F479110

General Info

Members Datasets Scaffolds Average Seq Length
751 251 1502 153

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10375775|Ga0157372_103757752
Length 180
Sequence VKQKFSSESRVLSSELATTQNSKLKTENMTNEELKSELLLLQPSLTFDETGEWLNVNIDPEAWPLFAKQLRDKENLFFNYLFCLTCVDWKTHLTMVYHLSSLRYHHNIVVKSKLDRVKPEIETVCRIWKTAEFHEREVYELFGVNFISHPDLRLLILPEGWEGKNPLRKDFEDPINMIKL

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
173 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
228 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
229 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
238 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
239 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
240 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
241 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.2
Rhizosphere 98.4
Stem 0
Stem Tuber 0
Unclassified 20.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10375775 3300013307 Bacteria 1656
2 MRS1b_contig_3434530 2162886011 Bacteria 907
3 JGI24736J21556_1032100 3300001904 Unclassified 811
4 JGI24751J29686_10005684 3300002459 Bacteria 2542
5 Ga0065714_10105577 3300005288 Bacteria 1564
6 Ga0065704_10136066 3300005289 Bacteria 1570
7 Ga0065712_10068792 3300005290 Bacteria 8966
8 Ga0065712_10074890 3300005290 Bacteria 3986
9 Ga0065712_10104423 3300005290 Bacteria 1959
10 Ga0065712_10184032 3300005290 Bacteria 1178
11 Ga0065712_10288808 3300005290 Bacteria 881
12 Ga0065712_10310127 3300005290 Bacteria 845
13 Ga0065715_10789406 3300005293 Bacteria 612
14 Ga0065707_10195463 3300005295 Bacteria 1338
15 Ga0065707_10254277 3300005295 Bacteria 1115
16 Ga0070658_10196689 3300005327 Bacteria 1700
17 Ga0070658_10573191 3300005327 Bacteria 977
18 Ga0070658_11272529 3300005327 Unclassified 639
19 Ga0070676_10004759 3300005328 Bacteria 7175
20 Ga0070683_100004630 3300005329 Bacteria 11360
21 Ga0070683_100127580 3300005329 Bacteria 2405
22 Ga0070683_100384056 3300005329 Bacteria 1338
23 Ga0070683_100642307 3300005329 Bacteria 1016
24 Ga0070690_100762852 3300005330 Unclassified 747
25 Ga0070670_100012129 3300005331 Bacteria 7372
26 Ga0070670_100043986 3300005331 Bacteria 3839
27 Ga0070670_100266279 3300005331 Bacteria 1495
28 Ga0070670_100294515 3300005331 Unclassified 1418
29 Ga0070670_100305507 3300005331 Bacteria 1392
30 Ga0070670_100479254 3300005331 Bacteria 1105
31 Ga0070670_100639984 3300005331 Bacteria 953
32 Ga0068869_100010013 3300005334 Bacteria 6164
33 Ga0068869_100017677 3300005334 Bacteria 4839
34 Ga0068869_100032776 3300005334 Bacteria 3663
35 Ga0068869_100167394 3300005334 Unclassified 1715
36 Ga0068869_100205432 3300005334 Unclassified 1555
37 Ga0068869_100848013 3300005334 Bacteria 788
38 Ga0070666_10000029 3300005335 Bacteria 141568
39 Ga0070666_10004710 3300005335 Bacteria 8339
40 Ga0070666_10076156 3300005335 Bacteria 2288
41 Ga0070666_10116086 3300005335 Unclassified 1854
42 Ga0070666_10648712 3300005335 Bacteria 772
43 Ga0070680_100017233 3300005336 Bacteria 5693
44 Ga0070682_100000121 3300005337 Bacteria 69122
45 Ga0070682_100027802 3300005337 Bacteria 3397
46 Ga0070682_100280100 3300005337 Bacteria 1215
47 Ga0068868_100001573 3300005338 Bacteria 15578
48 Ga0068868_100007158 3300005338 Bacteria 7929
49 Ga0068868_100040206 3300005338 Unclassified 3639
50 Ga0068868_100269680 3300005338 Bacteria 1438
51 Ga0068868_100648704 3300005338 Bacteria 940
52 Ga0068868_102262957 3300005338 Unclassified 518
53 Ga0070660_100125521 3300005339 Unclassified 2051
54 Ga0070660_100436657 3300005339 Bacteria 1085
55 Ga0070689_100052890 3300005340 Unclassified 3142
56 Ga0070689_100236439 3300005340 Unclassified 1503
57 Ga0070689_100385131 3300005340 Bacteria 1182
58 Ga0070689_100637129 3300005340 Unclassified 926
59 Ga0070689_100806066 3300005340 Unclassified 826
60 Ga0070687_100035475 3300005343 Bacteria 2477
61 Ga0070687_100117419 3300005343 Bacteria 1516
62 Ga0070661_100035447 3300005344 Bacteria 3623
63 Ga0070661_100039892 3300005344 Unclassified 3423
64 Ga0070661_100041788 3300005344 Unclassified 3345
65 Ga0070661_100924947 3300005344 Bacteria 721
66 Ga0070668_100283596 3300005347 Bacteria 1384
67 Ga0070668_100475140 3300005347 Unclassified 1079
68 Ga0070668_100496242 3300005347 Bacteria 1056
69 Ga0070669_100565173 3300005353 Bacteria 950
70 Ga0070669_101000141 3300005353 Bacteria 717
71 Ga0070669_101415466 3300005353 Bacteria 603
72 Ga0070675_100080407 3300005354 Unclassified 2717
73 Ga0070675_100612502 3300005354 Bacteria 988
74 Ga0070675_100898986 3300005354 Unclassified 811
75 Ga0070671_100041604 3300005355 Unclassified 3819
76 Ga0070671_100483173 3300005355 Bacteria 1064
77 Ga0070674_100091089 3300005356 Unclassified 2201
78 Ga0070673_100018294 3300005364 Bacteria 5001
79 Ga0070673_100020898 3300005364 Unclassified 4731
80 Ga0070673_100022215 3300005364 Unclassified 4615
81 Ga0070673_100145974 3300005364 Bacteria 2000
82 Ga0070673_100186325 3300005364 Bacteria 1779
83 Ga0070673_100293401 3300005364 Bacteria 1430
84 Ga0070673_100424128 3300005364 Bacteria 1193
85 Ga0070673_100459348 3300005364 Unclassified 1146
86 Ga0070673_100600112 3300005364 Bacteria 1004
87 Ga0070673_100815597 3300005364 Bacteria 862
88 Ga0070673_100857835 3300005364 Bacteria 840
89 Ga0070673_101372986 3300005364 Unclassified 664
90 Ga0070688_100030515 3300005365 Bacteria 3236
91 Ga0070688_100036380 3300005365 Unclassified 2994
92 Ga0070688_100040865 3300005365 Bacteria 2844
93 Ga0070688_100046959 3300005365 Bacteria 2676
94 Ga0070688_100215302 3300005365 Bacteria 1351
95 Ga0070659_100010229 3300005366 Bacteria 6897
96 Ga0070659_100026459 3300005366 Bacteria 4465
97 Ga0070659_101243949 3300005366 Bacteria 659
98 Ga0070659_101343947 3300005366 Bacteria 634
99 Ga0070667_100028876 3300005367 Bacteria 4617
100 Ga0070667_100043851 3300005367 Unclassified 3754
101 Ga0070667_100091355 3300005367 Bacteria 2618
102 Ga0070667_100587049 3300005367 Unclassified 1026
103 Ga0070667_100691777 3300005367 Bacteria 943
104 Ga0070701_10374624 3300005438 Bacteria 895
105 Ga0070700_100325763 3300005441 Bacteria 1130
106 Ga0070700_100540451 3300005441 Bacteria 903
107 Ga0070694_101638364 3300005444 Unclassified 546
108 Ga0070678_100208243 3300005456 Bacteria 1618
109 Ga0070678_100504996 3300005456 Bacteria 1067
110 Ga0070678_101014930 3300005456 Unclassified 763
111 Ga0070678_101149158 3300005456 Unclassified 718
112 Ga0070662_100007843 3300005457 Bacteria 6934
113 Ga0070662_100012087 3300005457 Bacteria 5716
114 Ga0070662_100157702 3300005457 Bacteria 1773
115 Ga0070662_101914789 3300005457 Bacteria 512
116 Ga0070681_10045988 3300005458 Bacteria 4365
117 Ga0070681_10387326 3300005458 Bacteria 1309
118 Ga0068867_100229758 3300005459 Unclassified 1499
119 Ga0068867_100999327 3300005459 Bacteria 758
120 Ga0070685_10014969 3300005466 Bacteria 4117
121 Ga0070685_10029150 3300005466 Bacteria 3063
122 Ga0070685_10032181 3300005466 Bacteria 2936
123 Ga0070685_10303442 3300005466 Bacteria 1077
124 Ga0070685_10323228 3300005466 Bacteria 1046
125 Ga0070685_11165449 3300005466 Unclassified 584
126 Ga0070698_100004719 3300005471 Bacteria 14966
127 Ga0070698_100045618 3300005471 Bacteria 4486
