207686_11137468 3300025934 Bacteria 637
305 Ga0207709_10082690 3300025935 Bacteria 2074
306 Ga0207709_10097542 3300025935 Bacteria 1936
307 Ga0207709_10121986 3300025935 Bacteria 1761
308 Ga0207709_10236082 3300025935 Bacteria 1327
309 Ga0207669_10018476 3300025937 Bacteria 3605
310 Ga0207669_10031063 3300025937 Bacteria 2979
311 Ga0207704_10046032 3300025938 Bacteria 2597
312 Ga0207665_10086832 3300025939 Bacteria 2161
313 Ga0207665_10128177 3300025939 Bacteria 1799
314 Ga0207665_10248265 3300025939 Bacteria 1314
315 Ga0207665_10906544 3300025939 Bacteria 699
316 Ga0207691_10304597 3300025940 Unclassified 1368
317 Ga0207711_10541197 3300025941 Bacteria 1086
318 Ga0207689_10503830 3300025942 Bacteria 1014
319 Ga0207689_10689799 3300025942 Bacteria 861
320 Ga0207661_10004175 3300025944 Bacteria 10108
321 Ga0207661_10020529 3300025944 Bacteria 4939
322 Ga0207661_10031627 3300025944 Bacteria 4091
323 Ga0207661_10237714 3300025944 Bacteria 1615
324 Ga0207661_10277388 3300025944 Bacteria 1497
325 Ga0207679_10100374 3300025945 Bacteria 2262
326 Ga0207667_10290950 3300025949 Bacteria 1669
327 Ga0207651_10033909 3300025960 Bacteria 3299
328 Ga0207712_10632965 3300025961 Bacteria 928
329 Ga0207640_10122247 3300025981 Bacteria 1867
330 Ga0207658_10001419 3300025986 Bacteria 18686
331 Ga0207658_10298180 3300025986 Bacteria 1388
332 Ga0207658_10928280 3300025986 Unclassified 793
333 Ga0207677_10078040 3300026023 Bacteria 2364
334 Ga0207703_10235355 3300026035 Bacteria 1644
335 Ga0207703_10882051 3300026035 Bacteria 856
336 Ga0207678_10194163 3300026067 Bacteria 1735
337 Ga0207678_11462680 3300026067 Bacteria 603
338 Ga0207708_10000817 3300026075 Bacteria 23458
339 Ga0207708_10204815 3300026075 Bacteria 1575
340 Ga0207708_10695806 3300026075 Bacteria 868
341 Ga0207702_10037300 3300026078 Bacteria 4068
342 Ga0207702_10100556 3300026078 Bacteria 2551
343 Ga0207702_10101609 3300026078 Bacteria 2539
344 Ga0207702_10168254 3300026078 Bacteria 2007
345 Ga0207641_10857933 3300026088 Bacteria 900
346 Ga0207674_10002510 3300026116 Bacteria 23138
347 Ga0207674_10050781 3300026116 Bacteria 4235
348 Ga0207674_10108328 3300026116 Bacteria 2755
349 Ga0207674_10308367 3300026116 Bacteria 1532
350 Ga0207674_10339629 3300026116 Bacteria 1452
351 Ga0207683_10187283 3300026121 Bacteria 1878
352 Ga0209813_10184736 3300027866 Bacteria 764
353 Ga0207428_10001781 3300027907 Bacteria 22060
354 Ga0207428_10024017 3300027907 Bacteria 5119
355 Ga0207428_10149519 3300027907 Bacteria 1778
356 Ga0207428_10215890 3300027907 Bacteria 1440
357 Ga0207428_10755857 3300027907 Bacteria 693
358 Ga0268266_10561336 3300028379 Bacteria 1094
359 Ga0268265_10159914 3300028380 Bacteria 1912
360 Ga0265326_10017825 3300028558 Bacteria 2046
361 Ga0265330_10013916 3300031235 Bacteria 3741
362 Ga0265329_10025331 3300031242 Bacteria 1964
363 Ga0265327_10000718 3300031251 Bacteria 52146
364 Ga0307409_100371012 3300031995 Bacteria 1357
365 Ga0373926_0020534 3300035083 Bacteria 2283
366 Ga0373926_0150040 3300035083 Unclassified 887
367 Ga0373944_0006292 3300035089 Bacteria 3148
368 Ga0373936_0115772 3300035113 Bacteria 1141
369 Ga0373945_0010430 3300035116 Bacteria 3059
370 Ga0373953_0180628 3300035117 Bacteria 910
371 Ga0373956_0081971 3300035119 Bacteria 1481
372 Ga0373956_0190671 3300035119 Bacteria 971
373 Ga0373957_0108179 3300035120 Bacteria 1118
374 Ga0373943_0189627 3300035170 Bacteria 1133
375 Ga0373943_0659947 3300035170 Unclassified 618
376 Ga0373924_0058138 3300035410 Bacteria 1614
377 Ga0373924_0108353 3300035410 Bacteria 1199
378 Ga0373935_0006653 3300035692 Bacteria 6906
379 Ga0373935_0638683 3300035692 Bacteria 780
380 Ga0373927_0024079 3300035695 Bacteria 3983
381 Ga0373927_0040719 3300035695 Bacteria 3014
382 Ga0373927_0561775 3300035695 Unclassified 754
383 Ga0373933_0048689 3300035724 Bacteria 2524
384 Ga0373947_0270239 3300035725 Bacteria 1128
385 Ga0373937_0022525 3300036401 Bacteria 5665
386 Ga0373937_0365130 3300036401 Bacteria 1368
387 Ga0316584_0420406 3300036712 Bacteria 949
388 Ga0373925_0018170 3300037068 Bacteria 5108
389 Ga0373925_0079850 3300037068 Bacteria 2486
390 Ga0373925_0124636 3300037068 Bacteria 2003
391 Ga0395900_0154383 3300037418 Unclassified 2345
392 Ga0395900_0260055 3300037418 Bacteria 1734
393 Ga0395900_1146523 3300037418 Bacteria 694
394 Ga0395898_0294558 3300037466 Bacteria 1548
395 Ga0395898_0458128 3300037466 Unclassified 1214
396 Ga0436364_0570019 3300037853 Bacteria 3240
397 Ga0395901_0048526 3300038443 Bacteria 4409
398 Ga0395901_0051131 3300038443 Bacteria 4295
399 Ga0395901_0538726 3300038443 Bacteria 1184
400 Ga0395901_0663503 3300038443 Bacteria 1045
401 Ga0395901_0935345 3300038443 Bacteria 847
402 Ga0436365_0689271 3300039437 Bacteria 11971
403 Ga0436365_0913000 3300039437 Bacteria 1184
404 Ga0436365_1231943 3300039437 Bacteria 4548
405 Ga0436365_1278218 3300039437 Bacteria 4962
406 Ga0436365_1803478 3300039437 Bacteria 999
407 Ga0436360_0832316 3300039438 Bacteria 2681
408 Ga0436361_0269551 3300039447 Bacteria 1370
