F479120
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 751 | 356 | 1502 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300031728|Ga0316578_10062742|Ga0316578_100627421 |
| Length | 196 |
| Sequence | MYGAVPASRPPAAPPYRRGMTEGTFLRLLNEQIGHEFHASQQYIAIAVYFDREALPQLAAHFYAQSVEERNHAMMLVQYLLDADARIEIPGTGEVVTSFDAYSEPVALALAQERQVTEQIKALVRAAREEGDLLGEQFLQWFLKEQVEEVATVSTLLRVMEHAGDTILQVEEYLSRQPGGAGGPDPTAPSAAGGAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 2 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 3 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 203 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 206 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 207 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 208 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 346 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 347 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 348 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 349 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 350 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 351 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 352 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 353 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 354 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 355 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 356 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.87 |
| Metatranscriptomes | 0.67 |
| Isolates | 1.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.86 |
| Nodule | 0 |
| Rhizoplane | 11.85 |
| Rhizosphere | 82.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316578_10062742 | 3300031728 | Bacteria | 2191 |
| 2 | Ga0006562J51391_1054243 | 3300003578 | Bacteria | 1660 |
| 3 | Ga0006562J51391_1054246 | 3300003578 | Bacteria | 740 |
| 4 | Ga0055540_1000038 | 3300003792 | Bacteria | 161988 |
| 5 | Ga0065714_10065949 | 3300005288 | Bacteria | 7995 |
| 6 | Ga0065714_10234720 | 3300005288 | Bacteria | 799 |
| 7 | Ga0065704_10007708 | 3300005289 | Bacteria | 3447 |
| 8 | Ga0065712_10130057 | 3300005290 | Bacteria | 1561 |
| 9 | Ga0070658_11599062 | 3300005327 | Bacteria | 565 |
| 10 | Ga0070676_10109091 | 3300005328 | Bacteria | 1721 |
| 11 | Ga0070676_10256096 | 3300005328 | Bacteria | 1170 |
| 12 | Ga0070683_100033279 | 3300005329 | Bacteria | 4700 |
| 13 | Ga0070683_100062006 | 3300005329 | Bacteria | 3476 |
| 14 | Ga0070683_100265550 | 3300005329 | Bacteria | 1633 |
| 15 | Ga0070683_100381292 | 3300005329 | Bacteria | 1343 |
| 16 | Ga0068869_100647728 | 3300005334 | Bacteria | 896 |
| 17 | Ga0070666_10125833 | 3300005335 | Bacteria | 1779 |
| 18 | Ga0070680_100002207 | 3300005336 | Bacteria | 14358 |
| 19 | Ga0070682_100056553 | 3300005337 | Bacteria | 2468 |
| 20 | Ga0070682_100384583 | 3300005337 | Bacteria | 1057 |
| 21 | Ga0068868_100003823 | 3300005338 | Bacteria | 10512 |
| 22 | Ga0068868_100342482 | 3300005338 | Bacteria | 1279 |
| 23 | Ga0070660_100017052 | 3300005339 | Bacteria | 5288 |
| 24 | Ga0070660_100391653 | 3300005339 | Bacteria | 1148 |
| 25 | Ga0070660_101102758 | 3300005339 | Bacteria | 672 |
| 26 | Ga0070689_100386850 | 3300005340 | Bacteria | 1180 |
| 27 | Ga0070691_10008781 | 3300005341 | Bacteria | 4627 |
| 28 | Ga0070661_100334778 | 3300005344 | Bacteria | 1185 |
| 29 | Ga0070661_100654719 | 3300005344 | Bacteria | 853 |
| 30 | Ga0070661_100662963 | 3300005344 | Bacteria | 848 |
| 31 | Ga0070692_10251702 | 3300005345 | Bacteria | 1058 |
| 32 | Ga0070669_100726443 | 3300005353 | Unclassified | 840 |
| 33 | Ga0070675_100058936 | 3300005354 | Bacteria | 3167 |
| 34 | Ga0070675_101388296 | 3300005354 | Unclassified | 648 |
| 35 | Ga0070671_100114816 | 3300005355 | Unclassified | 2263 |
| 36 | Ga0070674_100030552 | 3300005356 | Bacteria | 3562 |
| 37 | Ga0070674_100533732 | 3300005356 | Bacteria | 982 |
| 38 | Ga0070674_100541958 | 3300005356 | Bacteria | 975 |
| 39 | Ga0070673_100044855 | 3300005364 | Unclassified | 3425 |
| 40 | Ga0070688_100053182 | 3300005365 | Bacteria | 2532 |
| 41 | Ga0070659_100047566 | 3300005366 | Bacteria | 3365 |
| 42 | Ga0070659_100165797 | 3300005366 | Bacteria | 1808 |
| 43 | Ga0070667_100000883 | 3300005367 | Bacteria | 27691 |
| 44 | Ga0070667_101105116 | 3300005367 | Bacteria | 741 |
| 45 | Ga0070709_10617895 | 3300005434 | Unclassified | 836 |
| 46 | Ga0070709_10678365 | 3300005434 | Bacteria | 800 |
| 47 | Ga0070714_100131092 | 3300005435 | Bacteria | 2240 |
| 48 | Ga0070714_100133945 | 3300005435 | Bacteria | 2217 |
| 49 | Ga0070714_100274598 | 3300005435 | Bacteria | 1564 |
| 50 | Ga0070714_100364198 | 3300005435 | Bacteria | 1360 |
| 51 | Ga0070713_100060640 | 3300005436 | Bacteria | 3163 |
| 52 | Ga0070713_100146818 | 3300005436 | Bacteria | 2094 |
| 53 | Ga0070713_100341876 | 3300005436 | Bacteria | 1387 |
| 54 | Ga0070713_100611911 | 3300005436 | Bacteria | 1035 |
| 55 | Ga0070713_101163817 | 3300005436 | Bacteria | 746 |
| 56 | Ga0070710_10007389 | 3300005437 | Bacteria | 5319 |
| 57 | Ga0070710_10832246 | 3300005437 | Bacteria | 661 |
| 58 | Ga0070701_10237287 | 3300005438 | Bacteria | 1095 |
| 59 | Ga0070701_10448048 | 3300005438 | Bacteria | 828 |
| 60 | Ga0070711_100006496 | 3300005439 | Bacteria | 7051 |
| 61 | Ga0070711_100107424 | 3300005439 | Bacteria | 2042 |
| 62 | Ga0070711_100450918 | 3300005439 | Bacteria | 1053 |
| 63 | Ga0070711_101183448 | 3300005439 | Bacteria | 661 |
| 64 | Ga0070705_100075815 | 3300005440 | Bacteria | 2049 |
| 65 | Ga0070700_100015971 | 3300005441 | Bacteria | 4268 |
| 66 | Ga0070700_100206315 | 3300005441 | Bacteria | 1384 |
| 67 | Ga0070708_100817478 | 3300005445 | Bacteria | 876 |
| 68 | Ga0070663_100166980 | 3300005455 | Bacteria | 1698 |
| 69 | Ga0070678_100057594 | 3300005456 | Bacteria | 2848 |
| 70 | Ga0070678_100340357 | 3300005456 | Bacteria | 1287 |
| 71 | Ga0070678_100357919 | 3300005456 | Bacteria | 1257 |
| 72 | Ga0070681_10006968 | 3300005458 | Bacteria | 10999 |
| 73 | Ga0070681_10502451 | 3300005458 | Bacteria | 1126 |
| 74 | Ga0070685_10370658 | 3300005466 | Bacteria | 984 |
| 75 | Ga0070685_10493610 | 3300005466 | Bacteria | 865 |
| 76 | Ga0070706_100267419 | 3300005467 | Bacteria | 1596 |
| 77 | Ga0070707_100104458 | 3300005468 | Bacteria | 2746 |
| 78 | Ga0070707_101900625 | 3300005468 | Bacteria | 563 |
| 79 | Ga0070698_100002676 | 3300005471 | Bacteria | 19643 |
| 80 | Ga0070698_100780913 | 3300005471 | Bacteria | 899 |
| 81 | Ga0070699_100046993 | 3300005518 | Bacteria | 3734 |
| 82 | Ga0070679_100007549 | 3300005530 | Bacteria | 10170 |
| 83 | Ga0070679_100199310 | 3300005530 | Bacteria | 1968 |
| 84 | Ga0070684_100003771 | 3300005535 | Bacteria | 11441 |
| 85 | Ga0070684_100010570 | 3300005535 | Bacteria | 7317 |
| 86 | Ga0070684_100152849 | 3300005535 | Bacteria | 2092 |
| 87 | Ga0070684_100291957 | 3300005535 | Bacteria | 1495 |
| 88 | Ga0068853_100005415 | 3300005539 | Bacteria | 10002 |
| 89 | Ga0070672_100781928 | 3300005543 | Unclassified | 839 |
| 90 | Ga0070695_101046416 | 3300005545 | Bacteria | 666 |
| 91 | Ga0070665_100685343 | 3300005548 | Bacteria | 1038 |
| 92 | Ga0070665_100896553 | 3300005548 | Bacteria | 899 |
| 93 | Ga0070665_101387822 | 3300005548 | Unclassified | 712 |
| 94 | Ga0070704_100203784 | 3300005549 | Bacteria | 1599 |
| 95 | Ga0070704_101096837 | 3300005549 | Bacteria | 723 |
| 96 | Ga0068855_100435415 | 3300005563 | Bacteria | 1433 |
| 97 | Ga0070664_100004514 | 3300005564 | Bacteria | 11165 |
| 98 | Ga0070664_100160556 | 3300005564 | Bacteria | 1988 |
| 99 | Ga0070664_100283633 | 3300005564 | Bacteria | 1494 |
| 100 | Ga0068857_100002367 | 3300005577 | Bacteria | 15368 |
| 101 | Ga0068857_100292232 | 3300005577 | Bacteria | 1501 |
| 102 | Ga0068857_100505297 | 3300005577 | Bacteria | 1135 |
| 103 | Ga0068857_101334084 | 3300005577 | Bacteria | 697 |
| 104 | Ga0068854_100142996 | 3300005578 | Bacteria | 1838 |
| 105 | Ga0068856_100026064 | 3300005614 | Bacteria | 5701 |
| 106 | Ga0068856_100027660 | 3300005614 | Bacteria | 5532 |
| 107 | Ga0068856_100149181 | 3300005614 | Bacteria | 2346 |
| 108 | Ga0068856_100191186 | 3300005614 | Bacteria | 2061 |
| 109 | Ga0068856_101316317 | 3300005614 | Bacteria | 738 |
| 110 | Ga0070702_100045035 | 3300005615 | Bacteria | 2494 |
| 111 | Ga0070702_100136076 | 3300005615 | Bacteria | 1559 |
| 112 | Ga0068852_100003496 | 3300005616 | Bacteria | 10984 |
| 113 | Ga0068852_100743500 | 3300005616 | Bacteria | 993 |
| 114 | Ga0068859_100212846 | 3300005617 | Bacteria | 2019 |
| 115 | Ga0068864_101522730 | 3300005618 | Bacteria | 672 |
| 116 | Ga0068866_10049728 | 3300005718 | Bacteria | 2126 |
| 117 | Ga0068861_100345193 | 3300005719 | Bacteria | 1304 |
| 118 | Ga0068861_101185277 | 3300005719 | Bacteria | 738 |
| 119 | Ga0068870_10087597 | 3300005840 | Bacteria | 1734 |
| 120 | Ga0068870_10163395 | 3300005840 | Bacteria | 1323 |
| 121 | Ga0068863_100840058 | 3300005841 | Bacteria | 917 |
| 122 | Ga0068858_100490608 | 3300005842 | Bacteria | 1186 |
| 123 | Ga0068860_101509749 | 3300005843 | Bacteria | 694 |
| 124 | Ga0068862_100186950 | 3300005844 | Bacteria | 1862 |
| 125 | Ga0081455_10086432 | 3300005937 | Bacteria | 2554 |