128 Ga0070684_100001507 3300005535 Bacteria 16819
129 Ga0070684_100001823 3300005535 Bacteria 15602
130 Ga0070684_100030747 3300005535 Bacteria 4566
131 Ga0070684_100055788 3300005535 Unclassified 3446
132 Ga0070684_100117066 3300005535 Unclassified 2394
133 Ga0068853_100003495 3300005539 Bacteria 12019
134 Ga0068853_100014307 3300005539 Bacteria 6493
135 Ga0068853_100207088 3300005539 Bacteria 1787
136 Ga0068853_100568394 3300005539 Bacteria 1075
137 Ga0068853_100753380 3300005539 Bacteria 931
138 Ga0070672_100120004 3300005543 Bacteria 2151
139 Ga0070672_100291875 3300005543 Bacteria 1381
140 Ga0070672_100432605 3300005543 Bacteria 1131
141 Ga0070672_100494812 3300005543 Unclassified 1057
142 Ga0070672_100499618 3300005543 Unclassified 1052
143 Ga0070672_100883618 3300005543 Bacteria 789
144 Ga0070686_100032847 3300005544 Bacteria 3185
145 Ga0070665_100861273 3300005548 Bacteria 919
146 Ga0070665_101474597 3300005548 Bacteria 689
147 Ga0068855_100345598 3300005563 Bacteria 1639
148 Ga0068855_101093422 3300005563 Bacteria 834
149 Ga0070664_100006509 3300005564 Bacteria 9417
150 Ga0070664_100010783 3300005564 Bacteria 7411
151 Ga0070664_100058228 3300005564 Bacteria 3286
152 Ga0070664_100173752 3300005564 Unclassified 1912
153 Ga0070664_100287178 3300005564 Bacteria 1484
154 Ga0070664_100804492 3300005564 Unclassified 879
155 Ga0068857_100066491 3300005577 Bacteria 3207
156 Ga0068857_100114923 3300005577 Bacteria 2421
157 Ga0068857_100129118 3300005577 Unclassified 2279
158 Ga0068857_100248502 3300005577 Bacteria 1630
159 Ga0068857_100418819 3300005577 Bacteria 1248
160 Ga0068857_100909250 3300005577 Bacteria 844
161 Ga0068854_100197217 3300005578 Bacteria 1580
162 Ga0068854_100576228 3300005578 Bacteria 958
163 Ga0068854_100829071 3300005578 Bacteria 808
164 Ga0068856_100501660 3300005614 Bacteria 1235
165 Ga0068856_100847568 3300005614 Bacteria 933
166 Ga0070702_100543724 3300005615 Bacteria 861
167 Ga0068852_100007673 3300005616 Bacteria 7893
168 Ga0068852_100122581 3300005616 Bacteria 2383
169 Ga0068852_100228211 3300005616 Bacteria 1774
170 Ga0068852_100454084 3300005616 Unclassified 1269
171 Ga0068852_100580714 3300005616 Bacteria 1123
172 Ga0068852_100761825 3300005616 Bacteria 980
173 Ga0068852_100782139 3300005616 Bacteria 968
174 Ga0068852_101064526 3300005616 Bacteria 828
175 Ga0068852_101142348 3300005616 Unclassified 799
176 Ga0068852_101178933 3300005616 Bacteria 787
177 Ga0068859_100000035 3300005617 Bacteria 169846
178 Ga0068859_100008881 3300005617 Bacteria 10146
179 Ga0068859_100012825 3300005617 Bacteria 8416
180 Ga0068859_100017555 3300005617 Bacteria 7194
181 Ga0068859_100017669 3300005617 Bacteria 7171
182 Ga0068859_100174800 3300005617 Bacteria 2229
183 Ga0068859_100479273 3300005617 Unclassified 1340
184 Ga0068859_100712738 3300005617 Unclassified 1094
185 Ga0068859_100827532 3300005617 Bacteria 1012
186 Ga0068859_100878118 3300005617 Unclassified 982
187 Ga0068864_100003701 3300005618 Bacteria 12627
188 Ga0068864_100010317 3300005618 Bacteria 7715
189 Ga0068864_100026904 3300005618 Bacteria 4852
190 Ga0068864_100062013 3300005618 Bacteria 3239
191 Ga0068864_100303544 3300005618 Bacteria 1495
192 Ga0068864_100490498 3300005618 Bacteria 1181
193 Ga0068864_101386128 3300005618 Bacteria 704
194 Ga0068866_10602165 3300005718 Unclassified 742
195 Ga0068861_100004361 3300005719 Bacteria 9488
196 Ga0068861_100207279 3300005719 Bacteria 1649
197 Ga0068861_101607657 3300005719 Bacteria 640
198 Ga0068851_10028262 3300005834 Bacteria 2770
199 Ga0068851_10053859 3300005834 Bacteria 2049
200 Ga0068851_10067464 3300005834 Bacteria 1845
201 Ga0068851_10148845 3300005834 Bacteria 1278
202 Ga0068851_10160475 3300005834 Bacteria 1235
203 Ga0068851_10300976 3300005834 Bacteria 922
204 Ga0068851_10488982 3300005834 Bacteria 736
205 Ga0068870_10025336 3300005840 Bacteria 2943
206 Ga0068863_100012229 3300005841 Bacteria 8288
207 Ga0068863_100019716 3300005841 Bacteria 6450
208 Ga0068863_100065220 3300005841 Bacteria 3445
209 Ga0068863_100103642 3300005841 Bacteria 2706
210 Ga0068863_100143956 3300005841 Unclassified 2279
211 Ga0068863_100233660 3300005841 Bacteria 1774
212 Ga0068863_100299805 3300005841 Bacteria 1559
213 Ga0068863_100591402 3300005841 Bacteria 1098
214 Ga0068863_100623343 3300005841 Bacteria 1068
215 Ga0068863_100818738 3300005841 Bacteria 929
216 Ga0068863_101287977 3300005841 Bacteria 738
217 Ga0068858_100008843 3300005842 Bacteria 9658
218 Ga0068858_100167359 3300005842 Unclassified 2072
219 Ga0068858_100700968 3300005842 Bacteria 985
220 Ga0068858_100804638 3300005842 Unclassified 917
221 Ga0068858_101130714 3300005842 Unclassified 769
222 Ga0068858_101526831 3300005842 Bacteria 659
223 Ga0068860_100001866 3300005843 Bacteria 22390
224 Ga0068860_100014180 3300005843 Bacteria 7814
225 Ga0068860_100023690 3300005843 Bacteria 5934
226 Ga0068860_100031479 3300005843 Bacteria 5100
227 Ga0068860_100822027 3300005843 Unclassified 943
228 Ga0068860_100846983 3300005843 Unclassified 929
229 Ga0068860_101627850 3300005843 Bacteria 668
230 Ga0068862_100006882 3300005844 Bacteria 9429
231 Ga0068862_100930383 3300005844 Bacteria 856
232 Ga0070715_10159697 3300006163 Bacteria 1113
233 Ga0075366_10117729 3300006195 Bacteria 1600
234 Ga0097621_100044878 3300006237 Bacteria 3568
235 Ga0097621_100072831 3300006237 Bacteria 2843
236 Ga0097621_100092268 3300006237 Bacteria 2536
237 Ga0097621_100103231 3300006237 Bacteria 2401
238 Ga0097621_100479725 3300006237 Bacteria 1124
239 Ga0097621_101062334 3300006237 Bacteria 759
240 Ga0097621_101111205 3300006237 Unclassified 742
241 Ga0097621_101268005 3300006237 Bacteria 695
242 Ga0097621_101695481 3300006237 Unclassified 602
243 Ga0068871_100005122 3300006358 Bacteria 9155
244 Ga0068871_100142713 3300006358 Unclassified 2037
245 Ga0068871_100208189 3300006358 Unclassified 1691
246 Ga0068871_100230320 3300006358 Unclassified 1608
247 Ga0068871_100250498 3300006358 Unclassified 1542
248 Ga0068871_100528397 3300006358 Bacteria 1066
249 Ga0068871_100692673 3300006358 Bacteria 933
250 Ga0068871_100765174 3300006358 Bacteria 888
251 Ga0075428_100030428 3300006844 Bacteria 5970
252 Ga0075428_100204390 3300006844 Bacteria 2135
253 Ga0075428_100849829 3300006844 Unclassified 969
254 Ga0075430_100752259 3300006846 Bacteria 803
255 Ga0075434_100045188 3300006871 Unclassified 4369
256 Ga0075434_101095018 3300006871 Bacteria 810
257 Ga0075429_100073998 3300006880 Bacteria 2967
258 Ga0075429_100256192 3300006880 Bacteria 1532
259 Ga0068865_100034060 3300006881 Bacteria 3415
260 Ga0068865_100701905 3300006881 Bacteria 865
261 Ga0068865_100867697 3300006881 Bacteria 783
262 Ga0068865_100913478 3300006881 Bacteria 764
263 Ga0097620_100000035 3300006931 Bacteria 169846
264 Ga0097620_100008881 3300006931 Bacteria 10146
265 Ga0097620_100012825 3300006931 Bacteria 8416
266 Ga0097620_100017554 3300006931 Bacteria 7194
267 Ga0097620_100017669 3300006931 Bacteria 7171
268 Ga0097620_100174795 3300006931 Bacteria 2229
269 Ga0097620_100479310 3300006931 Unclassified 1340
270 Ga0097620_100712666 3300006931 Unclassified 1094
271 Ga0097620_100827534 3300006931 Bacteria 1012