409 Ga0436363_1012909 3300039450 Bacteria 2898
410 Ga0439456_035851 3300042013 Bacteria 1070
411 Ga0450888_005589 3300042126 Bacteria 1346
412 Ga0450907_039195 3300042146 Bacteria 811
413 Ga0439460_0077777 3300042461 Bacteria 1037
414 Ga0466969_0112385 3300044656 Bacteria 1274
415 Ga0466969_0427518 3300044656 Bacteria 602
416 Ga0466972_0096760 3300044658 Bacteria 1398
417 Ga0466965_0047693 3300044683 Bacteria 2121
418 Ga0466965_0123210 3300044683 Bacteria 1340
419 Ga0466966_0250721 3300044684 Bacteria 1066
420 Ga0466966_0441960 3300044684 Bacteria 782
421 Ga0466961_0017997 3300044693 Bacteria 4543
422 Ga0466963_0001875 3300044694 Bacteria 11468
423 Ga0466963_0011902 3300044694 Bacteria 5312
424 Ga0466963_0084607 3300044694 Bacteria 2152
425 Ga0466963_0543725 3300044694 Bacteria 820
426 Ga0466964_0328883 3300044706 Bacteria 779
427 Ga0466971_0010163 3300044719 Bacteria 4109
428 Ga0466970_0415559 3300044765 Bacteria 768
429 Ga0466957_0237430 3300044842 Bacteria 1209
430 Ga0466957_0588037 3300044842 Bacteria 778
431 Ga0466959_0014031 3300045049 Bacteria 5816
432 Ga0466959_0014247 3300045049 Bacteria 5771
433 Ga0466959_0529644 3300045049 Bacteria 795
434 Ga0451576_0132377 3300045051 Bacteria 2600
435 Ga0466958_0092387 3300045836 Bacteria 1873
436 Ga0466958_0266721 3300045836 Bacteria 1096
437 Ga0466958_0304300 3300045836 Bacteria 1024
438 Ga0466958_0313212 3300045836 Bacteria 1008
439 Ga0466967_0127690 3300045976 Bacteria 2357
440 Ga0466967_0326914 3300045976 Bacteria 1480
441 Ga0466967_0400029 3300045976 Bacteria 1336
442 Ga0466967_0436082 3300045976 Bacteria 1279
443 Ga0466967_0644434 3300045976 Bacteria 1047
444 Ga0466967_1033875 3300045976 Bacteria 818
445 Ga0495592_0006144 3300046454 Bacteria 8934
446 Ga0495592_0733657 3300046454 Bacteria 592
447 Ga0495603_0086274 3300046455 Bacteria 1837
448 Ga0495629_0033307 3300046459 Bacteria 3644
449 Ga0495641_0036374 3300046461 Bacteria 2314
450 Ga0495641_0037480 3300046461 Bacteria 2271
451 Ga0495651_0024966 3300046462 Bacteria 4649
452 Ga0495651_0248066 3300046462 Bacteria 1217
453 Ga0495653_0056126 3300046463 Bacteria 3003
454 Ga0495580_0027803 3300046472 Bacteria 4113
455 Ga0495582_0003047 3300046473 Bacteria 9385
456 Ga0495582_0195139 3300046473 Bacteria 1156
457 Ga0495662_0004189 3300046476 Bacteria 7266
458 Ga0495664_0053472 3300046477 Bacteria 2401
459 Ga0495594_0003952 3300046499 Bacteria 7629
460 Ga0495596_0093434 3300046500 Bacteria 1168
461 Ga0495596_0304377 3300046500 Bacteria 620
462 Ga0495608_0007049 3300046511 Bacteria 7956
463 Ga0495608_0023009 3300046511 Bacteria 4272
464 Ga0495618_0085482 3300046514 Bacteria 2016
465 Ga0495630_0055891 3300046517 Bacteria 2957
466 Ga0495630_0140645 3300046517 Bacteria 1835
467 Ga0495630_0855094 3300046517 Bacteria 694
468 Ga0495642_0277667 3300046528 Bacteria 733
469 Ga0495652_0079206 3300046529 Bacteria 2717
470 Ga0495652_0749479 3300046529 Bacteria 653
471 Ga0495665_0004549 3300046531 Bacteria 7487
472 Ga0495640_0028287 3300046533 Bacteria 4037
473 Ga0495640_0093202 3300046533 Bacteria 1985
474 Ga0495586_0071580 3300046535 Bacteria 1895
475 Ga0495587_0006633 3300046536 Bacteria 7540
476 Ga0495587_0245344 3300046536 Bacteria 1007
477 Ga0495622_0068703 3300046557 Bacteria 1637
478 Ga0495667_0001992 3300046559 Bacteria 13531
479 Ga0495667_0062382 3300046559 Bacteria 2442
480 Ga0495667_0397924 3300046559 Bacteria 868
481 Ga0495656_0255438 3300046615 Bacteria 886
482 Ga0495634_0017526 3300046642 Bacteria 5107
483 Ga0495634_0027097 3300046642 Bacteria 3991
484 Ga0495635_0008916 3300046663 Bacteria 7000
485 Ga0495657_0003096 3300046675 Bacteria 13731
486 Ga0495657_0003376 3300046675 Bacteria 13056
487 Ga0495599_0023229 3300046678 Bacteria 3875
488 Ga0495599_0159982 3300046678 Bacteria 1392
489 Ga0495623_0073658 3300046679 Bacteria 2123
490 Ga0495646_0005153 3300046680 Bacteria 8247
491 Ga0495646_0097852 3300046680 Bacteria 1685
492 Ga0495647_0018222 3300046681 Bacteria 2496
493 Ga0495658_0018334 3300046683 Bacteria 3637
494 Ga0495669_0115013 3300046684 Bacteria 1258
495 Ga0495613_0009270 3300046689 Bacteria 7302
496 Ga0495624_0077364 3300046690 Bacteria 2063
497 Ga0495624_0187847 3300046690 Bacteria 1257
498 Ga0495600_0020787 3300046809 Bacteria 4200
499 Ga0495600_0037828 3300046809 Bacteria 3138
500 Ga0495581_0002670 3300047315 Bacteria 10147
501 Ga0495604_0011014 3300047317 Bacteria 7178
502 Ga0495604_0263903 3300047317 Bacteria 1169
503 Ga0495674_0016849 3300047319 Bacteria 6815
504 Ga0495674_0863178 3300047319 Bacteria 700
505 Ga0495676_0006826 3300047321 Bacteria 10494
506 Ga0495680_0007106 3300047322 Bacteria 10309
507 Ga0495680_0018629 3300047322 Bacteria 5884
508 Ga0495675_0048805 3300047444 Bacteria 2692
509 Ga0495684_0013682 3300047471 Bacteria 6248
510 Ga0495684_0049095 3300047471 Bacteria 3225
511 Ga0495684_0426339 3300047471 Bacteria 926
512 Ga0495593_0010661 3300047673 Bacteria 5300
513 Ga0495602_0024138 3300048088 Bacteria 5903
514 Ga0495602_0625775 3300048088 Bacteria 737