| 126 | Ga0081455_10088231 | 3300005937 | Bacteria | 2521 |
| 127 | Ga0081455_10161312 | 3300005937 | Bacteria | 1718 |
| 128 | Ga0081538_10009498 | 3300005981 | Bacteria | 8108 |
| 129 | Ga0081538_10071445 | 3300005981 | Bacteria | 1909 |
| 130 | Ga0081539_10162709 | 3300005985 | Bacteria | 1062 |
| 131 | Ga0070717_10014628 | 3300006028 | Bacteria | 6041 |
| 132 | Ga0070717_10047508 | 3300006028 | Bacteria | 3517 |
| 133 | Ga0070717_10051330 | 3300006028 | Bacteria | 3394 |
| 134 | Ga0070717_10065295 | 3300006028 | Bacteria | 3025 |
| 135 | Ga0070717_10139701 | 3300006028 | Bacteria | 2089 |
| 136 | Ga0070717_11029303 | 3300006028 | Unclassified | 750 |
| 137 | Ga0070717_11323312 | 3300006028 | Bacteria | 655 |
| 138 | Ga0075365_10147340 | 3300006038 | Bacteria | 1636 |
| 139 | Ga0075365_10407820 | 3300006038 | Bacteria | 959 |
| 140 | Ga0075368_10246235 | 3300006042 | Bacteria | 763 |
| 141 | Ga0075364_10274572 | 3300006051 | Bacteria | 1146 |
| 142 | Ga0075432_10098563 | 3300006058 | Bacteria | 1078 |
| 143 | Ga0075432_10243862 | 3300006058 | Bacteria | 727 |
| 144 | Ga0070715_10205578 | 3300006163 | Unclassified | 1003 |
| 145 | Ga0070716_100091454 | 3300006173 | Bacteria | 1842 |
| 146 | Ga0070712_100105038 | 3300006175 | Bacteria | 2097 |
| 147 | Ga0070712_100116652 | 3300006175 | Bacteria | 2003 |
| 148 | Ga0075362_10032974 | 3300006177 | Bacteria | 2251 |
| 149 | Ga0097621_100183932 | 3300006237 | Bacteria | 1807 |
| 150 | Ga0075428_100031162 | 3300006844 | Bacteria | 5897 |
| 151 | Ga0075428_100057799 | 3300006844 | Bacteria | 4246 |
| 152 | Ga0075428_100217886 | 3300006844 | Bacteria | 2061 |
| 153 | Ga0075428_100786772 | 3300006844 | Bacteria | 1011 |
| 154 | Ga0075430_100016244 | 3300006846 | Bacteria | 6339 |
| 155 | Ga0075430_100018217 | 3300006846 | Bacteria | 5976 |
| 156 | Ga0075431_100010542 | 3300006847 | Bacteria | 9291 |
| 157 | Ga0075431_100322892 | 3300006847 | Bacteria | 1556 |
| 158 | Ga0075431_100759177 | 3300006847 | Bacteria | 945 |
| 159 | Ga0075431_101144498 | 3300006847 | Bacteria | 742 |
| 160 | Ga0075433_10004829 | 3300006852 | Bacteria | 10532 |
| 161 | Ga0075434_100007632 | 3300006871 | Bacteria | 10010 |
| 162 | Ga0075434_100021751 | 3300006871 | Bacteria | 6238 |
| 163 | Ga0075434_100385796 | 3300006871 | Bacteria | 1422 |
| 164 | Ga0075429_100018897 | 3300006880 | Bacteria | 5970 |
| 165 | Ga0075429_100283630 | 3300006880 | Bacteria | 1450 |
| 166 | Ga0068865_100199110 | 3300006881 | Bacteria | 1554 |
| 167 | Ga0068865_100399829 | 3300006881 | Bacteria | 1125 |
| 168 | Ga0075436_100027372 | 3300006914 | Bacteria | 3924 |
| 169 | Ga0075436_100086490 | 3300006914 | Unclassified | 2177 |
| 170 | Ga0075436_100108710 | 3300006914 | Bacteria | 1934 |
| 171 | Ga0075436_100127301 | 3300006914 | Unclassified | 1785 |
| 172 | Ga0097620_100212841 | 3300006931 | Bacteria | 2019 |
| 173 | Ga0075435_100193418 | 3300007076 | Bacteria | 1722 |
| 174 | Ga0075435_100309782 | 3300007076 | Bacteria | 1351 |
| 175 | Ga0105240_10015177 | 3300009093 | Bacteria | 10485 |
| 176 | Ga0105240_11636768 | 3300009093 | Unclassified | 673 |
| 177 | Ga0111539_10000579 | 3300009094 | Bacteria | 47092 |
| 178 | Ga0111539_10297779 | 3300009094 | Bacteria | 1877 |
| 179 | Ga0111539_10879192 | 3300009094 | Bacteria | 1042 |
| 180 | Ga0105245_10010437 | 3300009098 | Bacteria | 8087 |
| 181 | Ga0105245_10044550 | 3300009098 | Bacteria | 3960 |
| 182 | Ga0105245_10068096 | 3300009098 | Bacteria | 3225 |
| 183 | Ga0105245_10264072 | 3300009098 | Bacteria | 1676 |
| 184 | Ga0105245_11449271 | 3300009098 | Bacteria | 737 |
| 185 | Ga0105247_10248743 | 3300009101 | Bacteria | 1214 |
| 186 | Ga0105247_10434336 | 3300009101 | Bacteria | 943 |
| 187 | Ga0105247_10805117 | 3300009101 | Bacteria | 717 |
| 188 | Ga0114129_10029595 | 3300009147 | Bacteria | 7755 |
| 189 | Ga0114129_10133874 | 3300009147 | Bacteria | 3403 |
| 190 | Ga0114129_10387452 | 3300009147 | Bacteria | 1844 |
| 191 | Ga0114129_10455948 | 3300009147 | Bacteria | 1676 |
| 192 | Ga0114129_10561943 | 3300009147 | Bacteria | 1482 |
| 193 | Ga0105243_10040988 | 3300009148 | Bacteria | 3620 |
| 194 | Ga0105243_10733966 | 3300009148 | Bacteria | 966 |
| 195 | Ga0105242_10195029 | 3300009176 | Bacteria | 1795 |
| 196 | Ga0105242_10344022 | 3300009176 | Bacteria | 1375 |
| 197 | Ga0105248_10959609 | 3300009177 | Bacteria | 966 |
| 198 | Ga0105237_10005032 | 3300009545 | Bacteria | 15049 |
| 199 | Ga0105237_10018125 | 3300009545 | Bacteria | 7290 |
| 200 | Ga0105237_10188049 | 3300009545 | Bacteria | 2065 |
| 201 | Ga0105237_10570681 | 3300009545 | Bacteria | 1138 |
| 202 | Ga0105238_10091818 | 3300009551 | Bacteria | 3023 |
| 203 | Ga0105249_10126322 | 3300009553 | Bacteria | 2436 |
| 204 | Ga0105239_10050146 | 3300010375 | Bacteria | 4579 |
| 205 | Ga0105239_10051659 | 3300010375 | Bacteria | 4506 |
| 206 | Ga0105239_10092372 | 3300010375 | Bacteria | 3341 |
| 207 | Ga0105239_10206195 | 3300010375 | Bacteria | 2203 |
| 208 | Ga0105239_10462035 | 3300010375 | Bacteria | 1441 |
| 209 | Ga0105239_10501852 | 3300010375 | Bacteria | 1379 |
| 210 | Ga0105246_10026821 | 3300011119 | Bacteria | 3770 |
| 211 | Ga0105246_11004641 | 3300011119 | Bacteria | 755 |
| 212 | Ga0105246_11228002 | 3300011119 | Bacteria | 691 |
| 213 | Ga0105246_11373364 | 3300011119 | Bacteria | 658 |
| 214 | Ga0157370_10003299 | 3300013104 | Bacteria | 19024 |
| 215 | Ga0157370_10403331 | 3300013104 | Bacteria | 1258 |
| 216 | Ga0157369_10511837 | 3300013105 | Bacteria | 1242 |
| 217 | Ga0157374_10059513 | 3300013296 | Bacteria | 3572 |
| 218 | Ga0157374_10107192 | 3300013296 | Unclassified | 2685 |
| 219 | Ga0157374_10224869 | 3300013296 | Bacteria | 1843 |
| 220 | Ga0157374_10226036 | 3300013296 | Bacteria | 1838 |
| 221 | Ga0157374_10405275 | 3300013296 | Bacteria | 1361 |
| 222 | Ga0157374_10534566 | 3300013296 | Bacteria | 1179 |
| 223 | Ga0157378_10246139 | 3300013297 | Bacteria | 1710 |
| 224 | Ga0157378_11000781 | 3300013297 | Bacteria | 870 |
| 225 | Ga0163162_10695565 | 3300013306 | Bacteria | 1139 |
| 226 | Ga0163162_10896747 | 3300013306 | Bacteria | 1000 |
| 227 | Ga0163162_10905766 | 3300013306 | Bacteria | 995 |
| 228 | Ga0157372_10023566 | 3300013307 | Bacteria | 6675 |
| 229 | Ga0157372_10023707 | 3300013307 | Bacteria | 6656 |
| 230 | Ga0157372_10544334 | 3300013307 | Bacteria | 1353 |
| 231 | Ga0157372_10576489 | 3300013307 | Bacteria | 1311 |
| 232 | Ga0157372_11463414 | 3300013307 | Bacteria | 787 |
| 233 | Ga0157375_10135064 | 3300013308 | Bacteria | 2589 |
| 234 | Ga0157375_10369649 | 3300013308 | Bacteria | 1600 |
| 235 | Ga0157375_11364322 | 3300013308 | Bacteria | 834 |
| 236 | Ga0163163_10310972 | 3300014325 | Bacteria | 1628 |
| 237 | Ga0163163_10548220 | 3300014325 | Bacteria | 1219 |
| 238 | Ga0163163_11538417 | 3300014325 | Bacteria | 726 |
| 239 | Ga0157380_10656510 | 3300014326 | Bacteria | 1047 |
| 240 | Ga0157380_10703482 | 3300014326 | Bacteria | 1016 |
| 241 | Ga0182008_10144438 | 3300014497 | Bacteria | 1192 |
| 242 | Ga0157377_10113583 | 3300014745 | Bacteria | 1631 |
| 243 | Ga0157377_10156337 | 3300014745 | Bacteria | 1414 |
| 244 | Ga0157376_10312288 | 3300014969 | Bacteria | 1492 |
| 245 | Ga0157376_10424341 | 3300014969 | Bacteria | 1291 |
| 246 | Ga0157376_10457382 | 3300014969 | Bacteria | 1246 |
| 247 | Ga0157376_11187525 | 3300014969 | Bacteria | 791 |
| 248 | Ga0182007_10233051 | 3300015262 | Bacteria | 654 |
| 249 | Ga0163161_10597071 | 3300017792 | Unclassified | 910 |
| 250 | Ga0163161_11385325 | 3300017792 | Bacteria | 614 |
| 251 | Ga0206354_11138832 | 3300020081 | Bacteria | 1556 |
| 252 | Ga0206353_11108710 | 3300020082 | Bacteria | 4256 |
| 253 | Ga0213876_10228740 | 3300021384 | Bacteria | 988 |
| 254 | Ga0213876_10281937 | 3300021384 | Bacteria | 883 |
| 255 | Ga0213875_10493710 | 3300021388 | Bacteria | 588 |
| 256 | Ga0224712_10342064 | 3300022467 | Bacteria | 706 |
| 257 | Ga0209051_1000014 | 3300025303 | Bacteria | 552732 |
| 258 | Ga0207692_10002457 | 3300025898 | Bacteria | 7113 |
| 259 | Ga0207642_10111283 | 3300025899 | Bacteria | 1395 |
| 260 | Ga0207688_10002443 | 3300025901 | Bacteria | 10010 |
| 261 | Ga0207680_10199019 | 3300025903 | Bacteria | 1364 |
| 262 | Ga0207647_10206341 | 3300025904 | Bacteria | 1136 |
| 263 | Ga0207685_10062440 | 3300025905 | Bacteria | 1480 |
| 264 | Ga0207699_10007314 | 3300025906 | Bacteria | 5394 |
| 265 | Ga0207645_10155323 | 3300025907 | Bacteria | 1495 |
| 266 | Ga0207645_10304713 | 3300025907 | Bacteria | 1061 |
| 267 | Ga0207643_10020603 | 3300025908 | Bacteria | 3620 |
| 268 | Ga0207707_10002713 | 3300025912 | Bacteria | 15814 |
| 269 | Ga0207707_10007903 | 3300025912 | Bacteria | 9251 |
| 270 | Ga0207695_10636912 | 3300025913 | Bacteria | 947 |
| 271 | Ga0207671_10005149 | 3300025914 | Bacteria | 12170 |
| 272 | Ga0207671_10023865 | 3300025914 | Bacteria | 4607 |
| 273 | Ga0207671_10620142 | 3300025914 | Bacteria | 862 |
| 274 | Ga0207693_10011035 | 3300025915 | Bacteria | 7321 |
| 275 | Ga0207693_10028083 | 3300025915 | Bacteria | 4446 |
| 276 | Ga0207693_10166997 | 3300025915 | Unclassified | 1733 |
| 277 | Ga0207663_10066194 | 3300025916 | Bacteria | 2312 |
