F479118
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 751 | 464 | 1502 | 468 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10009926|Ga0265330_100099264 |
| Length | 565 |
| Sequence | MPATAGLLCMGLFSIFELGAGTGPALRRSAPMRIGWHRDVRRQQVPGDRTAQAAHAPHARELVRDRARKRPARHRSGLTERNLPDIAVPEIPVDEAERPLPPPEPSARNALVDGPILRTLLWLAWPNVVALSAGTCVVIAETSYIGRLGVESLAAMALVFPFVILTMTMSGGAMGXXVASAIARALGAGDTGRASTLATHAMLNAICFGLAFMLGMLIFGPRLLETLGGRGNVLANAVGYAQIFFGGAVLPWLMNSMAGILRGTGNMKLPSLMILSSAVFQIILGGTLGLGLGPIPQFGMRGVASGSLIAYSISITVMGWYLFSGRGRVVPKVAGLRIQWAMFVDILKVGAVSCLSPLQSVLSISIFTHLLARFGTEILAGYGIGARLEFMLTSIAFAVGIASVPMIGMAIGADRIARARRIAWIAGAVGFVSVGAVATLIAIFPDLWVDIFTRDAAVRAASRQYLATAAPMYAFIGLSISMYFSSQGAAKVLGPVLAQTARLAFVAGGGAWLSAHDATAANFFALAAASMVVLGLLSAASVVLTRWGPKGSDPDVRPVLSGMLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 51 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 67 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 68 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 69 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 70 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 111 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 112 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 127 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 128 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 129 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 247 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 255 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 256 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 257 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 259 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 260 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 261 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 262 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 263 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 264 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 265 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 266 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 267 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 270 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 271 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 272 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 273 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 275 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 280 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 281 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 282 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 283 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 284 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 285 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 286 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 287 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 288 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 289 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 290 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 291 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 292 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 293 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 294 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 295 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 296 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 297 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 298 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 299 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 300 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 301 | 2791355199 | |||
| 302 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 303 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 304 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 305 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 306 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 307 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 308 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 309 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 310 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 311 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 312 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 313 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 314 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 315 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 316 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 317 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 318 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 319 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 320 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 321 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 322 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 323 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 324 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 325 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 326 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 327 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 328 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 329 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 330 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 331 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 332 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 333 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 334 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 335 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 336 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 337 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 338 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 339 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 340 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 341 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 342 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 343 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 344 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 345 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 346 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 347 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 348 | 2904699407 | |||
| 349 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 350 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 351 | 2906610324 | |||
| 352 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 353 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 354 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 355 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 356 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 357 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 358 | 2922368715 | |||
| 359 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 360 | 2922425934 | |||
| 361 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 362 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 363 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 364 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 365 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 366 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 367 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 368 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 369 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 370 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 371 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 372 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 373 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 374 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 375 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 376 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 377 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 378 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 379 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 380 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 381 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 382 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 383 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 384 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 385 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 386 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 387 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 388 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 389 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 390 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 391 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 392 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 393 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 394 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 395 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 396 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 397 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 398 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 399 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 400 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 401 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 402 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 403 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 404 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 405 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 406 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 407 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 408 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 409 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 410 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 411 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 412 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 413 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 414 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 415 