515 Ga0495614_0004821 3300048089 Bacteria 6088
516 Ga0495614_0043068 3300048089 Bacteria 1936
517 Ga0496100_0000087 3300048903 Bacteria 52650
518 Ga0496100_0038990 3300048903 Bacteria 3014
519 Ga0496100_0112474 3300048903 Bacteria 1894
520 Ga0496100_0121574 3300048903 Bacteria 1827
521 Ga0496100_0316469 3300048903 Bacteria 1171
522 Ga0496101_0000034 3300048904 Bacteria 178045
523 Ga0496101_0005189 3300048904 Bacteria 8287
524 Ga0496101_0024741 3300048904 Bacteria 4160
525 Ga0496101_0127157 3300048904 Bacteria 1932
526 Ga0496101_0336892 3300048904 Bacteria 1184
527 Ga0496101_0898333 3300048904 Bacteria 697
528 Ga0496101_1127607 3300048904 Bacteria 615
529 Ga0496102_0003014 3300048905 Bacteria 14265
530 Ga0496102_0015914 3300048905 Bacteria 6562
531 Ga0496102_0018869 3300048905 Bacteria 6068
532 Ga0496102_0019364 3300048905 Bacteria 5995
533 Ga0496102_0025095 3300048905 Bacteria 5302
534 Ga0496102_0072081 3300048905 Bacteria 3173
535 Ga0496103_0003562 3300048906 Bacteria 9515
536 Ga0496103_0063747 3300048906 Bacteria 2296
537 Ga0496103_0128484 3300048906 Bacteria 1617
538 Ga0496103_0138720 3300048906 Bacteria 1554
539 Ga0496103_0551998 3300048906 Unclassified 735
540 Ga0496103_0687576 3300048906 Bacteria 649
541 Ga0496104_0004621 3300048907 Bacteria 11998
542 Ga0496104_0064566 3300048907 Bacteria 3473
543 Ga0496104_0065999 3300048907 Bacteria 3436
544 Ga0496104_0078294 3300048907 Bacteria 3150
545 Ga0496104_0288197 3300048907 Bacteria 1554
546 Ga0496105_0000147 3300048908 Bacteria 46556
547 Ga0496105_0050289 3300048908 Bacteria 3442
548 Ga0496105_0451749 3300048908 Bacteria 1014
549 Ga0496105_0506219 3300048908 Bacteria 947
550 Ga0496105_0676087 3300048908 Bacteria 794
551 Ga0496105_0851003 3300048908 Unclassified 690
552 Ga0496106_0006173 3300048909 Bacteria 8859
553 Ga0496106_0139299 3300048909 Bacteria 1907
554 Ga0496106_0353350 3300048909 Bacteria 1181
555 Ga0496106_0420485 3300048909 Bacteria 1074
556 Ga0496106_0535111 3300048909 Bacteria 940
557 Ga0496107_0000108 3300048910 Bacteria 40403
558 Ga0496107_0056952 3300048910 Bacteria 2825
559 Ga0496107_0100967 3300048910 Bacteria 2115
560 Ga0496107_0249518 3300048910 Bacteria 1321
561 Ga0496107_0307896 3300048910 Bacteria 1179
562 Ga0496108_0005536 3300048911 Bacteria 10219
563 Ga0496108_0007784 3300048911 Bacteria 8679
564 Ga0496108_0053320 3300048911 Bacteria 3391
565 Ga0496108_0101020 3300048911 Bacteria 2460
566 Ga0496108_0342584 3300048911 Bacteria 1304
567 Ga0496109_0000127 3300048912 Bacteria 77905
568 Ga0496109_0005421 3300048912 Bacteria 10672
569 Ga0496109_0062829 3300048912 Bacteria 3396
570 Ga0496109_0357438 3300048912 Bacteria 1380
571 Ga0496109_0415316 3300048912 Bacteria 1271
572 Ga0496109_0708297 3300048912 Unclassified 944
573 Ga0496110_0000632 3300048913 Bacteria 24071
574 Ga0496110_0001687 3300048913 Bacteria 16208
575 Ga0496110_0003225 3300048913 Bacteria 12422
576 Ga0496110_0040253 3300048913 Bacteria 4073
577 Ga0496110_0354909 3300048913 Bacteria 1336
578 Ga0496110_0447017 3300048913 Bacteria 1178
579 Ga0496110_0659576 3300048913 Bacteria 946
580 Ga0496111_0003696 3300048914 Bacteria 9511
581 Ga0496111_0028583 3300048914 Bacteria 3952
582 Ga0496111_0045727 3300048914 Bacteria 3150
583 Ga0496111_0154362 3300048914 Bacteria 1703
584 Ga0496112_0007427 3300048915 Bacteria 9728
585 Ga0496112_0007538 3300048915 Bacteria 9662
586 Ga0496112_0021242 3300048915 Bacteria 6171
587 Ga0496112_0076915 3300048915 Bacteria 3300
588 Ga0496112_0349068 3300048915 Bacteria 1422
589 Ga0496112_0540346 3300048915 Bacteria 1100
590 Ga0496112_0906821 3300048915 Bacteria 803
591 Ga0496112_0998493 3300048915 Unclassified 757
592 Ga0496113_0024294 3300048916 Bacteria 4306
593 Ga0496113_0041527 3300048916 Bacteria 3394
594 Ga0496113_0243092 3300048916 Bacteria 1436
595 Ga0496113_0266510 3300048916 Bacteria 1369
596 Ga0496113_0427455 3300048916 Bacteria 1064
597 Ga0496113_0487880 3300048916 Bacteria 989
598 Ga0496114_0000277 3300048917 Bacteria 37457
599 Ga0496114_0003776 3300048917 Bacteria 11677
600 Ga0496114_0278569 3300048917 Bacteria 1474
601 Ga0496114_0308995 3300048917 Bacteria 1396
602 Ga0496114_0758152 3300048917 Bacteria 848
603 Ga0496115_0002281 3300048918 Bacteria 13734
604 Ga0496115_0036167 3300048918 Bacteria 3909
605 Ga0496115_0118626 3300048918 Bacteria 2176
606 Ga0496116_0009881 3300048919 Bacteria 8070
607 Ga0496117_0025665 3300048920 Bacteria 4627
608 Ga0496118_0012406 3300048921 Bacteria 8184
609 Ga0496119_0007860 3300048922 Bacteria 9498
610 Ga0496120_0085583 3300048923 Bacteria 1696
611 Ga0496121_0000048 3300048924 Bacteria 330242
612 Ga0496122_0002047 3300048925 Bacteria 29932
613 Ga0496122_0007157 3300048925 Bacteria 12505
614 Ga0496123_0005077 3300048926 Bacteria 13448
615 Ga0496123_0028217 3300048926 Bacteria 4160
616 Ga0496124_0000044 3300048927 Bacteria 289064
617 Ga0496125_0000037 3300048928 Bacteria 330242
618 Ga0496126_0000046 3300048929 Bacteria 330242
619 Ga0496126_0008405 3300048929 Bacteria 11139
620 Ga0501031_0014077 3300049568 Bacteria 5204
