F479118

General Info

Members Datasets Scaffolds Average Seq Length
751 464 1502 468

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10009926|Ga0265330_100099264
Length 565
Sequence MPATAGLLCMGLFSIFELGAGTGPALRRSAPMRIGWHRDVRRQQVPGDRTAQAAHAPHARELVRDRARKRPARHRSGLTERNLPDIAVPEIPVDEAERPLPPPEPSARNALVDGPILRTLLWLAWPNVVALSAGTCVVIAETSYIGRLGVESLAAMALVFPFVILTMTMSGGAMGXXVASAIARALGAGDTGRASTLATHAMLNAICFGLAFMLGMLIFGPRLLETLGGRGNVLANAVGYAQIFFGGAVLPWLMNSMAGILRGTGNMKLPSLMILSSAVFQIILGGTLGLGLGPIPQFGMRGVASGSLIAYSISITVMGWYLFSGRGRVVPKVAGLRIQWAMFVDILKVGAVSCLSPLQSVLSISIFTHLLARFGTEILAGYGIGARLEFMLTSIAFAVGIASVPMIGMAIGADRIARARRIAWIAGAVGFVSVGAVATLIAIFPDLWVDIFTRDAAVRAASRQYLATAAPMYAFIGLSISMYFSSQGAAKVLGPVLAQTARLAFVAGGGAWLSAHDATAANFFALAAASMVVLGLLSAASVVLTRWGPKGSDPDVRPVLSGMLD