272 Ga0097620_100877907 3300006931 Unclassified 982
273 Ga0105251_10114145 3300009011 Unclassified 1229
274 Ga0111539_10252588 3300009094 Bacteria 2053
275 Ga0111539_11257993 3300009094 Bacteria 859
276 Ga0111539_11926136 3300009094 Unclassified 685
277 Ga0105247_10007092 3300009101 Bacteria 6883
278 Ga0114129_10264806 3300009147 Bacteria 2302
279 Ga0105241_10009779 3300009174 Bacteria 7048
280 Ga0105241_10016614 3300009174 Bacteria 5401
281 Ga0105241_10651063 3300009174 Unclassified 957
282 Ga0105241_11243346 3300009174 Bacteria 707
283 Ga0105242_10004904 3300009176 Bacteria 10361
284 Ga0105242_10026221 3300009176 Bacteria 4619
285 Ga0105242_10110990 3300009176 Bacteria 2337
286 Ga0105248_10336986 3300009177 Bacteria 1698
287 Ga0105248_10520018 3300009177 Bacteria 1342
288 Ga0105248_10643080 3300009177 Bacteria 1197
289 Ga0105237_10000982 3300009545 Bacteria 38268
290 Ga0105237_10177716 3300009545 Bacteria 2129
291 Ga0105237_10182652 3300009545 Bacteria 2097
292 Ga0105237_10506527 3300009545 Bacteria 1214
293 Ga0105249_10001660 3300009553 Bacteria 19515
294 Ga0105249_10002832 3300009553 Bacteria 14963
295 Ga0105249_10006234 3300009553 Bacteria 10355
296 Ga0105249_10136973 3300009553 Bacteria 2344
297 Ga0105249_10184694 3300009553 Unclassified 2031
298 Ga0105249_10219876 3300009553 Bacteria 1869
299 Ga0105249_10356570 3300009553 Bacteria 1483
300 Ga0105249_10396887 3300009553 Bacteria 1409
301 Ga0105249_10612049 3300009553 Bacteria 1145
302 Ga0105249_10664039 3300009553 Bacteria 1101
303 Ga0105249_10679028 3300009553 Bacteria 1089
304 Ga0105239_10080572 3300010375 Unclassified 3582
305 Ga0105239_10134667 3300010375 Bacteria 2750
306 Ga0105239_10143481 3300010375 Bacteria 2662
307 Ga0105239_10305987 3300010375 Bacteria 1790
308 Ga0105246_10019435 3300011119 Bacteria 4340
309 Ga0105246_10199502 3300011119 Bacteria 1554
310 Ga0105246_11437674 3300011119 Unclassified 645
311 Ga0157373_10039346 3300013100 Bacteria 3386
312 Ga0157373_10052637 3300013100 Bacteria 2896
313 Ga0157371_10097601 3300013102 Bacteria 2083
314 Ga0157371_10120123 3300013102 Bacteria 1868
315 Ga0157371_10247805 3300013102 Bacteria 1282
316 Ga0157370_10011710 3300013104 Bacteria 9155
317 Ga0157370_10344984 3300013104 Bacteria 1372
318 Ga0157370_10388437 3300013104 Bacteria 1285
319 Ga0157370_11258476 3300013104 Unclassified 667
320 Ga0157370_11388978 3300013104 Unclassified 632
321 Ga0157369_10007185 3300013105 Bacteria 12833
322 Ga0157369_10082633 3300013105 Bacteria 3437
323 Ga0157369_10507244 3300013105 Unclassified 1248
324 Ga0157369_10584004 3300013105 Bacteria 1154
325 Ga0157374_10006774 3300013296 Bacteria 9741
326 Ga0157374_10064530 3300013296 Bacteria 3436
327 Ga0157374_10067760 3300013296 Bacteria 3356
328 Ga0157374_10100235 3300013296 Bacteria 2776
329 Ga0157374_10458954 3300013296 Unclassified 1276
330 Ga0157374_10498781 3300013296 Bacteria 1222
331 Ga0157374_11163959 3300013296 Bacteria 792
332 Ga0157374_11357822 3300013296 Unclassified 733
333 Ga0157374_12406634 3300013296 Unclassified 554
334 Ga0157378_10001438 3300013297 Bacteria 21454
335 Ga0157378_10010020 3300013297 Bacteria 8261
336 Ga0157378_10011679 3300013297 Bacteria 7688
337 Ga0157378_10022663 3300013297 Bacteria 5527
338 Ga0157378_10045203 3300013297 Bacteria 3912
339 Ga0157378_10071008 3300013297 Bacteria 3126
340 Ga0157378_10767071 3300013297 Bacteria 988
341 Ga0157378_10786731 3300013297 Bacteria 976
342 Ga0157378_11047926 3300013297 Unclassified 851
343 Ga0157378_11530734 3300013297 Bacteria 712
344 Ga0157378_11666802 3300013297 Bacteria 684
345 Ga0163162_10000573 3300013306 Bacteria 34029
346 Ga0163162_10008034 3300013306 Bacteria 10292
347 Ga0163162_10050425 3300013306 Bacteria 4174
348 Ga0163162_10068868 3300013306 Bacteria 3591
349 Ga0163162_10086601 3300013306 Unclassified 3210
350 Ga0163162_10090772 3300013306 Bacteria 3137
351 Ga0163162_10122396 3300013306 Bacteria 2706
352 Ga0163162_10348054 3300013306 Unclassified 1615
353 Ga0163162_10940572 3300013306 Bacteria 976
354 Ga0163162_11024540 3300013306 Bacteria 934
355 Ga0163162_11439225 3300013306 Bacteria 784
356 Ga0163162_11684684 3300013306 Bacteria 724
357 Ga0163162_11757523 3300013306 Bacteria 709
358 Ga0157372_10035574 3300013307 Bacteria 5484
359 Ga0157372_10098666 3300013307 Bacteria 3333
360 Ga0157372_10243366 3300013307 Bacteria 2087
361 Ga0157372_10330442 3300013307 Bacteria 1775
362 Ga0157372_10335385 3300013307 Bacteria 1761
363 Ga0157372_10434704 3300013307 Bacteria 1530
364 Ga0157372_11625253 3300013307 Bacteria 744
365 Ga0157372_11923447 3300013307 Bacteria 680
366 Ga0157372_12014527 3300013307 Unclassified 663
367 Ga0157375_10004591 3300013308 Bacteria 12001
368 Ga0157375_10015720 3300013308 Bacteria 6781
369 Ga0157375_10021560 3300013308 Bacteria 5911
370 Ga0157375_10036679 3300013308 Bacteria 4692
371 Ga0157375_10177980 3300013308 Bacteria 2278
372 Ga0157375_10203163 3300013308 Bacteria 2138
373 Ga0157375_10226217 3300013308 Bacteria 2030
374 Ga0157375_10280323 3300013308 Unclassified 1830
375 Ga0157375_10285564 3300013308 Bacteria 1813
376 Ga0157375_10469058 3300013308 Bacteria 1424
377 Ga0157375_10705153 3300013308 Bacteria 1163
378 Ga0163163_10000389 3300014325 Bacteria 41878
379 Ga0163163_10001282 3300014325 Bacteria 21236
380 Ga0163163_10002619 3300014325 Bacteria 15233
381 Ga0163163_10020882 3300014325 Bacteria 6175
382 Ga0163163_10073355 3300014325 Bacteria 3413
383 Ga0163163_10260697 3300014325 Bacteria 1784
384 Ga0163163_10301975 3300014325 Bacteria 1653
385 Ga0163163_11181906 3300014325 Bacteria 828
386 Ga0163163_12356692 3300014325 Bacteria 591
387 Ga0157380_10034980 3300014326 Bacteria 3877
388 Ga0157380_10058057 3300014326 Unclassified 3084
389 Ga0157380_10235746 3300014326 Bacteria 1646
390 Ga0157380_10481803 3300014326 Unclassified 1200
391 Ga0157380_10602009 3300014326 Unclassified 1087
392 Ga0157380_10730369 3300014326 Bacteria 999
393 Ga0157380_11826655 3300014326 Bacteria 667
394 Ga0157380_12228007 3300014326 Bacteria 612
395 Ga0157377_10063094 3300014745 Bacteria 2122
396 Ga0157377_10120864 3300014745 Bacteria 1587
397 Ga0157379_10042275 3300014968 Bacteria 4068
398 Ga0157379_10048220 3300014968 Unclassified 3802
399 Ga0157379_10090866 3300014968 Unclassified 2739
400 Ga0157379_10224980 3300014968 Bacteria 1700
401 Ga0157379_10833012 3300014968 Bacteria 872
402 Ga0157379_11026545 3300014968 Bacteria 787
403 Ga0157379_11745478 3300014968 Bacteria 610
404 Ga0157379_12214068 3300014968 Unclassified 546
405 Ga0157376_10027665 3300014969 Bacteria 4497
406 Ga0157376_10059285 3300014969 Bacteria 3209
407 Ga0157376_10108182 3300014969 Bacteria 2442
408 Ga0157376_10307364 3300014969 Unclassified 1503
409 Ga0157376_10495666 3300014969 Unclassified 1199
410 Ga0157376_10584970 3300014969 Bacteria 1109
411 Ga0157376_10763198 3300014969 Bacteria 977
412 Ga0157376_11019837 3300014969 Bacteria 851
413 Ga0157376_12231795 3300014969 Bacteria 586
414 Ga0163161_10042057 3300017792 Unclassified 3285
415 Ga0163161_10095208 3300017792 Bacteria 2208
416 Ga0163161_10117369 3300017792 Unclassified 1996
417 Ga0163161_10120309 3300017792 Bacteria 1972