621 Ga0501031_0070731 3300049568 Bacteria 2273
622 Ga0501031_0500526 3300049568 Bacteria 784
623 Ga0501032_0054235 3300049569 Bacteria 2699
624 Ga0501032_0275842 3300049569 Bacteria 1089
625 Ga0501032_0424478 3300049569 Bacteria 853
626 Ga0501033_0125117 3300049570 Bacteria 1864
627 Ga0501034_0413860 3300049571 Bacteria 1270
628 Ga0501036_0007462 3300049572 Bacteria 8913
629 Ga0501036_0229737 3300049572 Bacteria 1557
630 Ga0501036_0331432 3300049572 Bacteria 1271
631 Ga0501038_0013394 3300049574 Bacteria 7476
632 Ga0501038_0330442 3300049574 Bacteria 1191
633 Ga0501039_0027582 3300049575 Bacteria 4366
634 Ga0501039_1136325 3300049575 Bacteria 605
635 Ga0501040_0106789 3300049576 Bacteria 1956
636 Ga0501040_0114624 3300049576 Bacteria 1887
637 Ga0501041_0017328 3300049577 Bacteria 4286
638 Ga0501042_0023700 3300049578 Bacteria 4297
639 Ga0501042_0212032 3300049578 Bacteria 1397
640 Ga0501042_0226350 3300049578 Bacteria 1349
641 Ga0501046_0037622 3300049580 Bacteria 3888
642 Ga0501047_0696580 3300049581 Bacteria 833
643 Ga0501048_0009748 3300049582 Bacteria 7203
644 Ga0501048_0106029 3300049582 Bacteria 1984
645 Ga0501048_0494487 3300049582 Bacteria 877
646 Ga0501067_0033157 3300049583 Bacteria 2866
647 Ga0501067_0135306 3300049583 Bacteria 1372
648 Ga0501068_0050184 3300049584 Bacteria 2522
649 Ga0501068_0482258 3300049584 Bacteria 803
650 Ga0501070_0092995 3300049586 Bacteria 2495
651 Ga0501070_0475620 3300049586 Bacteria 1005
652 Ga0501070_0549506 3300049586 Bacteria 925
653 Ga0501070_0612362 3300049586 Bacteria 867
654 Ga0501071_0110605 3300049587 Bacteria 2030
655 Ga0501071_0186078 3300049587 Bacteria 1557
656 Ga0501071_0337185 3300049587 Bacteria 1146
657 Ga0501072_0013405 3300049588 Bacteria 6273
658 Ga0501072_0067366 3300049588 Bacteria 2825
659 Ga0501072_0213339 3300049588 Bacteria 1538
660 Ga0501072_0341845 3300049588 Bacteria 1189
661 Ga0501073_0168962 3300049589 Bacteria 1514
662 Ga0501074_0005969 3300049590 Bacteria 8787
663 Ga0501074_0079505 3300049590 Bacteria 2353
664 Ga0501074_0329973 3300049590 Bacteria 1083
665 Ga0501075_0034824 3300049591 Bacteria 3751
666 Ga0501075_0133769 3300049591 Bacteria 1889
667 Ga0501076_0266926 3300049592 Bacteria 1401
668 Ga0501076_0567769 3300049592 Bacteria 936
669 Ga0501077_0002560 3300049593 Bacteria 10903
670 Ga0501077_0114092 3300049593 Bacteria 1713
671 Ga0501077_0190601 3300049593 Bacteria 1302
672 Ga0501077_0228887 3300049593 Bacteria 1182
673 Ga0501079_0005337 3300049741 Bacteria 9566
674 Ga0501079_0231748 3300049741 Bacteria 1442
675 Ga0501079_0405666 3300049741 Bacteria 1069
676 Ga0501080_0020690 3300049742 Bacteria 6095
677 Ga0501080_0283997 3300049742 Bacteria 1504
678 Ga0501080_0451336 3300049742 Bacteria 1153
679 Ga0501081_0068227 3300049743 Bacteria 2475
680 Ga0501081_0333290 3300049743 Bacteria 1116
681 Ga0501081_0376848 3300049743 Bacteria 1048
682 Ga0501081_0983126 3300049743 Bacteria 637
683 Ga0501035_0578222 3300049822 Bacteria 918
684 Ga0501045_0064045 3300049824 Bacteria 2698
685 Ga0501045_0140987 3300049824 Bacteria 1792
686 Ga0501045_0466266 3300049824 Bacteria 939
687 nmdc:mga00v17_32429_c1 3300050491 Bacteria 3088
688 nmdc:mga0yw44_30198_c1 3300050492 Bacteria 3137
689 nmdc:mga0yw44_312024_c1 3300050492 Bacteria 1055
690 nmdc:mga06z11_119945_c1 3300050494 Bacteria 1466
691 nmdc:mga04h51_212855_c1 3300050495 Bacteria 763
692 nmdc:mga05p37_101310_c1 3300050507 Bacteria 3547
693 nmdc:mga05p37_283886_c1 3300050507 Bacteria 1973
694 nmdc:mga05p37_497905_c1 3300050507 Bacteria 1399
695 nmdc:mga05p37_799877_c1 3300050507 Bacteria 1032
696 nmdc:mga09592_37795_c1 3300050508 Bacteria 4051
697 nmdc:mga09592_45778_c1 3300050508 Bacteria 3686
698 nmdc:mga0qj67_126988_c1 3300050509 Bacteria 2064
699 nmdc:mga0qj67_29212_c1 3300050509 Bacteria 4282
700 nmdc:mga06r32_1383787_c1 3300050510 Bacteria 646
701 nmdc:mga06r32_500865_c1 3300050510 Bacteria 1191
702 nmdc:mga06r32_5768_c1 3300050510 Bacteria 11157
703 nmdc:mga06r32_59188_c1 3300050510 Bacteria 3683
704 nmdc:mga06r32_74573_c1 3300050510 Bacteria 3290
705 nmdc:mga06r32_893472_c1 3300050510 Bacteria 845
706 nmdc:mga08y16_170775_c1 3300050511 Bacteria 2259
707 nmdc:mga08y16_305569_c1 3300050511 Bacteria 1639
708 nmdc:mga08y16_325536_c1 3300050511 Bacteria 1581
709 nmdc:mga08y16_58946_c1 3300050511 Bacteria 4012
710 nmdc:mga08y16_6329_c1 3300050511 Bacteria 12416
711 nmdc:mga08y16_698861_c1 3300050511 Bacteria 1014
712 nmdc:mga08y16_711878_c1 3300050511 Bacteria 1003
713 nmdc:mga0n895_1775470_c1 3300050512 Bacteria 578
714 nmdc:mga0n895_42287_c1 3300050512 Bacteria 4433
715 nmdc:mga0n895_9300_c1 3300050512 Bacteria 8585
716 nmdc:mga0rr50_163598_c1 3300050513 Bacteria 1808
717 nmdc:mga0rr50_247299_c1 3300050513 Bacteria 1480
718 nmdc:mga08x19_207332_c1 3300050514 Unclassified 1345
719 nmdc:mga08x19_224992_c1 3300050514 Unclassified 1290
720 nmdc:mga08x19_53088_c1 3300050514 Bacteria 2607
721 nmdc:mga0a205_1204365_c1 3300050515 Bacteria 605
722 nmdc:mga0a205_7015_c1 3300050515 Bacteria 10174