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 416 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 417 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 418 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 419 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 420 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 421 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 422 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 423 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 424 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 425 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 426 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 427 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 428 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 429 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 430 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 431 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 432 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 433 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 434 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 435 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 436 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 437 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 438 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 439 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 440 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 441 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 442 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 443 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 444 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 445 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 446 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 447 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 448 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 449 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 450 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 451 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 452 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 453 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 454 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 455 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 456 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 457 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 458 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 459 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 460 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 461 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 462 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 463 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 464 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 62.31 |
| Metatranscriptomes | 0 |
| Isolates | 37.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.25 |
| Nodule | 34.49 |
| Rhizoplane | 4.26 |
| Rhizosphere | 40.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265330_10009926 | 3300031235 | Bacteria | 4505 |
| 2 | JGI25406J46586_10021268 | 3300003203 | Bacteria | 2607 |
| 3 | JGI25153J46596_10002490 | 3300003215 | Bacteria | 10574 |
| 4 | JGI25160J50197_1000486 | 3300003354 | Bacteria | 23951 |
| 5 | JGI25160J50197_1013985 | 3300003354 | Bacteria | 2706 |
| 6 | Ga0055531_10010052 | 3300003794 | Bacteria | 4755 |
| 7 | Ga0055543_1001606 | 3300004625 | Bacteria | 8671 |
| 8 | Ga0065165_1001966 | 3300005262 | Bacteria | 19466 |
| 9 | Ga0065165_1002218 | 3300005262 | Bacteria | 17339 |
| 10 | Ga0065165_1003663 | 3300005262 | Bacteria | 10488 |
| 11 | Ga0070658_10020964 | 3300005327 | Bacteria | 5236 |
| 12 | Ga0070683_100007874 | 3300005329 | Bacteria | 9027 |
| 13 | Ga0070683_100082314 | 3300005329 | Bacteria | 3014 |
| 14 | Ga0070683_100091151 | 3300005329 | Bacteria | 2862 |
| 15 | Ga0068869_100069170 | 3300005334 | Bacteria | 2609 |
| 16 | Ga0070680_100030884 | 3300005336 | Bacteria | 4304 |
| 17 | Ga0070660_100116900 | 3300005339 | Bacteria | 2126 |
| 18 | Ga0070661_100046829 | 3300005344 | Bacteria | 3164 |
| 19 | Ga0070668_100026589 | 3300005347 | Bacteria | 4392 |
| 20 | Ga0070668_100044274 | 3300005347 | Bacteria | 3414 |
| 21 | Ga0070669_100117305 | 3300005353 | Bacteria | 2026 |
| 22 | Ga0070671_100081998 | 3300005355 | Bacteria | 2697 |
| 23 | Ga0070671_100102344 | 3300005355 | Bacteria | 2403 |
| 24 | Ga0070674_100018654 | 3300005356 | Bacteria | 4392 |
| 25 | Ga0070659_100050492 | 3300005366 | Bacteria | 3269 |
| 26 | Ga0070709_10033788 | 3300005434 | Bacteria | 3096 |
| 27 | Ga0070713_100059664 | 3300005436 | Bacteria | 3187 |
| 28 | Ga0070710_10045202 | 3300005437 | Bacteria | 2447 |
| 29 | Ga0070711_100009819 | 3300005439 | Bacteria | 5902 |
| 30 | Ga0070663_100005881 | 3300005455 | Bacteria | 7335 |
| 31 | Ga0070663_100026955 | 3300005455 | Bacteria | 3897 |
| 32 | Ga0070663_100047001 | 3300005455 | Bacteria | 3056 |
| 33 | Ga0070678_100015841 | 3300005456 | Bacteria | 4803 |
| 34 | Ga0070678_100105075 | 3300005456 | Bacteria | 2197 |
| 35 | Ga0070681_10018751 | 3300005458 | Bacteria | 6925 |
| 36 | Ga0070681_10053254 | 3300005458 | Bacteria | 4032 |
| 37 | Ga0070681_10140755 | 3300005458 | Bacteria | 2342 |
| 38 | Ga0070706_100236457 | 3300005467 | Bacteria | 1706 |
| 39 | Ga0070679_100010254 | 3300005530 | Bacteria | 8883 |
| 40 | Ga0070679_100038781 | 3300005530 | Bacteria | 4736 |
| 41 | Ga0070679_100150311 | 3300005530 | Bacteria | 2305 |
| 42 | Ga0068853_100220295 | 3300005539 | Bacteria | 1733 |
| 43 | Ga0068853_100225272 | 3300005539 | Bacteria | 1714 |
| 44 | Ga0070672_100169493 | 3300005543 | Bacteria | 1815 |
| 45 | Ga0070665_100009678 | 3300005548 | Bacteria | 9739 |
| 46 | Ga0070665_100046467 | 3300005548 | Bacteria | 4361 |
| 47 | Ga0070665_100216645 | 3300005548 | Bacteria | 1915 |
| 48 | Ga0068855_100086235 | 3300005563 | Bacteria | 3631 |
| 49 | Ga0068855_100123231 | 3300005563 | Bacteria | 2966 |
| 50 | Ga0068856_100000511 | 3300005614 | Bacteria | 42929 |
| 51 | Ga0068861_100028783 | 3300005719 | Bacteria | 4056 |
| 52 | Ga0068861_100051868 | 3300005719 | Bacteria | 3116 |
| 53 | Ga0068858_100040008 | 3300005842 | Bacteria | 4347 |
| 54 | Ga0068858_100100434 | 3300005842 | Bacteria | 2698 |
| 55 | Ga0068860_100000629 | 3300005843 | Bacteria | 41623 |
| 56 | Ga0068860_100060959 | 3300005843 | Bacteria | 3584 |
| 57 | Ga0068862_100094658 | 3300005844 | Bacteria | 2605 |
| 58 | Ga0081455_10004380 | 3300005937 | Bacteria | 15903 |
| 59 | Ga0081455_10166183 | 3300005937 | Bacteria | 1686 |
| 60 | Ga0081540_1000663 | 3300005983 | Bacteria | 32432 |
| 61 | Ga0081540_1001004 | 3300005983 | Bacteria | 25337 |
| 62 | Ga0081540_1004994 | 3300005983 | Bacteria | 9970 |
| 63 | Ga0081540_1007119 | 3300005983 | Bacteria | 8028 |
| 64 | Ga0081540_1023353 | 3300005983 | Bacteria | 3619 |
| 65 | Ga0081539_10000902 | 3300005985 | Bacteria | 56412 |
| 66 | Ga0081539_10078453 | 3300005985 | Bacteria | 1743 |
| 67 | Ga0070717_10018039 | 3300006028 | Bacteria | 5505 |
| 68 | Ga0075365_10009165 | 3300006038 | Bacteria | 5670 |
| 69 | Ga0075365_10063778 | 3300006038 | Bacteria | 2467 |
| 70 | Ga0075368_10007451 | 3300006042 | Bacteria | 3861 |
| 71 | Ga0075368_10030211 | 3300006042 | Bacteria | 2097 |
| 72 | Ga0075368_10032831 | 3300006042 | Bacteria | 2017 |
| 73 | Ga0075363_100004319 | 3300006048 | Bacteria | 6189 |
| 74 | Ga0075367_10041993 | 3300006178 | Bacteria | 2675 |
| 75 | Ga0075369_10023775 | 3300006186 | Bacteria | 2535 |
| 76 | Ga0075369_10041973 | 3300006186 | Bacteria | 1959 |
| 77 | Ga0097621_100047571 | 3300006237 | Bacteria | 3477 |
| 78 | Ga0075370_10089066 | 3300006353 | Bacteria | 1779 |
| 79 | Ga0068871_100053957 | 3300006358 | Bacteria | 3259 |
| 80 | Ga0075434_100021715 | 3300006871 | Bacteria | 6243 |
| 81 | Ga0099822_1009768 | 3300006943 | Bacteria | 12016 |
| 82 | Ga0099823_1046362 | 3300006944 | Bacteria | 2858 |
| 83 | Ga0105240_10002869 | 3300009093 | Bacteria | 27260 |
| 84 | Ga0105240_10059548 | 3300009093 | Bacteria | 4765 |
| 85 | Ga0105240_10073683 | 3300009093 | Bacteria | 4216 |
| 86 | Ga0105240_10176372 | 3300009093 | Bacteria | 2526 |
| 87 | Ga0105240_10239784 | 3300009093 | Bacteria | 2102 |
| 88 | Ga0105245_10049309 | 3300009098 | Bacteria | 3770 |
| 89 | Ga0105247_10002364 | 3300009101 | Bacteria | 12856 |
| 90 | Ga0105247_10014989 | 3300009101 | Bacteria | 4648 |
| 91 | Ga0105243_10126320 | 3300009148 | Bacteria | 2164 |
| 92 | Ga0105241_10031004 | 3300009174 | Bacteria | 3999 |
| 93 | Ga0105237_10040819 | 3300009545 | Bacteria | 4679 |
| 94 | Ga0105237_10055197 | 3300009545 | Bacteria | 3979 |
| 95 | Ga0105237_10083184 | 3300009545 | Bacteria | 3192 |
| 96 | Ga0105239_10060463 | 3300010375 | Bacteria | 4158 |
| 97 | Ga0105239_10139140 | 3300010375 | Bacteria | 2704 |
| 98 | Ga0105239_10188937 | 3300010375 | Bacteria | 2306 |
| 99 | Ga0105239_10336291 | 3300010375 | Bacteria | 1704 |
| 100 | Ga0105246_10004265 | 3300011119 | Bacteria | 8699 |
| 101 | Ga0157374_10006560 | 3300013296 | Bacteria | 9880 |
| 102 | Ga0157378_10004228 | 3300013297 | Bacteria | 12667 |
| 103 | Ga0157375_10013756 | 3300013308 | Bacteria | 7214 |
| 104 | Ga0157375_10171168 | 3300013308 | Bacteria | 2319 |
| 105 | Ga0163163_10026333 | 3300014325 | Bacteria | 5558 |
| 106 | Ga0163163_10037680 | 3300014325 | Bacteria | 4705 |
| 107 | Ga0163163_10162280 | 3300014325 | Bacteria | 2280 |
| 108 | Ga0157380_10114589 | 3300014326 | Bacteria | 2272 |
| 109 | Ga0157376_10021650 | 3300014969 | Bacteria | 4996 |
| 110 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 111 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 112 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 113 | Ga0214545_1020783 | 3300021324 | Bacteria | 5131 |
| 114 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 115 | Ga0214543_1024316 | 3300021327 | Bacteria | 3775 |
| 116 | Ga0209148_1000904 | 3300025254 | Bacteria | 20182 |
| 117 | Ga0209455_1003487 | 3300025272 | Bacteria | 5540 |
| 118 | Ga0209455_1005268 | 3300025272 | Bacteria | 4035 |