| 278 | Ga0207663_10426542 | 3300025916 | Bacteria | 1019 |
| 279 | Ga0207663_10626745 | 3300025916 | Unclassified | 847 |
| 280 | Ga0207657_10011545 | 3300025919 | Bacteria | 8768 |
| 281 | Ga0207657_10413669 | 3300025919 | Bacteria | 1060 |
| 282 | Ga0207649_10286670 | 3300025920 | Bacteria | 1199 |
| 283 | Ga0207649_10395133 | 3300025920 | Bacteria | 1033 |
| 284 | Ga0207652_10003071 | 3300025921 | Bacteria | 13937 |
| 285 | Ga0207652_10004552 | 3300025921 | Bacteria | 11253 |
| 286 | Ga0207646_10348879 | 3300025922 | Bacteria | 1337 |
| 287 | Ga0207646_11450087 | 3300025922 | Bacteria | 596 |
| 288 | Ga0207650_10789648 | 3300025925 | Unclassified | 804 |
| 289 | Ga0207659_10024835 | 3300025926 | Bacteria | 4022 |
| 290 | Ga0207687_10019472 | 3300025927 | Bacteria | 4496 |
| 291 | Ga0207687_10024586 | 3300025927 | Bacteria | 4026 |
| 292 | Ga0207687_10059992 | 3300025927 | Bacteria | 2681 |
| 293 | Ga0207700_10014269 | 3300025928 | Bacteria | 5199 |
| 294 | Ga0207700_10070893 | 3300025928 | Bacteria | 2681 |
| 295 | Ga0207700_10144276 | 3300025928 | Bacteria | 1960 |
| 296 | Ga0207664_10117439 | 3300025929 | Bacteria | 2221 |
| 297 | Ga0207664_10237804 | 3300025929 | Bacteria | 1585 |
| 298 | Ga0207664_10385604 | 3300025929 | Bacteria | 1244 |
| 299 | Ga0207644_11323840 | 3300025931 | Unclassified | 605 |
| 300 | Ga0207690_10020041 | 3300025932 | Bacteria | 4126 |
| 301 | Ga0207690_10028430 | 3300025932 | Bacteria | 3544 |
| 302 | Ga0207686_10201879 | 3300025934 | Bacteria | 1424 |
| 303 | Ga0207686_10291045 | 3300025934 | Bacteria | 1209 |
| 304 | Ga0207686_11137468 | 3300025934 | Bacteria | 637 |
| 305 | Ga0207709_10082690 | 3300025935 | Bacteria | 2074 |
| 306 | Ga0207709_10097542 | 3300025935 | Bacteria | 1936 |
| 307 | Ga0207709_10121986 | 3300025935 | Bacteria | 1761 |
| 308 | Ga0207709_10236082 | 3300025935 | Bacteria | 1327 |
| 309 | Ga0207669_10018476 | 3300025937 | Bacteria | 3605 |
| 310 | Ga0207669_10031063 | 3300025937 | Bacteria | 2979 |
| 311 | Ga0207704_10046032 | 3300025938 | Bacteria | 2597 |
| 312 | Ga0207665_10086832 | 3300025939 | Bacteria | 2161 |
| 313 | Ga0207665_10128177 | 3300025939 | Bacteria | 1799 |
| 314 | Ga0207665_10248265 | 3300025939 | Bacteria | 1314 |
| 315 | Ga0207665_10906544 | 3300025939 | Bacteria | 699 |
| 316 | Ga0207691_10304597 | 3300025940 | Unclassified | 1368 |
| 317 | Ga0207711_10541197 | 3300025941 | Bacteria | 1086 |
| 318 | Ga0207689_10503830 | 3300025942 | Bacteria | 1014 |
| 319 | Ga0207689_10689799 | 3300025942 | Bacteria | 861 |
| 320 | Ga0207661_10004175 | 3300025944 | Bacteria | 10108 |
| 321 | Ga0207661_10020529 | 3300025944 | Bacteria | 4939 |
| 322 | Ga0207661_10031627 | 3300025944 | Bacteria | 4091 |
| 323 | Ga0207661_10237714 | 3300025944 | Bacteria | 1615 |
| 324 | Ga0207661_10277388 | 3300025944 | Bacteria | 1497 |
| 325 | Ga0207679_10100374 | 3300025945 | Bacteria | 2262 |
| 326 | Ga0207667_10290950 | 3300025949 | Bacteria | 1669 |
| 327 | Ga0207651_10033909 | 3300025960 | Bacteria | 3299 |
| 328 | Ga0207712_10632965 | 3300025961 | Bacteria | 928 |
| 329 | Ga0207640_10122247 | 3300025981 | Bacteria | 1867 |
| 330 | Ga0207658_10001419 | 3300025986 | Bacteria | 18686 |
| 331 | Ga0207658_10298180 | 3300025986 | Bacteria | 1388 |
| 332 | Ga0207658_10928280 | 3300025986 | Unclassified | 793 |
| 333 | Ga0207677_10078040 | 3300026023 | Bacteria | 2364 |
| 334 | Ga0207703_10235355 | 3300026035 | Bacteria | 1644 |
| 335 | Ga0207703_10882051 | 3300026035 | Bacteria | 856 |
| 336 | Ga0207678_10194163 | 3300026067 | Bacteria | 1735 |
| 337 | Ga0207678_11462680 | 3300026067 | Bacteria | 603 |
| 338 | Ga0207708_10000817 | 3300026075 | Bacteria | 23458 |
| 339 | Ga0207708_10204815 | 3300026075 | Bacteria | 1575 |
| 340 | Ga0207708_10695806 | 3300026075 | Bacteria | 868 |
| 341 | Ga0207702_10037300 | 3300026078 | Bacteria | 4068 |
| 342 | Ga0207702_10100556 | 3300026078 | Bacteria | 2551 |
| 343 | Ga0207702_10101609 | 3300026078 | Bacteria | 2539 |
| 344 | Ga0207702_10168254 | 3300026078 | Bacteria | 2007 |
| 345 | Ga0207641_10857933 | 3300026088 | Bacteria | 900 |
| 346 | Ga0207674_10002510 | 3300026116 | Bacteria | 23138 |
| 347 | Ga0207674_10050781 | 3300026116 | Bacteria | 4235 |
| 348 | Ga0207674_10108328 | 3300026116 | Bacteria | 2755 |
| 349 | Ga0207674_10308367 | 3300026116 | Bacteria | 1532 |
| 350 | Ga0207674_10339629 | 3300026116 | Bacteria | 1452 |
| 351 | Ga0207683_10187283 | 3300026121 | Bacteria | 1878 |
| 352 | Ga0209813_10184736 | 3300027866 | Bacteria | 764 |
| 353 | Ga0207428_10001781 | 3300027907 | Bacteria | 22060 |
| 354 | Ga0207428_10024017 | 3300027907 | Bacteria | 5119 |
| 355 | Ga0207428_10149519 | 3300027907 | Bacteria | 1778 |
| 356 | Ga0207428_10215890 | 3300027907 | Bacteria | 1440 |
| 357 | Ga0207428_10755857 | 3300027907 | Bacteria | 693 |
| 358 | Ga0268266_10561336 | 3300028379 | Bacteria | 1094 |
| 359 | Ga0268265_10159914 | 3300028380 | Bacteria | 1912 |
| 360 | Ga0265326_10017825 | 3300028558 | Bacteria | 2046 |
| 361 | Ga0265330_10013916 | 3300031235 | Bacteria | 3741 |
| 362 | Ga0265329_10025331 | 3300031242 | Bacteria | 1964 |
| 363 | Ga0265327_10000718 | 3300031251 | Bacteria | 52146 |
| 364 | Ga0307409_100371012 | 3300031995 | Bacteria | 1357 |
| 365 | Ga0373926_0020534 | 3300035083 | Bacteria | 2283 |
| 366 | Ga0373926_0150040 | 3300035083 | Unclassified | 887 |
| 367 | Ga0373944_0006292 | 3300035089 | Bacteria | 3148 |
| 368 | Ga0373936_0115772 | 3300035113 | Bacteria | 1141 |
| 369 | Ga0373945_0010430 | 3300035116 | Bacteria | 3059 |
| 370 | Ga0373953_0180628 | 3300035117 | Bacteria | 910 |
| 371 | Ga0373956_0081971 | 3300035119 | Bacteria | 1481 |
| 372 | Ga0373956_0190671 | 3300035119 | Bacteria | 971 |
| 373 | Ga0373957_0108179 | 3300035120 | Bacteria | 1118 |
| 374 | Ga0373943_0189627 | 3300035170 | Bacteria | 1133 |
| 375 | Ga0373943_0659947 | 3300035170 | Unclassified | 618 |
| 376 | Ga0373924_0058138 | 3300035410 | Bacteria | 1614 |
| 377 | Ga0373924_0108353 | 3300035410 | Bacteria | 1199 |
| 378 | Ga0373935_0006653 | 3300035692 | Bacteria | 6906 |
| 379 | Ga0373935_0638683 | 3300035692 | Bacteria | 780 |
| 380 | Ga0373927_0024079 | 3300035695 | Bacteria | 3983 |
| 381 | Ga0373927_0040719 | 3300035695 | Bacteria | 3014 |
| 382 | Ga0373927_0561775 | 3300035695 | Unclassified | 754 |
| 383 | Ga0373933_0048689 | 3300035724 | Bacteria | 2524 |
| 384 | Ga0373947_0270239 | 3300035725 | Bacteria | 1128 |
| 385 | Ga0373937_0022525 | 3300036401 | Bacteria | 5665 |
| 386 | Ga0373937_0365130 | 3300036401 | Bacteria | 1368 |
| 387 | Ga0316584_0420406 | 3300036712 | Bacteria | 949 |
| 388 | Ga0373925_0018170 | 3300037068 | Bacteria | 5108 |
| 389 | Ga0373925_0079850 | 3300037068 | Bacteria | 2486 |
| 390 | Ga0373925_0124636 | 3300037068 | Bacteria | 2003 |
| 391 | Ga0395900_0154383 | 3300037418 | Unclassified | 2345 |
| 392 | Ga0395900_0260055 | 3300037418 | Bacteria | 1734 |
| 393 | Ga0395900_1146523 | 3300037418 | Bacteria | 694 |
| 394 | Ga0395898_0294558 | 3300037466 | Bacteria | 1548 |
| 395 | Ga0395898_0458128 | 3300037466 | Unclassified | 1214 |
| 396 | Ga0436364_0570019 | 3300037853 | Bacteria | 3240 |
| 397 | Ga0395901_0048526 | 3300038443 | Bacteria | 4409 |
| 398 | Ga0395901_0051131 | 3300038443 | Bacteria | 4295 |
| 399 | Ga0395901_0538726 | 3300038443 | Bacteria | 1184 |
| 400 | Ga0395901_0663503 | 3300038443 | Bacteria | 1045 |
| 401 | Ga0395901_0935345 | 3300038443 | Bacteria | 847 |
| 402 | Ga0436365_0689271 | 3300039437 | Bacteria | 11971 |
| 403 | Ga0436365_0913000 | 3300039437 | Bacteria | 1184 |
| 404 | Ga0436365_1231943 | 3300039437 | Bacteria | 4548 |
| 405 | Ga0436365_1278218 | 3300039437 | Bacteria | 4962 |
| 406 | Ga0436365_1803478 | 3300039437 | Bacteria | 999 |
| 407 | Ga0436360_0832316 | 3300039438 | Bacteria | 2681 |
| 408 | Ga0436361_0269551 | 3300039447 | Bacteria | 1370 |
| 409 | Ga0436363_1012909 | 3300039450 | Bacteria | 2898 |
| 410 | Ga0439456_035851 | 3300042013 | Bacteria | 1070 |
| 411 | Ga0450888_005589 | 3300042126 | Bacteria | 1346 |
| 412 | Ga0450907_039195 | 3300042146 | Bacteria | 811 |
| 413 | Ga0439460_0077777 | 3300042461 | Bacteria | 1037 |
| 414 | Ga0466969_0112385 | 3300044656 | Bacteria | 1274 |
| 415 | Ga0466969_0427518 | 3300044656 | Bacteria | 602 |
| 416 | Ga0466972_0096760 | 3300044658 | Bacteria | 1398 |
| 417 | Ga0466965_0047693 | 3300044683 | Bacteria | 2121 |
| 418 | Ga0466965_0123210 | 3300044683 | Bacteria | 1340 |
| 419 | Ga0466966_0250721 | 3300044684 | Bacteria | 1066 |
| 420 | Ga0466966_0441960 | 3300044684 | Bacteria | 782 |
| 421 | Ga0466961_0017997 | 3300044693 | Bacteria | 4543 |
| 422 | Ga0466963_0001875 | 3300044694 | Bacteria | 11468 |
| 423 | Ga0466963_0011902 | 3300044694 | Bacteria | 5312 |
| 424 | Ga0466963_0084607 | 3300044694 | Bacteria | 2152 |
| 425 | Ga0466963_0543725 | 3300044694 | Bacteria | 820 |
| 426 | Ga0466964_0328883 | 3300044706 | Bacteria | 779 |
| 427 | Ga0466971_0010163 | 3300044719 | Bacteria | 4109 |
| 428 | Ga0466970_0415559 | 3300044765 | Bacteria | 768 |
| 429 | Ga0466957_0237430 | 3300044842 | Bacteria | 1209 |
| 430 | Ga0466957_0588037 | 3300044842 | Bacteria | 778 |
| 431 | Ga0466959_0014031 | 3300045049 | Bacteria | 5816 |