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
51 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
68 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
69 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
110 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
111 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
112 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
260 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
261 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
262 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
267 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
268 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
273 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
274 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
275 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
280 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
281 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
282 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
283 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
284 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
285 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
286 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
287 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
288 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
289 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
290 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
291 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
292 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
293 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
294 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
295 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
296 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
297 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
298 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
299 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
300 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
301 2791355199
302 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
303 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
304 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
305 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
306 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
307 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
308 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
309 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
310 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
311 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
312 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
313 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
314 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
315 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
316 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
317 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
318 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
319 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
320 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
321 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
322 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
323 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
324 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
325 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
326 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
327 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
328 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
329 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
330 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
331 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
332 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
333 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
334 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
335 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
336 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
337 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
338 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
339 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
340 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
341 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
342 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
343 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
344 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
345 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
346 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
347 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
348 2904699407
349 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
350 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
351 2906610324
352 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
353 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
354 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
355 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
356 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
357 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
358 2922368715
359 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
360 2922425934
361 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
362 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
363 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
364 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
365 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
366 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
367 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
368 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
369 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
370 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
371 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
372 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
373 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
374 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
375 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
376 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
377 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
378 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
379 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
380 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
381 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
382 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
383 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
384 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
385 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
386 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
387 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
388 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
389 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
390 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
391 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
392 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
393 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
394 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
395 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
396 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
397 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
398 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
399 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
400 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
401 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
402 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
403 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
404 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
405 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
406 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
407 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
408 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
409 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
410 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
411 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
412 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
413 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
414 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
415 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
416 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
417 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
418 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
419 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
420 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
421 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
422 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
423 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
424 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
425 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
426 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
427 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
428 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
429 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
430 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
431 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
432 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
433 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
434 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
435 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
436 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
437 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
438 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
439 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
440 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
441 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
442 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
443 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