| 119 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 120 | Ga0209758_1000389 | 3300025297 | Bacteria | 75919 |
| 121 | Ga0209758_1000716 | 3300025297 | Bacteria | 48984 |
| 122 | Ga0209758_1003057 | 3300025297 | Bacteria | 15903 |
| 123 | Ga0209758_1016615 | 3300025297 | Bacteria | 3727 |
| 124 | Ga0209256_1011453 | 3300025299 | Bacteria | 3544 |
| 125 | Ga0207426_1000380 | 3300025302 | Bacteria | 76046 |
| 126 | Ga0207426_1000832 | 3300025302 | Bacteria | 32765 |
| 127 | Ga0209257_1003856 | 3300025304 | Bacteria | 12259 |
| 128 | Ga0209257_1016175 | 3300025304 | Bacteria | 3040 |
| 129 | Ga0207692_10041252 | 3300025898 | Bacteria | 2283 |
| 130 | Ga0207647_10005598 | 3300025904 | Bacteria | 9180 |
| 131 | Ga0207643_10039734 | 3300025908 | Bacteria | 2647 |
| 132 | Ga0207707_10000712 | 3300025912 | Bacteria | 33048 |
| 133 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 134 | Ga0207695_10063652 | 3300025913 | Bacteria | 3801 |
| 135 | Ga0207695_10065214 | 3300025913 | Bacteria | 3745 |
| 136 | Ga0207671_10063889 | 3300025914 | Bacteria | 2736 |
| 137 | Ga0207671_10189423 | 3300025914 | Bacteria | 1604 |
| 138 | Ga0207693_10024727 | 3300025915 | Bacteria | 4763 |
| 139 | Ga0207693_10089203 | 3300025915 | Bacteria | 2417 |
| 140 | Ga0207663_10005664 | 3300025916 | Bacteria | 6316 |
| 141 | Ga0207663_10062775 | 3300025916 | Bacteria | 2363 |
| 142 | Ga0207657_10023771 | 3300025919 | Bacteria | 5699 |
| 143 | Ga0207657_10082476 | 3300025919 | Bacteria | 2699 |
| 144 | Ga0207657_10101907 | 3300025919 | Bacteria | 2382 |
| 145 | Ga0207649_10049750 | 3300025920 | Bacteria | 2590 |
| 146 | Ga0207652_10006317 | 3300025921 | Bacteria | 9570 |
| 147 | Ga0207681_10071708 | 3300025923 | Bacteria | 2417 |
| 148 | Ga0207687_10095435 | 3300025927 | Bacteria | 2178 |
| 149 | Ga0207700_10156169 | 3300025928 | Bacteria | 1890 |
| 150 | Ga0207700_10184618 | 3300025928 | Bacteria | 1749 |
| 151 | Ga0207690_10072522 | 3300025932 | Bacteria | 2378 |
| 152 | Ga0207690_10141211 | 3300025932 | Bacteria | 1775 |
| 153 | Ga0207704_10114802 | 3300025938 | Bacteria | 1829 |
| 154 | Ga0207691_10123047 | 3300025940 | Bacteria | 2297 |
| 155 | Ga0207691_10172950 | 3300025940 | Bacteria | 1891 |
| 156 | Ga0207691_10205980 | 3300025940 | Bacteria | 1711 |
| 157 | Ga0207689_10018063 | 3300025942 | Bacteria | 5956 |
| 158 | Ga0207689_10061430 | 3300025942 | Bacteria | 3090 |
| 159 | Ga0207661_10007684 | 3300025944 | Bacteria | 7671 |
| 160 | Ga0207661_10136044 | 3300025944 | Bacteria | 2110 |
| 161 | Ga0207667_10203346 | 3300025949 | Bacteria | 2031 |
| 162 | Ga0207712_10038023 | 3300025961 | Bacteria | 3288 |
| 163 | Ga0207668_10067622 | 3300025972 | Bacteria | 2537 |
| 164 | Ga0207677_10021016 | 3300026023 | Bacteria | 3979 |
| 165 | Ga0207677_10077353 | 3300026023 | Bacteria | 2372 |
| 166 | Ga0207703_10038176 | 3300026035 | Bacteria | 3831 |
| 167 | Ga0207703_10144279 | 3300026035 | Bacteria | 2069 |
| 168 | Ga0207639_10203377 | 3300026041 | Bacteria | 1700 |
| 169 | Ga0207678_10006198 | 3300026067 | Bacteria | 10623 |
| 170 | Ga0207678_10013992 | 3300026067 | Bacteria | 7052 |
| 171 | Ga0207678_10022779 | 3300026067 | Bacteria | 5485 |
| 172 | Ga0207678_10022967 | 3300026067 | Bacteria | 5458 |
| 173 | Ga0207678_10050442 | 3300026067 | Bacteria | 3595 |
| 174 | Ga0207678_10090694 | 3300026067 | Bacteria | 2612 |
| 175 | Ga0207708_10146419 | 3300026075 | Bacteria | 1856 |
| 176 | Ga0207702_10000936 | 3300026078 | Bacteria | 30149 |
| 177 | Ga0207676_10063322 | 3300026095 | Bacteria | 2937 |
| 178 | Ga0207674_10080874 | 3300026116 | Bacteria | 3252 |
| 179 | Ga0207675_100014293 | 3300026118 | Bacteria | 7400 |
| 180 | Ga0207675_100024815 | 3300026118 | Bacteria | 5578 |
| 181 | Ga0207683_10034991 | 3300026121 | Bacteria | 4369 |
| 182 | Ga0207683_10051704 | 3300026121 | Bacteria | 3600 |
| 183 | Ga0207698_10101024 | 3300026142 | Bacteria | 2391 |
| 184 | Ga0207698_10136330 | 3300026142 | Bacteria | 2106 |
| 185 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 186 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 187 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 188 | Ga0209489_102237 | 3300027361 | Bacteria | 39491 |
| 189 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 190 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 191 | Ga0268266_10005316 | 3300028379 | Bacteria | 12065 |
| 192 | Ga0268266_10036058 | 3300028379 | Bacteria | 4207 |
| 193 | Ga0268266_10062092 | 3300028379 | Bacteria | 3224 |
| 194 | Ga0268266_10082744 | 3300028379 | Bacteria | 2800 |
| 195 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 196 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 197 | Ga0268264_10100241 | 3300028381 | Bacteria | 2515 |
| 198 | Ga0265334_10003911 | 3300028573 | Bacteria | 6710 |
| 199 | Ga0307517_10002212 | 3300028786 | Bacteria | 31405 |
| 200 | Ga0307515_10086618 | 3300028794 | Bacteria | 3990 |
| 201 | Ga0307511_10049347 | 3300030521 | Bacteria | 3409 |
| 202 | Ga0265330_10020386 | 3300031235 | Bacteria | 3029 |
| 203 | Ga0265332_10004766 | 3300031238 | Bacteria | 6323 |
| 204 | Ga0265325_10011905 | 3300031241 | Bacteria | 4988 |
| 205 | Ga0265327_10037962 | 3300031251 | Bacteria | 2632 |
| 206 | Ga0307509_10046652 | 3300031507 | Bacteria | 4663 |
| 207 | Ga0307509_10053562 | 3300031507 | Bacteria | 4301 |
| 208 | Ga0307508_10000046 | 3300031616 | Bacteria | 139709 |
| 209 | Ga0265314_10002276 | 3300031711 | Bacteria | 19887 |
| 210 | Ga0307516_10064332 | 3300031730 | Bacteria | 3547 |
| 211 | Ga0307510_10013273 | 3300033180 | Bacteria | 9768 |
| 212 | Ga0307510_10038531 | 3300033180 | Bacteria | 5284 |
| 213 | Ga0315911_1000037 | 3300033442 | Bacteria | 62198 |
| 214 | Ga0373926_0023595 | 3300035083 | Bacteria | 2137 |
| 215 | Ga0373923_0010145 | 3300035111 | Bacteria | 3419 |
| 216 | Ga0373936_0015397 | 3300035113 | Bacteria | 2931 |
| 217 | Ga0373956_0002735 | 3300035119 | Bacteria | 7132 |
| 218 | Ga0373956_0008060 | 3300035119 | Bacteria | 4260 |
| 219 | Ga0373956_0035966 | 3300035119 | Bacteria | 2185 |
| 220 | Ga0373957_0005522 | 3300035120 | Bacteria | 3923 |
| 221 | Ga0373957_0021315 | 3300035120 | Bacteria | 2299 |
| 222 | Ga0373943_0010611 | 3300035170 | Bacteria | 4132 |
| 223 | Ga0373955_0000362 | 3300035172 | Bacteria | 19112 |
| 224 | Ga0373955_0015392 | 3300035172 | Bacteria | 3744 |
| 225 | Ga0373924_0007637 | 3300035410 | Bacteria | 3908 |
| 226 | Ga0373931_0103698 | 3300035691 | Bacteria | 1603 |
| 227 | Ga0373935_0014939 | 3300035692 | Bacteria | 4687 |
| 228 | Ga0373927_0015877 | 3300035695 | Bacteria | 4968 |
| 229 | Ga0373927_0018020 | 3300035695 | Bacteria | 4644 |
| 230 | Ga0373927_0051668 | 3300035695 | Bacteria | 2658 |
| 231 | Ga0373927_0058205 | 3300035695 | Bacteria | 2499 |
| 232 | Ga0373927_0066984 | 3300035695 | Bacteria | 2323 |
| 233 | Ga0373947_0021235 | 3300035725 | Bacteria | 3757 |
| 234 | Ga0373947_0068090 | 3300035725 | Bacteria | 2176 |
| 235 | Ga0373947_0103867 | 3300035725 | Bacteria | 1788 |
| 236 | Ga0373925_0127335 | 3300037068 | Bacteria | 1982 |
| 237 | Ga0395900_0000937 | 3300037418 | Bacteria | 38218 |
| 238 | Ga0395900_0301938 | 3300037418 | Bacteria | 1587 |
| 239 | Ga0395898_0005127 | 3300037466 | Bacteria | 14184 |
| 240 | Ga0395905_0003588 | 3300037471 | Bacteria | 16513 |
| 241 | Ga0395901_0006000 | 3300038443 | Bacteria | 12306 |
| 242 | Ga0395901_0266144 | 3300038443 | Bacteria | 1784 |
| 243 | Ga0436365_0494985 | 3300039437 | Bacteria | 2200 |
| 244 | Ga0466969_0021786 | 3300044656 | Bacteria | 3312 |
| 245 | Ga0466966_0001410 | 3300044684 | Bacteria | 15480 |
| 246 | Ga0466966_0054398 | 3300044684 | Bacteria | 2537 |
| 247 | Ga0466961_0000126 | 3300044693 | Bacteria | 51032 |
| 248 | Ga0466963_0015621 | 3300044694 | Bacteria | 4707 |
| 249 | Ga0466964_0046822 | 3300044706 | Bacteria | 1764 |
| 250 | Ga0466959_0024698 | 3300045049 | Bacteria | 4452 |
| 251 | Ga0466967_0009509 | 3300045976 | Bacteria | 7218 |
| 252 | Ga0466967_0038196 | 3300045976 | Bacteria | 4116 |
| 253 | Ga0466967_0118886 | 3300045976 | Bacteria | 2438 |
| 254 | Ga0495617_016610 | 3300046452 | Bacteria | 2490 |
| 255 | Ga0495592_0013853 | 3300046454 | Bacteria | 6129 |
| 256 | Ga0495592_0053573 | 3300046454 | Bacteria | 2992 |
| 257 | Ga0495629_0000232 | 3300046459 | Bacteria | 49422 |
| 258 | Ga0495638_0039595 | 3300046460 | Bacteria | 2991 |
| 259 | Ga0495651_0057782 | 3300046462 | Bacteria | 2978 |
| 260 | Ga0495651_0101272 | 3300046462 | Bacteria | 2144 |
| 261 | Ga0495653_0000575 | 3300046463 | Bacteria | 28178 |
| 262 | Ga0495580_0047564 | 3300046472 | Bacteria | 3040 |
| 263 | Ga0495582_0023646 | 3300046473 | Bacteria | 3361 |
| 264 | Ga0495664_0011282 | 3300046477 | Bacteria | 5035 |
| 265 | Ga0495664_0034067 | 3300046477 | Bacteria | 2994 |
| 266 | Ga0495664_0036953 | 3300046477 | Bacteria | 2881 |
| 267 | Ga0495594_0090126 | 3300046499 | Bacteria | 1718 |
| 268 | Ga0495596_0014340 | 3300046500 | Bacteria | 3340 |
| 269 | Ga0495608_0015029 | 3300046511 | Bacteria | 5370 |
| 270 | Ga0495608_0026272 | 3300046511 | Bacteria | 3970 |
| 271 | Ga0495618_0013963 | 3300046514 | Bacteria | 4889 |
| 272 | Ga0495628_0013829 | 3300046516 | Bacteria | 6781 |
| 273 | Ga0495628_0182785 | 3300046516 | Bacteria | 1585 |
| 274 | Ga0495630_0062696 | 3300046517 | Bacteria | 2792 |
| 275 | Ga0495630_0064075 | 3300046517 | Bacteria | 2761 |
| 276 | Ga0495632_0053649 | 3300046519 | Bacteria | 1979 |
| 277 | Ga0495643_0010141 | 3300046522 | Bacteria | 5810 |
| 278 | Ga0495643_0049611 | 3300046522 | Bacteria | 2263 |
| 279 | Ga0495648_0003301 | 3300046524 | Bacteria | 14240 |
| 280 | Ga0495652_0011732 | 3300046529 | Bacteria | 7915 |
| 281 | Ga0495652_0052602 | 3300046529 | Bacteria | 3472 |
| 282 | Ga0495665_0010436 | 3300046531 | Bacteria | 5026 |
| 283 | Ga0495587_0024903 | 3300046536 | Bacteria | 3662 |
| 284 | Ga0495645_0017382 | 3300046543 | Bacteria | 5151 |
| 285 | Ga0495622_0008202 | 3300046557 | Bacteria | 4840 |
| 286 | Ga0495667_0010074 | 3300046559 | Bacteria | 6400 |
| 287 | Ga0495667_0012506 | 3300046559 | Bacteria | 5756 |
| 288 | Ga0495667_0045785 | 3300046559 | Bacteria | 2895 |