| 432 | Ga0466959_0014247 | 3300045049 | Bacteria | 5771 |
| 433 | Ga0466959_0529644 | 3300045049 | Bacteria | 795 |
| 434 | Ga0451576_0132377 | 3300045051 | Bacteria | 2600 |
| 435 | Ga0466958_0092387 | 3300045836 | Bacteria | 1873 |
| 436 | Ga0466958_0266721 | 3300045836 | Bacteria | 1096 |
| 437 | Ga0466958_0304300 | 3300045836 | Bacteria | 1024 |
| 438 | Ga0466958_0313212 | 3300045836 | Bacteria | 1008 |
| 439 | Ga0466967_0127690 | 3300045976 | Bacteria | 2357 |
| 440 | Ga0466967_0326914 | 3300045976 | Bacteria | 1480 |
| 441 | Ga0466967_0400029 | 3300045976 | Bacteria | 1336 |
| 442 | Ga0466967_0436082 | 3300045976 | Bacteria | 1279 |
| 443 | Ga0466967_0644434 | 3300045976 | Bacteria | 1047 |
| 444 | Ga0466967_1033875 | 3300045976 | Bacteria | 818 |
| 445 | Ga0495592_0006144 | 3300046454 | Bacteria | 8934 |
| 446 | Ga0495592_0733657 | 3300046454 | Bacteria | 592 |
| 447 | Ga0495603_0086274 | 3300046455 | Bacteria | 1837 |
| 448 | Ga0495629_0033307 | 3300046459 | Bacteria | 3644 |
| 449 | Ga0495641_0036374 | 3300046461 | Bacteria | 2314 |
| 450 | Ga0495641_0037480 | 3300046461 | Bacteria | 2271 |
| 451 | Ga0495651_0024966 | 3300046462 | Bacteria | 4649 |
| 452 | Ga0495651_0248066 | 3300046462 | Bacteria | 1217 |
| 453 | Ga0495653_0056126 | 3300046463 | Bacteria | 3003 |
| 454 | Ga0495580_0027803 | 3300046472 | Bacteria | 4113 |
| 455 | Ga0495582_0003047 | 3300046473 | Bacteria | 9385 |
| 456 | Ga0495582_0195139 | 3300046473 | Bacteria | 1156 |
| 457 | Ga0495662_0004189 | 3300046476 | Bacteria | 7266 |
| 458 | Ga0495664_0053472 | 3300046477 | Bacteria | 2401 |
| 459 | Ga0495594_0003952 | 3300046499 | Bacteria | 7629 |
| 460 | Ga0495596_0093434 | 3300046500 | Bacteria | 1168 |
| 461 | Ga0495596_0304377 | 3300046500 | Bacteria | 620 |
| 462 | Ga0495608_0007049 | 3300046511 | Bacteria | 7956 |
| 463 | Ga0495608_0023009 | 3300046511 | Bacteria | 4272 |
| 464 | Ga0495618_0085482 | 3300046514 | Bacteria | 2016 |
| 465 | Ga0495630_0055891 | 3300046517 | Bacteria | 2957 |
| 466 | Ga0495630_0140645 | 3300046517 | Bacteria | 1835 |
| 467 | Ga0495630_0855094 | 3300046517 | Bacteria | 694 |
| 468 | Ga0495642_0277667 | 3300046528 | Bacteria | 733 |
| 469 | Ga0495652_0079206 | 3300046529 | Bacteria | 2717 |
| 470 | Ga0495652_0749479 | 3300046529 | Bacteria | 653 |
| 471 | Ga0495665_0004549 | 3300046531 | Bacteria | 7487 |
| 472 | Ga0495640_0028287 | 3300046533 | Bacteria | 4037 |
| 473 | Ga0495640_0093202 | 3300046533 | Bacteria | 1985 |
| 474 | Ga0495586_0071580 | 3300046535 | Bacteria | 1895 |
| 475 | Ga0495587_0006633 | 3300046536 | Bacteria | 7540 |
| 476 | Ga0495587_0245344 | 3300046536 | Bacteria | 1007 |
| 477 | Ga0495622_0068703 | 3300046557 | Bacteria | 1637 |
| 478 | Ga0495667_0001992 | 3300046559 | Bacteria | 13531 |
| 479 | Ga0495667_0062382 | 3300046559 | Bacteria | 2442 |
| 480 | Ga0495667_0397924 | 3300046559 | Bacteria | 868 |
| 481 | Ga0495656_0255438 | 3300046615 | Bacteria | 886 |
| 482 | Ga0495634_0017526 | 3300046642 | Bacteria | 5107 |
| 483 | Ga0495634_0027097 | 3300046642 | Bacteria | 3991 |
| 484 | Ga0495635_0008916 | 3300046663 | Bacteria | 7000 |
| 485 | Ga0495657_0003096 | 3300046675 | Bacteria | 13731 |
| 486 | Ga0495657_0003376 | 3300046675 | Bacteria | 13056 |
| 487 | Ga0495599_0023229 | 3300046678 | Bacteria | 3875 |
| 488 | Ga0495599_0159982 | 3300046678 | Bacteria | 1392 |
| 489 | Ga0495623_0073658 | 3300046679 | Bacteria | 2123 |
| 490 | Ga0495646_0005153 | 3300046680 | Bacteria | 8247 |
| 491 | Ga0495646_0097852 | 3300046680 | Bacteria | 1685 |
| 492 | Ga0495647_0018222 | 3300046681 | Bacteria | 2496 |
| 493 | Ga0495658_0018334 | 3300046683 | Bacteria | 3637 |
| 494 | Ga0495669_0115013 | 3300046684 | Bacteria | 1258 |
| 495 | Ga0495613_0009270 | 3300046689 | Bacteria | 7302 |
| 496 | Ga0495624_0077364 | 3300046690 | Bacteria | 2063 |
| 497 | Ga0495624_0187847 | 3300046690 | Bacteria | 1257 |
| 498 | Ga0495600_0020787 | 3300046809 | Bacteria | 4200 |
| 499 | Ga0495600_0037828 | 3300046809 | Bacteria | 3138 |
| 500 | Ga0495581_0002670 | 3300047315 | Bacteria | 10147 |
| 501 | Ga0495604_0011014 | 3300047317 | Bacteria | 7178 |
| 502 | Ga0495604_0263903 | 3300047317 | Bacteria | 1169 |
| 503 | Ga0495674_0016849 | 3300047319 | Bacteria | 6815 |
| 504 | Ga0495674_0863178 | 3300047319 | Bacteria | 700 |
| 505 | Ga0495676_0006826 | 3300047321 | Bacteria | 10494 |
| 506 | Ga0495680_0007106 | 3300047322 | Bacteria | 10309 |
| 507 | Ga0495680_0018629 | 3300047322 | Bacteria | 5884 |
| 508 | Ga0495675_0048805 | 3300047444 | Bacteria | 2692 |
| 509 | Ga0495684_0013682 | 3300047471 | Bacteria | 6248 |
| 510 | Ga0495684_0049095 | 3300047471 | Bacteria | 3225 |
| 511 | Ga0495684_0426339 | 3300047471 | Bacteria | 926 |
| 512 | Ga0495593_0010661 | 3300047673 | Bacteria | 5300 |
| 513 | Ga0495602_0024138 | 3300048088 | Bacteria | 5903 |
| 514 | Ga0495602_0625775 | 3300048088 | Bacteria | 737 |
| 515 | Ga0495614_0004821 | 3300048089 | Bacteria | 6088 |
| 516 | Ga0495614_0043068 | 3300048089 | Bacteria | 1936 |
| 517 | Ga0496100_0000087 | 3300048903 | Bacteria | 52650 |
| 518 | Ga0496100_0038990 | 3300048903 | Bacteria | 3014 |
| 519 | Ga0496100_0112474 | 3300048903 | Bacteria | 1894 |
| 520 | Ga0496100_0121574 | 3300048903 | Bacteria | 1827 |
| 521 | Ga0496100_0316469 | 3300048903 | Bacteria | 1171 |
| 522 | Ga0496101_0000034 | 3300048904 | Bacteria | 178045 |
| 523 | Ga0496101_0005189 | 3300048904 | Bacteria | 8287 |
| 524 | Ga0496101_0024741 | 3300048904 | Bacteria | 4160 |
| 525 | Ga0496101_0127157 | 3300048904 | Bacteria | 1932 |
| 526 | Ga0496101_0336892 | 3300048904 | Bacteria | 1184 |
| 527 | Ga0496101_0898333 | 3300048904 | Bacteria | 697 |
| 528 | Ga0496101_1127607 | 3300048904 | Bacteria | 615 |
| 529 | Ga0496102_0003014 | 3300048905 | Bacteria | 14265 |
| 530 | Ga0496102_0015914 | 3300048905 | Bacteria | 6562 |
| 531 | Ga0496102_0018869 | 3300048905 | Bacteria | 6068 |
| 532 | Ga0496102_0019364 | 3300048905 | Bacteria | 5995 |
| 533 | Ga0496102_0025095 | 3300048905 | Bacteria | 5302 |
| 534 | Ga0496102_0072081 | 3300048905 | Bacteria | 3173 |
| 535 | Ga0496103_0003562 | 3300048906 | Bacteria | 9515 |
| 536 | Ga0496103_0063747 | 3300048906 | Bacteria | 2296 |
| 537 | Ga0496103_0128484 | 3300048906 | Bacteria | 1617 |
| 538 | Ga0496103_0138720 | 3300048906 | Bacteria | 1554 |
| 539 | Ga0496103_0551998 | 3300048906 | Unclassified | 735 |
| 540 | Ga0496103_0687576 | 3300048906 | Bacteria | 649 |
| 541 | Ga0496104_0004621 | 3300048907 | Bacteria | 11998 |
| 542 | Ga0496104_0064566 | 3300048907 | Bacteria | 3473 |
| 543 | Ga0496104_0065999 | 3300048907 | Bacteria | 3436 |
| 544 | Ga0496104_0078294 | 3300048907 | Bacteria | 3150 |
| 545 | Ga0496104_0288197 | 3300048907 | Bacteria | 1554 |
| 546 | Ga0496105_0000147 | 3300048908 | Bacteria | 46556 |
| 547 | Ga0496105_0050289 | 3300048908 | Bacteria | 3442 |
| 548 | Ga0496105_0451749 | 3300048908 | Bacteria | 1014 |
| 549 | Ga0496105_0506219 | 3300048908 | Bacteria | 947 |
| 550 | Ga0496105_0676087 | 3300048908 | Bacteria | 794 |
| 551 | Ga0496105_0851003 | 3300048908 | Unclassified | 690 |
| 552 | Ga0496106_0006173 | 3300048909 | Bacteria | 8859 |
| 553 | Ga0496106_0139299 | 3300048909 | Bacteria | 1907 |
| 554 | Ga0496106_0353350 | 3300048909 | Bacteria | 1181 |
| 555 | Ga0496106_0420485 | 3300048909 | Bacteria | 1074 |
| 556 | Ga0496106_0535111 | 3300048909 | Bacteria | 940 |
| 557 | Ga0496107_0000108 | 3300048910 | Bacteria | 40403 |
| 558 | Ga0496107_0056952 | 3300048910 | Bacteria | 2825 |
| 559 | Ga0496107_0100967 | 3300048910 | Bacteria | 2115 |
| 560 | Ga0496107_0249518 | 3300048910 | Bacteria | 1321 |
| 561 | Ga0496107_0307896 | 3300048910 | Bacteria | 1179 |
| 562 | Ga0496108_0005536 | 3300048911 | Bacteria | 10219 |
| 563 | Ga0496108_0007784 | 3300048911 | Bacteria | 8679 |
| 564 | Ga0496108_0053320 | 3300048911 | Bacteria | 3391 |
| 565 | Ga0496108_0101020 | 3300048911 | Bacteria | 2460 |
| 566 | Ga0496108_0342584 | 3300048911 | Bacteria | 1304 |
| 567 | Ga0496109_0000127 | 3300048912 | Bacteria | 77905 |
| 568 | Ga0496109_0005421 | 3300048912 | Bacteria | 10672 |
| 569 | Ga0496109_0062829 | 3300048912 | Bacteria | 3396 |
| 570 | Ga0496109_0357438 | 3300048912 | Bacteria | 1380 |
| 571 | Ga0496109_0415316 | 3300048912 | Bacteria | 1271 |
| 572 | Ga0496109_0708297 | 3300048912 | Unclassified | 944 |
| 573 | Ga0496110_0000632 | 3300048913 | Bacteria | 24071 |
| 574 | Ga0496110_0001687 | 3300048913 | Bacteria | 16208 |
| 575 | Ga0496110_0003225 | 3300048913 | Bacteria | 12422 |
| 576 | Ga0496110_0040253 | 3300048913 | Bacteria | 4073 |
| 577 | Ga0496110_0354909 | 3300048913 | Bacteria | 1336 |
| 578 | Ga0496110_0447017 | 3300048913 | Bacteria | 1178 |
| 579 | Ga0496110_0659576 | 3300048913 | Bacteria | 946 |
| 580 | Ga0496111_0003696 | 3300048914 | Bacteria | 9511 |
| 581 | Ga0496111_0028583 | 3300048914 | Bacteria | 3952 |
| 582 | Ga0496111_0045727 | 3300048914 | Bacteria | 3150 |
| 583 | Ga0496111_0154362 | 3300048914 | Bacteria | 1703 |
| 584 | Ga0496112_0007427 | 3300048915 | Bacteria | 9728 |
| 585 | Ga0496112_0007538 | 3300048915 | Bacteria | 9662 |
| 586 | Ga0496112_0021242 | 3300048915 | Bacteria | 6171 |