444 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
445 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
446 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
447 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
448 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
449 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
450 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
451 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
452 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
453 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
454 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
455 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
456 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
457 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
458 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
459 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
460 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
461 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
462 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
463 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
464 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.31
Metatranscriptomes 0
Isolates 37.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.25
Nodule 34.49
Rhizoplane 4.26
Rhizosphere 40.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10009926 3300031235 Bacteria 4505
2 JGI25406J46586_10021268 3300003203 Bacteria 2607
3 JGI25153J46596_10002490 3300003215 Bacteria 10574
4 JGI25160J50197_1000486 3300003354 Bacteria 23951
5 JGI25160J50197_1013985 3300003354 Bacteria 2706
6 Ga0055531_10010052 3300003794 Bacteria 4755
7 Ga0055543_1001606 3300004625 Bacteria 8671
8 Ga0065165_1001966 3300005262 Bacteria 19466
9 Ga0065165_1002218 3300005262 Bacteria 17339
10 Ga0065165_1003663 3300005262 Bacteria 10488
11 Ga0070658_10020964 3300005327 Bacteria 5236
12 Ga0070683_100007874 3300005329 Bacteria 9027
13 Ga0070683_100082314 3300005329 Bacteria 3014
14 Ga0070683_100091151 3300005329 Bacteria 2862
15 Ga0068869_100069170 3300005334 Bacteria 2609
16 Ga0070680_100030884 3300005336 Bacteria 4304
17 Ga0070660_100116900 3300005339 Bacteria 2126
18 Ga0070661_100046829 3300005344 Bacteria 3164
19 Ga0070668_100026589 3300005347 Bacteria 4392
20 Ga0070668_100044274 3300005347 Bacteria 3414
21 Ga0070669_100117305 3300005353 Bacteria 2026
22 Ga0070671_100081998 3300005355 Bacteria 2697
23 Ga0070671_100102344 3300005355 Bacteria 2403
24 Ga0070674_100018654 3300005356 Bacteria 4392
25 Ga0070659_100050492 3300005366 Bacteria 3269
26 Ga0070709_10033788 3300005434 Bacteria 3096
27 Ga0070713_100059664 3300005436 Bacteria 3187
28 Ga0070710_10045202 3300005437 Bacteria 2447
29 Ga0070711_100009819 3300005439 Bacteria 5902
30 Ga0070663_100005881 3300005455 Bacteria 7335
31 Ga0070663_100026955 3300005455 Bacteria 3897
32 Ga0070663_100047001 3300005455 Bacteria 3056
33 Ga0070678_100015841 3300005456 Bacteria 4803
34 Ga0070678_100105075 3300005456 Bacteria 2197
35 Ga0070681_10018751 3300005458 Bacteria 6925
36 Ga0070681_10053254 3300005458 Bacteria 4032
37 Ga0070681_10140755 3300005458 Bacteria 2342
38 Ga0070706_100236457 3300005467 Bacteria 1706
39 Ga0070679_100010254 3300005530 Bacteria 8883
40 Ga0070679_100038781 3300005530 Bacteria 4736
41 Ga0070679_100150311 3300005530 Bacteria 2305
42 Ga0068853_100220295 3300005539 Bacteria 1733
43 Ga0068853_100225272 3300005539 Bacteria 1714
44 Ga0070672_100169493 3300005543 Bacteria 1815
45 Ga0070665_100009678 3300005548 Bacteria 9739
46 Ga0070665_100046467 3300005548 Bacteria 4361
47 Ga0070665_100216645 3300005548 Bacteria 1915
48 Ga0068855_100086235 3300005563 Bacteria 3631
49 Ga0068855_100123231 3300005563 Bacteria 2966
50 Ga0068856_100000511 3300005614 Bacteria 42929
51 Ga0068861_100028783 3300005719 Bacteria 4056
52 Ga0068861_100051868 3300005719 Bacteria 3116
53 Ga0068858_100040008 3300005842 Bacteria 4347
54 Ga0068858_100100434 3300005842 Bacteria 2698
55 Ga0068860_100000629 3300005843 Bacteria 41623
56 Ga0068860_100060959 3300005843 Bacteria 3584
57 Ga0068862_100094658 3300005844 Bacteria 2605
58 Ga0081455_10004380 3300005937 Bacteria 15903
59 Ga0081455_10166183 3300005937 Bacteria 1686
60 Ga0081540_1000663 3300005983 Bacteria 32432
61 Ga0081540_1001004 3300005983 Bacteria 25337
62 Ga0081540_1004994 3300005983 Bacteria 9970
63 Ga0081540_1007119 3300005983 Bacteria 8028
64 Ga0081540_1023353 3300005983 Bacteria 3619
65 Ga0081539_10000902 3300005985 Bacteria 56412
66 Ga0081539_10078453 3300005985 Bacteria 1743
67 Ga0070717_10018039 3300006028 Bacteria 5505
68 Ga0075365_10009165 3300006038 Bacteria 5670
69 Ga0075365_10063778 3300006038 Bacteria 2467
70 Ga0075368_10007451 3300006042 Bacteria 3861
71 Ga0075368_10030211 3300006042 Bacteria 2097
72 Ga0075368_10032831 3300006042 Bacteria 2017
73 Ga0075363_100004319 3300006048 Bacteria 6189
74 Ga0075367_10041993 3300006178 Bacteria 2675
75 Ga0075369_10023775 3300006186 Bacteria 2535
76 Ga0075369_10041973 3300006186 Bacteria 1959
77 Ga0097621_100047571 3300006237 Bacteria 3477
78 Ga0075370_10089066 3300006353 Bacteria 1779
79 Ga0068871_100053957 3300006358 Bacteria 3259
80 Ga0075434_100021715 3300006871 Bacteria 6243
81 Ga0099822_1009768 3300006943 Bacteria 12016
82 Ga0099823_1046362 3300006944 Bacteria 2858
83 Ga0105240_10002869 3300009093 Bacteria 27260
84 Ga0105240_10059548 3300009093 Bacteria 4765
85 Ga0105240_10073683 3300009093 Bacteria 4216
86 Ga0105240_10176372 3300009093 Bacteria 2526
87 Ga0105240_10239784 3300009093 Bacteria 2102
88 Ga0105245_10049309 3300009098 Bacteria 3770
89 Ga0105247_10002364 3300009101 Bacteria 12856
90 Ga0105247_10014989 3300009101 Bacteria 4648
91 Ga0105243_10126320 3300009148 Bacteria 2164
92 Ga0105241_10031004 3300009174 Bacteria 3999
93 Ga0105237_10040819 3300009545 Bacteria 4679
94 Ga0105237_10055197 3300009545 Bacteria 3979
95 Ga0105237_10083184 3300009545 Bacteria 3192
96 Ga0105239_10060463 3300010375 Bacteria 4158
97 Ga0105239_10139140 3300010375 Bacteria 2704
98 Ga0105239_10188937 3300010375 Bacteria 2306
99 Ga0105239_10336291 3300010375 Bacteria 1704
100 Ga0105246_10004265 3300011119 Bacteria 8699
101 Ga0157374_10006560 3300013296 Bacteria 9880
102 Ga0157378_10004228 3300013297 Bacteria 12667
103 Ga0157375_10013756 3300013308 Bacteria 7214
104 Ga0157375_10171168 3300013308 Bacteria 2319
105 Ga0163163_10026333 3300014325 Bacteria 5558
106 Ga0163163_10037680 3300014325 Bacteria 4705
107 Ga0163163_10162280 3300014325 Bacteria 2280
108 Ga0157380_10114589 3300014326 Bacteria 2272
109 Ga0157376_10021650 3300014969 Bacteria 4996
110 Ga0214544_1000003 3300021320 Bacteria 643752
111 Ga0214542_1000003 3300021321 Bacteria 435700
112 Ga0214545_1000004 3300021324 Bacteria 453352
113 Ga0214545_1020783 3300021324 Bacteria 5131
114 Ga0214543_1000007 3300021327 Bacteria 414744
115 Ga0214543_1024316 3300021327 Bacteria 3775
116 Ga0209148_1000904 3300025254 Bacteria 20182
117 Ga0209455_1003487 3300025272 Bacteria 5540
118 Ga0209455_1005268 3300025272 Bacteria 4035
119 Ga0209758_1000015 3300025297 Bacteria 851943
120 Ga0209758_1000389 3300025297 Bacteria 75919
121 Ga0209758_1000716 3300025297 Bacteria 48984
122 Ga0209758_1003057 3300025297 Bacteria 15903
123 Ga0209758_1016615 3300025297 Bacteria 3727
124 Ga0209256_1011453 3300025299 Bacteria 3544
125 Ga0207426_1000380 3300025302 Bacteria 76046
126 Ga0207426_1000832 3300025302 Bacteria 32765
127 Ga0209257_1003856 3300025304 Bacteria 12259
128 Ga0209257_1016175 3300025304 Bacteria 3040
129 Ga0207692_10041252 3300025898 Bacteria 2283
130 Ga0207647_10005598 3300025904 Bacteria 9180
131 Ga0207643_10039734 3300025908 Bacteria 2647
132 Ga0207707_10000712 3300025912 Bacteria 33048
133 Ga0207695_10000065 3300025913 Bacteria 336949
134 Ga0207695_10063652 3300025913 Bacteria 3801
135 Ga0207695_10065214 3300025913 Bacteria 3745
136 Ga0207671_10063889 3300025914 Bacteria 2736
137 Ga0207671_10189423 3300025914 Bacteria 1604
138 Ga0207693_10024727 3300025915 Bacteria 4763
139 Ga0207693_10089203 3300025915 Bacteria 2417
140 Ga0207663_10005664 3300025916 Bacteria 6316
141 Ga0207663_10062775 3300025916 Bacteria 2363
142 Ga0207657_10023771 3300025919 Bacteria 5699
143 Ga0207657_10082476 3300025919 Bacteria 2699
144 Ga0207657_10101907 3300025919 Bacteria 2382
145 Ga0207649_10049750 3300025920 Bacteria 2590
146 Ga0207652_10006317 3300025921 Bacteria 9570
147 Ga0207681_10071708 3300025923 Bacteria 2417
148 Ga0207687_10095435 3300025927 Bacteria 2178
149 Ga0207700_10156169 3300025928 Bacteria 1890
150 Ga0207700_10184618 3300025928 Bacteria 1749
151 Ga0207690_10072522 3300025932 Bacteria 2378
152 Ga0207690_10141211 3300025932 Bacteria 1775
153 Ga0207704_10114802 3300025938 Bacteria 1829
154 Ga0207691_10123047 3300025940 Bacteria 2297
155 Ga0207691_10172950 3300025940 Bacteria 1891
156 Ga0207691_10205980 3300025940 Bacteria 1711
157 Ga0207689_10018063 3300025942 Bacteria 5956
158 Ga0207689_10061430 3300025942 Bacteria 3090
159 Ga0207661_10007684 3300025944 Bacteria 7671
160 Ga0207661_10136044 3300025944 Bacteria 2110
161 Ga0207667_10203346 3300025949 Bacteria 2031
162 Ga0207712_10038023 3300025961 Bacteria 3288
163 Ga0207668_10067622 3300025972 Bacteria 2537
164 Ga0207677_10021016 3300026023 Bacteria 3979
165 Ga0207677_10077353 3300026023 Bacteria 2372
166 Ga0207703_10038176 3300026035 Bacteria 3831
167 Ga0207703_10144279 3300026035 Bacteria 2069
168 Ga0207639_10203377 3300026041 Bacteria 1700
169 Ga0207678_10006198 3300026067 Bacteria 10623
170 Ga0207678_10013992 3300026067 Bacteria 7052
171 Ga0207678_10022779 3300026067 Bacteria 5485
172 Ga0207678_10022967 3300026067 Bacteria 5458
173 Ga0207678_10050442 3300026067 Bacteria 3595
174 Ga0207678_10090694 3300026067 Bacteria 2612
175 Ga0207708_10146419 3300026075 Bacteria 1856
176 Ga0207702_10000936 3300026078 Bacteria 30149
177 Ga0207676_10063322 3300026095 Bacteria 2937
178 Ga0207674_10080874 3300026116 Bacteria 3252
179 Ga0207675_100014293 3300026118 Bacteria 7400
180 Ga0207675_100024815 3300026118 Bacteria 5578
181 Ga0207683_10034991 3300026121 Bacteria 4369
182 Ga0207683_10051704 3300026121 Bacteria 3600
183 Ga0207698_10101024 3300026142 Bacteria 2391
184 Ga0207698_10136330 3300026142 Bacteria 2106