| 289 | Ga0495656_0002893 | 3300046615 | Bacteria | 5752 |
| 290 | Ga0495668_0019741 | 3300046616 | Bacteria | 3879 |
| 291 | Ga0495634_0014105 | 3300046642 | Bacteria | 5769 |
| 292 | Ga0495634_0053881 | 3300046642 | Bacteria | 2693 |
| 293 | Ga0495635_0003059 | 3300046663 | Bacteria | 11500 |
| 294 | Ga0495588_0000925 | 3300046674 | Bacteria | 12755 |
| 295 | Ga0495588_0016193 | 3300046674 | Bacteria | 3600 |
| 296 | Ga0495657_0004169 | 3300046675 | Bacteria | 11581 |
| 297 | Ga0495657_0031592 | 3300046675 | Bacteria | 3700 |
| 298 | Ga0495623_0020382 | 3300046679 | Bacteria | 4284 |
| 299 | Ga0495623_0158821 | 3300046679 | Bacteria | 1330 |
| 300 | Ga0495658_0042373 | 3300046683 | Bacteria | 2541 |
| 301 | Ga0495669_0005200 | 3300046684 | Bacteria | 5415 |
| 302 | Ga0495613_0028370 | 3300046689 | Bacteria | 4162 |
| 303 | Ga0495613_0098766 | 3300046689 | Bacteria | 2110 |
| 304 | Ga0495670_0031359 | 3300046691 | Bacteria | 2641 |
| 305 | Ga0495600_0006845 | 3300046809 | Bacteria | 6950 |
| 306 | Ga0495600_0009465 | 3300046809 | Bacteria | 6020 |
| 307 | Ga0495604_0006998 | 3300047317 | Bacteria | 8937 |
| 308 | Ga0495674_0038647 | 3300047319 | Bacteria | 4282 |
| 309 | Ga0495674_0053176 | 3300047319 | Bacteria | 3561 |
| 310 | Ga0495674_0059405 | 3300047319 | Bacteria | 3339 |
| 311 | Ga0495672_0015053 | 3300047320 | Bacteria | 5265 |
| 312 | Ga0495680_0006684 | 3300047322 | Bacteria | 10679 |
| 313 | Ga0495680_0009328 | 3300047322 | Bacteria | 8839 |
| 314 | Ga0495680_0060039 | 3300047322 | Bacteria | 2933 |
| 315 | Ga0495675_0007212 | 3300047444 | Bacteria | 6847 |
| 316 | Ga0495673_0036960 | 3300047469 | Bacteria | 2235 |
| 317 | Ga0495684_0003117 | 3300047471 | Bacteria | 13012 |
| 318 | Ga0495593_0010211 | 3300047673 | Bacteria | 5428 |
| 319 | Ga0495602_0084304 | 3300048088 | Bacteria | 2659 |
| 320 | Ga0495602_0121943 | 3300048088 | Bacteria | 2096 |
| 321 | Ga0496100_0011081 | 3300048903 | Bacteria | 5118 |
| 322 | Ga0496101_0001519 | 3300048904 | Bacteria | 13894 |
| 323 | Ga0496102_0001311 | 3300048905 | Bacteria | 22329 |
| 324 | Ga0496102_0074689 | 3300048905 | Bacteria | 3116 |
| 325 | Ga0496102_0274144 | 3300048905 | Bacteria | 1590 |
| 326 | Ga0496102_0369965 | 3300048905 | Bacteria | 1349 |
| 327 | Ga0496103_0038577 | 3300048906 | Bacteria | 2932 |
| 328 | Ga0496104_0067821 | 3300048907 | Bacteria | 3389 |
| 329 | Ga0496105_0032123 | 3300048908 | Bacteria | 4306 |
| 330 | Ga0496106_0000545 | 3300048909 | Bacteria | 26754 |
| 331 | Ga0496106_0009293 | 3300048909 | Bacteria | 7264 |
| 332 | Ga0496107_0010055 | 3300048910 | Bacteria | 6563 |
| 333 | Ga0496107_0069687 | 3300048910 | Bacteria | 2553 |
| 334 | Ga0496107_0117289 | 3300048910 | Bacteria | 1960 |
| 335 | Ga0496108_0065028 | 3300048911 | Bacteria | 3073 |
| 336 | Ga0496109_0030548 | 3300048912 | Bacteria | 4829 |
| 337 | Ga0496109_0073885 | 3300048912 | Bacteria | 3133 |
| 338 | Ga0496110_0009861 | 3300048913 | Bacteria | 7741 |
| 339 | Ga0496110_0073347 | 3300048913 | Bacteria | 3038 |
| 340 | Ga0496110_0100605 | 3300048913 | Bacteria | 2591 |
| 341 | Ga0496111_0033229 | 3300048914 | Bacteria | 3678 |
| 342 | Ga0496111_0162619 | 3300048914 | Bacteria | 1657 |
| 343 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 344 | Ga0496112_0126230 | 3300048915 | Bacteria | 2529 |
| 345 | Ga0496112_0133119 | 3300048915 | Bacteria | 2457 |
| 346 | Ga0496112_0194750 | 3300048915 | Bacteria | 1988 |
| 347 | Ga0496113_0032124 | 3300048916 | Bacteria | 3813 |
| 348 | Ga0496114_0064882 | 3300048917 | Bacteria | 3059 |
| 349 | Ga0496115_0001845 | 3300048918 | Bacteria | 15156 |
| 350 | Ga0496115_0079118 | 3300048918 | Bacteria | 2676 |
| 351 | Ga0496115_0092590 | 3300048918 | Bacteria | 2471 |
| 352 | Ga0496117_0008319 | 3300048920 | Bacteria | 9873 |
| 353 | Ga0496117_0046144 | 3300048920 | Bacteria | 3137 |
| 354 | Ga0496118_0001458 | 3300048921 | Bacteria | 35562 |
| 355 | Ga0496118_0004149 | 3300048921 | Bacteria | 17505 |
| 356 | Ga0496119_0026915 | 3300048922 | Bacteria | 3972 |
| 357 | Ga0496119_0043858 | 3300048922 | Bacteria | 2822 |
| 358 | Ga0496119_0066837 | 3300048922 | Bacteria | 2122 |
| 359 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 360 | Ga0496121_0000261 | 3300048924 | Bacteria | 110085 |
| 361 | Ga0496121_0016550 | 3300048924 | Bacteria | 7606 |
| 362 | Ga0496121_0026315 | 3300048924 | Bacteria | 5486 |
| 363 | Ga0496121_0034030 | 3300048924 | Bacteria | 4595 |
| 364 | Ga0496124_0001094 | 3300048927 | Bacteria | 42597 |
| 365 | Ga0496124_0009204 | 3300048927 | Bacteria | 10188 |
| 366 | Ga0496124_0099950 | 3300048927 | Bacteria | 2352 |
| 367 | Ga0496125_0017943 | 3300048928 | Bacteria | 6728 |
| 368 | Ga0496125_0019636 | 3300048928 | Bacteria | 6365 |
| 369 | Ga0496126_0004026 | 3300048929 | Bacteria | 17896 |
| 370 | Ga0496126_0006660 | 3300048929 | Bacteria | 12850 |
| 371 | Ga0496126_0013366 | 3300048929 | Bacteria | 8355 |
| 372 | Ga0496126_0015212 | 3300048929 | Bacteria | 7747 |
| 373 | Ga0496126_0027647 | 3300048929 | Bacteria | 5414 |
| 374 | Ga0496126_0043920 | 3300048929 | Bacteria | 4119 |
| 375 | Ga0496126_0063132 | 3300048929 | Bacteria | 3321 |
| 376 | Ga0496126_0104819 | 3300048929 | Bacteria | 2470 |
| 377 | Ga0501031_0002158 | 3300049568 | Bacteria | 12412 |
| 378 | Ga0501031_0080002 | 3300049568 | Bacteria | 2130 |
| 379 | Ga0501032_0000172 | 3300049569 | Bacteria | 52773 |
| 380 | Ga0501033_0011658 | 3300049570 | Bacteria | 6722 |
| 381 | Ga0501033_0029670 | 3300049570 | Bacteria | 4110 |
| 382 | Ga0501034_0000676 | 3300049571 | Bacteria | 51758 |
| 383 | Ga0501036_0000431 | 3300049572 | Bacteria | 29800 |
| 384 | Ga0501037_0000755 | 3300049573 | Bacteria | 24430 |
| 385 | Ga0501038_0000089 | 3300049574 | Bacteria | 78009 |
| 386 | Ga0501039_0000559 | 3300049575 | Bacteria | 26920 |
| 387 | Ga0501039_0129586 | 3300049575 | Bacteria | 1980 |
| 388 | Ga0501043_0006222 | 3300049579 | Bacteria | 9588 |
| 389 | Ga0501046_0001949 | 3300049580 | Bacteria | 19609 |
| 390 | Ga0501047_0000594 | 3300049581 | Bacteria | 38494 |
| 391 | Ga0501047_0047796 | 3300049581 | Bacteria | 4133 |
| 392 | Ga0501067_0000445 | 3300049583 | Bacteria | 22645 |
| 393 | Ga0501068_0000286 | 3300049584 | Bacteria | 25165 |
| 394 | Ga0501068_0080809 | 3300049584 | Bacteria | 1995 |
| 395 | Ga0501069_0000915 | 3300049585 | Bacteria | 14102 |
| 396 | Ga0501069_0056444 | 3300049585 | Bacteria | 2188 |
| 397 | Ga0501070_0060662 | 3300049586 | Bacteria | 3134 |
| 398 | Ga0501070_0096601 | 3300049586 | Bacteria | 2444 |
| 399 | Ga0501070_0144463 | 3300049586 | Bacteria | 1964 |
| 400 | Ga0501072_0005386 | 3300049588 | Bacteria | 9740 |
| 401 | Ga0501073_0000055 | 3300049589 | Bacteria | 71726 |
| 402 | Ga0501074_0002060 | 3300049590 | Bacteria | 13892 |
| 403 | Ga0501076_0159350 | 3300049592 | Bacteria | 1838 |
| 404 | Ga0501080_0000841 | 3300049742 | Bacteria | 25074 |
| 405 | Ga0501080_0027647 | 3300049742 | Bacteria | 5274 |
| 406 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 407 | Ga0501035_0064904 | 3300049822 | Bacteria | 3244 |
| 408 | Ga0501044_0000546 | 3300049823 | Bacteria | 45906 |
| 409 | Ga0501044_0065137 | 3300049823 | Bacteria | 3717 |
| 410 | nmdc:mga03n38_396_c1 | 3300050490 | Bacteria | 10795 |
| 411 | nmdc:mga00v17_16637_c1 | 3300050491 | Bacteria | 4147 |
| 412 | nmdc:mga00v17_42573_c1 | 3300050491 | Bacteria | 2732 |
| 413 | nmdc:mga0yw44_21632_c1 | 3300050492 | Bacteria | 3592 |
| 414 | nmdc:mga0yw44_23829_c1 | 3300050492 | Bacteria | 3454 |
| 415 | nmdc:mga0k408_43743_c1 | 3300050493 | Bacteria | 2582 |
| 416 | nmdc:mga06z11_104792_c1 | 3300050494 | Bacteria | 1557 |
| 417 | nmdc:mga07m45_10177_c1 | 3300050496 | Bacteria | 4904 |
| 418 | nmdc:mga07m45_13779_c1 | 3300050496 | Bacteria | 4294 |
| 419 | nmdc:mga0n895_12052_c1 | 3300050512 | Bacteria | 7739 |
| 420 | nmdc:mga0sz30_33525_c1 | 3300050516 | Bacteria | 2135 |
| 421 | nmdc:mga0sz30_57419_c1 | 3300050516 | Bacteria | 1659 |
| 422 | Ga0495601_0007416 | 3300053077 | Bacteria | 6429 |
| 423 | Ga0495595_0005106 | 3300053084 | Bacteria | 5305 |
| 424 | Ga0495595_0013939 | 3300053084 | Bacteria | 3403 |
| 425 | Ga0495619_0000458 | 3300053085 | Bacteria | 27498 |
| 426 | Ga0495619_0011276 | 3300053085 | Bacteria | 5623 |
| 427 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 428 | Ga0500643_000091 | 3300053087 | Bacteria | 93825 |
| 429 | Ga0500583_0017985 | 3300053092 | Bacteria | 2863 |
| 430 | Ga0500583_0049960 | 3300053092 | Bacteria | 1937 |
| 431 | Ga0500651_0082018 | 3300053093 | Bacteria | 1997 |
| 432 | Ga0500566_0000095 | 3300053094 | Bacteria | 44474 |
| 433 | Ga0500566_0000565 | 3300053094 | Bacteria | 20802 |
| 434 | Ga0500566_0063903 | 3300053094 | Bacteria | 2078 |
| 435 | Ga0500641_0003302 | 3300053096 | Bacteria | 5710 |
| 436 | Ga0500641_0012365 | 3300053096 | Bacteria | 3115 |
| 437 | Ga0500648_020542 | 3300053097 | Bacteria | 3652 |
| 438 | Ga0500554_001095 | 3300053102 | Bacteria | 5255 |
| 439 | Ga0500555_002648 | 3300053103 | Bacteria | 5154 |
| 440 | Ga0500572_006027 | 3300053111 | Bacteria | 2764 |
| 441 | Ga0500595_001045 | 3300053119 | Bacteria | 15421 |
| 442 | Ga0500595_001996 | 3300053119 | Bacteria | 10454 |
| 443 | Ga0500595_005190 | 3300053119 | Bacteria | 5714 |
| 444 | Ga0500595_010896 | 3300053119 | Bacteria | 3585 |
| 445 | Ga0500642_0000189 | 3300053130 | Bacteria | 25159 |
| 446 | Ga0500559_0001773 | 3300053136 | Bacteria | 11840 |
| 447 | Ga0500559_0022181 | 3300053136 | Bacteria | 2693 |
| 448 | Ga0500573_0032030 | 3300053140 | Bacteria | 3033 |
| 449 | Ga0500603_000264 | 3300053150 | Bacteria | 13814 |
| 450 | Ga0500604_0028082 | 3300053151 | Bacteria | 1632 |
| 451 | Ga0500616_0021736 | 3300053153 | Bacteria | 3591 |
| 452 | Ga0500634_0017382 | 3300053161 | Bacteria | 3851 |
| 453 | Ga0500637_0000075 | 3300053178 | Bacteria | 35551 |
| 454 | Ga0500637_0000269 | 3300053178 | Bacteria | 19469 |
| 455 | Ga0500576_005425 | 3300053725 | Bacteria | 5277 |
| 456 | Ga0500609_001240 | 3300053731 | Bacteria | 3798 |
| 457 | Ga0500596_000453 | 3300053735 | Bacteria | 7623 |
| 458 | Ga0500596_002689 | 3300053735 | Bacteria | 3488 |
| 459 | Ga0500596_002778 | 3300053735 | Bacteria | 3425 |