723 nmdc:mga0a205_91657_c1 3300050515 Bacteria 2937
724 nmdc:mga0a205_976526_c1 3300050515 Bacteria 694
725 Ga0495601_0018521 3300053077 Bacteria 4240
726 Ga0495655_0086296 3300053083 Unclassified 907
727 Ga0495595_0025743 3300053084 Bacteria 2609
728 Ga0495595_0161539 3300053084 Bacteria 1105
729 Ga0495619_0013544 3300053085 Bacteria 5139
730 Ga0500616_0000221 3300053153 Bacteria 88983
731 Ga0501084_0004889 3300054114 Bacteria 10948
732 Ga0501084_0182373 3300054114 Bacteria 1772
733 Ga0501084_0618795 3300054114 Bacteria 915
734 Ga0501082_0029608 3300060353 Bacteria 4717
735 Ga0501082_0186486 3300060353 Bacteria 1805
736 Ga0466962_0008688 3300061719 Bacteria 4871
737 Ga0466962_0287455 3300061719 Bacteria 812
738 Ga0530510_0110230 3300061734 Bacteria 2015
739 Ga0530510_0206660 3300061734 Bacteria 1459
740 Ga0530510_0730274 3300061734 Bacteria 755
741 2587864321 2585428094 Bacteria 3604039
742 2643875908 2643221572 Bacteria 3614809
743 2644382963 2643221669 Bacteria 3611286
744 2644538022 2643221697 Bacteria 3575694
745 2644610267 2643221711 Bacteria 4865335
746 2738663811 2738541264 Bacteria 5935393
747 2739142946 2738541356 Bacteria 5935017
748 2852678008 2852677369 Bacteria 3768884
749 2870628054 2870628048 Bacteria 3696012
750 2895663577 2895660088 Bacteria 3782833
751 2939602317 2939598168 Bacteria 4687164
752 Ga0316578_10062742
753 Ga0006562J51391_1054243
754 Ga0006562J51391_1054246
755 Ga0055540_1000038
756 Ga0065714_10065949
757 Ga0065714_10234720
758 Ga0065704_10007708
759 Ga0065712_10130057
760 Ga0070658_11599062
761 Ga0070676_10109091
762 Ga0070676_10256096
763 Ga0070683_100033279
764 Ga0070683_100062006
765 Ga0070683_100265550
766 Ga0070683_100381292
767 Ga0068869_100647728
768 Ga0070666_10125833
769 Ga0070680_100002207
770 Ga0070682_100056553
771 Ga0070682_100384583
772 Ga0068868_100003823
773 Ga0068868_100342482
774 Ga0070660_100017052
775 Ga0070660_100391653
776 Ga0070660_101102758
777 Ga0070689_100386850
778 Ga0070691_10008781
779 Ga0070661_100334778
780 Ga0070661_100654719
781 Ga0070661_100662963
782 Ga0070692_10251702
783 Ga0070669_100726443
784 Ga0070675_100058936
785 Ga0070675_101388296
786 Ga0070671_100114816
787 Ga0070674_100030552
788 Ga0070674_100533732
789 Ga0070674_100541958
790 Ga0070673_100044855
791 Ga0070688_100053182
792 Ga0070659_100047566
793 Ga0070659_100165797
794 Ga0070667_100000883
795 Ga0070667_101105116
796 Ga0070709_10617895
797 Ga0070709_10678365
798 Ga0070714_100131092
799 Ga0070714_100133945
800 Ga0070714_100274598
801 Ga0070714_100364198
802 Ga0070713_100060640
803 Ga0070713_100146818
804 Ga0070713_100341876
805 Ga0070713_100611911
806 Ga0070713_101163817
807 Ga0070710_10007389
808 Ga0070710_10832246
809 Ga0070701_10237287
810 Ga0070701_10448048
811 Ga0070711_100006496
812 Ga0070711_100107424
813 Ga0070711_100450918
814 Ga0070711_101183448
815 Ga0070705_100075815
816 Ga0070700_100015971
817 Ga0070700_100206315
818 Ga0070708_100817478
819 Ga0070663_100166980
820 Ga0070678_100057594
821 Ga0070678_100340357
822 Ga0070678_100357919
823 Ga0070681_10006968
824 Ga0070681_10502451
825 Ga0070685_10370658
826 Ga0070685_10493610
827 Ga0070706_100267419
828 Ga0070707_100104458
829 Ga0070707_101900625
830 Ga0070698_100002676
831 Ga0070698_100780913
832 Ga0070699_100046993
833 Ga0070679_100007549
834 Ga0070679_100199310
835 Ga0070684_100003771
836 Ga0070684_100010570
837 Ga0070684_100152849
838 Ga0070684_100291957
839 Ga0068853_100005415
840 Ga0070672_100781928
841 Ga0070695_101046416
842 Ga0070665_100685343
843 Ga0070665_100896553
844 Ga0070665_101387822
845 Ga0070704_100203784
846 Ga0070704_101096837
847 Ga0068855_100435415
848 Ga0070664_100004514
849 Ga0070664_100160556
850 Ga0070664_100283633
851 Ga0068857_100002367
852 Ga0068857_100292232
853 Ga0068857_100505297
854 Ga0068857_101334084
855 Ga0068854_100142996
856 Ga0068856_100026064
857 Ga0068856_100027660
858 Ga0068856_100149181
859 Ga0068856_100191186
860 Ga0068856_101316317
861 Ga0070702_100045035
862 Ga0070702_100136076
863 Ga0068852_100003496
864 Ga0068852_100743500
865 Ga0068859_100212846
866 Ga0068864_101522730
867 Ga0068866_10049728
868 Ga0068861_100345193
869 Ga0068861_101185277
870 Ga0068870_10087597
871 Ga0068870_10163395
872 Ga0068863_100840058
873 Ga0068858_100490608
874 Ga0068860_101509749
875 Ga0068862_100186950
876 Ga0081455_10086432
877 Ga0081455_10088231
878 Ga0081455_10161312
879 Ga0081538_10009498
880 Ga0081538_10071445
881 Ga0081539_10162709
882 Ga0070717_10014628
883 Ga0070717_10047508
884 Ga0070717_10051330
885 Ga0070717_10065295
886 Ga0070717_10139701
887 Ga0070717_11029303
888 Ga0070717_11323312
889 Ga0075365_10147340
890 Ga0075365_10407820
891 Ga0075368_10246235
892 Ga0075364_10274572
893 Ga0075432_10098563
894 Ga0075432_10243862
895 Ga0070715_10205578
896 Ga0070716_100091454
897 Ga0070712_100105038
898 Ga0070712_100116652
899 Ga0075362_10032974
900 Ga0097621_100183932
901 Ga0075428_100031162
902 Ga0075428_100057799
903 Ga0075428_100217886
904 Ga0075428_100786772
905 Ga0075430_100016244
906 Ga0075430_100018217