185 Ga0209389_1000016 3300027296 Bacteria 184844
186 Ga0209589_1000015 3300027357 Bacteria 225913
187 Ga0209489_100015 3300027361 Bacteria 225913
188 Ga0209489_102237 3300027361 Bacteria 39491
189 Ga0209700_100012 3300027363 Bacteria 357892
190 Ga0209700_100025 3300027363 Bacteria 225913
191 Ga0268266_10005316 3300028379 Bacteria 12065
192 Ga0268266_10036058 3300028379 Bacteria 4207
193 Ga0268266_10062092 3300028379 Bacteria 3224
194 Ga0268266_10082744 3300028379 Bacteria 2800
195 Ga0268264_10000042 3300028381 Bacteria 372069
196 Ga0268264_10000049 3300028381 Bacteria 329992
197 Ga0268264_10100241 3300028381 Bacteria 2515
198 Ga0265334_10003911 3300028573 Bacteria 6710
199 Ga0307517_10002212 3300028786 Bacteria 31405
200 Ga0307515_10086618 3300028794 Bacteria 3990
201 Ga0307511_10049347 3300030521 Bacteria 3409
202 Ga0265330_10020386 3300031235 Bacteria 3029
203 Ga0265332_10004766 3300031238 Bacteria 6323
204 Ga0265325_10011905 3300031241 Bacteria 4988
205 Ga0265327_10037962 3300031251 Bacteria 2632
206 Ga0307509_10046652 3300031507 Bacteria 4663
207 Ga0307509_10053562 3300031507 Bacteria 4301
208 Ga0307508_10000046 3300031616 Bacteria 139709
209 Ga0265314_10002276 3300031711 Bacteria 19887
210 Ga0307516_10064332 3300031730 Bacteria 3547
211 Ga0307510_10013273 3300033180 Bacteria 9768
212 Ga0307510_10038531 3300033180 Bacteria 5284
213 Ga0315911_1000037 3300033442 Bacteria 62198
214 Ga0373926_0023595 3300035083 Bacteria 2137
215 Ga0373923_0010145 3300035111 Bacteria 3419
216 Ga0373936_0015397 3300035113 Bacteria 2931
217 Ga0373956_0002735 3300035119 Bacteria 7132
218 Ga0373956_0008060 3300035119 Bacteria 4260
219 Ga0373956_0035966 3300035119 Bacteria 2185
220 Ga0373957_0005522 3300035120 Bacteria 3923
221 Ga0373957_0021315 3300035120 Bacteria 2299
222 Ga0373943_0010611 3300035170 Bacteria 4132
223 Ga0373955_0000362 3300035172 Bacteria 19112
224 Ga0373955_0015392 3300035172 Bacteria 3744
225 Ga0373924_0007637 3300035410 Bacteria 3908
226 Ga0373931_0103698 3300035691 Bacteria 1603
227 Ga0373935_0014939 3300035692 Bacteria 4687
228 Ga0373927_0015877 3300035695 Bacteria 4968
229 Ga0373927_0018020 3300035695 Bacteria 4644
230 Ga0373927_0051668 3300035695 Bacteria 2658
231 Ga0373927_0058205 3300035695 Bacteria 2499
232 Ga0373927_0066984 3300035695 Bacteria 2323
233 Ga0373947_0021235 3300035725 Bacteria 3757
234 Ga0373947_0068090 3300035725 Bacteria 2176
235 Ga0373947_0103867 3300035725 Bacteria 1788
236 Ga0373925_0127335 3300037068 Bacteria 1982
237 Ga0395900_0000937 3300037418 Bacteria 38218
238 Ga0395900_0301938 3300037418 Bacteria 1587
239 Ga0395898_0005127 3300037466 Bacteria 14184
240 Ga0395905_0003588 3300037471 Bacteria 16513
241 Ga0395901_0006000 3300038443 Bacteria 12306
242 Ga0395901_0266144 3300038443 Bacteria 1784
243 Ga0436365_0494985 3300039437 Bacteria 2200
244 Ga0466969_0021786 3300044656 Bacteria 3312
245 Ga0466966_0001410 3300044684 Bacteria 15480
246 Ga0466966_0054398 3300044684 Bacteria 2537
247 Ga0466961_0000126 3300044693 Bacteria 51032
248 Ga0466963_0015621 3300044694 Bacteria 4707
249 Ga0466964_0046822 3300044706 Bacteria 1764
250 Ga0466959_0024698 3300045049 Bacteria 4452
251 Ga0466967_0009509 3300045976 Bacteria 7218
252 Ga0466967_0038196 3300045976 Bacteria 4116
253 Ga0466967_0118886 3300045976 Bacteria 2438
254 Ga0495617_016610 3300046452 Bacteria 2490
255 Ga0495592_0013853 3300046454 Bacteria 6129
256 Ga0495592_0053573 3300046454 Bacteria 2992
257 Ga0495629_0000232 3300046459 Bacteria 49422
258 Ga0495638_0039595 3300046460 Bacteria 2991
259 Ga0495651_0057782 3300046462 Bacteria 2978
260 Ga0495651_0101272 3300046462 Bacteria 2144
261 Ga0495653_0000575 3300046463 Bacteria 28178
262 Ga0495580_0047564 3300046472 Bacteria 3040
263 Ga0495582_0023646 3300046473 Bacteria 3361
264 Ga0495664_0011282 3300046477 Bacteria 5035
265 Ga0495664_0034067 3300046477 Bacteria 2994
266 Ga0495664_0036953 3300046477 Bacteria 2881
267 Ga0495594_0090126 3300046499 Bacteria 1718
268 Ga0495596_0014340 3300046500 Bacteria 3340
269 Ga0495608_0015029 3300046511 Bacteria 5370
270 Ga0495608_0026272 3300046511 Bacteria 3970
271 Ga0495618_0013963 3300046514 Bacteria 4889
272 Ga0495628_0013829 3300046516 Bacteria 6781
273 Ga0495628_0182785 3300046516 Bacteria 1585
274 Ga0495630_0062696 3300046517 Bacteria 2792
275 Ga0495630_0064075 3300046517 Bacteria 2761
276 Ga0495632_0053649 3300046519 Bacteria 1979
277 Ga0495643_0010141 3300046522 Bacteria 5810
278 Ga0495643_0049611 3300046522 Bacteria 2263
279 Ga0495648_0003301 3300046524 Bacteria 14240
280 Ga0495652_0011732 3300046529 Bacteria 7915
281 Ga0495652_0052602 3300046529 Bacteria 3472
282 Ga0495665_0010436 3300046531 Bacteria 5026
283 Ga0495587_0024903 3300046536 Bacteria 3662
284 Ga0495645_0017382 3300046543 Bacteria 5151
285 Ga0495622_0008202 3300046557 Bacteria 4840
286 Ga0495667_0010074 3300046559 Bacteria 6400
287 Ga0495667_0012506 3300046559 Bacteria 5756
288 Ga0495667_0045785 3300046559 Bacteria 2895
289 Ga0495656_0002893 3300046615 Bacteria 5752
290 Ga0495668_0019741 3300046616 Bacteria 3879
291 Ga0495634_0014105 3300046642 Bacteria 5769
292 Ga0495634_0053881 3300046642 Bacteria 2693
293 Ga0495635_0003059 3300046663 Bacteria 11500
294 Ga0495588_0000925 3300046674 Bacteria 12755
295 Ga0495588_0016193 3300046674 Bacteria 3600
296 Ga0495657_0004169 3300046675 Bacteria 11581
297 Ga0495657_0031592 3300046675 Bacteria 3700
298 Ga0495623_0020382 3300046679 Bacteria 4284
299 Ga0495623_0158821 3300046679 Bacteria 1330
300 Ga0495658_0042373 3300046683 Bacteria 2541
301 Ga0495669_0005200 3300046684 Bacteria 5415
302 Ga0495613_0028370 3300046689 Bacteria 4162
303 Ga0495613_0098766 3300046689 Bacteria 2110
304 Ga0495670_0031359 3300046691 Bacteria 2641
305 Ga0495600_0006845 3300046809 Bacteria 6950
306 Ga0495600_0009465 3300046809 Bacteria 6020
307 Ga0495604_0006998 3300047317 Bacteria 8937
308 Ga0495674_0038647 3300047319 Bacteria 4282
309 Ga0495674_0053176 3300047319 Bacteria 3561
310 Ga0495674_0059405 3300047319 Bacteria 3339
311 Ga0495672_0015053 3300047320 Bacteria 5265
312 Ga0495680_0006684 3300047322 Bacteria 10679
313 Ga0495680_0009328 3300047322 Bacteria 8839
314 Ga0495680_0060039 3300047322 Bacteria 2933
315 Ga0495675_0007212 3300047444 Bacteria 6847
316 Ga0495673_0036960 3300047469 Bacteria 2235
317 Ga0495684_0003117 3300047471 Bacteria 13012
318 Ga0495593_0010211 3300047673 Bacteria 5428
319 Ga0495602_0084304 3300048088 Bacteria 2659
320 Ga0495602_0121943 3300048088 Bacteria 2096
321 Ga0496100_0011081 3300048903 Bacteria 5118
322 Ga0496101_0001519 3300048904 Bacteria 13894
323 Ga0496102_0001311 3300048905 Bacteria 22329
324 Ga0496102_0074689 3300048905 Bacteria 3116
325 Ga0496102_0274144 3300048905 Bacteria 1590
326 Ga0496102_0369965 3300048905 Bacteria 1349
327 Ga0496103_0038577 3300048906 Bacteria 2932
328 Ga0496104_0067821 3300048907 Bacteria 3389
329 Ga0496105_0032123 3300048908 Bacteria 4306
330 Ga0496106_0000545 3300048909 Bacteria 26754
331 Ga0496106_0009293 3300048909 Bacteria 7264
332 Ga0496107_0010055 3300048910 Bacteria 6563
333 Ga0496107_0069687 3300048910 Bacteria 2553
334 Ga0496107_0117289 3300048910 Bacteria 1960
335 Ga0496108_0065028 3300048911 Bacteria 3073
336 Ga0496109_0030548 3300048912 Bacteria 4829
337 Ga0496109_0073885 3300048912 Bacteria 3133
338 Ga0496110_0009861 3300048913 Bacteria 7741
339 Ga0496110_0073347 3300048913 Bacteria 3038
340 Ga0496110_0100605 3300048913 Bacteria 2591
341 Ga0496111_0033229 3300048914 Bacteria 3678
342 Ga0496111_0162619 3300048914 Bacteria 1657
343 Ga0496112_0000019 3300048915 Bacteria 185531
344 Ga0496112_0126230 3300048915 Bacteria 2529
345 Ga0496112_0133119 3300048915 Bacteria 2457
346 Ga0496112_0194750 3300048915 Bacteria 1988
347 Ga0496113_0032124 3300048916 Bacteria 3813
348 Ga0496114_0064882 3300048917 Bacteria 3059
349 Ga0496115_0001845 3300048918 Bacteria 15156
350 Ga0496115_0079118 3300048918 Bacteria 2676
351 Ga0496115_0092590 3300048918 Bacteria 2471
352 Ga0496117_0008319 3300048920 Bacteria 9873
353 Ga0496117_0046144 3300048920 Bacteria 3137
354 Ga0496118_0001458 3300048921 Bacteria 35562
355 Ga0496118_0004149 3300048921 Bacteria 17505
356 Ga0496119_0026915 3300048922 Bacteria 3972
357 Ga0496119_0043858 3300048922 Bacteria 2822
358 Ga0496119_0066837 3300048922 Bacteria 2122
359 Ga0496121_0000146 3300048924 Bacteria 154459
360 Ga0496121_0000261 3300048924 Bacteria 110085
361 Ga0496121_0016550 3300048924 Bacteria 7606
362 Ga0496121_0026315 3300048924 Bacteria 5486
363 Ga0496121_0034030 3300048924 Bacteria 4595
364 Ga0496124_0001094 3300048927 Bacteria 42597
365 Ga0496124_0009204 3300048927 Bacteria 10188
366 Ga0496124_0099950 3300048927 Bacteria 2352
367 Ga0496125_0017943 3300048928 Bacteria 6728
368 Ga0496125_0019636 3300048928 Bacteria 6365
369 Ga0496126_0004026 3300048929 Bacteria 17896
370 Ga0496126_0006660 3300048929 Bacteria 12850
371 Ga0496126_0013366 3300048929 Bacteria 8355
372 Ga0496126_0015212 3300048929 Bacteria 7747
373 Ga0496126_0027647 3300048929 Bacteria 5414
374 Ga0496126_0043920 3300048929 Bacteria 4119
375 Ga0496126_0063132 3300048929 Bacteria 3321
376 Ga0496126_0104819 3300048929 Bacteria 2470
377 Ga0501031_0002158 3300049568 Bacteria 12412
378 Ga0501031_0080002 3300049568 Bacteria 2130
379 Ga0501032_0000172 3300049569 Bacteria 52773
380 Ga0501033_0011658 3300049570 Bacteria 6722
381 Ga0501033_0029670 3300049570 Bacteria 4110
382 Ga0501034_0000676 3300049571 Bacteria 51758
383 Ga0501036_0000431 3300049572 Bacteria 29800
384 Ga0501037_0000755 3300049573 Bacteria 24430
385 Ga0501038_0000089 3300049574 Bacteria 78009
386 Ga0501039_0000559 3300049575 Bacteria 26920
387 Ga0501039_0129586 3300049575 Bacteria 1980
388 Ga0501043_0006222 3300049579 Bacteria 9588
389 Ga0501046_0001949 3300049580 Bacteria 19609
390 Ga0501047_0000594 3300049581 Bacteria 38494
391 Ga0501047_0047796 3300049581 Bacteria 4133
392 Ga0501067_0000445 3300049583 Bacteria 22645
393 Ga0501068_0000286 3300049584 Bacteria 25165
394 Ga0501068_0080809 3300049584 Bacteria 1995
395 Ga0501069_0000915 3300049585 Bacteria 14102
396 Ga0501069_0056444 3300049585 Bacteria 2188
397 Ga0501070_0060662 3300049586 Bacteria 3134
398 Ga0501070_0096601 3300049586 Bacteria 2444
399 Ga0501070_0144463 3300049586 Bacteria 1964