| 587 | Ga0496112_0076915 | 3300048915 | Bacteria | 3300 |
| 588 | Ga0496112_0349068 | 3300048915 | Bacteria | 1422 |
| 589 | Ga0496112_0540346 | 3300048915 | Bacteria | 1100 |
| 590 | Ga0496112_0906821 | 3300048915 | Bacteria | 803 |
| 591 | Ga0496112_0998493 | 3300048915 | Unclassified | 757 |
| 592 | Ga0496113_0024294 | 3300048916 | Bacteria | 4306 |
| 593 | Ga0496113_0041527 | 3300048916 | Bacteria | 3394 |
| 594 | Ga0496113_0243092 | 3300048916 | Bacteria | 1436 |
| 595 | Ga0496113_0266510 | 3300048916 | Bacteria | 1369 |
| 596 | Ga0496113_0427455 | 3300048916 | Bacteria | 1064 |
| 597 | Ga0496113_0487880 | 3300048916 | Bacteria | 989 |
| 598 | Ga0496114_0000277 | 3300048917 | Bacteria | 37457 |
| 599 | Ga0496114_0003776 | 3300048917 | Bacteria | 11677 |
| 600 | Ga0496114_0278569 | 3300048917 | Bacteria | 1474 |
| 601 | Ga0496114_0308995 | 3300048917 | Bacteria | 1396 |
| 602 | Ga0496114_0758152 | 3300048917 | Bacteria | 848 |
| 603 | Ga0496115_0002281 | 3300048918 | Bacteria | 13734 |
| 604 | Ga0496115_0036167 | 3300048918 | Bacteria | 3909 |
| 605 | Ga0496115_0118626 | 3300048918 | Bacteria | 2176 |
| 606 | Ga0496116_0009881 | 3300048919 | Bacteria | 8070 |
| 607 | Ga0496117_0025665 | 3300048920 | Bacteria | 4627 |
| 608 | Ga0496118_0012406 | 3300048921 | Bacteria | 8184 |
| 609 | Ga0496119_0007860 | 3300048922 | Bacteria | 9498 |
| 610 | Ga0496120_0085583 | 3300048923 | Bacteria | 1696 |
| 611 | Ga0496121_0000048 | 3300048924 | Bacteria | 330242 |
| 612 | Ga0496122_0002047 | 3300048925 | Bacteria | 29932 |
| 613 | Ga0496122_0007157 | 3300048925 | Bacteria | 12505 |
| 614 | Ga0496123_0005077 | 3300048926 | Bacteria | 13448 |
| 615 | Ga0496123_0028217 | 3300048926 | Bacteria | 4160 |
| 616 | Ga0496124_0000044 | 3300048927 | Bacteria | 289064 |
| 617 | Ga0496125_0000037 | 3300048928 | Bacteria | 330242 |
| 618 | Ga0496126_0000046 | 3300048929 | Bacteria | 330242 |
| 619 | Ga0496126_0008405 | 3300048929 | Bacteria | 11139 |
| 620 | Ga0501031_0014077 | 3300049568 | Bacteria | 5204 |
| 621 | Ga0501031_0070731 | 3300049568 | Bacteria | 2273 |
| 622 | Ga0501031_0500526 | 3300049568 | Bacteria | 784 |
| 623 | Ga0501032_0054235 | 3300049569 | Bacteria | 2699 |
| 624 | Ga0501032_0275842 | 3300049569 | Bacteria | 1089 |
| 625 | Ga0501032_0424478 | 3300049569 | Bacteria | 853 |
| 626 | Ga0501033_0125117 | 3300049570 | Bacteria | 1864 |
| 627 | Ga0501034_0413860 | 3300049571 | Bacteria | 1270 |
| 628 | Ga0501036_0007462 | 3300049572 | Bacteria | 8913 |
| 629 | Ga0501036_0229737 | 3300049572 | Bacteria | 1557 |
| 630 | Ga0501036_0331432 | 3300049572 | Bacteria | 1271 |
| 631 | Ga0501038_0013394 | 3300049574 | Bacteria | 7476 |
| 632 | Ga0501038_0330442 | 3300049574 | Bacteria | 1191 |
| 633 | Ga0501039_0027582 | 3300049575 | Bacteria | 4366 |
| 634 | Ga0501039_1136325 | 3300049575 | Bacteria | 605 |
| 635 | Ga0501040_0106789 | 3300049576 | Bacteria | 1956 |
| 636 | Ga0501040_0114624 | 3300049576 | Bacteria | 1887 |
| 637 | Ga0501041_0017328 | 3300049577 | Bacteria | 4286 |
| 638 | Ga0501042_0023700 | 3300049578 | Bacteria | 4297 |
| 639 | Ga0501042_0212032 | 3300049578 | Bacteria | 1397 |
| 640 | Ga0501042_0226350 | 3300049578 | Bacteria | 1349 |
| 641 | Ga0501046_0037622 | 3300049580 | Bacteria | 3888 |
| 642 | Ga0501047_0696580 | 3300049581 | Bacteria | 833 |
| 643 | Ga0501048_0009748 | 3300049582 | Bacteria | 7203 |
| 644 | Ga0501048_0106029 | 3300049582 | Bacteria | 1984 |
| 645 | Ga0501048_0494487 | 3300049582 | Bacteria | 877 |
| 646 | Ga0501067_0033157 | 3300049583 | Bacteria | 2866 |
| 647 | Ga0501067_0135306 | 3300049583 | Bacteria | 1372 |
| 648 | Ga0501068_0050184 | 3300049584 | Bacteria | 2522 |
| 649 | Ga0501068_0482258 | 3300049584 | Bacteria | 803 |
| 650 | Ga0501070_0092995 | 3300049586 | Bacteria | 2495 |
| 651 | Ga0501070_0475620 | 3300049586 | Bacteria | 1005 |
| 652 | Ga0501070_0549506 | 3300049586 | Bacteria | 925 |
| 653 | Ga0501070_0612362 | 3300049586 | Bacteria | 867 |
| 654 | Ga0501071_0110605 | 3300049587 | Bacteria | 2030 |
| 655 | Ga0501071_0186078 | 3300049587 | Bacteria | 1557 |
| 656 | Ga0501071_0337185 | 3300049587 | Bacteria | 1146 |
| 657 | Ga0501072_0013405 | 3300049588 | Bacteria | 6273 |
| 658 | Ga0501072_0067366 | 3300049588 | Bacteria | 2825 |
| 659 | Ga0501072_0213339 | 3300049588 | Bacteria | 1538 |
| 660 | Ga0501072_0341845 | 3300049588 | Bacteria | 1189 |
| 661 | Ga0501073_0168962 | 3300049589 | Bacteria | 1514 |
| 662 | Ga0501074_0005969 | 3300049590 | Bacteria | 8787 |
| 663 | Ga0501074_0079505 | 3300049590 | Bacteria | 2353 |
| 664 | Ga0501074_0329973 | 3300049590 | Bacteria | 1083 |
| 665 | Ga0501075_0034824 | 3300049591 | Bacteria | 3751 |
| 666 | Ga0501075_0133769 | 3300049591 | Bacteria | 1889 |
| 667 | Ga0501076_0266926 | 3300049592 | Bacteria | 1401 |
| 668 | Ga0501076_0567769 | 3300049592 | Bacteria | 936 |
| 669 | Ga0501077_0002560 | 3300049593 | Bacteria | 10903 |
| 670 | Ga0501077_0114092 | 3300049593 | Bacteria | 1713 |
| 671 | Ga0501077_0190601 | 3300049593 | Bacteria | 1302 |
| 672 | Ga0501077_0228887 | 3300049593 | Bacteria | 1182 |
| 673 | Ga0501079_0005337 | 3300049741 | Bacteria | 9566 |
| 674 | Ga0501079_0231748 | 3300049741 | Bacteria | 1442 |
| 675 | Ga0501079_0405666 | 3300049741 | Bacteria | 1069 |
| 676 | Ga0501080_0020690 | 3300049742 | Bacteria | 6095 |
| 677 | Ga0501080_0283997 | 3300049742 | Bacteria | 1504 |
| 678 | Ga0501080_0451336 | 3300049742 | Bacteria | 1153 |
| 679 | Ga0501081_0068227 | 3300049743 | Bacteria | 2475 |
| 680 | Ga0501081_0333290 | 3300049743 | Bacteria | 1116 |
| 681 | Ga0501081_0376848 | 3300049743 | Bacteria | 1048 |
| 682 | Ga0501081_0983126 | 3300049743 | Bacteria | 637 |
| 683 | Ga0501035_0578222 | 3300049822 | Bacteria | 918 |
| 684 | Ga0501045_0064045 | 3300049824 | Bacteria | 2698 |
| 685 | Ga0501045_0140987 | 3300049824 | Bacteria | 1792 |
| 686 | Ga0501045_0466266 | 3300049824 | Bacteria | 939 |
| 687 | nmdc:mga00v17_32429_c1 | 3300050491 | Bacteria | 3088 |
| 688 | nmdc:mga0yw44_30198_c1 | 3300050492 | Bacteria | 3137 |
| 689 | nmdc:mga0yw44_312024_c1 | 3300050492 | Bacteria | 1055 |
| 690 | nmdc:mga06z11_119945_c1 | 3300050494 | Bacteria | 1466 |
| 691 | nmdc:mga04h51_212855_c1 | 3300050495 | Bacteria | 763 |
| 692 | nmdc:mga05p37_101310_c1 | 3300050507 | Bacteria | 3547 |
| 693 | nmdc:mga05p37_283886_c1 | 3300050507 | Bacteria | 1973 |
| 694 | nmdc:mga05p37_497905_c1 | 3300050507 | Bacteria | 1399 |
| 695 | nmdc:mga05p37_799877_c1 | 3300050507 | Bacteria | 1032 |
| 696 | nmdc:mga09592_37795_c1 | 3300050508 | Bacteria | 4051 |
| 697 | nmdc:mga09592_45778_c1 | 3300050508 | Bacteria | 3686 |
| 698 | nmdc:mga0qj67_126988_c1 | 3300050509 | Bacteria | 2064 |
| 699 | nmdc:mga0qj67_29212_c1 | 3300050509 | Bacteria | 4282 |
| 700 | nmdc:mga06r32_1383787_c1 | 3300050510 | Bacteria | 646 |
| 701 | nmdc:mga06r32_500865_c1 | 3300050510 | Bacteria | 1191 |
| 702 | nmdc:mga06r32_5768_c1 | 3300050510 | Bacteria | 11157 |
| 703 | nmdc:mga06r32_59188_c1 | 3300050510 | Bacteria | 3683 |
| 704 | nmdc:mga06r32_74573_c1 | 3300050510 | Bacteria | 3290 |
| 705 | nmdc:mga06r32_893472_c1 | 3300050510 | Bacteria | 845 |
| 706 | nmdc:mga08y16_170775_c1 | 3300050511 | Bacteria | 2259 |
| 707 | nmdc:mga08y16_305569_c1 | 3300050511 | Bacteria | 1639 |
| 708 | nmdc:mga08y16_325536_c1 | 3300050511 | Bacteria | 1581 |
| 709 | nmdc:mga08y16_58946_c1 | 3300050511 | Bacteria | 4012 |
| 710 | nmdc:mga08y16_6329_c1 | 3300050511 | Bacteria | 12416 |
| 711 | nmdc:mga08y16_698861_c1 | 3300050511 | Bacteria | 1014 |
| 712 | nmdc:mga08y16_711878_c1 | 3300050511 | Bacteria | 1003 |
| 713 | nmdc:mga0n895_1775470_c1 | 3300050512 | Bacteria | 578 |
| 714 | nmdc:mga0n895_42287_c1 | 3300050512 | Bacteria | 4433 |
| 715 | nmdc:mga0n895_9300_c1 | 3300050512 | Bacteria | 8585 |
| 716 | nmdc:mga0rr50_163598_c1 | 3300050513 | Bacteria | 1808 |
| 717 | nmdc:mga0rr50_247299_c1 | 3300050513 | Bacteria | 1480 |
| 718 | nmdc:mga08x19_207332_c1 | 3300050514 | Unclassified | 1345 |
| 719 | nmdc:mga08x19_224992_c1 | 3300050514 | Unclassified | 1290 |
| 720 | nmdc:mga08x19_53088_c1 | 3300050514 | Bacteria | 2607 |
| 721 | nmdc:mga0a205_1204365_c1 | 3300050515 | Bacteria | 605 |
| 722 | nmdc:mga0a205_7015_c1 | 3300050515 | Bacteria | 10174 |
| 723 | nmdc:mga0a205_91657_c1 | 3300050515 | Bacteria | 2937 |
| 724 | nmdc:mga0a205_976526_c1 | 3300050515 | Bacteria | 694 |
| 725 | Ga0495601_0018521 | 3300053077 | Bacteria | 4240 |
| 726 | Ga0495655_0086296 | 3300053083 | Unclassified | 907 |
| 727 | Ga0495595_0025743 | 3300053084 | Bacteria | 2609 |
| 728 | Ga0495595_0161539 | 3300053084 | Bacteria | 1105 |
| 729 | Ga0495619_0013544 | 3300053085 | Bacteria | 5139 |
| 730 | Ga0500616_0000221 | 3300053153 | Bacteria | 88983 |
| 731 | Ga0501084_0004889 | 3300054114 | Bacteria | 10948 |
| 732 | Ga0501084_0182373 | 3300054114 | Bacteria | 1772 |
| 733 | Ga0501084_0618795 | 3300054114 | Bacteria | 915 |
| 734 | Ga0501082_0029608 | 3300060353 | Bacteria | 4717 |
| 735 | Ga0501082_0186486 | 3300060353 | Bacteria | 1805 |
| 736 | Ga0466962_0008688 | 3300061719 | Bacteria | 4871 |
| 737 | Ga0466962_0287455 | 3300061719 | Bacteria | 812 |
| 738 | Ga0530510_0110230 | 3300061734 | Bacteria | 2015 |