418 Ga0163161_10242660 3300017792 Bacteria 1402
419 Ga0163161_10480954 3300017792 Bacteria 1008
420 Ga0163161_10999552 3300017792 Unclassified 714
421 Ga0163161_11319272 3300017792 Bacteria 628
422 Ga0207697_10031810 3300025315 Bacteria 2158
423 Ga0207656_10029691 3300025321 Bacteria 2254
424 Ga0207656_10063745 3300025321 Bacteria 1623
425 Ga0207656_10066261 3300025321 Bacteria 1596
426 Ga0207656_10091317 3300025321 Bacteria 1382
427 Ga0207656_10206696 3300025321 Unclassified 950
428 Ga0207682_10055907 3300025893 Bacteria 1642
429 Ga0207682_10088751 3300025893 Bacteria 1337
430 Ga0207688_10670796 3300025901 Unclassified 655
431 Ga0207680_10000049 3300025903 Bacteria 57625
432 Ga0207680_10067092 3300025903 Bacteria 2209
433 Ga0207680_10135088 3300025903 Bacteria 1629
434 Ga0207680_10535337 3300025903 Bacteria 836
435 Ga0207647_10000476 3300025904 Bacteria 32374
436 Ga0207647_10091251 3300025904 Bacteria 1817
437 Ga0207685_10060305 3300025905 Bacteria 1500
438 Ga0207645_10027954 3300025907 Bacteria 3641
439 Ga0207645_10032027 3300025907 Bacteria 3381
440 Ga0207645_10132465 3300025907 Bacteria 1623
441 Ga0207643_10001986 3300025908 Bacteria 11301
442 Ga0207643_10240235 3300025908 Bacteria 1113
443 Ga0207705_10073031 3300025909 Bacteria 2489
444 Ga0207705_10561860 3300025909 Bacteria 887
445 Ga0207654_10002237 3300025911 Bacteria 9923
446 Ga0207654_10727413 3300025911 Unclassified 714
447 Ga0207654_10783050 3300025911 Bacteria 688
448 Ga0207707_10663035 3300025912 Bacteria 879
449 Ga0207707_11037598 3300025912 Bacteria 671
450 Ga0207671_10010433 3300025914 Bacteria 7664
451 Ga0207671_10228990 3300025914 Bacteria 1458
452 Ga0207671_10411483 3300025914 Bacteria 1076
453 Ga0207660_10016945 3300025917 Bacteria 4834
454 Ga0207662_10124911 3300025918 Bacteria 1617
455 Ga0207657_10010243 3300025919 Bacteria 9366
456 Ga0207657_10010983 3300025919 Bacteria 9001
457 Ga0207649_10026820 3300025920 Unclassified 3374
458 Ga0207649_10065132 3300025920 Bacteria 2306
459 Ga0207649_10106454 3300025920 Unclassified 1865
460 Ga0207652_10040389 3300025921 Bacteria 3962
461 Ga0207681_10335682 3300025923 Bacteria 1206
462 Ga0207681_10811031 3300025923 Bacteria 782
463 Ga0207681_10947381 3300025923 Bacteria 722
464 Ga0207681_11485301 3300025923 Unclassified 568
465 Ga0207650_10002762 3300025925 Bacteria 12120
466 Ga0207650_10072853 3300025925 Bacteria 2586
467 Ga0207650_10077074 3300025925 Bacteria 2520
468 Ga0207650_10093877 3300025925 Bacteria 2297
469 Ga0207650_10462247 3300025925 Unclassified 1057
470 Ga0207650_10715104 3300025925 Bacteria 846
471 Ga0207650_10897324 3300025925 Bacteria 753
472 Ga0207650_10922709 3300025925 Unclassified 742
473 Ga0207650_11668348 3300025925 Bacteria 540
474 Ga0207659_11573036 3300025926 Bacteria 562
475 Ga0207644_10012044 3300025931 Bacteria 5735
476 Ga0207644_10025394 3300025931 Bacteria 4076
477 Ga0207644_10327533 3300025931 Bacteria 1240
478 Ga0207644_10372245 3300025931 Bacteria 1164
479 Ga0207644_10599115 3300025931 Unclassified 915
480 Ga0207644_10600564 3300025931 Unclassified 914
481 Ga0207644_10669080 3300025931 Bacteria 865
482 Ga0207690_10063607 3300025932 Bacteria 2516
483 Ga0207690_10202204 3300025932 Bacteria 1509
484 Ga0207690_10508836 3300025932 Bacteria 975
485 Ga0207690_10522242 3300025932 Bacteria 962
486 Ga0207706_10001166 3300025933 Bacteria 26648
487 Ga0207706_10144953 3300025933 Unclassified 2089
488 Ga0207686_10005943 3300025934 Bacteria 6553
489 Ga0207686_10017719 3300025934 Unclassified 4017
490 Ga0207670_10019401 3300025936 Bacteria 4153
491 Ga0207670_10103117 3300025936 Bacteria 2041
492 Ga0207670_10697121 3300025936 Unclassified 840
493 Ga0207704_10779329 3300025938 Bacteria 797
494 Ga0207691_10038909 3300025940 Bacteria 4401
495 Ga0207691_10044646 3300025940 Bacteria 4078
496 Ga0207691_10070753 3300025940 Bacteria 3150
497 Ga0207691_10154860 3300025940 Bacteria 2013
498 Ga0207691_10276454 3300025940 Bacteria 1445
499 Ga0207711_10460276 3300025941 Bacteria 1184
500 Ga0207689_10003728 3300025942 Bacteria 13893
501 Ga0207689_10004815 3300025942 Bacteria 12169
502 Ga0207689_10017714 3300025942 Bacteria 6020
503 Ga0207689_10022363 3300025942 Bacteria 5317
504 Ga0207689_10030721 3300025942 Bacteria 4476
505 Ga0207689_10125592 3300025942 Bacteria 2110
506 Ga0207689_10224172 3300025942 Unclassified 1554
507 Ga0207689_10692045 3300025942 Bacteria 860
508 Ga0207689_10926542 3300025942 Unclassified 735
509 Ga0207661_10004912 3300025944 Bacteria 9370
510 Ga0207661_10013672 3300025944 Bacteria 5926
511 Ga0207661_10105202 3300025944 Bacteria 2377
512 Ga0207661_10124704 3300025944 Bacteria 2198
513 Ga0207661_10346948 3300025944 Bacteria 1339
514 Ga0207661_10389930 3300025944 Bacteria 1262
515 Ga0207679_10088400 3300025945 Unclassified 2389
516 Ga0207679_10098682 3300025945 Bacteria 2278
517 Ga0207679_10104216 3300025945 Bacteria 2225
518 Ga0207679_10426370 3300025945 Bacteria 1172
519 Ga0207679_10789216 3300025945 Unclassified 865
520 Ga0207679_11334314 3300025945 Bacteria 658
521 Ga0207679_11361421 3300025945 Unclassified 651
522 Ga0207667_11026638 3300025949 Unclassified 811
523 Ga0207651_10072803 3300025960 Unclassified 2441
524 Ga0207651_10134090 3300025960 Bacteria 1901
525 Ga0207651_10184650 3300025960 Bacteria 1658
526 Ga0207651_10263326 3300025960 Bacteria 1417
527 Ga0207651_10309748 3300025960 Unclassified 1316
528 Ga0207651_10353621 3300025960 Bacteria 1238
529 Ga0207651_10675154 3300025960 Bacteria 908
530 Ga0207651_10873776 3300025960 Bacteria 800
531 Ga0207651_10987793 3300025960 Unclassified 752
532 Ga0207651_11256479 3300025960 Bacteria 665
533 Ga0207712_10001799 3300025961 Bacteria 14194
534 Ga0207712_10017174 3300025961 Bacteria 4695
535 Ga0207712_10148302 3300025961 Bacteria 1809
536 Ga0207712_10195039 3300025961 Unclassified 1601
537 Ga0207712_10335983 3300025961 Bacteria 1251
538 Ga0207712_10383683 3300025961 Unclassified 1177
539 Ga0207712_10497065 3300025961 Bacteria 1042
540 Ga0207712_10498834 3300025961 Bacteria 1040
541 Ga0207712_10558800 3300025961 Unclassified 985
542 Ga0207712_10806744 3300025961 Bacteria 825
543 Ga0207668_10797206 3300025972 Bacteria 836
544 Ga0207668_11057201 3300025972 Bacteria 727
545 Ga0207640_10018137 3300025981 Bacteria 4130
546 Ga0207640_10098329 3300025981 Bacteria 2046
547 Ga0207640_10199007 3300025981 Bacteria 1517
548 Ga0207640_10329434 3300025981 Unclassified 1219
549 Ga0207658_10033518 3300025986 Bacteria 3665
550 Ga0207658_10173546 3300025986 Bacteria 1778
551 Ga0207658_10506948 3300025986 Bacteria 1075
552 Ga0207658_10523332 3300025986 Bacteria 1059
553 Ga0207658_10574576 3300025986 Bacteria 1011
554 Ga0207658_10915885 3300025986 Bacteria 798
555 Ga0207658_11284449 3300025986 Bacteria 669
556 Ga0207658_11314442 3300025986 Unclassified 661
557 Ga0207677_10066026 3300026023 Unclassified 2527
558 Ga0207677_10094102 3300026023 Bacteria 2186
559 Ga0207677_10467367 3300026023 Bacteria 1084
560 Ga0207677_12009267 3300026023 Unclassified 537
561 Ga0207703_10004435 3300026035 Bacteria 11530
562 Ga0207703_10065575 3300026035 Bacteria 2985
563 Ga0207703_10898998 3300026035 Bacteria 848
564 Ga0207639_10033622 3300026041 Bacteria 3784