400 Ga0501072_0005386 3300049588 Bacteria 9740
401 Ga0501073_0000055 3300049589 Bacteria 71726
402 Ga0501074_0002060 3300049590 Bacteria 13892
403 Ga0501076_0159350 3300049592 Bacteria 1838
404 Ga0501080_0000841 3300049742 Bacteria 25074
405 Ga0501080_0027647 3300049742 Bacteria 5274
406 Ga0501035_0000150 3300049822 Bacteria 85450
407 Ga0501035_0064904 3300049822 Bacteria 3244
408 Ga0501044_0000546 3300049823 Bacteria 45906
409 Ga0501044_0065137 3300049823 Bacteria 3717
410 nmdc:mga03n38_396_c1 3300050490 Bacteria 10795
411 nmdc:mga00v17_16637_c1 3300050491 Bacteria 4147
412 nmdc:mga00v17_42573_c1 3300050491 Bacteria 2732
413 nmdc:mga0yw44_21632_c1 3300050492 Bacteria 3592
414 nmdc:mga0yw44_23829_c1 3300050492 Bacteria 3454
415 nmdc:mga0k408_43743_c1 3300050493 Bacteria 2582
416 nmdc:mga06z11_104792_c1 3300050494 Bacteria 1557
417 nmdc:mga07m45_10177_c1 3300050496 Bacteria 4904
418 nmdc:mga07m45_13779_c1 3300050496 Bacteria 4294
419 nmdc:mga0n895_12052_c1 3300050512 Bacteria 7739
420 nmdc:mga0sz30_33525_c1 3300050516 Bacteria 2135
421 nmdc:mga0sz30_57419_c1 3300050516 Bacteria 1659
422 Ga0495601_0007416 3300053077 Bacteria 6429
423 Ga0495595_0005106 3300053084 Bacteria 5305
424 Ga0495595_0013939 3300053084 Bacteria 3403
425 Ga0495619_0000458 3300053085 Bacteria 27498
426 Ga0495619_0011276 3300053085 Bacteria 5623
427 Ga0500643_000052 3300053087 Bacteria 144656
428 Ga0500643_000091 3300053087 Bacteria 93825
429 Ga0500583_0017985 3300053092 Bacteria 2863
430 Ga0500583_0049960 3300053092 Bacteria 1937
431 Ga0500651_0082018 3300053093 Bacteria 1997
432 Ga0500566_0000095 3300053094 Bacteria 44474
433 Ga0500566_0000565 3300053094 Bacteria 20802
434 Ga0500566_0063903 3300053094 Bacteria 2078
435 Ga0500641_0003302 3300053096 Bacteria 5710
436 Ga0500641_0012365 3300053096 Bacteria 3115
437 Ga0500648_020542 3300053097 Bacteria 3652
438 Ga0500554_001095 3300053102 Bacteria 5255
439 Ga0500555_002648 3300053103 Bacteria 5154
440 Ga0500572_006027 3300053111 Bacteria 2764
441 Ga0500595_001045 3300053119 Bacteria 15421
442 Ga0500595_001996 3300053119 Bacteria 10454
443 Ga0500595_005190 3300053119 Bacteria 5714
444 Ga0500595_010896 3300053119 Bacteria 3585
445 Ga0500642_0000189 3300053130 Bacteria 25159
446 Ga0500559_0001773 3300053136 Bacteria 11840
447 Ga0500559_0022181 3300053136 Bacteria 2693
448 Ga0500573_0032030 3300053140 Bacteria 3033
449 Ga0500603_000264 3300053150 Bacteria 13814
450 Ga0500604_0028082 3300053151 Bacteria 1632
451 Ga0500616_0021736 3300053153 Bacteria 3591
452 Ga0500634_0017382 3300053161 Bacteria 3851
453 Ga0500637_0000075 3300053178 Bacteria 35551
454 Ga0500637_0000269 3300053178 Bacteria 19469
455 Ga0500576_005425 3300053725 Bacteria 5277
456 Ga0500609_001240 3300053731 Bacteria 3798
457 Ga0500596_000453 3300053735 Bacteria 7623
458 Ga0500596_002689 3300053735 Bacteria 3488
459 Ga0500596_002778 3300053735 Bacteria 3425
460 Ga0500601_000069 3300053737 Bacteria 21313
461 Ga0501084_0001259 3300054114 Bacteria 19951
462 Ga0500661_000342 3300055283 Bacteria 8472
463 Ga0501082_0005147 3300060353 Bacteria 11383
464 2508545800 2508501009 Bacteria 7784016
465 2508695037 2508501042 Bacteria 8719808
466 2513649936 2513237095 Bacteria 8976980
467 2513657363 2513237096 Bacteria 8722461
468 2513661955 2513237096 Bacteria 8722461
469 2513673067 2513237098 Bacteria 9902361
470 2513694816 2513237101 Bacteria 7952346
471 2513857209 2513237137 Bacteria 9558895
472 2513874231 2513237139 Bacteria 8737671
473 2513889763 2513237141 Bacteria 8496279
474 2513916616 2513237145 Bacteria 8979722
475 2513923545 2513237145 Bacteria 8979722
476 2514010003 2513237161 Bacteria 8871253
477 2515625960 2515154112 Bacteria 8294334
478 2517887431 2517572143 Bacteria 9484767
479 2517888149 2517572143 Bacteria 9484767
480 2524468302 2524023210 Bacteria 9029266
481 2524533329 2524023228 Bacteria 10118060
482 2528850295 2528768022 Bacteria 10457665
483 2528850431 2528768022 Bacteria 10457665
484 2617353856 2617270735 Bacteria 9163226
485 2671119385 2667528175 Bacteria 7532676
486 2723842127 2721755755 Bacteria 8322773
487 2728753813 2728368998 Bacteria 8720350
488 2793059365 2791355196 Bacteria 7323613
489 2793063199 2791355196 Bacteria 7323613
490 2793072860 2791355197 Bacteria 8420563
491 2793073469 2791355197 Bacteria 8420563
492 2793078601
493 2793083728
494 2805919397 2802429603 Bacteria 8777136
495 2805922121 2802429603 Bacteria 8777136
496 2818237180 2816332527 Bacteria 8933356
497 2818240936 2816332527 Bacteria 8933356
498 2824663562 2824661429 Bacteria 9877870
499 2824667388 2824661429 Bacteria 9877870
500 2824675534 2824671348 Bacteria 8369588
501 2824677895 2824671348 Bacteria 8369588
502 2824691756 2824687955 Bacteria 8360029
503 2824694603 2824687955 Bacteria 8360029
504 2824698983 2824696289 Bacteria 8335049
505 2824702781 2824696289 Bacteria 8335049
506 2824761075 2824753945 Bacteria 9787441
507 2824771808 2824763712 Bacteria 9792355
508 2824779750 2824773399 Bacteria 8360218
509 2824779874 2824773399 Bacteria 8360218
510 2838129451 2838122688 Bacteria 8803140
511 2841942515 2841941048 Bacteria 8688029
512 2841944352 2841941048 Bacteria 8688029
513 2841953135 2841949485 Bacteria 8680857
514 2841954471 2841949485 Bacteria 8680857
515 2841960643 2841957949 Bacteria 8652217
516 2841969129 2841966195 Bacteria 8673214
517 2841970841 2841966195 Bacteria 8673214
518 2841977900 2841974524 Bacteria 8931498
519 2841979903 2841974524 Bacteria 8931498
520 2841984535 2841983080 Bacteria 8395090
521 2841990916 2841983080 Bacteria 8395090
522 2842041744 2842038055 Bacteria 8002051
523 2842049786 2842045827 Bacteria 8006841
524 2844321728 2844315083 Bacteria 8138177
525 2847932039 2847930680 Bacteria 9342022
526 2847943276 2847939898 Bacteria 8606328
527 2849077003 2849076700 Bacteria 7039503
528 2849082571 2849076700 Bacteria 7039503
529 2874595679 2874590934 Bacteria 8299676
530 2874606781 2874604998 Bacteria 7834745
531 2874610258 2874604998 Bacteria 7834745
532 2874647718 2874645413 Bacteria 8214782
533 2874651688 2874645413 Bacteria 8214782
534 2876770078 2876761206 Bacteria 10111113
535 2876775874 2876771140 Bacteria 8287509
536 2876812716 2876808645 Bacteria 8824342
537 2876821583 2876818435 Bacteria 8274608
538 2879079965 2879074833 Bacteria 8279565
539 2879085715 2879083081 Bacteria 8587928
540 2879100883 2879099564 Bacteria 10442239
541 2879101843 2879099564 Bacteria 10442239
542 2879111568 2879110137 Bacteria 8907982
543 2879130678 2879127579 Bacteria 8294491
544 2879134049 2879127579 Bacteria 8294491
545 2879143140 2879142872 Bacteria 8267021
546 2879148534 2879142872 Bacteria 8267021
547 2885374448 2885366525 Bacteria 8326213
548 2885380005 2885374607 Bacteria 8927485
549 2885384624 2885383462 Bacteria 9473874
550 2885410897 2885409591 Bacteria 9235467
551 2888380069 2888378607 Bacteria 9652610
552 2888391494 2888388044 Bacteria 7304136
553 2889034960 2889033259 Bacteria 9099371
554 2903727726 2903727486 Bacteria 8281579
555 2903754108 2903748898 Bacteria 9972761
556 2903755939 2903748898 Bacteria 9972761
557 2903773471 2903768456 Bacteria 9749579
558 2904691724 2904690495 Bacteria 9412302
559 2904695728 2904690495 Bacteria 9412302
560 2904710052
561 2904713591 2904711408 Bacteria 9771557
562 2906602788 2906602504 Bacteria 8295279
563 2906612638
564 2906614489
565 2906639968 2906635258 Bacteria 8601019
566 2906647248 2906643746 Bacteria 8722424
567 2906666574 2906660503 Bacteria 8595048
568 2908746681 2908739725 Bacteria 8628932
569 2908763828 2908756301 Bacteria 8864324
570 2908764242 2908756301 Bacteria 8864324
571 2922366859 2922361189 Bacteria 7436256
572 2922367578 2922361189 Bacteria 7436256
573 2922378453
574 2922391912 2922386360 Bacteria 7017218
575 2922426324
576 2922433135
577 2929619839 2929615660 Bacteria 9193770
578 2929622446 2929615660 Bacteria 9193770
579 2929629150 2929624759 Bacteria 9339455
580 2929631337 2929624759 Bacteria 9339455
581 2932789717 2932784394 Bacteria 9704911
582 2932805412 2932801729 Bacteria 7987968
583 2932812680 2932809354 Bacteria 9135765
584 2932817771 2932809354 Bacteria 9135765
585 2932823042 2932818245 Bacteria 9955613
586 2932827118 2932818245 Bacteria 9955613
587 2932829484 2932828146 Bacteria 9745859
588 2932835642 2932828146 Bacteria 9745859
589 2933581758 2933577622 Bacteria 9116884
590 2933584474 2933577622 Bacteria 9116884
591 2935613220 2935608549 Bacteria 8203142
592 2935615051 2935608549 Bacteria 8203142
593 2935618002 2935616580 Bacteria 9032984
594 2935624584 2935616580 Bacteria 9032984
595 2935630632 2935630451 Bacteria 8169952
596 2935632707 2935630451 Bacteria 8169952
597 2935641600 2935638405 Bacteria 10015038
598 2935647189 2935638405 Bacteria 10015038
599 2935651597 2935648319 Bacteria 8801166
600 2935655606 2935648319 Bacteria 8801166
601 2935659635 2935656913 Bacteria 8965014
602 2935664490 2935656913 Bacteria 8965014
603 2935669342 2935665750 Bacteria 9571747
604 2935674348 2935665750 Bacteria 9571747
605 2935678062 2935675223 Bacteria 9928132
606 2935684229 2935675223 Bacteria 9928132
607 2935689100 2935684952 Bacteria 9590419
608 2935693619 2935684952 Bacteria 9590419
609 2935697640 2935694250 Bacteria 9291695
610 2935701701 2935694250 Bacteria 9291695
611 2935707165 2935703347 Bacteria 10242284
612 2935711337 2935703347 Bacteria 10242284
613 2935717008 2935713505 Bacteria 9608509
614 2935720046 2935713505 Bacteria 9608509
615 2935728337 2935722832 Bacteria 9608746
616 2935730158 2935722832 Bacteria 9608746
617 2935737066 2935732158 Bacteria 9706831
618 2935738422 2935732158 Bacteria 9706831
619 2935746873 2935741537 Bacteria 9707219
620 2935750210 2935741537 Bacteria 9707219
621 2935757840 2935750917 Bacteria 9590372
622 2935759804 2935750917 Bacteria 9590372
623 2935764218 2935760218 Bacteria 9817913
624 2935764545 2935760218 Bacteria 9817913
625 2935772867 2935769743 Bacteria 7878163
626 2935777997 2935777560 Bacteria 8077691
627 2935787224 2935785616 Bacteria 7962367
628 2935790182 2935785616 Bacteria 7962367
629 2935795988 2935793552 Bacteria 8012592
630 2935798776 2935793552 Bacteria 8012592
631 2935804454 2935801545 Bacteria 9301974
632 2935809877 2935801545 Bacteria 9301974
633 2935817315 2935810662 Bacteria 9401221