| 739 | Ga0530510_0206660 | 3300061734 | Bacteria | 1459 |
| 740 | Ga0530510_0730274 | 3300061734 | Bacteria | 755 |
| 741 | 2587864321 | 2585428094 | Bacteria | 3604039 |
| 742 | 2643875908 | 2643221572 | Bacteria | 3614809 |
| 743 | 2644382963 | 2643221669 | Bacteria | 3611286 |
| 744 | 2644538022 | 2643221697 | Bacteria | 3575694 |
| 745 | 2644610267 | 2643221711 | Bacteria | 4865335 |
| 746 | 2738663811 | 2738541264 | Bacteria | 5935393 |
| 747 | 2739142946 | 2738541356 | Bacteria | 5935017 |
| 748 | 2852678008 | 2852677369 | Bacteria | 3768884 |
| 749 | 2870628054 | 2870628048 | Bacteria | 3696012 |
| 750 | 2895663577 | 2895660088 | Bacteria | 3782833 |
| 751 | 2939602317 | 2939598168 | Bacteria | 4687164 |
| 752 | Ga0316578_10062742 | |||
| 753 | Ga0006562J51391_1054243 | |||
| 754 | Ga0006562J51391_1054246 | |||
| 755 | Ga0055540_1000038 | |||
| 756 | Ga0065714_10065949 | |||
| 757 | Ga0065714_10234720 | |||
| 758 | Ga0065704_10007708 | |||
| 759 | Ga0065712_10130057 | |||
| 760 | Ga0070658_11599062 | |||
| 761 | Ga0070676_10109091 | |||
| 762 | Ga0070676_10256096 | |||
| 763 | Ga0070683_100033279 | |||
| 764 | Ga0070683_100062006 | |||
| 765 | Ga0070683_100265550 | |||
| 766 | Ga0070683_100381292 | |||
| 767 | Ga0068869_100647728 | |||
| 768 | Ga0070666_10125833 | |||
| 769 | Ga0070680_100002207 | |||
| 770 | Ga0070682_100056553 | |||
| 771 | Ga0070682_100384583 | |||
| 772 | Ga0068868_100003823 | |||
| 773 | Ga0068868_100342482 | |||
| 774 | Ga0070660_100017052 | |||
| 775 | Ga0070660_100391653 | |||
| 776 | Ga0070660_101102758 | |||
| 777 | Ga0070689_100386850 | |||
| 778 | Ga0070691_10008781 | |||
| 779 | Ga0070661_100334778 | |||
| 780 | Ga0070661_100654719 | |||
| 781 | Ga0070661_100662963 | |||
| 782 | Ga0070692_10251702 | |||
| 783 | Ga0070669_100726443 | |||
| 784 | Ga0070675_100058936 | |||
| 785 | Ga0070675_101388296 | |||
| 786 | Ga0070671_100114816 | |||
| 787 | Ga0070674_100030552 | |||
| 788 | Ga0070674_100533732 | |||
| 789 | Ga0070674_100541958 | |||
| 790 | Ga0070673_100044855 | |||
| 791 | Ga0070688_100053182 | |||
| 792 | Ga0070659_100047566 | |||
| 793 | Ga0070659_100165797 | |||
| 794 | Ga0070667_100000883 | |||
| 795 | Ga0070667_101105116 | |||
| 796 | Ga0070709_10617895 | |||
| 797 | Ga0070709_10678365 | |||
| 798 | Ga0070714_100131092 | |||
| 799 | Ga0070714_100133945 | |||
| 800 | Ga0070714_100274598 | |||
| 801 | Ga0070714_100364198 | |||
| 802 | Ga0070713_100060640 | |||
| 803 | Ga0070713_100146818 | |||
| 804 | Ga0070713_100341876 | |||
| 805 | Ga0070713_100611911 | |||
| 806 | Ga0070713_101163817 | |||
| 807 | Ga0070710_10007389 | |||
| 808 | Ga0070710_10832246 | |||
| 809 | Ga0070701_10237287 | |||
| 810 | Ga0070701_10448048 | |||
| 811 | Ga0070711_100006496 | |||
| 812 | Ga0070711_100107424 | |||
| 813 | Ga0070711_100450918 | |||
| 814 | Ga0070711_101183448 | |||
| 815 | Ga0070705_100075815 | |||
| 816 | Ga0070700_100015971 | |||
| 817 | Ga0070700_100206315 | |||
| 818 | Ga0070708_100817478 | |||
| 819 | Ga0070663_100166980 | |||
| 820 | Ga0070678_100057594 | |||
| 821 | Ga0070678_100340357 | |||
| 822 | Ga0070678_100357919 | |||
| 823 | Ga0070681_10006968 | |||
| 824 | Ga0070681_10502451 | |||
| 825 | Ga0070685_10370658 | |||
| 826 | Ga0070685_10493610 | |||
| 827 | Ga0070706_100267419 | |||
| 828 | Ga0070707_100104458 | |||
| 829 | Ga0070707_101900625 | |||
| 830 | Ga0070698_100002676 | |||
| 831 | Ga0070698_100780913 | |||
| 832 | Ga0070699_100046993 | |||
| 833 | Ga0070679_100007549 | |||
| 834 | Ga0070679_100199310 | |||
| 835 | Ga0070684_100003771 | |||
| 836 | Ga0070684_100010570 | |||
| 837 | Ga0070684_100152849 | |||
| 838 | Ga0070684_100291957 | |||
| 839 | Ga0068853_100005415 | |||
| 840 | Ga0070672_100781928 | |||
| 841 | Ga0070695_101046416 | |||
| 842 | Ga0070665_100685343 | |||
| 843 | Ga0070665_100896553 | |||
| 844 | Ga0070665_101387822 | |||
| 845 | Ga0070704_100203784 | |||
| 846 | Ga0070704_101096837 | |||
| 847 | Ga0068855_100435415 | |||
| 848 | Ga0070664_100004514 | |||
| 849 | Ga0070664_100160556 | |||
| 850 | Ga0070664_100283633 | |||
| 851 | Ga0068857_100002367 | |||
| 852 | Ga0068857_100292232 | |||
| 853 | Ga0068857_100505297 | |||
| 854 | Ga0068857_101334084 | |||
| 855 | Ga0068854_100142996 | |||
| 856 | Ga0068856_100026064 | |||
| 857 | Ga0068856_100027660 | |||
| 858 | Ga0068856_100149181 | |||
| 859 | Ga0068856_100191186 | |||
| 860 | Ga0068856_101316317 | |||
| 861 | Ga0070702_100045035 | |||
| 862 | Ga0070702_100136076 | |||
| 863 | Ga0068852_100003496 | |||
| 864 | Ga0068852_100743500 | |||
| 865 | Ga0068859_100212846 | |||
| 866 | Ga0068864_101522730 | |||
| 867 | Ga0068866_10049728 | |||
| 868 | Ga0068861_100345193 | |||
| 869 | Ga0068861_101185277 | |||
| 870 | Ga0068870_10087597 | |||
| 871 | Ga0068870_10163395 | |||
| 872 | Ga0068863_100840058 | |||
| 873 | Ga0068858_100490608 | |||
| 874 | Ga0068860_101509749 | |||
| 875 | Ga0068862_100186950 | |||
| 876 | Ga0081455_10086432 | |||
| 877 | Ga0081455_10088231 | |||
| 878 | Ga0081455_10161312 | |||
| 879 | Ga0081538_10009498 | |||
| 880 | Ga0081538_10071445 | |||
| 881 | Ga0081539_10162709 | |||
| 882 | Ga0070717_10014628 | |||
| 883 | Ga0070717_10047508 | |||
| 884 | Ga0070717_10051330 | |||
| 885 | Ga0070717_10065295 | |||
| 886 | Ga0070717_10139701 | |||
| 887 | Ga0070717_11029303 | |||
| 888 | Ga0070717_11323312 | |||
| 889 | Ga0075365_10147340 | |||
| 890 | Ga0075365_10407820 | |||
| 891 | Ga0075368_10246235 | |||
| 892 | Ga0075364_10274572 | |||
| 893 | Ga0075432_10098563 | |||
| 894 | Ga0075432_10243862 | |||
| 895 | Ga0070715_10205578 | |||
| 896 | Ga0070716_100091454 | |||
| 897 | Ga0070712_100105038 | |||
| 898 | Ga0070712_100116652 | |||
| 899 | Ga0075362_10032974 | |||
| 900 | Ga0097621_100183932 | |||
| 901 | Ga0075428_100031162 | |||
| 902 | Ga0075428_100057799 | |||
| 903 | Ga0075428_100217886 | |||
| 904 | Ga0075428_100786772 | |||
| 905 | Ga0075430_100016244 | |||
| 906 | Ga0075430_100018217 | |||
| 907 | Ga0075431_100010542 | |||
| 908 | Ga0075431_100322892 | |||
| 909 | Ga0075431_100759177 | |||
| 910 | Ga0075431_101144498 | |||
| 911 | Ga0075433_10004829 | |||
| 912 | Ga0075434_100007632 | |||
| 913 | Ga0075434_100021751 | |||
| 914 | Ga0075434_100385796 | |||
| 915 | Ga0075429_100018897 | |||
| 916 | Ga0075429_100283630 | |||
| 917 | Ga0068865_100199110 | |||
| 918 | Ga0068865_100399829 | |||
| 919 | Ga0075436_100027372 | |||
| 920 | Ga0075436_100086490 | |||
| 921 | Ga0075436_100108710 | |||
| 922 | Ga0075436_100127301 | |||
| 923 | Ga0097620_100212841 | |||
| 924 | Ga0075435_100193418 | |||
| 925 | Ga0075435_100309782 | |||
| 926 | Ga0105240_10015177 | |||
| 927 | Ga0105240_11636768 | |||
| 928 | Ga0111539_10000579 | |||
| 929 | Ga0111539_10297779 | |||
| 930 | Ga0111539_10879192 | |||
| 931 | Ga0105245_10010437 | |||
| 932 | Ga0105245_10044550 | |||
| 933 | Ga0105245_10068096 | |||
| 934 | Ga0105245_10264072 | |||
| 935 | Ga0105245_11449271 | |||
| 936 | Ga0105247_10248743 | |||
| 937 | Ga0105247_10434336 | |||
| 938 | Ga0105247_10805117 | |||
| 939 | Ga0114129_10029595 | |||
| 940 | Ga0114129_10133874 | |||
| 941 | Ga0114129_10387452 | |||
| 942 | Ga0114129_10455948 | |||
| 943 | Ga0114129_10561943 | |||
| 944 | Ga0105243_10040988 | |||
| 945 | Ga0105243_10733966 | |||
| 946 | Ga0105242_10195029 | |||
| 947 | Ga0105242_10344022 | |||
| 948 | Ga0105248_10959609 | |||
| 949 | Ga0105237_10005032 | |||
| 950 | Ga0105237_10018125 | |||
| 951 | Ga0105237_10188049 | |||
| 952 | Ga0105237_10570681 | |||
| 953 | Ga0105238_10091818 | |||
| 954 | Ga0105249_10126322 | |||
| 955 | Ga0105239_10050146 | |||
| 956 | Ga0105239_10051659 | |||
| 957 | Ga0105239_10092372 | |||
| 958 | Ga0105239_10206195 | |||
| 959 | Ga0105239_10462035 | |||
| 960 | Ga0105239_10501852 | |||
| 961 | Ga0105246_10026821 | |||
| 962 | Ga0105246_11004641 | |||
| 963 | Ga0105246_11228002 | |||
| 964 | Ga0105246_11373364 | |||
| 965 | Ga0157370_10003299 | |||
| 966 | Ga0157370_10403331 | |||
| 967 | Ga0157369_10511837 | |||
| 968 | Ga0157374_10059513 | |||
| 969 | Ga0157374_10107192 | |||
| 970 | Ga0157374_10224869 | |||
| 971 | Ga0157374_10226036 | |||
| 972 | Ga0157374_10405275 | |||
| 973 | Ga0157374_10534566 | |||
| 974 | Ga0157378_10246139 | |||
| 975 | Ga0157378_11000781 | |||
| 976 | Ga0163162_10695565 | |||
| 977 | Ga0163162_10896747 | |||
| 978 | Ga0163162_10905766 | |||
| 979 | Ga0157372_10023566 | |||
| 980 | Ga0157372_10023707 | |||
| 981 | Ga0157372_10544334 | |||
| 982 | Ga0157372_10576489 | |||
| 983 | Ga0157372_11463414 | |||
| 984 | Ga0157375_10135064 | |||
| 985 | Ga0157375_10369649 | |||
| 986 | Ga0157375_11364322 | |||
| 987 | Ga0163163_10310972 | |||
| 988 | Ga0163163_10548220 | |||
| 989 | Ga0163163_11538417 | |||
| 990 | Ga0157380_10656510 | |||
| 991 | Ga0157380_10703482 | |||
| 992 | Ga0182008_10144438 | |||
| 993 | Ga0157377_10113583 | |||
| 994 | Ga0157377_10156337 | |||
| 995 | Ga0157376_10312288 | |||
| 996 | Ga0157376_10424341 | |||
| 997 | Ga0157376_10457382 | |||
| 998 | Ga0157376_11187525 | |||
| 999 | Ga0182007_10233051 | |||
| 1000 | Ga0163161_10597071 | |||
| 1001 | Ga0163161_11385325 | |||
| 1002 | Ga0206354_11138832 | |||
| 1003 | Ga0206353_11108710 | |||