| 460 | Ga0500601_000069 | 3300053737 | Bacteria | 21313 |
| 461 | Ga0501084_0001259 | 3300054114 | Bacteria | 19951 |
| 462 | Ga0500661_000342 | 3300055283 | Bacteria | 8472 |
| 463 | Ga0501082_0005147 | 3300060353 | Bacteria | 11383 |
| 464 | 2508545800 | 2508501009 | Bacteria | 7784016 |
| 465 | 2508695037 | 2508501042 | Bacteria | 8719808 |
| 466 | 2513649936 | 2513237095 | Bacteria | 8976980 |
| 467 | 2513657363 | 2513237096 | Bacteria | 8722461 |
| 468 | 2513661955 | 2513237096 | Bacteria | 8722461 |
| 469 | 2513673067 | 2513237098 | Bacteria | 9902361 |
| 470 | 2513694816 | 2513237101 | Bacteria | 7952346 |
| 471 | 2513857209 | 2513237137 | Bacteria | 9558895 |
| 472 | 2513874231 | 2513237139 | Bacteria | 8737671 |
| 473 | 2513889763 | 2513237141 | Bacteria | 8496279 |
| 474 | 2513916616 | 2513237145 | Bacteria | 8979722 |
| 475 | 2513923545 | 2513237145 | Bacteria | 8979722 |
| 476 | 2514010003 | 2513237161 | Bacteria | 8871253 |
| 477 | 2515625960 | 2515154112 | Bacteria | 8294334 |
| 478 | 2517887431 | 2517572143 | Bacteria | 9484767 |
| 479 | 2517888149 | 2517572143 | Bacteria | 9484767 |
| 480 | 2524468302 | 2524023210 | Bacteria | 9029266 |
| 481 | 2524533329 | 2524023228 | Bacteria | 10118060 |
| 482 | 2528850295 | 2528768022 | Bacteria | 10457665 |
| 483 | 2528850431 | 2528768022 | Bacteria | 10457665 |
| 484 | 2617353856 | 2617270735 | Bacteria | 9163226 |
| 485 | 2671119385 | 2667528175 | Bacteria | 7532676 |
| 486 | 2723842127 | 2721755755 | Bacteria | 8322773 |
| 487 | 2728753813 | 2728368998 | Bacteria | 8720350 |
| 488 | 2793059365 | 2791355196 | Bacteria | 7323613 |
| 489 | 2793063199 | 2791355196 | Bacteria | 7323613 |
| 490 | 2793072860 | 2791355197 | Bacteria | 8420563 |
| 491 | 2793073469 | 2791355197 | Bacteria | 8420563 |
| 492 | 2793078601 | |||
| 493 | 2793083728 | |||
| 494 | 2805919397 | 2802429603 | Bacteria | 8777136 |
| 495 | 2805922121 | 2802429603 | Bacteria | 8777136 |
| 496 | 2818237180 | 2816332527 | Bacteria | 8933356 |
| 497 | 2818240936 | 2816332527 | Bacteria | 8933356 |
| 498 | 2824663562 | 2824661429 | Bacteria | 9877870 |
| 499 | 2824667388 | 2824661429 | Bacteria | 9877870 |
| 500 | 2824675534 | 2824671348 | Bacteria | 8369588 |
| 501 | 2824677895 | 2824671348 | Bacteria | 8369588 |
| 502 | 2824691756 | 2824687955 | Bacteria | 8360029 |
| 503 | 2824694603 | 2824687955 | Bacteria | 8360029 |
| 504 | 2824698983 | 2824696289 | Bacteria | 8335049 |
| 505 | 2824702781 | 2824696289 | Bacteria | 8335049 |
| 506 | 2824761075 | 2824753945 | Bacteria | 9787441 |
| 507 | 2824771808 | 2824763712 | Bacteria | 9792355 |
| 508 | 2824779750 | 2824773399 | Bacteria | 8360218 |
| 509 | 2824779874 | 2824773399 | Bacteria | 8360218 |
| 510 | 2838129451 | 2838122688 | Bacteria | 8803140 |
| 511 | 2841942515 | 2841941048 | Bacteria | 8688029 |
| 512 | 2841944352 | 2841941048 | Bacteria | 8688029 |
| 513 | 2841953135 | 2841949485 | Bacteria | 8680857 |
| 514 | 2841954471 | 2841949485 | Bacteria | 8680857 |
| 515 | 2841960643 | 2841957949 | Bacteria | 8652217 |
| 516 | 2841969129 | 2841966195 | Bacteria | 8673214 |
| 517 | 2841970841 | 2841966195 | Bacteria | 8673214 |
| 518 | 2841977900 | 2841974524 | Bacteria | 8931498 |
| 519 | 2841979903 | 2841974524 | Bacteria | 8931498 |
| 520 | 2841984535 | 2841983080 | Bacteria | 8395090 |
| 521 | 2841990916 | 2841983080 | Bacteria | 8395090 |
| 522 | 2842041744 | 2842038055 | Bacteria | 8002051 |
| 523 | 2842049786 | 2842045827 | Bacteria | 8006841 |
| 524 | 2844321728 | 2844315083 | Bacteria | 8138177 |
| 525 | 2847932039 | 2847930680 | Bacteria | 9342022 |
| 526 | 2847943276 | 2847939898 | Bacteria | 8606328 |
| 527 | 2849077003 | 2849076700 | Bacteria | 7039503 |
| 528 | 2849082571 | 2849076700 | Bacteria | 7039503 |
| 529 | 2874595679 | 2874590934 | Bacteria | 8299676 |
| 530 | 2874606781 | 2874604998 | Bacteria | 7834745 |
| 531 | 2874610258 | 2874604998 | Bacteria | 7834745 |
| 532 | 2874647718 | 2874645413 | Bacteria | 8214782 |
| 533 | 2874651688 | 2874645413 | Bacteria | 8214782 |
| 534 | 2876770078 | 2876761206 | Bacteria | 10111113 |
| 535 | 2876775874 | 2876771140 | Bacteria | 8287509 |
| 536 | 2876812716 | 2876808645 | Bacteria | 8824342 |
| 537 | 2876821583 | 2876818435 | Bacteria | 8274608 |
| 538 | 2879079965 | 2879074833 | Bacteria | 8279565 |
| 539 | 2879085715 | 2879083081 | Bacteria | 8587928 |
| 540 | 2879100883 | 2879099564 | Bacteria | 10442239 |
| 541 | 2879101843 | 2879099564 | Bacteria | 10442239 |
| 542 | 2879111568 | 2879110137 | Bacteria | 8907982 |
| 543 | 2879130678 | 2879127579 | Bacteria | 8294491 |
| 544 | 2879134049 | 2879127579 | Bacteria | 8294491 |
| 545 | 2879143140 | 2879142872 | Bacteria | 8267021 |
| 546 | 2879148534 | 2879142872 | Bacteria | 8267021 |
| 547 | 2885374448 | 2885366525 | Bacteria | 8326213 |
| 548 | 2885380005 | 2885374607 | Bacteria | 8927485 |
| 549 | 2885384624 | 2885383462 | Bacteria | 9473874 |
| 550 | 2885410897 | 2885409591 | Bacteria | 9235467 |
| 551 | 2888380069 | 2888378607 | Bacteria | 9652610 |
| 552 | 2888391494 | 2888388044 | Bacteria | 7304136 |
| 553 | 2889034960 | 2889033259 | Bacteria | 9099371 |
| 554 | 2903727726 | 2903727486 | Bacteria | 8281579 |
| 555 | 2903754108 | 2903748898 | Bacteria | 9972761 |
| 556 | 2903755939 | 2903748898 | Bacteria | 9972761 |
| 557 | 2903773471 | 2903768456 | Bacteria | 9749579 |
| 558 | 2904691724 | 2904690495 | Bacteria | 9412302 |
| 559 | 2904695728 | 2904690495 | Bacteria | 9412302 |
| 560 | 2904710052 | |||
| 561 | 2904713591 | 2904711408 | Bacteria | 9771557 |
| 562 | 2906602788 | 2906602504 | Bacteria | 8295279 |
| 563 | 2906612638 | |||
| 564 | 2906614489 | |||
| 565 | 2906639968 | 2906635258 | Bacteria | 8601019 |
| 566 | 2906647248 | 2906643746 | Bacteria | 8722424 |
| 567 | 2906666574 | 2906660503 | Bacteria | 8595048 |
| 568 | 2908746681 | 2908739725 | Bacteria | 8628932 |
| 569 | 2908763828 | 2908756301 | Bacteria | 8864324 |
| 570 | 2908764242 | 2908756301 | Bacteria | 8864324 |
| 571 | 2922366859 | 2922361189 | Bacteria | 7436256 |
| 572 | 2922367578 | 2922361189 | Bacteria | 7436256 |
| 573 | 2922378453 | |||
| 574 | 2922391912 | 2922386360 | Bacteria | 7017218 |
| 575 | 2922426324 | |||
| 576 | 2922433135 | |||
| 577 | 2929619839 | 2929615660 | Bacteria | 9193770 |
| 578 | 2929622446 | 2929615660 | Bacteria | 9193770 |
| 579 | 2929629150 | 2929624759 | Bacteria | 9339455 |
| 580 | 2929631337 | 2929624759 | Bacteria | 9339455 |
| 581 | 2932789717 | 2932784394 | Bacteria | 9704911 |
| 582 | 2932805412 | 2932801729 | Bacteria | 7987968 |
| 583 | 2932812680 | 2932809354 | Bacteria | 9135765 |
| 584 | 2932817771 | 2932809354 | Bacteria | 9135765 |
| 585 | 2932823042 | 2932818245 | Bacteria | 9955613 |
| 586 | 2932827118 | 2932818245 | Bacteria | 9955613 |
| 587 | 2932829484 | 2932828146 | Bacteria | 9745859 |
| 588 | 2932835642 | 2932828146 | Bacteria | 9745859 |
| 589 | 2933581758 | 2933577622 | Bacteria | 9116884 |
| 590 | 2933584474 | 2933577622 | Bacteria | 9116884 |
| 591 | 2935613220 | 2935608549 | Bacteria | 8203142 |
| 592 | 2935615051 | 2935608549 | Bacteria | 8203142 |
| 593 | 2935618002 | 2935616580 | Bacteria | 9032984 |
| 594 | 2935624584 | 2935616580 | Bacteria | 9032984 |
| 595 | 2935630632 | 2935630451 | Bacteria | 8169952 |
| 596 | 2935632707 | 2935630451 | Bacteria | 8169952 |
| 597 | 2935641600 | 2935638405 | Bacteria | 10015038 |
| 598 | 2935647189 | 2935638405 | Bacteria | 10015038 |
| 599 | 2935651597 | 2935648319 | Bacteria | 8801166 |
| 600 | 2935655606 | 2935648319 | Bacteria | 8801166 |
| 601 | 2935659635 | 2935656913 | Bacteria | 8965014 |
| 602 | 2935664490 | 2935656913 | Bacteria | 8965014 |
| 603 | 2935669342 | 2935665750 | Bacteria | 9571747 |
| 604 | 2935674348 | 2935665750 | Bacteria | 9571747 |
| 605 | 2935678062 | 2935675223 | Bacteria | 9928132 |
| 606 | 2935684229 | 2935675223 | Bacteria | 9928132 |
| 607 | 2935689100 | 2935684952 | Bacteria | 9590419 |
| 608 | 2935693619 | 2935684952 | Bacteria | 9590419 |
| 609 | 2935697640 | 2935694250 | Bacteria | 9291695 |
| 610 | 2935701701 | 2935694250 | Bacteria | 9291695 |
| 611 | 2935707165 | 2935703347 | Bacteria | 10242284 |
| 612 | 2935711337 | 2935703347 | Bacteria | 10242284 |
| 613 | 2935717008 | 2935713505 | Bacteria | 9608509 |
| 614 | 2935720046 | 2935713505 | Bacteria | 9608509 |
| 615 | 2935728337 | 2935722832 | Bacteria | 9608746 |
| 616 | 2935730158 | 2935722832 | Bacteria | 9608746 |
| 617 | 2935737066 | 2935732158 | Bacteria | 9706831 |
| 618 | 2935738422 | 2935732158 | Bacteria | 9706831 |
| 619 | 2935746873 | 2935741537 | Bacteria | 9707219 |
| 620 | 2935750210 | 2935741537 | Bacteria | 9707219 |
| 621 | 2935757840 | 2935750917 | Bacteria | 9590372 |
| 622 | 2935759804 | 2935750917 | Bacteria | 9590372 |
| 623 | 2935764218 | 2935760218 | Bacteria | 9817913 |
| 624 | 2935764545 | 2935760218 | Bacteria | 9817913 |
| 625 | 2935772867 | 2935769743 | Bacteria | 7878163 |
| 626 | 2935777997 | 2935777560 | Bacteria | 8077691 |
| 627 | 2935787224 | 2935785616 | Bacteria | 7962367 |
| 628 | 2935790182 | 2935785616 | Bacteria | 7962367 |
| 629 | 2935795988 | 2935793552 | Bacteria | 8012592 |
| 630 | 2935798776 | 2935793552 | Bacteria | 8012592 |
| 631 | 2935804454 | 2935801545 | Bacteria | 9301974 |
| 632 | 2935809877 | 2935801545 | Bacteria | 9301974 |
| 633 | 2935817315 | 2935810662 | Bacteria | 9401221 |
| 634 | 2935819342 | 2935810662 | Bacteria | 9401221 |
| 635 | 2935824926 | 2935819856 | Bacteria | 8261050 |
| 636 | 2935825911 | 2935819856 | Bacteria | 8261050 |
| 637 | 2935831331 | 2935827899 | Bacteria | 10038562 |
| 638 | 2935836613 | 2935827899 | Bacteria | 10038562 |
| 639 | 2935841940 | 2935837841 | Bacteria | 9454360 |
| 640 | 2935846823 | 2935837841 | Bacteria | 9454360 |
| 641 | 2935851530 | 2935847175 | Bacteria | 8228321 |
| 642 | 2935852146 | 2935847175 | Bacteria | 8228321 |
| 643 | 2935856499 | 2935855204 | Bacteria | 9035059 |
| 644 | 2935863206 | 2935855204 | Bacteria | 9035059 |
| 645 | 2935868675 | 2935864058 | Bacteria | 9784707 |
| 646 | 2935870959 | 2935864058 | Bacteria | 9784707 |
| 647 | 2935874475 | 2935873716 | Bacteria | 9632195 |