634 2935819342 2935810662 Bacteria 9401221
635 2935824926 2935819856 Bacteria 8261050
636 2935825911 2935819856 Bacteria 8261050
637 2935831331 2935827899 Bacteria 10038562
638 2935836613 2935827899 Bacteria 10038562
639 2935841940 2935837841 Bacteria 9454360
640 2935846823 2935837841 Bacteria 9454360
641 2935851530 2935847175 Bacteria 8228321
642 2935852146 2935847175 Bacteria 8228321
643 2935856499 2935855204 Bacteria 9035059
644 2935863206 2935855204 Bacteria 9035059
645 2935868675 2935864058 Bacteria 9784707
646 2935870959 2935864058 Bacteria 9784707
647 2935874475 2935873716 Bacteria 9632195
648 2935879449 2935873716 Bacteria 9632195
649 2935888991 2935883170 Bacteria 7964738
650 2935910449 2935908558 Bacteria 8568796
651 2935911493 2935908558 Bacteria 8568796
652 2935918257 2935916978 Bacteria 9113783
653 2935925410 2935916978 Bacteria 9113783
654 2935927640 2935926038 Bacteria 8601059
655 2935928522 2935926038 Bacteria 8601059
656 2935936488 2935934488 Bacteria 8602579
657 2935938167 2935934488 Bacteria 8602579
658 2935943959 2935942939 Bacteria 8599779
659 2935945449 2935942939 Bacteria 8599779
660 2935952396 2935951376 Bacteria 8602333
661 2935954045 2935951376 Bacteria 8602333
662 2935964242 2935959822 Bacteria 7869783
663 2935969236 2935967501 Bacteria 8603075
664 2935971687 2935967501 Bacteria 8603075
665 2935978003 2935975950 Bacteria 8347125
666 2935980090 2935975950 Bacteria 8347125
667 2935984697 2935984226 Bacteria 8302647
668 2935993936 2935992306 Bacteria 9802711
669 2936000243 2935992306 Bacteria 9802711
670 2936005053 2936002035 Bacteria 9362176
671 2936010285 2936002035 Bacteria 9362176
672 2936014051 2936011229 Bacteria 8801034
673 2936018556 2936011229 Bacteria 8801034
674 2936023040 2936019824 Bacteria 8804134
675 2936027074 2936019824 Bacteria 8804134
676 2936031176 2936028420 Bacteria 8965941
677 2936035959 2936028420 Bacteria 8965941
678 2936044112 2936037263 Bacteria 9446081
679 2936045965 2936037263 Bacteria 9446081
680 2936049298 2936046547 Bacteria 8903709
681 2936054038 2936046547 Bacteria 8903709
682 2936055867 2936055302 Bacteria 8785755
683 2940563338 2940556831 Bacteria 9590747
684 2940565742 2940556831 Bacteria 9590747
685 2941507284 2941507105 Bacteria 8166816
686 2941508629 2941507105 Bacteria 8166816
687 2941515711 2941515067 Bacteria 8166720
688 2941516459 2941515067 Bacteria 8166720
689 2941523581 2941523033 Bacteria 8169134
690 2941524525 2941523033 Bacteria 8169134
691 2941544013 2941538514 Bacteria 9402094
692 2941547251 2941538514 Bacteria 9402094
693 3005475691 3005474847 Bacteria 9259049
694 3005602077 3005594810 Bacteria 8716512
695 3005717831 3005710791 Bacteria 7622528
696 3005724863 3005718088 Bacteria 8283608
697 8006935025 8006933436 Bacteria 10410654
698 8006937030 8006933436 Bacteria 10410654
699 8006965421 8006964411 Bacteria 8966052
700 8006966454 8006964411 Bacteria 8966052
701 8006974992 8006973647 Bacteria 10679141
702 8006976995 8006973647 Bacteria 10679141
703 8006988605 8006984368 Bacteria 9651211
704 8006997116 8006994254 Bacteria 8309700
705 8016518749 8016511872 Bacteria 9921665
706 8016519173 8016511872 Bacteria 9921665
707 8016526702 8016522445 Bacteria 8156687
708 8016531786 8016530956 Bacteria 8155261
709 8016544991 8016539877 Bacteria 8155419
710 8016557082 8016548790 Bacteria 8155074
711 8016565434 8016557553 Bacteria 8154380
712 8016582637 8016575299 Bacteria 8154085
713 8016587651 8016583857 Bacteria 10421953
714 8016603068 8016595262 Bacteria 8149947
715 8016605973 8016603502 Bacteria 8731218
716 8016623716 8016622563 Bacteria 7999408
717 8016636185 8016630954 Bacteria 9217207
718 8016636894 8016630954 Bacteria 9217207
719 8017057928 8017057580 Bacteria 10023680
720 8017066330 8017057580 Bacteria 10023680
721 8019539921 8019538911 Bacteria 7872763
722 8019561649 8019555841 Bacteria 9642137
723 8019573705 8019565922 Bacteria 9639779
724 8019577795 8019576017 Bacteria 10049540
725 8019578288 8019576017 Bacteria 10049540
726 8019595897 8019586578 Bacteria 10212056
727 8019596323 8019586578 Bacteria 10212056
728 8019605376 8019597564 Bacteria 10041141
729 8019605858 8019597564 Bacteria 10041141
730 8019613167 8019608314 Bacteria 10042931
731 8019622444 8019619141 Bacteria 9218857
732 8019623857 8019619141 Bacteria 9218857
733 8019630670 8019629233 Bacteria 8687553
734 8019639947 8019638758 Bacteria 9062356
735 8019641450 8019638758 Bacteria 9062356
736 8019651976 8019648815 Bacteria 10014479
737 8019666103 8019659431 Bacteria 8577854
738 8019667494 8019659431 Bacteria 8577854
739 8019675615 8019668869 Bacteria 8791617
740 8019677266 8019668869 Bacteria 8791617
741 8019678717 8019678201 Bacteria 8863603
742 8019680484 8019678201 Bacteria 8863603
743 8019695275 8019687851 Bacteria 8712826
744 8019696800 8019687851 Bacteria 8712826
745 8055750408 8055742211 Bacteria 9226248
746 8055750897 8055742211 Bacteria 9226248
747 8056678911 8056673599 Bacteria 7871253
748 8056679315 8056673599 Bacteria 7871253
749 8056681367 8056681323 Bacteria 8472857
750 8056695333 8056689827 Bacteria 6712655
751 8056975581 8056967851 Bacteria 9038162
752 Ga0265330_10009926
753 JGI25406J46586_10021268
754 JGI25153J46596_10002490
755 JGI25160J50197_1000486
756 JGI25160J50197_1013985
757 Ga0055531_10010052
758 Ga0055543_1001606
759 Ga0065165_1001966
760 Ga0065165_1002218
761 Ga0065165_1003663
762 Ga0070658_10020964
763 Ga0070683_100007874
764 Ga0070683_100082314
765 Ga0070683_100091151
766 Ga0068869_100069170
767 Ga0070680_100030884
768 Ga0070660_100116900
769 Ga0070661_100046829
770 Ga0070668_100026589
771 Ga0070668_100044274
772 Ga0070669_100117305
773 Ga0070671_100081998
774 Ga0070671_100102344
775 Ga0070674_100018654
776 Ga0070659_100050492
777 Ga0070709_10033788
778 Ga0070713_100059664
779 Ga0070710_10045202
780 Ga0070711_100009819
781 Ga0070663_100005881
782 Ga0070663_100026955
783 Ga0070663_100047001
784 Ga0070678_100015841
785 Ga0070678_100105075
786 Ga0070681_10018751
787 Ga0070681_10053254
788 Ga0070681_10140755
789 Ga0070706_100236457
790 Ga0070679_100010254
791 Ga0070679_100038781
792 Ga0070679_100150311
793 Ga0068853_100220295
794 Ga0068853_100225272
795 Ga0070672_100169493
796 Ga0070665_100009678
797 Ga0070665_100046467
798 Ga0070665_100216645
799 Ga0068855_100086235
800 Ga0068855_100123231
801 Ga0068856_100000511
802 Ga0068861_100028783
803 Ga0068861_100051868
804 Ga0068858_100040008
805 Ga0068858_100100434
806 Ga0068860_100000629
807 Ga0068860_100060959
808 Ga0068862_100094658
809 Ga0081455_10004380
810 Ga0081455_10166183
811 Ga0081540_1000663
812 Ga0081540_1001004
813 Ga0081540_1004994
814 Ga0081540_1007119
815 Ga0081540_1023353
816 Ga0081539_10000902
817 Ga0081539_10078453
818 Ga0070717_10018039
819 Ga0075365_10009165
820 Ga0075365_10063778
821 Ga0075368_10007451
822 Ga0075368_10030211
823 Ga0075368_10032831
824 Ga0075363_100004319
825 Ga0075367_10041993
826 Ga0075369_10023775
827 Ga0075369_10041973
828 Ga0097621_100047571
829 Ga0075370_10089066
830 Ga0068871_100053957
831 Ga0075434_100021715
832 Ga0099822_1009768
833 Ga0099823_1046362
834 Ga0105240_10002869
835 Ga0105240_10059548
836 Ga0105240_10073683
837 Ga0105240_10176372
838 Ga0105240_10239784
839 Ga0105245_10049309
840 Ga0105247_10002364
841 Ga0105247_10014989
842 Ga0105243_10126320
843 Ga0105241_10031004
844 Ga0105237_10040819
845 Ga0105237_10055197
846 Ga0105237_10083184
847 Ga0105239_10060463
848 Ga0105239_10139140
849 Ga0105239_10188937
850 Ga0105239_10336291
851 Ga0105246_10004265
852 Ga0157374_10006560
853 Ga0157378_10004228
854 Ga0157375_10013756
855 Ga0157375_10171168
856 Ga0163163_10026333
857 Ga0163163_10037680
858 Ga0163163_10162280
859 Ga0157380_10114589
860 Ga0157376_10021650
861 Ga0214544_1000003
862 Ga0214542_1000003
863 Ga0214545_1000004
864 Ga0214545_1020783
865 Ga0214543_1000007
866 Ga0214543_1024316
867 Ga0209148_1000904
868 Ga0209455_1003487
869 Ga0209455_1005268
870 Ga0209758_1000015
871 Ga0209758_1000389
872 Ga0209758_1000716
873 Ga0209758_1003057
874 Ga0209758_1016615
875 Ga0209256_1011453
876 Ga0207426_1000380
877 Ga0207426_1000832
878 Ga0209257_1003856
879 Ga0209257_1016175
880 Ga0207692_10041252
881 Ga0207647_10005598
882 Ga0207643_10039734
883 Ga0207707_10000712
884 Ga0207695_10000065
885 Ga0207695_10063652
886 Ga0207695_10065214
887 Ga0207671_10063889
888 Ga0207671_10189423
889 Ga0207693_10024727
890 Ga0207693_10089203
891 Ga0207663_10005664
892 Ga0207663_10062775
893 Ga0207657_10023771
894 Ga0207657_10082476
895 Ga0207657_10101907
896 Ga0207649_10049750
897 Ga0207652_10006317
898 Ga0207681_10071708
899 Ga0207687_10095435
900 Ga0207700_10156169
901 Ga0207700_10184618
902 Ga0207690_10072522
903 Ga0207690_10141211
904 Ga0207704_10114802
905 Ga0207691_10123047
906 Ga0207691_10172950
907 Ga0207691_10205980
908 Ga0207689_10018063
909 Ga0207689_10061430
910 Ga0207661_10007684
911 Ga0207661_10136044
912 Ga0207667_10203346
913 Ga0207712_10038023
914 Ga0207668_10067622
915 Ga0207677_10021016
916 Ga0207677_10077353
917 Ga0207703_10038176
918 Ga0207703_10144279
919 Ga0207639_10203377
920 Ga0207678_10006198
921 Ga0207678_10013992
922 Ga0207678_10022779
923 Ga0207678_10022967
924 Ga0207678_10050442
925 Ga0207678_10090694
926 Ga0207708_10146419
927 Ga0207702_10000936
928 Ga0207676_10063322
929 Ga0207674_10080874
930 Ga0207675_100014293
931 Ga0207675_100024815
932 Ga0207683_10034991
933 Ga0207683_10051704
934 Ga0207698_10101024
935 Ga0207698_10136330
936 Ga0209389_1000016
937 Ga0209589_1000015
938 Ga0209489_100015
939 Ga0209489_102237
940 Ga0209700_100012
941 Ga0209700_100025
942 Ga0268266_10005316
943 Ga0268266_10036058
944 Ga0268266_10062092
945 Ga0268266_10082744
946 Ga0268264_10000042
947 Ga0268264_10000049
948 Ga0268264_10100241
949 Ga0265334_10003911
950 Ga0307517_10002212
951 Ga0307515_10086618
952 Ga0307511_10049347
953 Ga0265330_10020386
954 Ga0265332_10004766
955 Ga0265325_10011905
956 Ga0265327_10037962
957 Ga0307509_10046652
958 Ga0307509_10053562
959 Ga0307508_10000046
960 Ga0265314_10002276
961 Ga0307516_10064332
962 Ga0307510_10013273
963 Ga0307510_10038531
964 Ga0315911_1000037
965 Ga0373926_0023595
966 Ga0373923_0010145
967 Ga0373936_0015397
968 Ga0373956_0002735
969 Ga0373956_0008060
970 Ga0373956_0035966
971 Ga0373957_0005522
972 Ga0373957_0021315