907 Ga0075431_100010542
908 Ga0075431_100322892
909 Ga0075431_100759177
910 Ga0075431_101144498
911 Ga0075433_10004829
912 Ga0075434_100007632
913 Ga0075434_100021751
914 Ga0075434_100385796
915 Ga0075429_100018897
916 Ga0075429_100283630
917 Ga0068865_100199110
918 Ga0068865_100399829
919 Ga0075436_100027372
920 Ga0075436_100086490
921 Ga0075436_100108710
922 Ga0075436_100127301
923 Ga0097620_100212841
924 Ga0075435_100193418
925 Ga0075435_100309782
926 Ga0105240_10015177
927 Ga0105240_11636768
928 Ga0111539_10000579
929 Ga0111539_10297779
930 Ga0111539_10879192
931 Ga0105245_10010437
932 Ga0105245_10044550
933 Ga0105245_10068096
934 Ga0105245_10264072
935 Ga0105245_11449271
936 Ga0105247_10248743
937 Ga0105247_10434336
938 Ga0105247_10805117
939 Ga0114129_10029595
940 Ga0114129_10133874
941 Ga0114129_10387452
942 Ga0114129_10455948
943 Ga0114129_10561943
944 Ga0105243_10040988
945 Ga0105243_10733966
946 Ga0105242_10195029
947 Ga0105242_10344022
948 Ga0105248_10959609
949 Ga0105237_10005032
950 Ga0105237_10018125
951 Ga0105237_10188049
952 Ga0105237_10570681
953 Ga0105238_10091818
954 Ga0105249_10126322
955 Ga0105239_10050146
956 Ga0105239_10051659
957 Ga0105239_10092372
958 Ga0105239_10206195
959 Ga0105239_10462035
960 Ga0105239_10501852
961 Ga0105246_10026821
962 Ga0105246_11004641
963 Ga0105246_11228002
964 Ga0105246_11373364
965 Ga0157370_10003299
966 Ga0157370_10403331
967 Ga0157369_10511837
968 Ga0157374_10059513
969 Ga0157374_10107192
970 Ga0157374_10224869
971 Ga0157374_10226036
972 Ga0157374_10405275
973 Ga0157374_10534566
974 Ga0157378_10246139
975 Ga0157378_11000781
976 Ga0163162_10695565
977 Ga0163162_10896747
978 Ga0163162_10905766
979 Ga0157372_10023566
980 Ga0157372_10023707
981 Ga0157372_10544334
982 Ga0157372_10576489
983 Ga0157372_11463414
984 Ga0157375_10135064
985 Ga0157375_10369649
986 Ga0157375_11364322
987 Ga0163163_10310972
988 Ga0163163_10548220
989 Ga0163163_11538417
990 Ga0157380_10656510
991 Ga0157380_10703482
992 Ga0182008_10144438
993 Ga0157377_10113583
994 Ga0157377_10156337
995 Ga0157376_10312288
996 Ga0157376_10424341
997 Ga0157376_10457382
998 Ga0157376_11187525
999 Ga0182007_10233051
1000 Ga0163161_10597071
1001 Ga0163161_11385325
1002 Ga0206354_11138832
1003 Ga0206353_11108710
1004 Ga0213876_10228740
1005 Ga0213876_10281937
1006 Ga0213875_10493710
1007 Ga0224712_10342064
1008 Ga0209051_1000014
1009 Ga0207692_10002457
1010 Ga0207642_10111283
1011 Ga0207688_10002443
1012 Ga0207680_10199019
1013 Ga0207647_10206341
1014 Ga0207685_10062440
1015 Ga0207699_10007314
1016 Ga0207645_10155323
1017 Ga0207645_10304713
1018 Ga0207643_10020603
1019 Ga0207707_10002713
1020 Ga0207707_10007903
1021 Ga0207695_10636912
1022 Ga0207671_10005149
1023 Ga0207671_10023865
1024 Ga0207671_10620142
1025 Ga0207693_10011035
1026 Ga0207693_10028083
1027 Ga0207693_10166997
1028 Ga0207663_10066194
1029 Ga0207663_10426542
1030 Ga0207663_10626745
1031 Ga0207657_10011545
1032 Ga0207657_10413669
1033 Ga0207649_10286670
1034 Ga0207649_10395133
1035 Ga0207652_10003071
1036 Ga0207652_10004552
1037 Ga0207646_10348879
1038 Ga0207646_11450087
1039 Ga0207650_10789648
1040 Ga0207659_10024835
1041 Ga0207687_10019472
1042 Ga0207687_10024586
1043 Ga0207687_10059992
1044 Ga0207700_10014269
1045 Ga0207700_10070893
1046 Ga0207700_10144276
1047 Ga0207664_10117439
1048 Ga0207664_10237804
1049 Ga0207664_10385604
1050 Ga0207644_11323840
1051 Ga0207690_10020041
1052 Ga0207690_10028430
1053 Ga0207686_10201879
1054 Ga0207686_10291045
1055 Ga0207686_11137468
1056 Ga0207709_10082690
1057 Ga0207709_10097542
1058 Ga0207709_10121986
1059 Ga0207709_10236082
1060 Ga0207669_10018476
1061 Ga0207669_10031063
1062 Ga0207704_10046032
1063 Ga0207665_10086832
1064 Ga0207665_10128177
1065 Ga0207665_10248265
1066 Ga0207665_10906544
1067 Ga0207691_10304597
1068 Ga0207711_10541197
1069 Ga0207689_10503830
1070 Ga0207689_10689799
1071 Ga0207661_10004175
1072 Ga0207661_10020529
1073 Ga0207661_10031627
1074 Ga0207661_10237714
1075 Ga0207661_10277388
1076 Ga0207679_10100374
1077 Ga0207667_10290950
1078 Ga0207651_10033909
1079 Ga0207712_10632965
1080 Ga0207640_10122247
1081 Ga0207658_10001419
1082 Ga0207658_10298180
1083 Ga0207658_10928280
1084 Ga0207677_10078040
1085 Ga0207703_10235355
1086 Ga0207703_10882051
1087 Ga0207678_10194163
1088 Ga0207678_11462680
1089 Ga0207708_10000817
1090 Ga0207708_10204815
1091 Ga0207708_10695806
1092 Ga0207702_10037300
1093 Ga0207702_10100556
1094 Ga0207702_10101609
1095 Ga0207702_10168254
1096 Ga0207641_10857933
1097 Ga0207674_10002510
1098 Ga0207674_10050781
1099 Ga0207674_10108328
1100 Ga0207674_10308367
1101 Ga0207674_10339629
1102 Ga0207683_10187283
1103 Ga0209813_10184736
1104 Ga0207428_10001781
1105 Ga0207428_10024017
1106 Ga0207428_10149519
1107 Ga0207428_10215890
1108 Ga0207428_10755857
1109 Ga0268266_10561336
1110 Ga0268265_10159914
1111 Ga0265326_10017825
1112 Ga0265330_10013916
1113 Ga0265329_10025331
1114 Ga0265327_10000718
1115 Ga0307409_100371012
1116 Ga0373926_0020534
1117 Ga0373926_0150040