565 Ga0207639_10066469 3300026041 Bacteria 2802
566 Ga0207639_10067896 3300026041 Bacteria 2776
567 Ga0207639_10619234 3300026041 Unclassified 999
568 Ga0207639_10805384 3300026041 Bacteria 875
569 Ga0207678_10073104 3300026067 Unclassified 2939
570 Ga0207708_11302097 3300026075 Bacteria 637
571 Ga0207702_11731751 3300026078 Bacteria 618
572 Ga0207641_10000043 3300026088 Bacteria 186340
573 Ga0207641_10003385 3300026088 Bacteria 14152
574 Ga0207641_10011357 3300026088 Bacteria 7309
575 Ga0207641_10068082 3300026088 Bacteria 3051
576 Ga0207641_10314942 3300026088 Unclassified 1482
577 Ga0207641_10400083 3300026088 Bacteria 1318
578 Ga0207641_10582432 3300026088 Bacteria 1094
579 Ga0207641_10811537 3300026088 Bacteria 926
580 Ga0207641_11361840 3300026088 Bacteria 710
581 Ga0207641_11399174 3300026088 Bacteria 700
582 Ga0207648_10043180 3300026089 Bacteria 3958
583 Ga0207648_10076501 3300026089 Bacteria 2918
584 Ga0207648_10535903 3300026089 Bacteria 1074
585 Ga0207648_10552544 3300026089 Bacteria 1058
586 Ga0207648_10602217 3300026089 Bacteria 1013
587 Ga0207648_10657628 3300026089 Unclassified 969
588 Ga0207648_10806478 3300026089 Unclassified 874
589 Ga0207676_10061662 3300026095 Bacteria 2970
590 Ga0207676_10072390 3300026095 Unclassified 2771
591 Ga0207676_10285386 3300026095 Bacteria 1500
592 Ga0207676_12048036 3300026095 Unclassified 571
593 Ga0207674_10026000 3300026116 Bacteria 6229
594 Ga0207674_10030349 3300026116 Bacteria 5684
595 Ga0207674_10062960 3300026116 Bacteria 3746
596 Ga0207674_10160993 3300026116 Bacteria 2199
597 Ga0207674_10213393 3300026116 Bacteria 1879
598 Ga0207674_10568595 3300026116 Unclassified 1095
599 Ga0207674_11109477 3300026116 Bacteria 760
600 Ga0207675_100003277 3300026118 Bacteria 15853
601 Ga0207675_100282013 3300026118 Bacteria 1614
602 Ga0207675_100314835 3300026118 Bacteria 1527
603 Ga0207675_100981177 3300026118 Bacteria 863
604 Ga0207675_101525912 3300026118 Bacteria 689
605 Ga0207683_10071827 3300026121 Bacteria 3060
606 Ga0207683_10268896 3300026121 Unclassified 1557
607 Ga0207683_10906280 3300026121 Bacteria 819
608 Ga0207683_10981018 3300026121 Bacteria 784
609 Ga0207698_10018104 3300026142 Bacteria 4793
610 Ga0207698_10068654 3300026142 Bacteria 2800
611 Ga0207698_10135279 3300026142 Bacteria 2114
612 Ga0207698_10169324 3300026142 Bacteria 1921
613 Ga0207698_10284786 3300026142 Bacteria 1530
614 Ga0207698_10287089 3300026142 Bacteria 1525
615 Ga0207698_10481887 3300026142 Bacteria 1203
616 Ga0207698_11087473 3300026142 Bacteria 812
617 Ga0207428_10170859 3300027907 Bacteria 1646
618 Ga0207428_10820030 3300027907 Bacteria 660
619 Ga0268266_10582352 3300028379 Bacteria 1074
620 Ga0268266_10769834 3300028379 Bacteria 929
621 Ga0268265_10555458 3300028380 Bacteria 1091
622 Ga0268265_11112798 3300028380 Unclassified 784
623 Ga0268265_11225959 3300028380 Bacteria 748
624 Ga0268264_10003448 3300028381 Bacteria 13637
625 Ga0268264_10022957 3300028381 Bacteria 5090
626 Ga0268264_10029666 3300028381 Bacteria 4482
627 Ga0268264_10107319 3300028381 Unclassified 2439
628 Ga0268264_10378492 3300028381 Unclassified 1355
629 Ga0268264_10392469 3300028381 Bacteria 1332
630 Ga0268264_10596643 3300028381 Unclassified 1088
631 Ga0268264_10641757 3300028381 Unclassified 1050
632 Ga0268264_10911495 3300028381 Bacteria 883
633 Ga0265334_10190773 3300028573 Bacteria 714
634 Ga0265331_10170638 3300031250 Bacteria 984
635 Ga0265331_10478487 3300031250 Bacteria 560
636 Ga0265327_10000486 3300031251 Bacteria 69971
637 Ga0265327_10001555 3300031251 Bacteria 28194
638 Ga0265327_10408693 3300031251 Unclassified 589
639 Ga0307413_10017012 3300031824 Bacteria 3777
640 Ga0307406_10104081 3300031901 Bacteria 1940
641 Ga0307407_10398840 3300031903 Bacteria 986
642 Ga0307412_10653487 3300031911 Unclassified 897
643 Ga0307416_100142826 3300032002 Bacteria 2179
644 Ga0307416_101092382 3300032002 Bacteria 902
645 Ga0307414_10296426 3300032004 Bacteria 1366
646 Ga0307414_10378835 3300032004 Bacteria 1223
647 Ga0307411_10035693 3300032005 Bacteria 3108
648 Ga0307415_100040145 3300032126 Bacteria 3099
649 Ga0373943_0082603 3300035170 Unclassified 1650
650 Ga0373935_0605370 3300035692 Bacteria 802
651 Ga0373927_0768172 3300035695 Bacteria 637
652 Ga0373937_0013766 3300036401 Bacteria 7127
653 Ga0395905_0250606 3300037471 Unclassified 1654
654 Ga0439453_0018488 3300041408 Bacteria 1233
655 Ga0451793_0600990 3300041452 Unclassified 721
656 Ga0451795_0700755 3300041456 Unclassified 726
657 Ga0451798_0634217 3300041458 Bacteria 1002
658 Ga0451849_0825984 3300041505 Unclassified 637
659 Ga0439441_039909 3300042001 Bacteria 937
660 Ga0450923_029799 3300042125 Bacteria 1107
661 Ga0450898_053856 3300042134 Bacteria 782
662 Ga0439434_0055071 3300042435 Unclassified 1238
663 Ga0439460_0035228 3300042461 Unclassified 1447
664 Ga0451577_1130525 3300042876 Bacteria 700
665 Ga0453683_0255836 3300044673 Bacteria 1116
666 Ga0453684_0065081 3300044712 Bacteria 4652
667 Ga0453684_0395843 3300044712 Bacteria 1548
668 Ga0466967_0246262 3300045976 Bacteria 1706
669 Ga0466967_0337847 3300045976 Bacteria 1456
670 Ga0495592_0262964 3300046454 Bacteria 1135
671 Ga0495638_0079108 3300046460 Bacteria 2000
672 Ga0495653_0322979 3300046463 Bacteria 1000
673 Ga0495580_0221858 3300046472 Bacteria 1299
674 Ga0495662_0153486 3300046476 Bacteria 1134
675 Ga0495608_0034622 3300046511 Bacteria 3409
676 Ga0495618_0271851 3300046514 Unclassified 1059
677 Ga0495630_0002006 3300046517 Bacteria 14160
678 Ga0495666_0238614 3300046526 Unclassified 830
679 Ga0495587_0286672 3300046536 Bacteria 922
680 Ga0495598_0033988 3300046537 Bacteria 1451
681 Ga0495621_0053688 3300046539 Bacteria 1447
682 Ga0495645_0284873 3300046543 Bacteria 1085
683 Ga0495667_0021363 3300046559 Bacteria 4368
684 Ga0495635_0602203 3300046663 Bacteria 717
685 Ga0495659_0201692 3300046664 Unclassified 816
686 Ga0495657_0200107 3300046675 Unclassified 1218
687 Ga0495647_0433739 3300046681 Bacteria 607
688 Ga0495613_0221523 3300046689 Bacteria 1328
689 Ga0495670_0313497 3300046691 Bacteria 842
690 Ga0495600_0691971 3300046809 Bacteria 614
691 Ga0495672_0018264 3300047320 Bacteria 4665
692 Ga0495680_0179329 3300047322 Bacteria 1530
693 Ga0495684_0445753 3300047471 Bacteria 901
694 Ga0495686_0072989 3300047472 Bacteria 2109
695 Ga0495686_0266720 3300047472 Bacteria 956
696 Ga0496104_0144810 3300048907 Unclassified 2282
697 Ga0496105_0619977 3300048908 Unclassified 838
698 Ga0496110_0057868 3300048913 Unclassified 3414
699 Ga0496110_0378354 3300048913 Bacteria 1290
700 Ga0496111_0358437 3300048914 Unclassified 1079
701 Ga0496112_0500354 3300048915 Bacteria 1151
702 Ga0501031_0277492 3300049568 Bacteria 1087
703 Ga0501034_0047320 3300049571 Bacteria 4343
704 Ga0501034_1428683 3300049571 Bacteria 566
705 Ga0501036_0108985 3300049572 Bacteria 2340
706 Ga0501037_0027175 3300049573 Bacteria 4227
707 Ga0501037_0421756 3300049573 Bacteria 913
708 Ga0501038_0034097 3300049574 Bacteria 4477
709 Ga0501039_0288737 3300049575 Bacteria 1289
710 Ga0501040_1435286 3300049576 Bacteria 501
711 Ga0501043_0013234 3300049579 Bacteria 6451