| 648 | 2935879449 | 2935873716 | Bacteria | 9632195 |
| 649 | 2935888991 | 2935883170 | Bacteria | 7964738 |
| 650 | 2935910449 | 2935908558 | Bacteria | 8568796 |
| 651 | 2935911493 | 2935908558 | Bacteria | 8568796 |
| 652 | 2935918257 | 2935916978 | Bacteria | 9113783 |
| 653 | 2935925410 | 2935916978 | Bacteria | 9113783 |
| 654 | 2935927640 | 2935926038 | Bacteria | 8601059 |
| 655 | 2935928522 | 2935926038 | Bacteria | 8601059 |
| 656 | 2935936488 | 2935934488 | Bacteria | 8602579 |
| 657 | 2935938167 | 2935934488 | Bacteria | 8602579 |
| 658 | 2935943959 | 2935942939 | Bacteria | 8599779 |
| 659 | 2935945449 | 2935942939 | Bacteria | 8599779 |
| 660 | 2935952396 | 2935951376 | Bacteria | 8602333 |
| 661 | 2935954045 | 2935951376 | Bacteria | 8602333 |
| 662 | 2935964242 | 2935959822 | Bacteria | 7869783 |
| 663 | 2935969236 | 2935967501 | Bacteria | 8603075 |
| 664 | 2935971687 | 2935967501 | Bacteria | 8603075 |
| 665 | 2935978003 | 2935975950 | Bacteria | 8347125 |
| 666 | 2935980090 | 2935975950 | Bacteria | 8347125 |
| 667 | 2935984697 | 2935984226 | Bacteria | 8302647 |
| 668 | 2935993936 | 2935992306 | Bacteria | 9802711 |
| 669 | 2936000243 | 2935992306 | Bacteria | 9802711 |
| 670 | 2936005053 | 2936002035 | Bacteria | 9362176 |
| 671 | 2936010285 | 2936002035 | Bacteria | 9362176 |
| 672 | 2936014051 | 2936011229 | Bacteria | 8801034 |
| 673 | 2936018556 | 2936011229 | Bacteria | 8801034 |
| 674 | 2936023040 | 2936019824 | Bacteria | 8804134 |
| 675 | 2936027074 | 2936019824 | Bacteria | 8804134 |
| 676 | 2936031176 | 2936028420 | Bacteria | 8965941 |
| 677 | 2936035959 | 2936028420 | Bacteria | 8965941 |
| 678 | 2936044112 | 2936037263 | Bacteria | 9446081 |
| 679 | 2936045965 | 2936037263 | Bacteria | 9446081 |
| 680 | 2936049298 | 2936046547 | Bacteria | 8903709 |
| 681 | 2936054038 | 2936046547 | Bacteria | 8903709 |
| 682 | 2936055867 | 2936055302 | Bacteria | 8785755 |
| 683 | 2940563338 | 2940556831 | Bacteria | 9590747 |
| 684 | 2940565742 | 2940556831 | Bacteria | 9590747 |
| 685 | 2941507284 | 2941507105 | Bacteria | 8166816 |
| 686 | 2941508629 | 2941507105 | Bacteria | 8166816 |
| 687 | 2941515711 | 2941515067 | Bacteria | 8166720 |
| 688 | 2941516459 | 2941515067 | Bacteria | 8166720 |
| 689 | 2941523581 | 2941523033 | Bacteria | 8169134 |
| 690 | 2941524525 | 2941523033 | Bacteria | 8169134 |
| 691 | 2941544013 | 2941538514 | Bacteria | 9402094 |
| 692 | 2941547251 | 2941538514 | Bacteria | 9402094 |
| 693 | 3005475691 | 3005474847 | Bacteria | 9259049 |
| 694 | 3005602077 | 3005594810 | Bacteria | 8716512 |
| 695 | 3005717831 | 3005710791 | Bacteria | 7622528 |
| 696 | 3005724863 | 3005718088 | Bacteria | 8283608 |
| 697 | 8006935025 | 8006933436 | Bacteria | 10410654 |
| 698 | 8006937030 | 8006933436 | Bacteria | 10410654 |
| 699 | 8006965421 | 8006964411 | Bacteria | 8966052 |
| 700 | 8006966454 | 8006964411 | Bacteria | 8966052 |
| 701 | 8006974992 | 8006973647 | Bacteria | 10679141 |
| 702 | 8006976995 | 8006973647 | Bacteria | 10679141 |
| 703 | 8006988605 | 8006984368 | Bacteria | 9651211 |
| 704 | 8006997116 | 8006994254 | Bacteria | 8309700 |
| 705 | 8016518749 | 8016511872 | Bacteria | 9921665 |
| 706 | 8016519173 | 8016511872 | Bacteria | 9921665 |
| 707 | 8016526702 | 8016522445 | Bacteria | 8156687 |
| 708 | 8016531786 | 8016530956 | Bacteria | 8155261 |
| 709 | 8016544991 | 8016539877 | Bacteria | 8155419 |
| 710 | 8016557082 | 8016548790 | Bacteria | 8155074 |
| 711 | 8016565434 | 8016557553 | Bacteria | 8154380 |
| 712 | 8016582637 | 8016575299 | Bacteria | 8154085 |
| 713 | 8016587651 | 8016583857 | Bacteria | 10421953 |
| 714 | 8016603068 | 8016595262 | Bacteria | 8149947 |
| 715 | 8016605973 | 8016603502 | Bacteria | 8731218 |
| 716 | 8016623716 | 8016622563 | Bacteria | 7999408 |
| 717 | 8016636185 | 8016630954 | Bacteria | 9217207 |
| 718 | 8016636894 | 8016630954 | Bacteria | 9217207 |
| 719 | 8017057928 | 8017057580 | Bacteria | 10023680 |
| 720 | 8017066330 | 8017057580 | Bacteria | 10023680 |
| 721 | 8019539921 | 8019538911 | Bacteria | 7872763 |
| 722 | 8019561649 | 8019555841 | Bacteria | 9642137 |
| 723 | 8019573705 | 8019565922 | Bacteria | 9639779 |
| 724 | 8019577795 | 8019576017 | Bacteria | 10049540 |
| 725 | 8019578288 | 8019576017 | Bacteria | 10049540 |
| 726 | 8019595897 | 8019586578 | Bacteria | 10212056 |
| 727 | 8019596323 | 8019586578 | Bacteria | 10212056 |
| 728 | 8019605376 | 8019597564 | Bacteria | 10041141 |
| 729 | 8019605858 | 8019597564 | Bacteria | 10041141 |
| 730 | 8019613167 | 8019608314 | Bacteria | 10042931 |
| 731 | 8019622444 | 8019619141 | Bacteria | 9218857 |
| 732 | 8019623857 | 8019619141 | Bacteria | 9218857 |
| 733 | 8019630670 | 8019629233 | Bacteria | 8687553 |
| 734 | 8019639947 | 8019638758 | Bacteria | 9062356 |
| 735 | 8019641450 | 8019638758 | Bacteria | 9062356 |
| 736 | 8019651976 | 8019648815 | Bacteria | 10014479 |
| 737 | 8019666103 | 8019659431 | Bacteria | 8577854 |
| 738 | 8019667494 | 8019659431 | Bacteria | 8577854 |
| 739 | 8019675615 | 8019668869 | Bacteria | 8791617 |
| 740 | 8019677266 | 8019668869 | Bacteria | 8791617 |
| 741 | 8019678717 | 8019678201 | Bacteria | 8863603 |
| 742 | 8019680484 | 8019678201 | Bacteria | 8863603 |
| 743 | 8019695275 | 8019687851 | Bacteria | 8712826 |
| 744 | 8019696800 | 8019687851 | Bacteria | 8712826 |
| 745 | 8055750408 | 8055742211 | Bacteria | 9226248 |
| 746 | 8055750897 | 8055742211 | Bacteria | 9226248 |
| 747 | 8056678911 | 8056673599 | Bacteria | 7871253 |
| 748 | 8056679315 | 8056673599 | Bacteria | 7871253 |
| 749 | 8056681367 | 8056681323 | Bacteria | 8472857 |
| 750 | 8056695333 | 8056689827 | Bacteria | 6712655 |
| 751 | 8056975581 | 8056967851 | Bacteria | 9038162 |
| 752 | Ga0265330_10009926 | |||
| 753 | JGI25406J46586_10021268 | |||
| 754 | JGI25153J46596_10002490 | |||
| 755 | JGI25160J50197_1000486 | |||
| 756 | JGI25160J50197_1013985 | |||
| 757 | Ga0055531_10010052 | |||
| 758 | Ga0055543_1001606 | |||
| 759 | Ga0065165_1001966 | |||
| 760 | Ga0065165_1002218 | |||
| 761 | Ga0065165_1003663 | |||
| 762 | Ga0070658_10020964 | |||
| 763 | Ga0070683_100007874 | |||
| 764 | Ga0070683_100082314 | |||
| 765 | Ga0070683_100091151 | |||
| 766 | Ga0068869_100069170 | |||
| 767 | Ga0070680_100030884 | |||
| 768 | Ga0070660_100116900 | |||
| 769 | Ga0070661_100046829 | |||
| 770 | Ga0070668_100026589 | |||
| 771 | Ga0070668_100044274 | |||
| 772 | Ga0070669_100117305 | |||
| 773 | Ga0070671_100081998 | |||
| 774 | Ga0070671_100102344 | |||
| 775 | Ga0070674_100018654 | |||
| 776 | Ga0070659_100050492 | |||
| 777 | Ga0070709_10033788 | |||
| 778 | Ga0070713_100059664 | |||
| 779 | Ga0070710_10045202 | |||
| 780 | Ga0070711_100009819 | |||
| 781 | Ga0070663_100005881 | |||
| 782 | Ga0070663_100026955 | |||
| 783 | Ga0070663_100047001 | |||
| 784 | Ga0070678_100015841 | |||
| 785 | Ga0070678_100105075 | |||
| 786 | Ga0070681_10018751 | |||
| 787 | Ga0070681_10053254 | |||
| 788 | Ga0070681_10140755 | |||
| 789 | Ga0070706_100236457 | |||
| 790 | Ga0070679_100010254 | |||
| 791 | Ga0070679_100038781 | |||
| 792 | Ga0070679_100150311 | |||
| 793 | Ga0068853_100220295 | |||
| 794 | Ga0068853_100225272 | |||
| 795 | Ga0070672_100169493 | |||
| 796 | Ga0070665_100009678 | |||
| 797 | Ga0070665_100046467 | |||
| 798 | Ga0070665_100216645 | |||
| 799 | Ga0068855_100086235 | |||
| 800 | Ga0068855_100123231 | |||
| 801 | Ga0068856_100000511 | |||
| 802 | Ga0068861_100028783 | |||
| 803 | Ga0068861_100051868 | |||
| 804 | Ga0068858_100040008 | |||
| 805 | Ga0068858_100100434 | |||
| 806 | Ga0068860_100000629 | |||
| 807 | Ga0068860_100060959 | |||
| 808 | Ga0068862_100094658 | |||
| 809 | Ga0081455_10004380 | |||
| 810 | Ga0081455_10166183 | |||
| 811 | Ga0081540_1000663 | |||
| 812 | Ga0081540_1001004 | |||
| 813 | Ga0081540_1004994 | |||
| 814 | Ga0081540_1007119 | |||
| 815 | Ga0081540_1023353 | |||
| 816 | Ga0081539_10000902 | |||
| 817 | Ga0081539_10078453 | |||
| 818 | Ga0070717_10018039 | |||
| 819 | Ga0075365_10009165 | |||
| 820 | Ga0075365_10063778 | |||
| 821 | Ga0075368_10007451 | |||
| 822 | Ga0075368_10030211 | |||
| 823 | Ga0075368_10032831 | |||
| 824 | Ga0075363_100004319 | |||
| 825 | Ga0075367_10041993 | |||
| 826 | Ga0075369_10023775 | |||
| 827 | Ga0075369_10041973 | |||
| 828 | Ga0097621_100047571 | |||
| 829 | Ga0075370_10089066 | |||
| 830 | Ga0068871_100053957 | |||
| 831 | Ga0075434_100021715 | |||
| 832 | Ga0099822_1009768 | |||
| 833 | Ga0099823_1046362 | |||
| 834 | Ga0105240_10002869 | |||
| 835 | Ga0105240_10059548 | |||
| 836 | Ga0105240_10073683 | |||
| 837 | Ga0105240_10176372 | |||
| 838 | Ga0105240_10239784 | |||
| 839 | Ga0105245_10049309 | |||
| 840 | Ga0105247_10002364 | |||
| 841 | Ga0105247_10014989 | |||
| 842 | Ga0105243_10126320 | |||
| 843 | Ga0105241_10031004 | |||
| 844 | Ga0105237_10040819 | |||
| 845 | Ga0105237_10055197 | |||
| 846 | Ga0105237_10083184 | |||
| 847 | Ga0105239_10060463 | |||
| 848 | Ga0105239_10139140 | |||
| 849 | Ga0105239_10188937 | |||
| 850 | Ga0105239_10336291 | |||
| 851 | Ga0105246_10004265 | |||
| 852 | Ga0157374_10006560 | |||
| 853 | Ga0157378_10004228 | |||
| 854 | Ga0157375_10013756 | |||
| 855 | Ga0157375_10171168 | |||
| 856 | Ga0163163_10026333 | |||
| 857 | Ga0163163_10037680 | |||
| 858 | Ga0163163_10162280 | |||
| 859 | Ga0157380_10114589 | |||
| 860 | Ga0157376_10021650 | |||
| 861 | Ga0214544_1000003 | |||
| 862 | Ga0214542_1000003 | |||
| 863 | Ga0214545_1000004 | |||
| 864 | Ga0214545_1020783 | |||
| 865 | Ga0214543_1000007 | |||
| 866 | Ga0214543_1024316 | |||
| 867 | Ga0209148_1000904 | |||
| 868 | Ga0209455_1003487 | |||
| 869 | Ga0209455_1005268 | |||
| 870 | Ga0209758_1000015 | |||
| 871 | Ga0209758_1000389 | |||
| 872 | Ga0209758_1000716 | |||
| 873 | Ga0209758_1003057 | |||
| 874 | Ga0209758_1016615 | |||
| 875 | Ga0209256_1011453 | |||
| 876 | Ga0207426_1000380 | |||
| 877 | Ga0207426_1000832 | |||
| 878 | Ga0209257_1003856 | |||
| 879 | Ga0209257_1016175 | |||
| 880 | Ga0207692_10041252 | |||
| 881 | Ga0207647_10005598 | |||
| 882 | Ga0207643_10039734 | |||
| 883 | Ga0207707_10000712 | |||