1118 Ga0373944_0006292
1119 Ga0373936_0115772
1120 Ga0373945_0010430
1121 Ga0373953_0180628
1122 Ga0373956_0081971
1123 Ga0373956_0190671
1124 Ga0373957_0108179
1125 Ga0373943_0189627
1126 Ga0373943_0659947
1127 Ga0373924_0058138
1128 Ga0373924_0108353
1129 Ga0373935_0006653
1130 Ga0373935_0638683
1131 Ga0373927_0024079
1132 Ga0373927_0040719
1133 Ga0373927_0561775
1134 Ga0373933_0048689
1135 Ga0373947_0270239
1136 Ga0373937_0022525
1137 Ga0373937_0365130
1138 Ga0316584_0420406
1139 Ga0373925_0018170
1140 Ga0373925_0079850
1141 Ga0373925_0124636
1142 Ga0395900_0154383
1143 Ga0395900_0260055
1144 Ga0395900_1146523
1145 Ga0395898_0294558
1146 Ga0395898_0458128
1147 Ga0436364_0570019
1148 Ga0395901_0048526
1149 Ga0395901_0051131
1150 Ga0395901_0538726
1151 Ga0395901_0663503
1152 Ga0395901_0935345
1153 Ga0436365_0689271
1154 Ga0436365_0913000
1155 Ga0436365_1231943
1156 Ga0436365_1278218
1157 Ga0436365_1803478
1158 Ga0436360_0832316
1159 Ga0436361_0269551
1160 Ga0436363_1012909
1161 Ga0439456_035851
1162 Ga0450888_005589
1163 Ga0450907_039195
1164 Ga0439460_0077777
1165 Ga0466969_0112385
1166 Ga0466969_0427518
1167 Ga0466972_0096760
1168 Ga0466965_0047693
1169 Ga0466965_0123210
1170 Ga0466966_0250721
1171 Ga0466966_0441960
1172 Ga0466961_0017997
1173 Ga0466963_0001875
1174 Ga0466963_0011902
1175 Ga0466963_0084607
1176 Ga0466963_0543725
1177 Ga0466964_0328883
1178 Ga0466971_0010163
1179 Ga0466970_0415559
1180 Ga0466957_0237430
1181 Ga0466957_0588037
1182 Ga0466959_0014031
1183 Ga0466959_0014247
1184 Ga0466959_0529644
1185 Ga0451576_0132377
1186 Ga0466958_0092387
1187 Ga0466958_0266721
1188 Ga0466958_0304300
1189 Ga0466958_0313212
1190 Ga0466967_0127690
1191 Ga0466967_0326914
1192 Ga0466967_0400029
1193 Ga0466967_0436082
1194 Ga0466967_0644434
1195 Ga0466967_1033875
1196 Ga0495592_0006144
1197 Ga0495592_0733657
1198 Ga0495603_0086274
1199 Ga0495629_0033307
1200 Ga0495641_0036374
1201 Ga0495641_0037480
1202 Ga0495651_0024966
1203 Ga0495651_0248066
1204 Ga0495653_0056126
1205 Ga0495580_0027803
1206 Ga0495582_0003047
1207 Ga0495582_0195139
1208 Ga0495662_0004189
1209 Ga0495664_0053472
1210 Ga0495594_0003952
1211 Ga0495596_0093434
1212 Ga0495596_0304377
1213 Ga0495608_0007049
1214 Ga0495608_0023009
1215 Ga0495618_0085482
1216 Ga0495630_0055891
1217 Ga0495630_0140645
1218 Ga0495630_0855094
1219 Ga0495642_0277667
1220 Ga0495652_0079206
1221 Ga0495652_0749479
1222 Ga0495665_0004549
1223 Ga0495640_0028287
1224 Ga0495640_0093202
1225 Ga0495586_0071580
1226 Ga0495587_0006633
1227 Ga0495587_0245344
1228 Ga0495622_0068703
1229 Ga0495667_0001992
1230 Ga0495667_0062382
1231 Ga0495667_0397924
1232 Ga0495656_0255438
1233 Ga0495634_0017526
1234 Ga0495634_0027097
1235 Ga0495635_0008916
1236 Ga0495657_0003096
1237 Ga0495657_0003376
1238 Ga0495599_0023229
1239 Ga0495599_0159982
1240 Ga0495623_0073658
1241 Ga0495646_0005153
1242 Ga0495646_0097852
1243 Ga0495647_0018222
1244 Ga0495658_0018334
1245 Ga0495669_0115013
1246 Ga0495613_0009270
1247 Ga0495624_0077364
1248 Ga0495624_0187847
1249 Ga0495600_0020787
1250 Ga0495600_0037828
1251 Ga0495581_0002670
1252 Ga0495604_0011014
1253 Ga0495604_0263903
1254 Ga0495674_0016849
1255 Ga0495674_0863178
1256 Ga0495676_0006826
1257 Ga0495680_0007106
1258 Ga0495680_0018629
1259 Ga0495675_0048805
1260 Ga0495684_0013682
1261 Ga0495684_0049095
1262 Ga0495684_0426339
1263 Ga0495593_0010661
1264 Ga0495602_0024138
1265 Ga0495602_0625775
1266 Ga0495614_0004821
1267 Ga0495614_0043068
1268 Ga0496100_0000087
1269 Ga0496100_0038990
1270 Ga0496100_0112474
1271 Ga0496100_0121574
1272 Ga0496100_0316469
1273 Ga0496101_0000034
1274 Ga0496101_0005189
1275 Ga0496101_0024741
1276 Ga0496101_0127157
1277 Ga0496101_0336892
1278 Ga0496101_0898333
1279 Ga0496101_1127607
1280 Ga0496102_0003014
1281 Ga0496102_0015914
1282 Ga0496102_0018869
1283 Ga0496102_0019364
1284 Ga0496102_0025095
1285 Ga0496102_0072081
1286 Ga0496103_0003562
1287 Ga0496103_0063747
1288 Ga0496103_0128484
1289 Ga0496103_0138720
1290 Ga0496103_0551998
1291 Ga0496103_0687576
1292 Ga0496104_0004621
1293 Ga0496104_0064566
1294 Ga0496104_0065999
1295 Ga0496104_0078294
1296 Ga0496104_0288197
1297 Ga0496105_0000147
1298 Ga0496105_0050289
1299 Ga0496105_0451749
1300 Ga0496105_0506219
1301 Ga0496105_0676087
1302 Ga0496105_0851003
1303 Ga0496106_0006173
1304 Ga0496106_0139299
1305 Ga0496106_0353350
1306 Ga0496106_0420485
1307 Ga0496106_0535111
1308 Ga0496107_0000108
1309 Ga0496107_0056952
1310 Ga0496107_0100967
1311 Ga0496107_0249518
1312 Ga0496107_0307896
1313 Ga0496108_0005536
1314 Ga0496108_0007784
1315 Ga0496108_0053320
1316 Ga0496108_0101020
1317 Ga0496108_0342584
1318 Ga0496109_0000127
1319 Ga0496109_0005421
1320 Ga0496109_0062829
1321 Ga0496109_0357438
1322 Ga0496109_0415316
1323 Ga0496109_0708297
1324 Ga0496110_0000632
1325 Ga0496110_0001687
1326 Ga0496110_0003225
1327 Ga0496110_0040253
1328 Ga0496110_0354909
1329 Ga0496110_0447017
1330 Ga0496110_0659576
1331 Ga0496111_0003696
1332 Ga0496111_0028583
1333 Ga0496111_0045727
1334 Ga0496111_0154362