973 Ga0373943_0010611
974 Ga0373955_0000362
975 Ga0373955_0015392
976 Ga0373924_0007637
977 Ga0373931_0103698
978 Ga0373935_0014939
979 Ga0373927_0015877
980 Ga0373927_0018020
981 Ga0373927_0051668
982 Ga0373927_0058205
983 Ga0373927_0066984
984 Ga0373947_0021235
985 Ga0373947_0068090
986 Ga0373947_0103867
987 Ga0373925_0127335
988 Ga0395900_0000937
989 Ga0395900_0301938
990 Ga0395898_0005127
991 Ga0395905_0003588
992 Ga0395901_0006000
993 Ga0395901_0266144
994 Ga0436365_0494985
995 Ga0466969_0021786
996 Ga0466966_0001410
997 Ga0466966_0054398
998 Ga0466961_0000126
999 Ga0466963_0015621
1000 Ga0466964_0046822
1001 Ga0466959_0024698
1002 Ga0466967_0009509
1003 Ga0466967_0038196
1004 Ga0466967_0118886
1005 Ga0495617_016610
1006 Ga0495592_0013853
1007 Ga0495592_0053573
1008 Ga0495629_0000232
1009 Ga0495638_0039595
1010 Ga0495651_0057782
1011 Ga0495651_0101272
1012 Ga0495653_0000575
1013 Ga0495580_0047564
1014 Ga0495582_0023646
1015 Ga0495664_0011282
1016 Ga0495664_0034067
1017 Ga0495664_0036953
1018 Ga0495594_0090126
1019 Ga0495596_0014340
1020 Ga0495608_0015029
1021 Ga0495608_0026272
1022 Ga0495618_0013963
1023 Ga0495628_0013829
1024 Ga0495628_0182785
1025 Ga0495630_0062696
1026 Ga0495630_0064075
1027 Ga0495632_0053649
1028 Ga0495643_0010141
1029 Ga0495643_0049611
1030 Ga0495648_0003301
1031 Ga0495652_0011732
1032 Ga0495652_0052602
1033 Ga0495665_0010436
1034 Ga0495587_0024903
1035 Ga0495645_0017382
1036 Ga0495622_0008202
1037 Ga0495667_0010074
1038 Ga0495667_0012506
1039 Ga0495667_0045785
1040 Ga0495656_0002893
1041 Ga0495668_0019741
1042 Ga0495634_0014105
1043 Ga0495634_0053881
1044 Ga0495635_0003059
1045 Ga0495588_0000925
1046 Ga0495588_0016193
1047 Ga0495657_0004169
1048 Ga0495657_0031592
1049 Ga0495623_0020382
1050 Ga0495623_0158821
1051 Ga0495658_0042373
1052 Ga0495669_0005200
1053 Ga0495613_0028370
1054 Ga0495613_0098766
1055 Ga0495670_0031359
1056 Ga0495600_0006845
1057 Ga0495600_0009465
1058 Ga0495604_0006998
1059 Ga0495674_0038647
1060 Ga0495674_0053176
1061 Ga0495674_0059405
1062 Ga0495672_0015053
1063 Ga0495680_0006684
1064 Ga0495680_0009328
1065 Ga0495680_0060039
1066 Ga0495675_0007212
1067 Ga0495673_0036960
1068 Ga0495684_0003117
1069 Ga0495593_0010211
1070 Ga0495602_0084304
1071 Ga0495602_0121943
1072 Ga0496100_0011081
1073 Ga0496101_0001519
1074 Ga0496102_0001311
1075 Ga0496102_0074689
1076 Ga0496102_0274144
1077 Ga0496102_0369965
1078 Ga0496103_0038577
1079 Ga0496104_0067821
1080 Ga0496105_0032123
1081 Ga0496106_0000545
1082 Ga0496106_0009293
1083 Ga0496107_0010055
1084 Ga0496107_0069687
1085 Ga0496107_0117289
1086 Ga0496108_0065028
1087 Ga0496109_0030548
1088 Ga0496109_0073885
1089 Ga0496110_0009861
1090 Ga0496110_0073347
1091 Ga0496110_0100605
1092 Ga0496111_0033229
1093 Ga0496111_0162619
1094 Ga0496112_0000019
1095 Ga0496112_0126230
1096 Ga0496112_0133119
1097 Ga0496112_0194750
1098 Ga0496113_0032124
1099 Ga0496114_0064882
1100 Ga0496115_0001845
1101 Ga0496115_0079118
1102 Ga0496115_0092590
1103 Ga0496117_0008319
1104 Ga0496117_0046144
1105 Ga0496118_0001458
1106 Ga0496118_0004149
1107 Ga0496119_0026915
1108 Ga0496119_0043858
1109 Ga0496119_0066837
1110 Ga0496121_0000146
1111 Ga0496121_0000261
1112 Ga0496121_0016550
1113 Ga0496121_0026315
1114 Ga0496121_0034030
1115 Ga0496124_0001094
1116 Ga0496124_0009204
1117 Ga0496124_0099950
1118 Ga0496125_0017943
1119 Ga0496125_0019636
1120 Ga0496126_0004026
1121 Ga0496126_0006660
1122 Ga0496126_0013366
1123 Ga0496126_0015212
1124 Ga0496126_0027647
1125 Ga0496126_0043920
1126 Ga0496126_0063132
1127 Ga0496126_0104819
1128 Ga0501031_0002158
1129 Ga0501031_0080002
1130 Ga0501032_0000172
1131 Ga0501033_0011658
1132 Ga0501033_0029670
1133 Ga0501034_0000676
1134 Ga0501036_0000431
1135 Ga0501037_0000755
1136 Ga0501038_0000089
1137 Ga0501039_0000559
1138 Ga0501039_0129586
1139 Ga0501043_0006222
1140 Ga0501046_0001949
1141 Ga0501047_0000594
1142 Ga0501047_0047796
1143 Ga0501067_0000445
1144 Ga0501068_0000286
1145 Ga0501068_0080809
1146 Ga0501069_0000915
1147 Ga0501069_0056444
1148 Ga0501070_0060662
1149 Ga0501070_0096601
1150 Ga0501070_0144463
1151 Ga0501072_0005386
1152 Ga0501073_0000055
1153 Ga0501074_0002060
1154 Ga0501076_0159350
1155 Ga0501080_0000841
1156 Ga0501080_0027647
1157 Ga0501035_0000150
1158 Ga0501035_0064904
1159 Ga0501044_0000546
1160 Ga0501044_0065137
1161 nmdc:mga03n38_396_c1
1162 nmdc:mga00v17_16637_c1
1163 nmdc:mga00v17_42573_c1
1164 nmdc:mga0yw44_21632_c1
1165 nmdc:mga0yw44_23829_c1
1166 nmdc:mga0k408_43743_c1
1167 nmdc:mga06z11_104792_c1
1168 nmdc:mga07m45_10177_c1
1169 nmdc:mga07m45_13779_c1
1170 nmdc:mga0n895_12052_c1
1171 nmdc:mga0sz30_33525_c1
1172 nmdc:mga0sz30_57419_c1
1173 Ga0495601_0007416
1174 Ga0495595_0005106
1175 Ga0495595_0013939
1176 Ga0495619_0000458
1177 Ga0495619_0011276
1178 Ga0500643_000052
1179 Ga0500643_000091
1180 Ga0500583_0017985
1181 Ga0500583_0049960
1182 Ga0500651_0082018
1183 Ga0500566_0000095
1184 Ga0500566_0000565
1185 Ga0500566_0063903
1186 Ga0500641_0003302
1187 Ga0500641_0012365
1188 Ga0500648_020542
1189 Ga0500554_001095
1190 Ga0500555_002648
1191 Ga0500572_006027
1192 Ga0500595_001045
1193 Ga0500595_001996
1194 Ga0500595_005190
1195 Ga0500595_010896
1196 Ga0500642_0000189
1197 Ga0500559_0001773
1198 Ga0500559_0022181
1199 Ga0500573_0032030
1200 Ga0500603_000264
1201 Ga0500604_0028082
1202 Ga0500616_0021736
1203 Ga0500634_0017382
1204 Ga0500637_0000075
1205 Ga0500637_0000269
1206 Ga0500576_005425
1207 Ga0500609_001240
1208 Ga0500596_000453
1209 Ga0500596_002689
1210 Ga0500596_002778
1211 Ga0500601_000069
1212 Ga0501084_0001259
1213 Ga0500661_000342
1214 Ga0501082_0005147
1215 2508545800
1216 2508695037
1217 2513649936
1218 2513657363
1219 2513661955
1220 2513673067
1221 2513694816
1222 2513857209
1223 2513874231
1224 2513889763
1225 2513916616
1226 2513923545
1227 2514010003
1228 2515625960
1229 2517887431
1230 2517888149
1231 2524468302
1232 2524533329
1233 2528850295
1234 2528850431
1235 2617353856
1236 2671119385
1237 2723842127
1238 2728753813
1239 2793059365
1240 2793063199
1241 2793072860
1242 2793073469
1243 2793078601
1244 2793083728
1245 2805919397
1246 2805922121
1247 2818237180
1248 2818240936
1249 2824663562
1250 2824667388
1251 2824675534
1252 2824677895
1253 2824691756
1254 2824694603
1255 2824698983
1256 2824702781
1257 2824761075
1258 2824771808
1259 2824779750
1260 2824779874
1261 2838129451
1262 2841942515
1263 2841944352
1264 2841953135
1265 2841954471
1266 2841960643
1267 2841969129
1268 2841970841
1269 2841977900
1270 2841979903
1271 2841984535
1272 2841990916
1273 2842041744
1274 2842049786
1275 2844321728
1276 2847932039
1277 2847943276
1278 2849077003
1279 2849082571
1280 2874595679
1281 2874606781
1282 2874610258
1283 2874647718
1284 2874651688
1285 2876770078
1286 2876775874
1287 2876812716
1288 2876821583
1289 2879079965
1290 2879085715
1291 2879100883
1292 2879101843
1293 2879111568
1294 2879130678
1295 2879134049
1296 2879143140
1297 2879148534
1298 2885374448
1299 2885380005
1300 2885384624
1301 2885410897
1302 2888380069
1303 2888391494
1304 2889034960
1305 2903727726
1306 2903754108
1307 2903755939
1308 2903773471
1309 2904691724
1310 2904695728
1311 2904710052
1312 2904713591
1313 2906602788
1314 2906612638
1315 2906614489
1316 2906639968
1317 2906647248
1318 2906666574
1319 2908746681
1320 2908763828
1321 2908764242
1322 2922366859
1323 2922367578
1324 2922378453
1325 2922391912
1326 2922426324
1327 2922433135
1328 2929619839
1329 2929622446
1330 2929629150
1331 2929631337
1332 2932789717
1333 2932805412
1334 2932812680
1335 2932817771
1336 2932823042
1337 2932827118
1338 2932829484
1339 2932835642
1340 2933581758
1341 2933584474
1342 2935613220
1343 2935615051
1344 2935618002
1345 2935624584
1346 2935630632
1347 2935632707
1348 2935641600
1349 2935647189
1350 2935651597
1351 2935655606
1352 2935659635
1353 2935664490
1354 2935669342
1355 2935674348
1356 2935678062
1357 2935684229
1358 2935689100
1359 2935693619
1360 2935697640
1361 2935701701
1362 2935707165
1363 2935711337
1364 2935717008
1365 2935720046
1366 2935728337
1367 2935730158
1368 2935737066
1369 2935738422
1370 2935746873
1371 2935750210
1372 2935757840
1373 2935759804
1374 2935764218
1375 2935764545
1376 2935772867
1377 2935777997
1378 2935787224
1379 2935790182
1380 2935795988
1381 2935798776
1382 2935804454
1383 2935809877
1384 2935817315
1385 2935819342
1386 2935824926
1387 2935825911
1388 2935831331
1389 2935836613
1390 2935841940
1391 2935846823
1392 2935851530
1393 2935852146
1394 2935856499
1395 2935863206
1396 2935868675
1397 2935870959
1398 2935874475
1399 2935879449
1400 2935888991
1401 2935910449
1402 2935911493
1403 2935918257
1404 2935925410
1405 2935927640
1406 2935928522
1407 2935936488
1408 2935938167
1409 2935943959
1410 2935945449
1411 2935952396
1412 2935954045
1413 2935964242
1414 2935969236
1415 2935971687
1416 2935978003
1417 2935980090
1418 2935984697
1419 2935993936
1420 2936000243
1421 2936005053
1422 2936010285
1423 2936014051
1424 2936018556
1425 2936023040
1426 2936027074
1427 2936031176
1428 2936035959
1429 2936044112
1430 2936045965
1431 2936049298
1432 2936054038
1433 2936055867
1434 2940563338
1435 2940565742
1436 2941507284
1437 2941508629
1438 2941515711
1439 2941516459
1440 2941523581
1441 2941524525
1442 2941544013
1443 2941547251
1444 3005475691
1445 3005602077
1446 3005717831
1447 3005724863
1448 8006935025
1449 8006937030
1450 8006965421
1451 8006966454
1452 8006974992
1453 8006976995
1454 8006988605
1455 8006997116
1456 8016518749
1457 8016519173
1458 8016526702
1459 8016531786
1460 8016544991
1461 8016557082
1462 8016565434
1463 8016582637
1464 8016587651
1465 8016603068
1466 8016605973
1467 8016623716
1468 8016636185
1469 8016636894
1470 8017057928
1471 8017066330
1472 8019539921
1473 8019561649
1474 8019573705
1475 8019577795
1476 8019578288
1477 8019595897
1478 8019596323
1479 8019605376
1480 8019605858
1481 8019613167
1482 8019622444
1483 8019623857
1484 8019630670
1485 8019639947
1486 8019641450
1487 8019651976
1488 8019666103
1489 8019667494
1490 8019675615
1491 8019677266
1492 8019678717
1493 8019680484
1494 8019695275
1495 8019696800
1496 8055750408
1497 8055750897
1498 8056678911
1499 8056679315
1500 8056681367
1501 8056695333
1502 8056975581