| 1004 | Ga0213876_10228740 | |||
| 1005 | Ga0213876_10281937 | |||
| 1006 | Ga0213875_10493710 | |||
| 1007 | Ga0224712_10342064 | |||
| 1008 | Ga0209051_1000014 | |||
| 1009 | Ga0207692_10002457 | |||
| 1010 | Ga0207642_10111283 | |||
| 1011 | Ga0207688_10002443 | |||
| 1012 | Ga0207680_10199019 | |||
| 1013 | Ga0207647_10206341 | |||
| 1014 | Ga0207685_10062440 | |||
| 1015 | Ga0207699_10007314 | |||
| 1016 | Ga0207645_10155323 | |||
| 1017 | Ga0207645_10304713 | |||
| 1018 | Ga0207643_10020603 | |||
| 1019 | Ga0207707_10002713 | |||
| 1020 | Ga0207707_10007903 | |||
| 1021 | Ga0207695_10636912 | |||
| 1022 | Ga0207671_10005149 | |||
| 1023 | Ga0207671_10023865 | |||
| 1024 | Ga0207671_10620142 | |||
| 1025 | Ga0207693_10011035 | |||
| 1026 | Ga0207693_10028083 | |||
| 1027 | Ga0207693_10166997 | |||
| 1028 | Ga0207663_10066194 | |||
| 1029 | Ga0207663_10426542 | |||
| 1030 | Ga0207663_10626745 | |||
| 1031 | Ga0207657_10011545 | |||
| 1032 | Ga0207657_10413669 | |||
| 1033 | Ga0207649_10286670 | |||
| 1034 | Ga0207649_10395133 | |||
| 1035 | Ga0207652_10003071 | |||
| 1036 | Ga0207652_10004552 | |||
| 1037 | Ga0207646_10348879 | |||
| 1038 | Ga0207646_11450087 | |||
| 1039 | Ga0207650_10789648 | |||
| 1040 | Ga0207659_10024835 | |||
| 1041 | Ga0207687_10019472 | |||
| 1042 | Ga0207687_10024586 | |||
| 1043 | Ga0207687_10059992 | |||
| 1044 | Ga0207700_10014269 | |||
| 1045 | Ga0207700_10070893 | |||
| 1046 | Ga0207700_10144276 | |||
| 1047 | Ga0207664_10117439 | |||
| 1048 | Ga0207664_10237804 | |||
| 1049 | Ga0207664_10385604 | |||
| 1050 | Ga0207644_11323840 | |||
| 1051 | Ga0207690_10020041 | |||
| 1052 | Ga0207690_10028430 | |||
| 1053 | Ga0207686_10201879 | |||
| 1054 | Ga0207686_10291045 | |||
| 1055 | Ga0207686_11137468 | |||
| 1056 | Ga0207709_10082690 | |||
| 1057 | Ga0207709_10097542 | |||
| 1058 | Ga0207709_10121986 | |||
| 1059 | Ga0207709_10236082 | |||
| 1060 | Ga0207669_10018476 | |||
| 1061 | Ga0207669_10031063 | |||
| 1062 | Ga0207704_10046032 | |||
| 1063 | Ga0207665_10086832 | |||
| 1064 | Ga0207665_10128177 | |||
| 1065 | Ga0207665_10248265 | |||
| 1066 | Ga0207665_10906544 | |||
| 1067 | Ga0207691_10304597 | |||
| 1068 | Ga0207711_10541197 | |||
| 1069 | Ga0207689_10503830 | |||
| 1070 | Ga0207689_10689799 | |||
| 1071 | Ga0207661_10004175 | |||
| 1072 | Ga0207661_10020529 | |||
| 1073 | Ga0207661_10031627 | |||
| 1074 | Ga0207661_10237714 | |||
| 1075 | Ga0207661_10277388 | |||
| 1076 | Ga0207679_10100374 | |||
| 1077 | Ga0207667_10290950 | |||
| 1078 | Ga0207651_10033909 | |||
| 1079 | Ga0207712_10632965 | |||
| 1080 | Ga0207640_10122247 | |||
| 1081 | Ga0207658_10001419 | |||
| 1082 | Ga0207658_10298180 | |||
| 1083 | Ga0207658_10928280 | |||
| 1084 | Ga0207677_10078040 | |||
| 1085 | Ga0207703_10235355 | |||
| 1086 | Ga0207703_10882051 | |||
| 1087 | Ga0207678_10194163 | |||
| 1088 | Ga0207678_11462680 | |||
| 1089 | Ga0207708_10000817 | |||
| 1090 | Ga0207708_10204815 | |||
| 1091 | Ga0207708_10695806 | |||
| 1092 | Ga0207702_10037300 | |||
| 1093 | Ga0207702_10100556 | |||
| 1094 | Ga0207702_10101609 | |||
| 1095 | Ga0207702_10168254 | |||
| 1096 | Ga0207641_10857933 | |||
| 1097 | Ga0207674_10002510 | |||
| 1098 | Ga0207674_10050781 | |||
| 1099 | Ga0207674_10108328 | |||
| 1100 | Ga0207674_10308367 | |||
| 1101 | Ga0207674_10339629 | |||
| 1102 | Ga0207683_10187283 | |||
| 1103 | Ga0209813_10184736 | |||
| 1104 | Ga0207428_10001781 | |||
| 1105 | Ga0207428_10024017 | |||
| 1106 | Ga0207428_10149519 | |||
| 1107 | Ga0207428_10215890 | |||
| 1108 | Ga0207428_10755857 | |||
| 1109 | Ga0268266_10561336 | |||
| 1110 | Ga0268265_10159914 | |||
| 1111 | Ga0265326_10017825 | |||
| 1112 | Ga0265330_10013916 | |||
| 1113 | Ga0265329_10025331 | |||
| 1114 | Ga0265327_10000718 | |||
| 1115 | Ga0307409_100371012 | |||
| 1116 | Ga0373926_0020534 | |||
| 1117 | Ga0373926_0150040 | |||
| 1118 | Ga0373944_0006292 | |||
| 1119 | Ga0373936_0115772 | |||
| 1120 | Ga0373945_0010430 | |||
| 1121 | Ga0373953_0180628 | |||
| 1122 | Ga0373956_0081971 | |||
| 1123 | Ga0373956_0190671 | |||
| 1124 | Ga0373957_0108179 | |||
| 1125 | Ga0373943_0189627 | |||
| 1126 | Ga0373943_0659947 | |||
| 1127 | Ga0373924_0058138 | |||
| 1128 | Ga0373924_0108353 | |||
| 1129 | Ga0373935_0006653 | |||
| 1130 | Ga0373935_0638683 | |||
| 1131 | Ga0373927_0024079 | |||
| 1132 | Ga0373927_0040719 | |||
| 1133 | Ga0373927_0561775 | |||
| 1134 | Ga0373933_0048689 | |||
| 1135 | Ga0373947_0270239 | |||
| 1136 | Ga0373937_0022525 | |||
| 1137 | Ga0373937_0365130 | |||
| 1138 | Ga0316584_0420406 | |||
| 1139 | Ga0373925_0018170 | |||
| 1140 | Ga0373925_0079850 | |||
| 1141 | Ga0373925_0124636 | |||
| 1142 | Ga0395900_0154383 | |||
| 1143 | Ga0395900_0260055 | |||
| 1144 | Ga0395900_1146523 | |||
| 1145 | Ga0395898_0294558 | |||
| 1146 | Ga0395898_0458128 | |||
| 1147 | Ga0436364_0570019 | |||
| 1148 | Ga0395901_0048526 | |||
| 1149 | Ga0395901_0051131 | |||
| 1150 | Ga0395901_0538726 | |||
| 1151 | Ga0395901_0663503 | |||
| 1152 | Ga0395901_0935345 | |||
| 1153 | Ga0436365_0689271 | |||
| 1154 | Ga0436365_0913000 | |||
| 1155 | Ga0436365_1231943 | |||
| 1156 | Ga0436365_1278218 | |||
| 1157 | Ga0436365_1803478 | |||
| 1158 | Ga0436360_0832316 | |||
| 1159 | Ga0436361_0269551 | |||
| 1160 | Ga0436363_1012909 | |||
| 1161 | Ga0439456_035851 | |||
| 1162 | Ga0450888_005589 | |||
| 1163 | Ga0450907_039195 | |||
| 1164 | Ga0439460_0077777 | |||
| 1165 | Ga0466969_0112385 | |||
| 1166 | Ga0466969_0427518 | |||
| 1167 | Ga0466972_0096760 | |||
| 1168 | Ga0466965_0047693 | |||
| 1169 | Ga0466965_0123210 | |||
| 1170 | Ga0466966_0250721 | |||
| 1171 | Ga0466966_0441960 | |||
| 1172 | Ga0466961_0017997 | |||
| 1173 | Ga0466963_0001875 | |||
| 1174 | Ga0466963_0011902 | |||
| 1175 | Ga0466963_0084607 | |||
| 1176 | Ga0466963_0543725 | |||
| 1177 | Ga0466964_0328883 | |||
| 1178 | Ga0466971_0010163 | |||
| 1179 | Ga0466970_0415559 | |||
| 1180 | Ga0466957_0237430 | |||
| 1181 | Ga0466957_0588037 | |||
| 1182 | Ga0466959_0014031 | |||
| 1183 | Ga0466959_0014247 | |||
| 1184 | Ga0466959_0529644 | |||
| 1185 | Ga0451576_0132377 | |||
| 1186 | Ga0466958_0092387 | |||
| 1187 | Ga0466958_0266721 | |||
| 1188 | Ga0466958_0304300 | |||
| 1189 | Ga0466958_0313212 | |||
| 1190 | Ga0466967_0127690 | |||
| 1191 | Ga0466967_0326914 | |||
| 1192 | Ga0466967_0400029 | |||
| 1193 | Ga0466967_0436082 | |||
| 1194 | Ga0466967_0644434 | |||
| 1195 | Ga0466967_1033875 | |||
| 1196 | Ga0495592_0006144 | |||
| 1197 | Ga0495592_0733657 | |||
| 1198 | Ga0495603_0086274 | |||
| 1199 | Ga0495629_0033307 | |||
| 1200 | Ga0495641_0036374 | |||
| 1201 | Ga0495641_0037480 | |||
| 1202 | Ga0495651_0024966 | |||
| 1203 | Ga0495651_0248066 | |||
| 1204 | Ga0495653_0056126 | |||
| 1205 | Ga0495580_0027803 | |||
| 1206 | Ga0495582_0003047 | |||
| 1207 | Ga0495582_0195139 | |||
| 1208 | Ga0495662_0004189 | |||
| 1209 | Ga0495664_0053472 | |||
| 1210 | Ga0495594_0003952 | |||
| 1211 | Ga0495596_0093434 | |||
| 1212 | Ga0495596_0304377 | |||
| 1213 | Ga0495608_0007049 | |||
| 1214 | Ga0495608_0023009 | |||
| 1215 | Ga0495618_0085482 | |||
| 1216 | Ga0495630_0055891 | |||
| 1217 | Ga0495630_0140645 | |||
| 1218 | Ga0495630_0855094 | |||
| 1219 | Ga0495642_0277667 | |||
| 1220 | Ga0495652_0079206 | |||
| 1221 | Ga0495652_0749479 | |||
| 1222 | Ga0495665_0004549 | |||
| 1223 | Ga0495640_0028287 | |||
| 1224 | Ga0495640_0093202 | |||
| 1225 | Ga0495586_0071580 | |||
| 1226 | Ga0495587_0006633 | |||
| 1227 | Ga0495587_0245344 | |||
| 1228 | Ga0495622_0068703 | |||
| 1229 | Ga0495667_0001992 | |||
| 1230 | Ga0495667_0062382 | |||
| 1231 | Ga0495667_0397924 | |||
| 1232 | Ga0495656_0255438 | |||
| 1233 | Ga0495634_0017526 | |||
| 1234 | Ga0495634_0027097 | |||
| 1235 | Ga0495635_0008916 | |||
| 1236 | Ga0495657_0003096 | |||
| 1237 | Ga0495657_0003376 | |||
| 1238 | Ga0495599_0023229 | |||
| 1239 | Ga0495599_0159982 | |||
| 1240 | Ga0495623_0073658 | |||
| 1241 | Ga0495646_0005153 | |||
| 1242 | Ga0495646_0097852 | |||
| 1243 | Ga0495647_0018222 | |||
| 1244 | Ga0495658_0018334 | |||
| 1245 | Ga0495669_0115013 | |||
| 1246 | Ga0495613_0009270 | |||
| 1247 | Ga0495624_0077364 | |||
| 1248 | Ga0495624_0187847 | |||
| 1249 | Ga0495600_0020787 | |||
| 1250 | Ga0495600_0037828 | |||
| 1251 | Ga0495581_0002670 | |||
| 1252 | Ga0495604_0011014 | |||
| 1253 | Ga0495604_0263903 | |||
| 1254 | Ga0495674_0016849 | |||
| 1255 | Ga0495674_0863178 | |||
| 1256 | Ga0495676_0006826 | |||
| 1257 | Ga0495680_0007106 | |||
| 1258 | Ga0495680_0018629 | |||
| 1259 | Ga0495675_0048805 | |||
| 1260 | Ga0495684_0013682 | |||
| 1261 | Ga0495684_0049095 | |||
| 1262 | Ga0495684_0426339 | |||
| 1263 | Ga0495593_0010661 | |||
| 1264 | Ga0495602_0024138 | |||
| 1265 | Ga0495602_0625775 | |||
| 1266 | Ga0495614_0004821 | |||
| 1267 | Ga0495614_0043068 | |||
| 1268 | Ga0496100_0000087 | |||
| 1269 | Ga0496100_0038990 | |||
| 1270 | Ga0496100_0112474 | |||
| 1271 | Ga0496100_0121574 | |||
| 1272 | Ga0496100_0316469 | |||
| 1273 | Ga0496101_0000034 | |||
| 1274 | Ga0496101_0005189 | |||
| 1275 | Ga0496101_0024741 | |||
| 1276 | Ga0496101_0127157 | |||
| 1277 | Ga0496101_0336892 | |||
| 1278 | Ga0496101_0898333 | |||