712 Ga0501043_0182679 3300049579 Bacteria 1634
713 Ga0501043_0285425 3300049579 Bacteria 1264
714 Ga0501046_0056282 3300049580 Bacteria 3088
715 Ga0501046_0081067 3300049580 Unclassified 2506
716 Ga0501047_0537971 3300049581 Bacteria 993
717 Ga0501067_0630256 3300049583 Bacteria 602
718 Ga0501072_0177857 3300049588 Bacteria 1697
719 Ga0501072_0399193 3300049588 Bacteria 1091
720 Ga0501073_0067230 3300049589 Unclassified 2498
721 Ga0501201_005117 3300049651 Bacteria 1224
722 Ga0501202_020271 3300049652 Bacteria 1320
723 Ga0501207_018939 3300049654 Unclassified 1087
724 Ga0501217_009670 3300049661 Bacteria 2101
725 Ga0501217_041074 3300049661 Bacteria 1177
726 Ga0501249_016850 3300049679 Bacteria 1572
727 Ga0501257_041528 3300049686 Bacteria 1130
728 Ga0501221_028726 3300049704 Bacteria 1146
729 Ga0501225_0012547 3300049705 Bacteria 2379
730 Ga0501080_0347800 3300049742 Bacteria 1339
731 Ga0501080_1094312 3300049742 Bacteria 688
732 Ga0501083_0083419 3300049744 Bacteria 2117
733 Ga0501266_002960 3300049763 Bacteria 2117
734 Ga0501272_031807 3300049769 Unclassified 673
735 Ga0501273_004902 3300049770 Bacteria 1493
736 Ga0501275_011896 3300049772 Bacteria 952
737 Ga0501275_057230 3300049772 Bacteria 586
738 Ga0501283_055906 3300049779 Bacteria 706
739 Ga0501035_0561762 3300049822 Bacteria 934
740 Ga0501044_0135760 3300049823 Bacteria 2451
741 Ga0501044_0480892 3300049823 Bacteria 1145
742 nmdc:mga0k408_522133_c1 3300050493 Bacteria 703
743 nmdc:mga05p37_245401_c1 3300050507 Bacteria 2150
744 nmdc:mga09592_2001_c1 3300050508 Bacteria 16439
745 nmdc:mga09592_413483_c1 3300050508 Unclassified 1165
746 nmdc:mga0qj67_16101_c1 3300050509 Bacteria 5664
747 nmdc:mga08y16_73496_c1 3300050511 Bacteria 3563
748 nmdc:mga08y16_819369_c1 3300050511 Bacteria 922
749 nmdc:mga0n895_35075_c1 3300050512 Unclassified 4834
750 Ga0495619_0313303 3300053085 Bacteria 1087
751 Ga0501082_0744283 3300060353 Bacteria 858
752 Ga0157372_10375775
753 MRS1b_contig_3434530
754 JGI24736J21556_1032100
755 JGI24751J29686_10005684
756 Ga0065714_10105577
757 Ga0065704_10136066
758 Ga0065712_10068792
759 Ga0065712_10074890
760 Ga0065712_10104423
761 Ga0065712_10184032
762 Ga0065712_10288808
763 Ga0065712_10310127
764 Ga0065715_10789406
765 Ga0065707_10195463
766 Ga0065707_10254277
767 Ga0070658_10196689
768 Ga0070658_10573191
769 Ga0070658_11272529
770 Ga0070676_10004759
771 Ga0070683_100004630
772 Ga0070683_100127580
773 Ga0070683_100384056
774 Ga0070683_100642307
775 Ga0070690_100762852
776 Ga0070670_100012129
777 Ga0070670_100043986
778 Ga0070670_100266279
779 Ga0070670_100294515
780 Ga0070670_100305507
781 Ga0070670_100479254
782 Ga0070670_100639984
783 Ga0068869_100010013
784 Ga0068869_100017677
785 Ga0068869_100032776
786 Ga0068869_100167394
787 Ga0068869_100205432
788 Ga0068869_100848013
789 Ga0070666_10000029
790 Ga0070666_10004710
791 Ga0070666_10076156
792 Ga0070666_10116086
793 Ga0070666_10648712
794 Ga0070680_100017233
795 Ga0070682_100000121
796 Ga0070682_100027802
797 Ga0070682_100280100
798 Ga0068868_100001573
799 Ga0068868_100007158
800 Ga0068868_100040206
801 Ga0068868_100269680
802 Ga0068868_100648704
803 Ga0068868_102262957
804 Ga0070660_100125521
805 Ga0070660_100436657
806 Ga0070689_100052890
807 Ga0070689_100236439
808 Ga0070689_100385131
809 Ga0070689_100637129
810 Ga0070689_100806066
811 Ga0070687_100035475
812 Ga0070687_100117419
813 Ga0070661_100035447
814 Ga0070661_100039892
815 Ga0070661_100041788
816 Ga0070661_100924947
817 Ga0070668_100283596
818 Ga0070668_100475140
819 Ga0070668_100496242
820 Ga0070669_100565173
821 Ga0070669_101000141
822 Ga0070669_101415466
823 Ga0070675_100080407
824 Ga0070675_100612502
825 Ga0070675_100898986
826 Ga0070671_100041604
827 Ga0070671_100483173
828 Ga0070674_100091089
829 Ga0070673_100018294
830 Ga0070673_100020898
831 Ga0070673_100022215
832 Ga0070673_100145974
833 Ga0070673_100186325
834 Ga0070673_100293401
835 Ga0070673_100424128
836 Ga0070673_100459348
837 Ga0070673_100600112
838 Ga0070673_100815597
839 Ga0070673_100857835
840 Ga0070673_101372986
841 Ga0070688_100030515
842 Ga0070688_100036380
843 Ga0070688_100040865
844 Ga0070688_100046959
845 Ga0070688_100215302
846 Ga0070659_100010229
847 Ga0070659_100026459
848 Ga0070659_101243949
849 Ga0070659_101343947
850 Ga0070667_100028876
851 Ga0070667_100043851
852 Ga0070667_100091355
853 Ga0070667_100587049
854 Ga0070667_100691777
855 Ga0070701_10374624
856 Ga0070700_100325763
857 Ga0070700_100540451
858 Ga0070694_101638364
859 Ga0070678_100208243
860 Ga0070678_100504996
861 Ga0070678_101014930
862 Ga0070678_101149158
863 Ga0070662_100007843
864 Ga0070662_100012087
865 Ga0070662_100157702
866 Ga0070662_101914789
867 Ga0070681_10045988
868 Ga0070681_10387326
869 Ga0068867_100229758
870 Ga0068867_100999327
871 Ga0070685_10014969
872 Ga0070685_10029150
873 Ga0070685_10032181
874 Ga0070685_10303442
875 Ga0070685_10323228
876 Ga0070685_11165449
877 Ga0070698_100004719
878 Ga0070698_100045618
879 Ga0070684_100001507
880 Ga0070684_100001823
881 Ga0070684_100030747
882 Ga0070684_100055788
883 Ga0070684_100117066
884 Ga0068853_100003495
885 Ga0068853_100014307
886 Ga0068853_100207088
887 Ga0068853_100568394
888 Ga0068853_100753380
889 Ga0070672_100120004
890 Ga0070672_100291875
891 Ga0070672_100432605
892 Ga0070672_100494812
893 Ga0070672_100499618
894 Ga0070672_100883618
895 Ga0070686_100032847
896 Ga0070665_100861273
897 Ga0070665_101474597
898 Ga0068855_100345598
899 Ga0068855_101093422
900 Ga0070664_100006509
901 Ga0070664_100010783
902 Ga0070664_100058228
903 Ga0070664_100173752
904 Ga0070664_100287178
905 Ga0070664_100804492
906 Ga0068857_100066491
907 Ga0068857_100114923
908 Ga0068857_100129118
909 Ga0068857_100248502
910 Ga0068857_100418819
911 Ga0068857_100909250
912 Ga0068854_100197217
913 Ga0068854_100576228
914 Ga0068854_100829071
915 Ga0068856_100501660
916 Ga0068856_100847568
917 Ga0070702_100543724
918 Ga0068852_100007673
919 Ga0068852_100122581
920 Ga0068852_100228211
921 Ga0068852_100454084
922 Ga0068852_100580714
923 Ga0068852_100761825
924 Ga0068852_100782139
925 Ga0068852_101064526
926 Ga0068852_101142348
927 Ga0068852_101178933
928 Ga0068859_100000035
929 Ga0068859_100008881
930 Ga0068859_100012825
931 Ga0068859_100017555
932 Ga0068859_100017669
933 Ga0068859_100174800
934 Ga0068859_100479273
935 Ga0068859_100712738
936 Ga0068859_100827532
937 Ga0068859_100878118
938 Ga0068864_100003701
939 Ga0068864_100010317
940 Ga0068864_100026904
941 Ga0068864_100062013
942 Ga0068864_100303544
943 Ga0068864_100490498
944 Ga0068864_101386128
945 Ga0068866_10602165
946 Ga0068861_100004361
947 Ga0068861_100207279
948 Ga0068861_101607657
949 Ga0068851_10028262
950 Ga0068851_10053859
951 Ga0068851_10067464
952 Ga0068851_10148845
953 Ga0068851_10160475
954 Ga0068851_10300976
955 Ga0068851_10488982
956 Ga0068870_10025336
957 Ga0068863_100012229
958 Ga0068863_100019716
959 Ga0068863_100065220
960 Ga0068863_100103642
961 Ga0068863_100143956
962 Ga0068863_100233660
963 Ga0068863_100299805
964 Ga0068863_100591402
965 Ga0068863_100623343
966 Ga0068863_100818738
967 Ga0068863_101287977
968 Ga0068858_100008843
969 Ga0068858_100167359
970 Ga0068858_100700968