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

126

287

0.94

PF01554

MatE

MatE

352

512

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hfb-assembly3.cif.gz_C outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.9279 28 459
3vvr-assembly1.cif.gz_A crystal structure of mate in complex with mad5 0.9278 29 459
4mlb-assembly1.cif.gz_C reverse polarity of binding pocket suggests different function of a mop superfamily transporter from pyrococcus furiosus vc1 (dsm3638) 0.9269 28 459
6ids-assembly1.cif.gz_A crystal structure of vibrio cholerae mate transporter vcmn d35n mutant 0.9268 34 459
6fv7-assembly1.cif.gz_A dimer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9247 38 452
ID Description Score Start End Superfamily
af_Q2G140_24_185_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.94 47 200 1.20.1250.20
af_Q54YM8_263_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9265 269 423 1.20.1250.20
af_P71616_238_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9248 271 420 1.20.1250.20
af_Q4DUB5_260_415_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9201 271 419 1.10.1760.20
af_Q5ACZ4_387_544_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9173 48 200 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A845M1G5-F1-model_v4 Probable multidrug resistance protein NorM 0.9571 55 235 GO:0005886
GO:0015297
GO:0042910
AF-A0A800L727-F1-model_v4 MATE family efflux transporter 0.9525 94 459 GO:0005886
GO:0015297
GO:0042910
AF-A0A5C1AT55-F1-model_v4 Multidrug-efflux transporter 0.9495 36 463 GO:0005886
GO:0006811
GO:0015297
GO:0042910
AF-A0A6I7P5I1-F1-model_v4 Multidrug export protein MepA 0.9478 28 459 GO:0005886
GO:0015297
GO:0042910
GO:0046677
AF-A0A6G3LG90-F1-model_v4 deleted 0.9466 34 379

Map