1335 Ga0496112_0007427
1336 Ga0496112_0007538
1337 Ga0496112_0021242
1338 Ga0496112_0076915
1339 Ga0496112_0349068
1340 Ga0496112_0540346
1341 Ga0496112_0906821
1342 Ga0496112_0998493
1343 Ga0496113_0024294
1344 Ga0496113_0041527
1345 Ga0496113_0243092
1346 Ga0496113_0266510
1347 Ga0496113_0427455
1348 Ga0496113_0487880
1349 Ga0496114_0000277
1350 Ga0496114_0003776
1351 Ga0496114_0278569
1352 Ga0496114_0308995
1353 Ga0496114_0758152
1354 Ga0496115_0002281
1355 Ga0496115_0036167
1356 Ga0496115_0118626
1357 Ga0496116_0009881
1358 Ga0496117_0025665
1359 Ga0496118_0012406
1360 Ga0496119_0007860
1361 Ga0496120_0085583
1362 Ga0496121_0000048
1363 Ga0496122_0002047
1364 Ga0496122_0007157
1365 Ga0496123_0005077
1366 Ga0496123_0028217
1367 Ga0496124_0000044
1368 Ga0496125_0000037
1369 Ga0496126_0000046
1370 Ga0496126_0008405
1371 Ga0501031_0014077
1372 Ga0501031_0070731
1373 Ga0501031_0500526
1374 Ga0501032_0054235
1375 Ga0501032_0275842
1376 Ga0501032_0424478
1377 Ga0501033_0125117
1378 Ga0501034_0413860
1379 Ga0501036_0007462
1380 Ga0501036_0229737
1381 Ga0501036_0331432
1382 Ga0501038_0013394
1383 Ga0501038_0330442
1384 Ga0501039_0027582
1385 Ga0501039_1136325
1386 Ga0501040_0106789
1387 Ga0501040_0114624
1388 Ga0501041_0017328
1389 Ga0501042_0023700
1390 Ga0501042_0212032
1391 Ga0501042_0226350
1392 Ga0501046_0037622
1393 Ga0501047_0696580
1394 Ga0501048_0009748
1395 Ga0501048_0106029
1396 Ga0501048_0494487
1397 Ga0501067_0033157
1398 Ga0501067_0135306
1399 Ga0501068_0050184
1400 Ga0501068_0482258
1401 Ga0501070_0092995
1402 Ga0501070_0475620
1403 Ga0501070_0549506
1404 Ga0501070_0612362
1405 Ga0501071_0110605
1406 Ga0501071_0186078
1407 Ga0501071_0337185
1408 Ga0501072_0013405
1409 Ga0501072_0067366
1410 Ga0501072_0213339
1411 Ga0501072_0341845
1412 Ga0501073_0168962
1413 Ga0501074_0005969
1414 Ga0501074_0079505
1415 Ga0501074_0329973
1416 Ga0501075_0034824
1417 Ga0501075_0133769
1418 Ga0501076_0266926
1419 Ga0501076_0567769
1420 Ga0501077_0002560
1421 Ga0501077_0114092
1422 Ga0501077_0190601
1423 Ga0501077_0228887
1424 Ga0501079_0005337
1425 Ga0501079_0231748
1426 Ga0501079_0405666
1427 Ga0501080_0020690
1428 Ga0501080_0283997
1429 Ga0501080_0451336
1430 Ga0501081_0068227
1431 Ga0501081_0333290
1432 Ga0501081_0376848
1433 Ga0501081_0983126
1434 Ga0501035_0578222
1435 Ga0501045_0064045
1436 Ga0501045_0140987
1437 Ga0501045_0466266
1438 nmdc:mga00v17_32429_c1
1439 nmdc:mga0yw44_30198_c1
1440 nmdc:mga0yw44_312024_c1
1441 nmdc:mga06z11_119945_c1
1442 nmdc:mga04h51_212855_c1
1443 nmdc:mga05p37_101310_c1
1444 nmdc:mga05p37_283886_c1
1445 nmdc:mga05p37_497905_c1
1446 nmdc:mga05p37_799877_c1
1447 nmdc:mga09592_37795_c1
1448 nmdc:mga09592_45778_c1
1449 nmdc:mga0qj67_126988_c1
1450 nmdc:mga0qj67_29212_c1
1451 nmdc:mga06r32_1383787_c1
1452 nmdc:mga06r32_500865_c1
1453 nmdc:mga06r32_5768_c1
1454 nmdc:mga06r32_59188_c1
1455 nmdc:mga06r32_74573_c1
1456 nmdc:mga06r32_893472_c1
1457 nmdc:mga08y16_170775_c1
1458 nmdc:mga08y16_305569_c1
1459 nmdc:mga08y16_325536_c1
1460 nmdc:mga08y16_58946_c1
1461 nmdc:mga08y16_6329_c1
1462 nmdc:mga08y16_698861_c1
1463 nmdc:mga08y16_711878_c1
1464 nmdc:mga0n895_1775470_c1
1465 nmdc:mga0n895_42287_c1
1466 nmdc:mga0n895_9300_c1
1467 nmdc:mga0rr50_163598_c1
1468 nmdc:mga0rr50_247299_c1
1469 nmdc:mga08x19_207332_c1
1470 nmdc:mga08x19_224992_c1
1471 nmdc:mga08x19_53088_c1
1472 nmdc:mga0a205_1204365_c1
1473 nmdc:mga0a205_7015_c1
1474 nmdc:mga0a205_91657_c1
1475 nmdc:mga0a205_976526_c1
1476 Ga0495601_0018521
1477 Ga0495655_0086296
1478 Ga0495595_0025743
1479 Ga0495595_0161539
1480 Ga0495619_0013544
1481 Ga0500616_0000221
1482 Ga0501084_0004889
1483 Ga0501084_0182373
1484 Ga0501084_0618795
1485 Ga0501082_0029608
1486 Ga0501082_0186486
1487 Ga0466962_0008688
1488 Ga0466962_0287455
1489 Ga0530510_0110230
1490 Ga0530510_0206660
1491 Ga0530510_0730274
1492 2587864321
1493 2643875908
1494 2644382963
1495 2644538022
1496 2644610267
1497 2738663811
1498 2739142946
1499 2852678008
1500 2870628054
1501 2895663577
1502 2939602317

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

26

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uno-assembly1.cif.gz_X mycobacterium tuberculosis ferritin homolog, bfrb 0.9846 3 173
3oj5-assembly1.cif.gz_A mycobacterium tuberculosis ferritin homolog, bfrb 0.9831 3 158
3uno-assembly1.cif.gz_F mycobacterium tuberculosis ferritin homolog, bfrb 0.983 3 173
3uno-assembly1.cif.gz_B mycobacterium tuberculosis ferritin homolog, bfrb 0.983 3 173
3uno-assembly1.cif.gz_D mycobacterium tuberculosis ferritin homolog, bfrb 0.9823 3 173
ID Description Score Start End Superfamily
3qd8H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.989 6 173 1.20.1260.10
3oj5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9831 3 158 1.20.1260.10
5gouG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9758 3 121 1.20.1260.10
3unoN00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9748 3 173 1.20.1260.10
5gouO00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9729 3 121 1.20.1260.10

Map