| 1279 | Ga0496101_1127607 | |||
| 1280 | Ga0496102_0003014 | |||
| 1281 | Ga0496102_0015914 | |||
| 1282 | Ga0496102_0018869 | |||
| 1283 | Ga0496102_0019364 | |||
| 1284 | Ga0496102_0025095 | |||
| 1285 | Ga0496102_0072081 | |||
| 1286 | Ga0496103_0003562 | |||
| 1287 | Ga0496103_0063747 | |||
| 1288 | Ga0496103_0128484 | |||
| 1289 | Ga0496103_0138720 | |||
| 1290 | Ga0496103_0551998 | |||
| 1291 | Ga0496103_0687576 | |||
| 1292 | Ga0496104_0004621 | |||
| 1293 | Ga0496104_0064566 | |||
| 1294 | Ga0496104_0065999 | |||
| 1295 | Ga0496104_0078294 | |||
| 1296 | Ga0496104_0288197 | |||
| 1297 | Ga0496105_0000147 | |||
| 1298 | Ga0496105_0050289 | |||
| 1299 | Ga0496105_0451749 | |||
| 1300 | Ga0496105_0506219 | |||
| 1301 | Ga0496105_0676087 | |||
| 1302 | Ga0496105_0851003 | |||
| 1303 | Ga0496106_0006173 | |||
| 1304 | Ga0496106_0139299 | |||
| 1305 | Ga0496106_0353350 | |||
| 1306 | Ga0496106_0420485 | |||
| 1307 | Ga0496106_0535111 | |||
| 1308 | Ga0496107_0000108 | |||
| 1309 | Ga0496107_0056952 | |||
| 1310 | Ga0496107_0100967 | |||
| 1311 | Ga0496107_0249518 | |||
| 1312 | Ga0496107_0307896 | |||
| 1313 | Ga0496108_0005536 | |||
| 1314 | Ga0496108_0007784 | |||
| 1315 | Ga0496108_0053320 | |||
| 1316 | Ga0496108_0101020 | |||
| 1317 | Ga0496108_0342584 | |||
| 1318 | Ga0496109_0000127 | |||
| 1319 | Ga0496109_0005421 | |||
| 1320 | Ga0496109_0062829 | |||
| 1321 | Ga0496109_0357438 | |||
| 1322 | Ga0496109_0415316 | |||
| 1323 | Ga0496109_0708297 | |||
| 1324 | Ga0496110_0000632 | |||
| 1325 | Ga0496110_0001687 | |||
| 1326 | Ga0496110_0003225 | |||
| 1327 | Ga0496110_0040253 | |||
| 1328 | Ga0496110_0354909 | |||
| 1329 | Ga0496110_0447017 | |||
| 1330 | Ga0496110_0659576 | |||
| 1331 | Ga0496111_0003696 | |||
| 1332 | Ga0496111_0028583 | |||
| 1333 | Ga0496111_0045727 | |||
| 1334 | Ga0496111_0154362 | |||
| 1335 | Ga0496112_0007427 | |||
| 1336 | Ga0496112_0007538 | |||
| 1337 | Ga0496112_0021242 | |||
| 1338 | Ga0496112_0076915 | |||
| 1339 | Ga0496112_0349068 | |||
| 1340 | Ga0496112_0540346 | |||
| 1341 | Ga0496112_0906821 | |||
| 1342 | Ga0496112_0998493 | |||
| 1343 | Ga0496113_0024294 | |||
| 1344 | Ga0496113_0041527 | |||
| 1345 | Ga0496113_0243092 | |||
| 1346 | Ga0496113_0266510 | |||
| 1347 | Ga0496113_0427455 | |||
| 1348 | Ga0496113_0487880 | |||
| 1349 | Ga0496114_0000277 | |||
| 1350 | Ga0496114_0003776 | |||
| 1351 | Ga0496114_0278569 | |||
| 1352 | Ga0496114_0308995 | |||
| 1353 | Ga0496114_0758152 | |||
| 1354 | Ga0496115_0002281 | |||
| 1355 | Ga0496115_0036167 | |||
| 1356 | Ga0496115_0118626 | |||
| 1357 | Ga0496116_0009881 | |||
| 1358 | Ga0496117_0025665 | |||
| 1359 | Ga0496118_0012406 | |||
| 1360 | Ga0496119_0007860 | |||
| 1361 | Ga0496120_0085583 | |||
| 1362 | Ga0496121_0000048 | |||
| 1363 | Ga0496122_0002047 | |||
| 1364 | Ga0496122_0007157 | |||
| 1365 | Ga0496123_0005077 | |||
| 1366 | Ga0496123_0028217 | |||
| 1367 | Ga0496124_0000044 | |||
| 1368 | Ga0496125_0000037 | |||
| 1369 | Ga0496126_0000046 | |||
| 1370 | Ga0496126_0008405 | |||
| 1371 | Ga0501031_0014077 | |||
| 1372 | Ga0501031_0070731 | |||
| 1373 | Ga0501031_0500526 | |||
| 1374 | Ga0501032_0054235 | |||
| 1375 | Ga0501032_0275842 | |||
| 1376 | Ga0501032_0424478 | |||
| 1377 | Ga0501033_0125117 | |||
| 1378 | Ga0501034_0413860 | |||
| 1379 | Ga0501036_0007462 | |||
| 1380 | Ga0501036_0229737 | |||
| 1381 | Ga0501036_0331432 | |||
| 1382 | Ga0501038_0013394 | |||
| 1383 | Ga0501038_0330442 | |||
| 1384 | Ga0501039_0027582 | |||
| 1385 | Ga0501039_1136325 | |||
| 1386 | Ga0501040_0106789 | |||
| 1387 | Ga0501040_0114624 | |||
| 1388 | Ga0501041_0017328 | |||
| 1389 | Ga0501042_0023700 | |||
| 1390 | Ga0501042_0212032 | |||
| 1391 | Ga0501042_0226350 | |||
| 1392 | Ga0501046_0037622 | |||
| 1393 | Ga0501047_0696580 | |||
| 1394 | Ga0501048_0009748 | |||
| 1395 | Ga0501048_0106029 | |||
| 1396 | Ga0501048_0494487 | |||
| 1397 | Ga0501067_0033157 | |||
| 1398 | Ga0501067_0135306 | |||
| 1399 | Ga0501068_0050184 | |||
| 1400 | Ga0501068_0482258 | |||
| 1401 | Ga0501070_0092995 | |||
| 1402 | Ga0501070_0475620 | |||
| 1403 | Ga0501070_0549506 | |||
| 1404 | Ga0501070_0612362 | |||
| 1405 | Ga0501071_0110605 | |||
| 1406 | Ga0501071_0186078 | |||
| 1407 | Ga0501071_0337185 | |||
| 1408 | Ga0501072_0013405 | |||
| 1409 | Ga0501072_0067366 | |||
| 1410 | Ga0501072_0213339 | |||
| 1411 | Ga0501072_0341845 | |||
| 1412 | Ga0501073_0168962 | |||
| 1413 | Ga0501074_0005969 | |||
| 1414 | Ga0501074_0079505 | |||
| 1415 | Ga0501074_0329973 | |||
| 1416 | Ga0501075_0034824 | |||
| 1417 | Ga0501075_0133769 | |||
| 1418 | Ga0501076_0266926 | |||
| 1419 | Ga0501076_0567769 | |||
| 1420 | Ga0501077_0002560 | |||
| 1421 | Ga0501077_0114092 | |||
| 1422 | Ga0501077_0190601 | |||
| 1423 | Ga0501077_0228887 | |||
| 1424 | Ga0501079_0005337 | |||
| 1425 | Ga0501079_0231748 | |||
| 1426 | Ga0501079_0405666 | |||
| 1427 | Ga0501080_0020690 | |||
| 1428 | Ga0501080_0283997 | |||
| 1429 | Ga0501080_0451336 | |||
| 1430 | Ga0501081_0068227 | |||
| 1431 | Ga0501081_0333290 | |||
| 1432 | Ga0501081_0376848 | |||
| 1433 | Ga0501081_0983126 | |||
| 1434 | Ga0501035_0578222 | |||
| 1435 | Ga0501045_0064045 | |||
| 1436 | Ga0501045_0140987 | |||
| 1437 | Ga0501045_0466266 | |||
| 1438 | nmdc:mga00v17_32429_c1 | |||
| 1439 | nmdc:mga0yw44_30198_c1 | |||
| 1440 | nmdc:mga0yw44_312024_c1 | |||
| 1441 | nmdc:mga06z11_119945_c1 | |||
| 1442 | nmdc:mga04h51_212855_c1 | |||
| 1443 | nmdc:mga05p37_101310_c1 | |||
| 1444 | nmdc:mga05p37_283886_c1 | |||
| 1445 | nmdc:mga05p37_497905_c1 | |||
| 1446 | nmdc:mga05p37_799877_c1 | |||
| 1447 | nmdc:mga09592_37795_c1 | |||
| 1448 | nmdc:mga09592_45778_c1 | |||
| 1449 | nmdc:mga0qj67_126988_c1 | |||
| 1450 | nmdc:mga0qj67_29212_c1 | |||
| 1451 | nmdc:mga06r32_1383787_c1 | |||
| 1452 | nmdc:mga06r32_500865_c1 | |||
| 1453 | nmdc:mga06r32_5768_c1 | |||
| 1454 | nmdc:mga06r32_59188_c1 | |||
| 1455 | nmdc:mga06r32_74573_c1 | |||
| 1456 | nmdc:mga06r32_893472_c1 | |||
| 1457 | nmdc:mga08y16_170775_c1 | |||
| 1458 | nmdc:mga08y16_305569_c1 | |||
| 1459 | nmdc:mga08y16_325536_c1 | |||
| 1460 | nmdc:mga08y16_58946_c1 | |||
| 1461 | nmdc:mga08y16_6329_c1 | |||
| 1462 | nmdc:mga08y16_698861_c1 | |||
| 1463 | nmdc:mga08y16_711878_c1 | |||
| 1464 | nmdc:mga0n895_1775470_c1 | |||
| 1465 | nmdc:mga0n895_42287_c1 | |||
| 1466 | nmdc:mga0n895_9300_c1 | |||
| 1467 | nmdc:mga0rr50_163598_c1 | |||
| 1468 | nmdc:mga0rr50_247299_c1 | |||
| 1469 | nmdc:mga08x19_207332_c1 | |||
| 1470 | nmdc:mga08x19_224992_c1 | |||
| 1471 | nmdc:mga08x19_53088_c1 | |||
| 1472 | nmdc:mga0a205_1204365_c1 | |||
| 1473 | nmdc:mga0a205_7015_c1 | |||
| 1474 | nmdc:mga0a205_91657_c1 | |||
| 1475 | nmdc:mga0a205_976526_c1 | |||
| 1476 | Ga0495601_0018521 | |||
| 1477 | Ga0495655_0086296 | |||
| 1478 | Ga0495595_0025743 | |||
| 1479 | Ga0495595_0161539 | |||
| 1480 | Ga0495619_0013544 | |||
| 1481 | Ga0500616_0000221 | |||
| 1482 | Ga0501084_0004889 | |||
| 1483 | Ga0501084_0182373 | |||
| 1484 | Ga0501084_0618795 | |||
| 1485 | Ga0501082_0029608 | |||
| 1486 | Ga0501082_0186486 | |||
| 1487 | Ga0466962_0008688 | |||
| 1488 | Ga0466962_0287455 | |||
| 1489 | Ga0530510_0110230 | |||
| 1490 | Ga0530510_0206660 | |||
| 1491 | Ga0530510_0730274 | |||
| 1492 | 2587864321 | |||
| 1493 | 2643875908 | |||
| 1494 | 2644382963 | |||
| 1495 | 2644538022 | |||
| 1496 | 2644610267 | |||
| 1497 | 2738663811 | |||
| 1498 | 2739142946 | |||
| 1499 | 2852678008 | |||
| 1500 | 2870628054 | |||
| 1501 | 2895663577 | |||
| 1502 | 2939602317 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3uno-assembly1.cif.gz_X | mycobacterium tuberculosis ferritin homolog, bfrb | 0.9846 | 3 | 173 |
| 3oj5-assembly1.cif.gz_A | mycobacterium tuberculosis ferritin homolog, bfrb | 0.9831 | 3 | 158 |
| 3uno-assembly1.cif.gz_F | mycobacterium tuberculosis ferritin homolog, bfrb | 0.983 | 3 | 173 |
| 3uno-assembly1.cif.gz_B | mycobacterium tuberculosis ferritin homolog, bfrb | 0.983 | 3 | 173 |
| 3uno-assembly1.cif.gz_D | mycobacterium tuberculosis ferritin homolog, bfrb | 0.9823 | 3 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qd8H00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.989 | 6 | 173 | 1.20.1260.10 |
| 3oj5A00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9831 | 3 | 158 | 1.20.1260.10 |
| 5gouG00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9758 | 3 | 121 | 1.20.1260.10 |
| 3unoN00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9748 | 3 | 173 | 1.20.1260.10 |
| 5gouO00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9729 | 3 | 121 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538L570-F1-model_v4 | Ferritin | 1.001 | 1 | 141 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008198 GO:0008199 |
| AF-A0A7V9LS47-F1-model_v4 | Ferritin | 1.001 | 1 | 81 |
GO:0008199
|
| AF-A0A5S4ZJV1-F1-model_v4 | deleted | 0.9989 | 1 | 174 |
|
| AF-A0A2H6B9D8-F1-model_v4 | Ferritin (EC 1.16.3.2) | 0.9987 | 1 | 158 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008198 GO:0008199 |
| AF-A0A7C3BNS2-F1-model_v4 | Ferritin (EC 1.16.3.2) | 0.9961 | 3 | 159 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008198 GO:0008199 |