| 884 | Ga0207695_10000065 | |||
| 885 | Ga0207695_10063652 | |||
| 886 | Ga0207695_10065214 | |||
| 887 | Ga0207671_10063889 | |||
| 888 | Ga0207671_10189423 | |||
| 889 | Ga0207693_10024727 | |||
| 890 | Ga0207693_10089203 | |||
| 891 | Ga0207663_10005664 | |||
| 892 | Ga0207663_10062775 | |||
| 893 | Ga0207657_10023771 | |||
| 894 | Ga0207657_10082476 | |||
| 895 | Ga0207657_10101907 | |||
| 896 | Ga0207649_10049750 | |||
| 897 | Ga0207652_10006317 | |||
| 898 | Ga0207681_10071708 | |||
| 899 | Ga0207687_10095435 | |||
| 900 | Ga0207700_10156169 | |||
| 901 | Ga0207700_10184618 | |||
| 902 | Ga0207690_10072522 | |||
| 903 | Ga0207690_10141211 | |||
| 904 | Ga0207704_10114802 | |||
| 905 | Ga0207691_10123047 | |||
| 906 | Ga0207691_10172950 | |||
| 907 | Ga0207691_10205980 | |||
| 908 | Ga0207689_10018063 | |||
| 909 | Ga0207689_10061430 | |||
| 910 | Ga0207661_10007684 | |||
| 911 | Ga0207661_10136044 | |||
| 912 | Ga0207667_10203346 | |||
| 913 | Ga0207712_10038023 | |||
| 914 | Ga0207668_10067622 | |||
| 915 | Ga0207677_10021016 | |||
| 916 | Ga0207677_10077353 | |||
| 917 | Ga0207703_10038176 | |||
| 918 | Ga0207703_10144279 | |||
| 919 | Ga0207639_10203377 | |||
| 920 | Ga0207678_10006198 | |||
| 921 | Ga0207678_10013992 | |||
| 922 | Ga0207678_10022779 | |||
| 923 | Ga0207678_10022967 | |||
| 924 | Ga0207678_10050442 | |||
| 925 | Ga0207678_10090694 | |||
| 926 | Ga0207708_10146419 | |||
| 927 | Ga0207702_10000936 | |||
| 928 | Ga0207676_10063322 | |||
| 929 | Ga0207674_10080874 | |||
| 930 | Ga0207675_100014293 | |||
| 931 | Ga0207675_100024815 | |||
| 932 | Ga0207683_10034991 | |||
| 933 | Ga0207683_10051704 | |||
| 934 | Ga0207698_10101024 | |||
| 935 | Ga0207698_10136330 | |||
| 936 | Ga0209389_1000016 | |||
| 937 | Ga0209589_1000015 | |||
| 938 | Ga0209489_100015 | |||
| 939 | Ga0209489_102237 | |||
| 940 | Ga0209700_100012 | |||
| 941 | Ga0209700_100025 | |||
| 942 | Ga0268266_10005316 | |||
| 943 | Ga0268266_10036058 | |||
| 944 | Ga0268266_10062092 | |||
| 945 | Ga0268266_10082744 | |||
| 946 | Ga0268264_10000042 | |||
| 947 | Ga0268264_10000049 | |||
| 948 | Ga0268264_10100241 | |||
| 949 | Ga0265334_10003911 | |||
| 950 | Ga0307517_10002212 | |||
| 951 | Ga0307515_10086618 | |||
| 952 | Ga0307511_10049347 | |||
| 953 | Ga0265330_10020386 | |||
| 954 | Ga0265332_10004766 | |||
| 955 | Ga0265325_10011905 | |||
| 956 | Ga0265327_10037962 | |||
| 957 | Ga0307509_10046652 | |||
| 958 | Ga0307509_10053562 | |||
| 959 | Ga0307508_10000046 | |||
| 960 | Ga0265314_10002276 | |||
| 961 | Ga0307516_10064332 | |||
| 962 | Ga0307510_10013273 | |||
| 963 | Ga0307510_10038531 | |||
| 964 | Ga0315911_1000037 | |||
| 965 | Ga0373926_0023595 | |||
| 966 | Ga0373923_0010145 | |||
| 967 | Ga0373936_0015397 | |||
| 968 | Ga0373956_0002735 | |||
| 969 | Ga0373956_0008060 | |||
| 970 | Ga0373956_0035966 | |||
| 971 | Ga0373957_0005522 | |||
| 972 | Ga0373957_0021315 | |||
| 973 | Ga0373943_0010611 | |||
| 974 | Ga0373955_0000362 | |||
| 975 | Ga0373955_0015392 | |||
| 976 | Ga0373924_0007637 | |||
| 977 | Ga0373931_0103698 | |||
| 978 | Ga0373935_0014939 | |||
| 979 | Ga0373927_0015877 | |||
| 980 | Ga0373927_0018020 | |||
| 981 | Ga0373927_0051668 | |||
| 982 | Ga0373927_0058205 | |||
| 983 | Ga0373927_0066984 | |||
| 984 | Ga0373947_0021235 | |||
| 985 | Ga0373947_0068090 | |||
| 986 | Ga0373947_0103867 | |||
| 987 | Ga0373925_0127335 | |||
| 988 | Ga0395900_0000937 | |||
| 989 | Ga0395900_0301938 | |||
| 990 | Ga0395898_0005127 | |||
| 991 | Ga0395905_0003588 | |||
| 992 | Ga0395901_0006000 | |||
| 993 | Ga0395901_0266144 | |||
| 994 | Ga0436365_0494985 | |||
| 995 | Ga0466969_0021786 | |||
| 996 | Ga0466966_0001410 | |||
| 997 | Ga0466966_0054398 | |||
| 998 | Ga0466961_0000126 | |||
| 999 | Ga0466963_0015621 | |||
| 1000 | Ga0466964_0046822 | |||
| 1001 | Ga0466959_0024698 | |||
| 1002 | Ga0466967_0009509 | |||
| 1003 | Ga0466967_0038196 | |||
| 1004 | Ga0466967_0118886 | |||
| 1005 | Ga0495617_016610 | |||
| 1006 | Ga0495592_0013853 | |||
| 1007 | Ga0495592_0053573 | |||
| 1008 | Ga0495629_0000232 | |||
| 1009 | Ga0495638_0039595 | |||
| 1010 | Ga0495651_0057782 | |||
| 1011 | Ga0495651_0101272 | |||
| 1012 | Ga0495653_0000575 | |||
| 1013 | Ga0495580_0047564 | |||
| 1014 | Ga0495582_0023646 | |||
| 1015 | Ga0495664_0011282 | |||
| 1016 | Ga0495664_0034067 | |||
| 1017 | Ga0495664_0036953 | |||
| 1018 | Ga0495594_0090126 | |||
| 1019 | Ga0495596_0014340 | |||
| 1020 | Ga0495608_0015029 | |||
| 1021 | Ga0495608_0026272 | |||
| 1022 | Ga0495618_0013963 | |||
| 1023 | Ga0495628_0013829 | |||
| 1024 | Ga0495628_0182785 | |||
| 1025 | Ga0495630_0062696 | |||
| 1026 | Ga0495630_0064075 | |||
| 1027 | Ga0495632_0053649 | |||
| 1028 | Ga0495643_0010141 | |||
| 1029 | Ga0495643_0049611 | |||
| 1030 | Ga0495648_0003301 | |||
| 1031 | Ga0495652_0011732 | |||
| 1032 | Ga0495652_0052602 | |||
| 1033 | Ga0495665_0010436 | |||
| 1034 | Ga0495587_0024903 | |||
| 1035 | Ga0495645_0017382 | |||
| 1036 | Ga0495622_0008202 | |||
| 1037 | Ga0495667_0010074 | |||
| 1038 | Ga0495667_0012506 | |||
| 1039 | Ga0495667_0045785 | |||
| 1040 | Ga0495656_0002893 | |||
| 1041 | Ga0495668_0019741 | |||
| 1042 | Ga0495634_0014105 | |||
| 1043 | Ga0495634_0053881 | |||
| 1044 | Ga0495635_0003059 | |||
| 1045 | Ga0495588_0000925 | |||
| 1046 | Ga0495588_0016193 | |||
| 1047 | Ga0495657_0004169 | |||
| 1048 | Ga0495657_0031592 | |||
| 1049 | Ga0495623_0020382 | |||
| 1050 | Ga0495623_0158821 | |||
| 1051 | Ga0495658_0042373 | |||
| 1052 | Ga0495669_0005200 | |||
| 1053 | Ga0495613_0028370 | |||
| 1054 | Ga0495613_0098766 | |||
| 1055 | Ga0495670_0031359 | |||
| 1056 | Ga0495600_0006845 | |||
| 1057 | Ga0495600_0009465 | |||
| 1058 | Ga0495604_0006998 | |||
| 1059 | Ga0495674_0038647 | |||
| 1060 | Ga0495674_0053176 | |||
| 1061 | Ga0495674_0059405 | |||
| 1062 | Ga0495672_0015053 | |||
| 1063 | Ga0495680_0006684 | |||
| 1064 | Ga0495680_0009328 | |||
| 1065 | Ga0495680_0060039 | |||
| 1066 | Ga0495675_0007212 | |||
| 1067 | Ga0495673_0036960 | |||
| 1068 | Ga0495684_0003117 | |||
| 1069 | Ga0495593_0010211 | |||
| 1070 | Ga0495602_0084304 | |||
| 1071 | Ga0495602_0121943 | |||
| 1072 | Ga0496100_0011081 | |||
| 1073 | Ga0496101_0001519 | |||
| 1074 | Ga0496102_0001311 | |||
| 1075 | Ga0496102_0074689 | |||
| 1076 | Ga0496102_0274144 | |||
| 1077 | Ga0496102_0369965 | |||
| 1078 | Ga0496103_0038577 | |||
| 1079 | Ga0496104_0067821 | |||
| 1080 | Ga0496105_0032123 | |||
| 1081 | Ga0496106_0000545 | |||
| 1082 | Ga0496106_0009293 | |||
| 1083 | Ga0496107_0010055 | |||
| 1084 | Ga0496107_0069687 | |||
| 1085 | Ga0496107_0117289 | |||
| 1086 | Ga0496108_0065028 | |||
| 1087 | Ga0496109_0030548 | |||
| 1088 | Ga0496109_0073885 | |||
| 1089 | Ga0496110_0009861 | |||
| 1090 | Ga0496110_0073347 | |||
| 1091 | Ga0496110_0100605 | |||
| 1092 | Ga0496111_0033229 | |||
| 1093 | Ga0496111_0162619 | |||
| 1094 | Ga0496112_0000019 | |||
| 1095 | Ga0496112_0126230 | |||
| 1096 | Ga0496112_0133119 | |||
| 1097 | Ga0496112_0194750 | |||
| 1098 | Ga0496113_0032124 | |||
| 1099 | Ga0496114_0064882 | |||
| 1100 | Ga0496115_0001845 | |||
| 1101 | Ga0496115_0079118 | |||
| 1102 | Ga0496115_0092590 | |||
| 1103 | Ga0496117_0008319 | |||
| 1104 | Ga0496117_0046144 | |||
| 1105 | Ga0496118_0001458 | |||
| 1106 | Ga0496118_0004149 | |||
| 1107 | Ga0496119_0026915 | |||
| 1108 | Ga0496119_0043858 | |||
| 1109 | Ga0496119_0066837 | |||
| 1110 | Ga0496121_0000146 | |||
| 1111 | Ga0496121_0000261 | |||
| 1112 | Ga0496121_0016550 | |||
| 1113 | Ga0496121_0026315 | |||
| 1114 | Ga0496121_0034030 | |||
| 1115 | Ga0496124_0001094 | |||
| 1116 | Ga0496124_0009204 | |||
| 1117 | Ga0496124_0099950 | |||
| 1118 | Ga0496125_0017943 | |||
| 1119 | Ga0496125_0019636 | |||
| 1120 | Ga0496126_0004026 | |||
| 1121 | Ga0496126_0006660 | |||
| 1122 | Ga0496126_0013366 | |||
| 1123 | Ga0496126_0015212 | |||
| 1124 | Ga0496126_0027647 | |||
| 1125 | Ga0496126_0043920 | |||
| 1126 | Ga0496126_0063132 | |||
| 1127 | Ga0496126_0104819 | |||
| 1128 | Ga0501031_0002158 | |||
| 1129 | Ga0501031_0080002 | |||
| 1130 | Ga0501032_0000172 | |||
| 1131 | Ga0501033_0011658 | |||
| 1132 | Ga0501033_0029670 | |||
| 1133 | Ga0501034_0000676 | |||
| 1134 | Ga0501036_0000431 | |||
| 1135 | Ga0501037_0000755 | |||
| 1136 | Ga0501038_0000089 | |||
| 1137 | Ga0501039_0000559 | |||
| 1138 | Ga0501039_0129586 | |||
| 1139 | Ga0501043_0006222 | |||
| 1140 | Ga0501046_0001949 | |||
| 1141 | Ga0501047_0000594 | |||
| 1142 | Ga0501047_0047796 | |||
| 1143 | Ga0501067_0000445 | |||
| 1144 | Ga0501068_0000286 | |||
| 1145 | Ga0501068_0080809 | |||
| 1146 | Ga0501069_0000915 | |||
| 1147 | Ga0501069_0056444 | |||
| 1148 | Ga0501070_0060662 | |||
| 1149 | Ga0501070_0096601 | |||
| 1150 | Ga0501070_0144463 | |||
| 1151 | Ga0501072_0005386 | |||
| 1152 | Ga0501073_0000055 | |||
| 1153 | Ga0501074_0002060 | |||
| 1154 | Ga0501076_0159350 | |||
| 1155 | Ga0501080_0000841 | |||
| 1156 | Ga0501080_0027647 | |||
| 1157 | Ga0501035_0000150 | |||
| 1158 | Ga0501035_0064904 | |||
| 1159 | Ga0501044_0000546 | |||
| 1160 | Ga0501044_0065137 | |||
| 1161 | nmdc:mga03n38_396_c1 | |||
| 1162 | nmdc:mga00v17_16637_c1 | |||
| 1163 | nmdc:mga00v17_42573_c1 | |||
| 1164 | nmdc:mga0yw44_21632_c1 | |||
| 1165 | nmdc:mga0yw44_23829_c1 | |||
| 1166 | nmdc:mga0k408_43743_c1 | |||
| 1167 | nmdc:mga06z11_104792_c1 | |||
| 1168 | nmdc:mga07m45_10177_c1 | |||
| 1169 | nmdc:mga07m45_13779_c1 | |||
| 1170 | nmdc:mga0n895_12052_c1 | |||
| 1171 | nmdc:mga0sz30_33525_c1 | |||
| 1172 | nmdc:mga0sz30_57419_c1 | |||
| 1173 | Ga0495601_0007416 | |||
| 1174 | Ga0495595_0005106 | |||
| 1175 | Ga0495595_0013939 | |||
| 1176 | Ga0495619_0000458 | |||
| 1177 | Ga0495619_0011276 | |||
| 1178 | Ga0500643_000052 | |||
| 1179 | Ga0500643_000091 | |||
| 1180 | Ga0500583_0017985 | |||
| 1181 | Ga0500583_0049960 | |||
| 1182 | Ga0500651_0082018 | |||
| 1183 | Ga0500566_0000095 | |||
| 1184 | Ga0500566_0000565 | |||
| 1185 | Ga0500566_0063903 | |||
| 1186 | Ga0500641_0003302 | |||
| 1187 | Ga0500641_0012365 | |||
| 1188 | Ga0500648_020542 | |||
| 1189 | Ga0500554_001095 | |||