971 Ga0068858_100804638
972 Ga0068858_101130714
973 Ga0068858_101526831
974 Ga0068860_100001866
975 Ga0068860_100014180
976 Ga0068860_100023690
977 Ga0068860_100031479
978 Ga0068860_100822027
979 Ga0068860_100846983
980 Ga0068860_101627850
981 Ga0068862_100006882
982 Ga0068862_100930383
983 Ga0070715_10159697
984 Ga0075366_10117729
985 Ga0097621_100044878
986 Ga0097621_100072831
987 Ga0097621_100092268
988 Ga0097621_100103231
989 Ga0097621_100479725
990 Ga0097621_101062334
991 Ga0097621_101111205
992 Ga0097621_101268005
993 Ga0097621_101695481
994 Ga0068871_100005122
995 Ga0068871_100142713
996 Ga0068871_100208189
997 Ga0068871_100230320
998 Ga0068871_100250498
999 Ga0068871_100528397
1000 Ga0068871_100692673
1001 Ga0068871_100765174
1002 Ga0075428_100030428
1003 Ga0075428_100204390
1004 Ga0075428_100849829
1005 Ga0075430_100752259
1006 Ga0075434_100045188
1007 Ga0075434_101095018
1008 Ga0075429_100073998
1009 Ga0075429_100256192
1010 Ga0068865_100034060
1011 Ga0068865_100701905
1012 Ga0068865_100867697
1013 Ga0068865_100913478
1014 Ga0097620_100000035
1015 Ga0097620_100008881
1016 Ga0097620_100012825
1017 Ga0097620_100017554
1018 Ga0097620_100017669
1019 Ga0097620_100174795
1020 Ga0097620_100479310
1021 Ga0097620_100712666
1022 Ga0097620_100827534
1023 Ga0097620_100877907
1024 Ga0105251_10114145
1025 Ga0111539_10252588
1026 Ga0111539_11257993
1027 Ga0111539_11926136
1028 Ga0105247_10007092
1029 Ga0114129_10264806
1030 Ga0105241_10009779
1031 Ga0105241_10016614
1032 Ga0105241_10651063
1033 Ga0105241_11243346
1034 Ga0105242_10004904
1035 Ga0105242_10026221
1036 Ga0105242_10110990
1037 Ga0105248_10336986
1038 Ga0105248_10520018
1039 Ga0105248_10643080
1040 Ga0105237_10000982
1041 Ga0105237_10177716
1042 Ga0105237_10182652
1043 Ga0105237_10506527
1044 Ga0105249_10001660
1045 Ga0105249_10002832
1046 Ga0105249_10006234
1047 Ga0105249_10136973
1048 Ga0105249_10184694
1049 Ga0105249_10219876
1050 Ga0105249_10356570
1051 Ga0105249_10396887
1052 Ga0105249_10612049
1053 Ga0105249_10664039
1054 Ga0105249_10679028
1055 Ga0105239_10080572
1056 Ga0105239_10134667
1057 Ga0105239_10143481
1058 Ga0105239_10305987
1059 Ga0105246_10019435
1060 Ga0105246_10199502
1061 Ga0105246_11437674
1062 Ga0157373_10039346
1063 Ga0157373_10052637
1064 Ga0157371_10097601
1065 Ga0157371_10120123
1066 Ga0157371_10247805
1067 Ga0157370_10011710
1068 Ga0157370_10344984
1069 Ga0157370_10388437
1070 Ga0157370_11258476
1071 Ga0157370_11388978
1072 Ga0157369_10007185
1073 Ga0157369_10082633
1074 Ga0157369_10507244
1075 Ga0157369_10584004
1076 Ga0157374_10006774
1077 Ga0157374_10064530
1078 Ga0157374_10067760
1079 Ga0157374_10100235
1080 Ga0157374_10458954
1081 Ga0157374_10498781
1082 Ga0157374_11163959
1083 Ga0157374_11357822
1084 Ga0157374_12406634
1085 Ga0157378_10001438
1086 Ga0157378_10010020
1087 Ga0157378_10011679
1088 Ga0157378_10022663
1089 Ga0157378_10045203
1090 Ga0157378_10071008
1091 Ga0157378_10767071
1092 Ga0157378_10786731
1093 Ga0157378_11047926
1094 Ga0157378_11530734
1095 Ga0157378_11666802
1096 Ga0163162_10000573
1097 Ga0163162_10008034
1098 Ga0163162_10050425
1099 Ga0163162_10068868
1100 Ga0163162_10086601
1101 Ga0163162_10090772
1102 Ga0163162_10122396
1103 Ga0163162_10348054
1104 Ga0163162_10940572
1105 Ga0163162_11024540
1106 Ga0163162_11439225
1107 Ga0163162_11684684
1108 Ga0163162_11757523
1109 Ga0157372_10035574
1110 Ga0157372_10098666
1111 Ga0157372_10243366
1112 Ga0157372_10330442
1113 Ga0157372_10335385
1114 Ga0157372_10434704
1115 Ga0157372_11625253
1116 Ga0157372_11923447
1117 Ga0157372_12014527
1118 Ga0157375_10004591
1119 Ga0157375_10015720
1120 Ga0157375_10021560
1121 Ga0157375_10036679
1122 Ga0157375_10177980
1123 Ga0157375_10203163
1124 Ga0157375_10226217
1125 Ga0157375_10280323
1126 Ga0157375_10285564
1127 Ga0157375_10469058
1128 Ga0157375_10705153
1129 Ga0163163_10000389
1130 Ga0163163_10001282
1131 Ga0163163_10002619
1132 Ga0163163_10020882
1133 Ga0163163_10073355
1134 Ga0163163_10260697
1135 Ga0163163_10301975
1136 Ga0163163_11181906
1137 Ga0163163_12356692
1138 Ga0157380_10034980
1139 Ga0157380_10058057
1140 Ga0157380_10235746
1141 Ga0157380_10481803
1142 Ga0157380_10602009
1143 Ga0157380_10730369
1144 Ga0157380_11826655
1145 Ga0157380_12228007
1146 Ga0157377_10063094
1147 Ga0157377_10120864
1148 Ga0157379_10042275
1149 Ga0157379_10048220
1150 Ga0157379_10090866
1151 Ga0157379_10224980
1152 Ga0157379_10833012
1153 Ga0157379_11026545
1154 Ga0157379_11745478
1155 Ga0157379_12214068
1156 Ga0157376_10027665
1157 Ga0157376_10059285
1158 Ga0157376_10108182
1159 Ga0157376_10307364
1160 Ga0157376_10495666
1161 Ga0157376_10584970
1162 Ga0157376_10763198
1163 Ga0157376_11019837
1164 Ga0157376_12231795
1165 Ga0163161_10042057
1166 Ga0163161_10095208
1167 Ga0163161_10117369
1168 Ga0163161_10120309
1169 Ga0163161_10242660
1170 Ga0163161_10480954
1171 Ga0163161_10999552
1172 Ga0163161_11319272
1173 Ga0207697_10031810
1174 Ga0207656_10029691
1175 Ga0207656_10063745
1176 Ga0207656_10066261
1177 Ga0207656_10091317
1178 Ga0207656_10206696
1179 Ga0207682_10055907
1180 Ga0207682_10088751
1181 Ga0207688_10670796
1182 Ga0207680_10000049
1183 Ga0207680_10067092
1184 Ga0207680_10135088
1185 Ga0207680_10535337
1186 Ga0207647_10000476
1187 Ga0207647_10091251
1188 Ga0207685_10060305
1189 Ga0207645_10027954
1190 Ga0207645_10032027
1191 Ga0207645_10132465
1192 Ga0207643_10001986
1193 Ga0207643_10240235
1194 Ga0207705_10073031
1195 Ga0207705_10561860
1196 Ga0207654_10002237
1197 Ga0207654_10727413
1198 Ga0207654_10783050
1199 Ga0207707_10663035
1200 Ga0207707_11037598
1201 Ga0207671_10010433
1202 Ga0207671_10228990
1203 Ga0207671_10411483
1204 Ga0207660_10016945
1205 Ga0207662_10124911
1206 Ga0207657_10010243
1207 Ga0207657_10010983
1208 Ga0207649_10026820
1209 Ga0207649_10065132
1210 Ga0207649_10106454
1211 Ga0207652_10040389
1212 Ga0207681_10335682
1213 Ga0207681_10811031
1214 Ga0207681_10947381
1215 Ga0207681_11485301
1216 Ga0207650_10002762
1217 Ga0207650_10072853
1218 Ga0207650_10077074
1219 Ga0207650_10093877
1220 Ga0207650_10462247
1221 Ga0207650_10715104
1222 Ga0207650_10897324
1223 Ga0207650_10922709
1224 Ga0207650_11668348
1225 Ga0207659_11573036
1226 Ga0207644_10012044
1227 Ga0207644_10025394
1228 Ga0207644_10327533
1229 Ga0207644_10372245
1230 Ga0207644_10599115
1231 Ga0207644_10600564
1232 Ga0207644_10669080
1233 Ga0207690_10063607
1234 Ga0207690_10202204
1235 Ga0207690_10508836
1236 Ga0207690_10522242
1237 Ga0207706_10001166
1238 Ga0207706_10144953
1239 Ga0207686_10005943
1240 Ga0207686_10017719
1241 Ga0207670_10019401
1242 Ga0207670_10103117
1243 Ga0207670_10697121
1244 Ga0207704_10779329
1245 Ga0207691_10038909
1246 Ga0207691_10044646
1247 Ga0207691_10070753
1248 Ga0207691_10154860
1249 Ga0207691_10276454
1250 Ga0207711_10460276
1251 Ga0207689_10003728
1252 Ga0207689_10004815
1253 Ga0207689_10017714
1254 Ga0207689_10022363
1255 Ga0207689_10030721
1256 Ga0207689_10125592
1257 Ga0207689_10224172
1258 Ga0207689_10692045
1259 Ga0207689_10926542
1260 Ga0207661_10004912
1261 Ga0207661_10013672
1262 Ga0207661_10105202
1263 Ga0207661_10124704
1264 Ga0207661_10346948
1265 Ga0207661_10389930
1266 Ga0207679_10088400
1267 Ga0207679_10098682
1268 Ga0207679_10104216
1269 Ga0207679_10426370
1270 Ga0207679_10789216
1271 Ga0207679_11334314
1272 Ga0207679_11361421
1273 Ga0207667_11026638
1274 Ga0207651_10072803
1275 Ga0207651_10134090
1276 Ga0207651_10184650
1277 Ga0207651_10263326
1278 Ga0207651_10309748
1279 Ga0207651_10353621
1280 Ga0207651_10675154
1281 Ga0207651_10873776
1282 Ga0207651_10987793
1283 Ga0207651_11256479
1284 Ga0207712_10001799
1285 Ga0207712_10017174
1286 Ga0207712_10148302
1287 Ga0207712_10195039
1288 Ga0207712_10335983
1289 Ga0207712_10383683
1290 Ga0207712_10497065
1291 Ga0207712_10498834
1292 Ga0207712_10558800
1293 Ga0207712_10806744
1294 Ga0207668_10797206
1295 Ga0207668_11057201
1296 Ga0207640_10018137
1297 Ga0207640_10098329
1298 Ga0207640_10199007
1299 Ga0207640_10329434
1300 Ga0207658_10033518
1301 Ga0207658_10173546
1302 Ga0207658_10506948
1303 Ga0207658_10523332
1304 Ga0207658_10574576
1305 Ga0207658_10915885
1306 Ga0207658_11284449
1307 Ga0207658_11314442
1308 Ga0207677_10066026
1309 Ga0207677_10094102
1310 Ga0207677_10467367
1311 Ga0207677_12009267
1312 Ga0207703_10004435
1313 Ga0207703_10065575
1314 Ga0207703_10898998
1315 Ga0207639_10033622
1316 Ga0207639_10066469
1317 Ga0207639_10067896
1318 Ga0207639_10619234
1319 Ga0207639_10805384
1320 Ga0207678_10073104
1321 Ga0207708_11302097
1322 Ga0207702_11731751
1323 Ga0207641_10000043
1324 Ga0207641_10003385
1325 Ga0207641_10011357
1326 Ga0207641_10068082
1327 Ga0207641_10314942
1328 Ga0207641_10400083
1329 Ga0207641_10582432
1330 Ga0207641_10811537
1331 Ga0207641_11361840
1332 Ga0207641_11399174
1333 Ga0207648_10043180
1334 Ga0207648_10076501
1335 Ga0207648_10535903
1336 Ga0207648_10552544
1337 Ga0207648_10602217
1338 Ga0207648_10657628
1339 Ga0207648_10806478
1340 Ga0207676_10061662
1341 Ga0207676_10072390
1342 Ga0207676_10285386
1343 Ga0207676_12048036
1344 Ga0207674_10026000
1345 Ga0207674_10030349
1346 Ga0207674_10062960
1347 Ga0207674_10160993
1348 Ga0207674_10213393
1349 Ga0207674_10568595
1350 Ga0207674_11109477
1351 Ga0207675_100003277
1352 Ga0207675_100282013
1353 Ga0207675_100314835
1354 Ga0207675_100981177
1355 Ga0207675_101525912
1356 Ga0207683_10071827
1357 Ga0207683_10268896
1358 Ga0207683_10906280
1359 Ga0207683_10981018
1360 Ga0207698_10018104
1361 Ga0207698_10068654
1362 Ga0207698_10135279
1363 Ga0207698_10169324
1364 Ga0207698_10284786
1365 Ga0207698_10287089
1366 Ga0207698_10481887
1367 Ga0207698_11087473
1368 Ga0207428_10170859
1369 Ga0207428_10820030
1370 Ga0268266_10582352
1371 Ga0268266_10769834
1372 Ga0268265_10555458
1373 Ga0268265_11112798
1374 Ga0268265_11225959
1375 Ga0268264_10003448
1376 Ga0268264_10022957
1377 Ga0268264_10029666
1378 Ga0268264_10107319
1379 Ga0268264_10378492
1380 Ga0268264_10392469
1381 Ga0268264_10596643
1382 Ga0268264_10641757
1383 Ga0268264_10911495
1384 Ga0265334_10190773
1385 Ga0265331_10170638
1386 Ga0265331_10478487
1387 Ga0265327_10000486
1388 Ga0265327_10001555
1389 Ga0265327_10408693
1390 Ga0307413_10017012
1391 Ga0307406_10104081
1392 Ga0307407_10398840
1393 Ga0307412_10653487
1394 Ga0307416_100142826
1395 Ga0307416_101092382
1396 Ga0307414_10296426
1397 Ga0307414_10378835
1398 Ga0307411_10035693
1399 Ga0307415_100040145
1400 Ga0373943_0082603
1401 Ga0373935_0605370
1402 Ga0373927_0768172
1403 Ga0373937_0013766
1404 Ga0395905_0250606
1405 Ga0439453_0018488
1406 Ga0451793_0600990
1407 Ga0451795_0700755
1408 Ga0451798_0634217
1409 Ga0451849_0825984
1410 Ga0439441_039909
1411 Ga0450923_029799
1412 Ga0450898_053856
1413 Ga0439434_0055071
1414 Ga0439460_0035228
1415 Ga0451577_1130525
1416 Ga0453683_0255836
1417 Ga0453684_0065081
1418 Ga0453684_0395843
1419 Ga0466967_0246262
1420 Ga0466967_0337847
1421 Ga0495592_0262964
1422 Ga0495638_0079108
1423 Ga0495653_0322979
1424 Ga0495580_0221858
1425 Ga0495662_0153486
1426 Ga0495608_0034622
1427 Ga0495618_0271851
1428 Ga0495630_0002006
1429 Ga0495666_0238614
1430 Ga0495587_0286672
1431 Ga0495598_0033988
1432 Ga0495621_0053688
1433 Ga0495645_0284873
1434 Ga0495667_0021363
1435 Ga0495635_0602203
1436 Ga0495659_0201692
1437 Ga0495657_0200107
1438 Ga0495647_0433739
1439 Ga0495613_0221523
1440 Ga0495670_0313497
1441 Ga0495600_0691971
1442 Ga0495672_0018264
1443 Ga0495680_0179329
1444 Ga0495684_0445753
1445 Ga0495686_0072989
1446 Ga0495686_0266720
1447 Ga0496104_0144810
1448 Ga0496105_0619977
1449 Ga0496110_0057868
1450 Ga0496110_0378354
1451 Ga0496111_0358437
1452 Ga0496112_0500354
1453 Ga0501031_0277492
1454 Ga0501034_0047320
1455 Ga0501034_1428683
1456 Ga0501036_0108985
1457 Ga0501037_0027175
1458 Ga0501037_0421756
1459 Ga0501038_0034097
1460 Ga0501039_0288737
1461 Ga0501040_1435286
1462 Ga0501043_0013234
1463 Ga0501043_0182679
1464 Ga0501043_0285425
1465 Ga0501046_0056282
1466 Ga0501046_0081067
1467 Ga0501047_0537971
1468 Ga0501067_0630256
1469 Ga0501072_0177857
1470 Ga0501072_0399193
1471 Ga0501073_0067230
1472 Ga0501201_005117
1473 Ga0501202_020271
1474 Ga0501207_018939
1475 Ga0501217_009670
1476 Ga0501217_041074
1477 Ga0501249_016850
1478 Ga0501257_041528
1479 Ga0501221_028726
1480 Ga0501225_0012547
1481 Ga0501080_0347800
1482 Ga0501080_1094312
1483 Ga0501083_0083419
1484 Ga0501266_002960
1485 Ga0501272_031807
1486 Ga0501273_004902
1487 Ga0501275_011896
1488 Ga0501275_057230
1489 Ga0501283_055906
1490 Ga0501035_0561762
1491 Ga0501044_0135760
1492 Ga0501044_0480892
1493 nmdc:mga0k408_522133_c1
1494 nmdc:mga05p37_245401_c1
1495 nmdc:mga09592_2001_c1
1496 nmdc:mga09592_413483_c1
1497 nmdc:mga0qj67_16101_c1
1498 nmdc:mga08y16_73496_c1
1499 nmdc:mga08y16_819369_c1
1500 nmdc:mga0n895_35075_c1
1501 Ga0495619_0313303
1502 Ga0501082_0744283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

56

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9i-assembly1.cif.gz_C mycobacterial respiratory complex i, semi-inserted quinone 0.9166 3 143
7dkf-assembly1.cif.gz_C2 activity optimized supercomplex state4 0.9026 4 143
7p7l-assembly1.cif.gz_C complex i from e. coli, ddm/lmng-purified, with nadh and fmn, open state 0.8924 3 143
6gcs-assembly1.cif.gz_G cryo-em structure of respiratory complex i from yarrowia lipolytica 0.8912 4 143
7p7k-assembly1.cif.gz_C complex i from e. coli, ddm/lmng-purified, with dq, resting state 0.8893 3 143
ID Description Score Start End Superfamily
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9377 18 125 3.30.460.80
af_P22237_2_142_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9333 4 125 3.30.460.80
af_K7MG26_41_126_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9304 50 125 3.30.460.80
af_Q9VZU4_36_188_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9168 4 125 3.30.460.80
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9149 4 125 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A351PZ43-F1-model_v4 deleted 0.9903 1 110
AF-A0A351PZ43-F1-model_v4 deleted 0.9814 1 110
AF-A0A3A4V720-F1-model_v4 NADH-quinone oxidoreductase (EC 7.1.1.-) 0.9672 27 142 GO:0008137
GO:0048038
AF-A0A1F6Q0Z0-F1-model_v4 NADH:ubiquinone oxidoreductase 30kDa subunit domain-containing protein 0.9666 27 146 GO:0008137
AF-A0A6J7HK28-F1-model_v4 Unannotated protein 0.9599 29 144 GO:0008137

Map