| 1190 | Ga0500555_002648 | |||
| 1191 | Ga0500572_006027 | |||
| 1192 | Ga0500595_001045 | |||
| 1193 | Ga0500595_001996 | |||
| 1194 | Ga0500595_005190 | |||
| 1195 | Ga0500595_010896 | |||
| 1196 | Ga0500642_0000189 | |||
| 1197 | Ga0500559_0001773 | |||
| 1198 | Ga0500559_0022181 | |||
| 1199 | Ga0500573_0032030 | |||
| 1200 | Ga0500603_000264 | |||
| 1201 | Ga0500604_0028082 | |||
| 1202 | Ga0500616_0021736 | |||
| 1203 | Ga0500634_0017382 | |||
| 1204 | Ga0500637_0000075 | |||
| 1205 | Ga0500637_0000269 | |||
| 1206 | Ga0500576_005425 | |||
| 1207 | Ga0500609_001240 | |||
| 1208 | Ga0500596_000453 | |||
| 1209 | Ga0500596_002689 | |||
| 1210 | Ga0500596_002778 | |||
| 1211 | Ga0500601_000069 | |||
| 1212 | Ga0501084_0001259 | |||
| 1213 | Ga0500661_000342 | |||
| 1214 | Ga0501082_0005147 | |||
| 1215 | 2508545800 | |||
| 1216 | 2508695037 | |||
| 1217 | 2513649936 | |||
| 1218 | 2513657363 | |||
| 1219 | 2513661955 | |||
| 1220 | 2513673067 | |||
| 1221 | 2513694816 | |||
| 1222 | 2513857209 | |||
| 1223 | 2513874231 | |||
| 1224 | 2513889763 | |||
| 1225 | 2513916616 | |||
| 1226 | 2513923545 | |||
| 1227 | 2514010003 | |||
| 1228 | 2515625960 | |||
| 1229 | 2517887431 | |||
| 1230 | 2517888149 | |||
| 1231 | 2524468302 | |||
| 1232 | 2524533329 | |||
| 1233 | 2528850295 | |||
| 1234 | 2528850431 | |||
| 1235 | 2617353856 | |||
| 1236 | 2671119385 | |||
| 1237 | 2723842127 | |||
| 1238 | 2728753813 | |||
| 1239 | 2793059365 | |||
| 1240 | 2793063199 | |||
| 1241 | 2793072860 | |||
| 1242 | 2793073469 | |||
| 1243 | 2793078601 | |||
| 1244 | 2793083728 | |||
| 1245 | 2805919397 | |||
| 1246 | 2805922121 | |||
| 1247 | 2818237180 | |||
| 1248 | 2818240936 | |||
| 1249 | 2824663562 | |||
| 1250 | 2824667388 | |||
| 1251 | 2824675534 | |||
| 1252 | 2824677895 | |||
| 1253 | 2824691756 | |||
| 1254 | 2824694603 | |||
| 1255 | 2824698983 | |||
| 1256 | 2824702781 | |||
| 1257 | 2824761075 | |||
| 1258 | 2824771808 | |||
| 1259 | 2824779750 | |||
| 1260 | 2824779874 | |||
| 1261 | 2838129451 | |||
| 1262 | 2841942515 | |||
| 1263 | 2841944352 | |||
| 1264 | 2841953135 | |||
| 1265 | 2841954471 | |||
| 1266 | 2841960643 | |||
| 1267 | 2841969129 | |||
| 1268 | 2841970841 | |||
| 1269 | 2841977900 | |||
| 1270 | 2841979903 | |||
| 1271 | 2841984535 | |||
| 1272 | 2841990916 | |||
| 1273 | 2842041744 | |||
| 1274 | 2842049786 | |||
| 1275 | 2844321728 | |||
| 1276 | 2847932039 | |||
| 1277 | 2847943276 | |||
| 1278 | 2849077003 | |||
| 1279 | 2849082571 | |||
| 1280 | 2874595679 | |||
| 1281 | 2874606781 | |||
| 1282 | 2874610258 | |||
| 1283 | 2874647718 | |||
| 1284 | 2874651688 | |||
| 1285 | 2876770078 | |||
| 1286 | 2876775874 | |||
| 1287 | 2876812716 | |||
| 1288 | 2876821583 | |||
| 1289 | 2879079965 | |||
| 1290 | 2879085715 | |||
| 1291 | 2879100883 | |||
| 1292 | 2879101843 | |||
| 1293 | 2879111568 | |||
| 1294 | 2879130678 | |||
| 1295 | 2879134049 | |||
| 1296 | 2879143140 | |||
| 1297 | 2879148534 | |||
| 1298 | 2885374448 | |||
| 1299 | 2885380005 | |||
| 1300 | 2885384624 | |||
| 1301 | 2885410897 | |||
| 1302 | 2888380069 | |||
| 1303 | 2888391494 | |||
| 1304 | 2889034960 | |||
| 1305 | 2903727726 | |||
| 1306 | 2903754108 | |||
| 1307 | 2903755939 | |||
| 1308 | 2903773471 | |||
| 1309 | 2904691724 | |||
| 1310 | 2904695728 | |||
| 1311 | 2904710052 | |||
| 1312 | 2904713591 | |||
| 1313 | 2906602788 | |||
| 1314 | 2906612638 | |||
| 1315 | 2906614489 | |||
| 1316 | 2906639968 | |||
| 1317 | 2906647248 | |||
| 1318 | 2906666574 | |||
| 1319 | 2908746681 | |||
| 1320 | 2908763828 | |||
| 1321 | 2908764242 | |||
| 1322 | 2922366859 | |||
| 1323 | 2922367578 | |||
| 1324 | 2922378453 | |||
| 1325 | 2922391912 | |||
| 1326 | 2922426324 | |||
| 1327 | 2922433135 | |||
| 1328 | 2929619839 | |||
| 1329 | 2929622446 | |||
| 1330 | 2929629150 | |||
| 1331 | 2929631337 | |||
| 1332 | 2932789717 | |||
| 1333 | 2932805412 | |||
| 1334 | 2932812680 | |||
| 1335 | 2932817771 | |||
| 1336 | 2932823042 | |||
| 1337 | 2932827118 | |||
| 1338 | 2932829484 | |||
| 1339 | 2932835642 | |||
| 1340 | 2933581758 | |||
| 1341 | 2933584474 | |||
| 1342 | 2935613220 | |||
| 1343 | 2935615051 | |||
| 1344 | 2935618002 | |||
| 1345 | 2935624584 | |||
| 1346 | 2935630632 | |||
| 1347 | 2935632707 | |||
| 1348 | 2935641600 | |||
| 1349 | 2935647189 | |||
| 1350 | 2935651597 | |||
| 1351 | 2935655606 | |||
| 1352 | 2935659635 | |||
| 1353 | 2935664490 | |||
| 1354 | 2935669342 | |||
| 1355 | 2935674348 | |||
| 1356 | 2935678062 | |||
| 1357 | 2935684229 | |||
| 1358 | 2935689100 | |||
| 1359 | 2935693619 | |||
| 1360 | 2935697640 | |||
| 1361 | 2935701701 | |||
| 1362 | 2935707165 | |||
| 1363 | 2935711337 | |||
| 1364 | 2935717008 | |||
| 1365 | 2935720046 | |||
| 1366 | 2935728337 | |||
| 1367 | 2935730158 | |||
| 1368 | 2935737066 | |||
| 1369 | 2935738422 | |||
| 1370 | 2935746873 | |||
| 1371 | 2935750210 | |||
| 1372 | 2935757840 | |||
| 1373 | 2935759804 | |||
| 1374 | 2935764218 | |||
| 1375 | 2935764545 | |||
| 1376 | 2935772867 | |||
| 1377 | 2935777997 | |||
| 1378 | 2935787224 | |||
| 1379 | 2935790182 | |||
| 1380 | 2935795988 | |||
| 1381 | 2935798776 | |||
| 1382 | 2935804454 | |||
| 1383 | 2935809877 | |||
| 1384 | 2935817315 | |||
| 1385 | 2935819342 | |||
| 1386 | 2935824926 | |||
| 1387 | 2935825911 | |||
| 1388 | 2935831331 | |||
| 1389 | 2935836613 | |||
| 1390 | 2935841940 | |||
| 1391 | 2935846823 | |||
| 1392 | 2935851530 | |||
| 1393 | 2935852146 | |||
| 1394 | 2935856499 | |||
| 1395 | 2935863206 | |||
| 1396 | 2935868675 | |||
| 1397 | 2935870959 | |||
| 1398 | 2935874475 | |||
| 1399 | 2935879449 | |||
| 1400 | 2935888991 | |||
| 1401 | 2935910449 | |||
| 1402 | 2935911493 | |||
| 1403 | 2935918257 | |||
| 1404 | 2935925410 | |||
| 1405 | 2935927640 | |||
| 1406 | 2935928522 | |||
| 1407 | 2935936488 | |||
| 1408 | 2935938167 | |||
| 1409 | 2935943959 | |||
| 1410 | 2935945449 | |||
| 1411 | 2935952396 | |||
| 1412 | 2935954045 | |||
| 1413 | 2935964242 | |||
| 1414 | 2935969236 | |||
| 1415 | 2935971687 | |||
| 1416 | 2935978003 | |||
| 1417 | 2935980090 | |||
| 1418 | 2935984697 | |||
| 1419 | 2935993936 | |||
| 1420 | 2936000243 | |||
| 1421 | 2936005053 | |||
| 1422 | 2936010285 | |||
| 1423 | 2936014051 | |||
| 1424 | 2936018556 | |||
| 1425 | 2936023040 | |||
| 1426 | 2936027074 | |||
| 1427 | 2936031176 | |||
| 1428 | 2936035959 | |||
| 1429 | 2936044112 | |||
| 1430 | 2936045965 | |||
| 1431 | 2936049298 | |||
| 1432 | 2936054038 | |||
| 1433 | 2936055867 | |||
| 1434 | 2940563338 | |||
| 1435 | 2940565742 | |||
| 1436 | 2941507284 | |||
| 1437 | 2941508629 | |||
| 1438 | 2941515711 | |||
| 1439 | 2941516459 | |||
| 1440 | 2941523581 | |||
| 1441 | 2941524525 | |||
| 1442 | 2941544013 | |||
| 1443 | 2941547251 | |||
| 1444 | 3005475691 | |||
| 1445 | 3005602077 | |||
| 1446 | 3005717831 | |||
| 1447 | 3005724863 | |||
| 1448 | 8006935025 | |||
| 1449 | 8006937030 | |||
| 1450 | 8006965421 | |||
| 1451 | 8006966454 | |||
| 1452 | 8006974992 | |||
| 1453 | 8006976995 | |||
| 1454 | 8006988605 | |||
| 1455 | 8006997116 | |||
| 1456 | 8016518749 | |||
| 1457 | 8016519173 | |||
| 1458 | 8016526702 | |||
| 1459 | 8016531786 | |||
| 1460 | 8016544991 | |||
| 1461 | 8016557082 | |||
| 1462 | 8016565434 | |||
| 1463 | 8016582637 | |||
| 1464 | 8016587651 | |||
| 1465 | 8016603068 | |||
| 1466 | 8016605973 | |||
| 1467 | 8016623716 | |||
| 1468 | 8016636185 | |||
| 1469 | 8016636894 | |||
| 1470 | 8017057928 | |||
| 1471 | 8017066330 | |||
| 1472 | 8019539921 | |||
| 1473 | 8019561649 | |||
| 1474 | 8019573705 | |||
| 1475 | 8019577795 | |||
| 1476 | 8019578288 | |||
| 1477 | 8019595897 | |||
| 1478 | 8019596323 | |||
| 1479 | 8019605376 | |||
| 1480 | 8019605858 | |||
| 1481 | 8019613167 | |||
| 1482 | 8019622444 | |||
| 1483 | 8019623857 | |||
| 1484 | 8019630670 | |||
| 1485 | 8019639947 | |||
| 1486 | 8019641450 | |||
| 1487 | 8019651976 | |||
| 1488 | 8019666103 | |||
| 1489 | 8019667494 | |||
| 1490 | 8019675615 | |||
| 1491 | 8019677266 | |||
| 1492 | 8019678717 | |||
| 1493 | 8019680484 | |||
| 1494 | 8019695275 | |||
| 1495 | 8019696800 | |||
| 1496 | 8055750408 | |||
| 1497 | 8055750897 | |||
| 1498 | 8056678911 | |||
| 1499 | 8056679315 | |||
| 1500 | 8056681367 | |||
| 1501 | 8056695333 | |||
| 1502 | 8056975581 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hfb-assembly3.cif.gz_C | outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. | 0.9279 | 28 | 459 |
| 3vvr-assembly1.cif.gz_A | crystal structure of mate in complex with mad5 | 0.9278 | 29 | 459 |
| 4mlb-assembly1.cif.gz_C | reverse polarity of binding pocket suggests different function of a mop superfamily transporter from pyrococcus furiosus vc1 (dsm3638) | 0.9269 | 28 | 459 |
| 6ids-assembly1.cif.gz_A | crystal structure of vibrio cholerae mate transporter vcmn d35n mutant | 0.9268 | 34 | 459 |
| 6fv7-assembly1.cif.gz_A | dimer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state | 0.9247 | 38 | 452 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G140_24_185_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.94 | 47 | 200 | 1.20.1250.20 |
| af_Q54YM8_263_426_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9265 | 269 | 423 | 1.20.1250.20 |
| af_P71616_238_398_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9248 | 271 | 420 | 1.20.1250.20 |
| af_Q4DUB5_260_415_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.9201 | 271 | 419 | 1.10.1760.20 |
| af_Q5ACZ4_387_544_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9173 | 48 | 200 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A845M1G5-F1-model_v4 | Probable multidrug resistance protein NorM | 0.9571 | 55 | 235 |
GO:0005886
GO:0015297 GO:0042910 |
| AF-A0A800L727-F1-model_v4 | MATE family efflux transporter | 0.9525 | 94 | 459 |
GO:0005886
GO:0015297 GO:0042910 |
| AF-A0A5C1AT55-F1-model_v4 | Multidrug-efflux transporter | 0.9495 | 36 | 463 |
GO:0005886
GO:0006811 GO:0015297 GO:0042910 |
| AF-A0A6I7P5I1-F1-model_v4 | Multidrug export protein MepA | 0.9478 | 28 | 459 |
GO:0005886
GO:0015297 GO:0042910 GO:0046677 |
| AF-A0A6G3LG90-F1-model_v4 | deleted | 0.9466 | 34 | 379 |
|