F479018
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 749 | 251 | 748 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0080447|Ga0495638_0080447_441_908 |
| Length | 155 |
| Sequence | LAPRGAARILTRETPSPEDAMPLELKILAWGCVLALVHILAASHVRTRQFGIAWNTGPRDTDPAAPAPIVGRLLRAQANYFETFPIAAAALLIDGLFPLSSALTQLGAALWLGARIIYLPLYAAGVPVLRSLVWLVSLLGIALLLWPALWASLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 225 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 226 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 237 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 239 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 240 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 242 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 243 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 244 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 245 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 246 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 247 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 251 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0.13 |
| Rhizoplane | 3.2 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10020127 | 3300001979 | Bacteria | 2335 |
| 2 | JGI24740J21852_10034420 | 3300001979 | Bacteria | 1596 |
| 3 | JGI24739J22299_10000453 | 3300001989 | Bacteria | 14331 |
| 4 | JGI24739J22299_10027197 | 3300001989 | Unclassified | 2001 |
| 5 | JGI24737J22298_10000021 | 3300001990 | Bacteria | 45543 |
| 6 | JGI24737J22298_10056449 | 3300001990 | Bacteria | 1186 |
| 7 | JGI24735J21928_10017771 | 3300002067 | Bacteria | 2198 |
| 8 | JGI24748J21848_1024486 | 3300002074 | Bacteria | 735 |
| 9 | JGI24738J21930_10000062 | 3300002075 | Bacteria | 22279 |
| 10 | JGI24749J21850_1007519 | 3300002076 | Bacteria | 1519 |
| 11 | JGI24035J26624_1005815 | 3300002126 | Bacteria | 1184 |
| 12 | Ga0065712_10031930 | 3300005290 | Bacteria | 1229 |
| 13 | Ga0070658_10034989 | 3300005327 | Bacteria | 4044 |
| 14 | Ga0070658_10169474 | 3300005327 | Bacteria | 1834 |
| 15 | Ga0070658_10410767 | 3300005327 | Bacteria | 1163 |
| 16 | Ga0070658_10857287 | 3300005327 | Bacteria | 789 |
| 17 | Ga0070658_11090690 | 3300005327 | Bacteria | 694 |
| 18 | Ga0070658_11141804 | 3300005327 | Bacteria | 677 |
| 19 | Ga0070658_11327575 | 3300005327 | Unclassified | 624 |
| 20 | Ga0070676_10003504 | 3300005328 | Bacteria | 8192 |
| 21 | Ga0070676_10011228 | 3300005328 | Bacteria | 4871 |
| 22 | Ga0070676_10169095 | 3300005328 | Bacteria | 1412 |
| 23 | Ga0070676_10218065 | 3300005328 | Bacteria | 1259 |
| 24 | Ga0070683_101497744 | 3300005329 | Bacteria | 649 |
| 25 | Ga0070683_101765478 | 3300005329 | Bacteria | 595 |
| 26 | Ga0070690_100018652 | 3300005330 | Bacteria | 4194 |
| 27 | Ga0070670_100010365 | 3300005331 | Bacteria | 7955 |
| 28 | Ga0070670_100075676 | 3300005331 | Bacteria | 2892 |
| 29 | Ga0070670_100197748 | 3300005331 | Bacteria | 1746 |
| 30 | Ga0070670_100211938 | 3300005331 | Bacteria | 1684 |
| 31 | Ga0070670_100301085 | 3300005331 | Bacteria | 1403 |
| 32 | Ga0070677_10004566 | 3300005333 | Bacteria | 4525 |
| 33 | Ga0070677_10061063 | 3300005333 | Bacteria | 1555 |
| 34 | Ga0070677_10560965 | 3300005333 | Bacteria | 627 |
| 35 | Ga0068869_100034193 | 3300005334 | Bacteria | 3594 |
| 36 | Ga0068869_100071883 | 3300005334 | Bacteria | 2562 |
| 37 | Ga0068869_100339175 | 3300005334 | Bacteria | 1223 |
| 38 | Ga0070666_10049262 | 3300005335 | Bacteria | 2830 |
| 39 | Ga0070666_10052157 | 3300005335 | Bacteria | 2756 |
| 40 | Ga0070666_10162447 | 3300005335 | Bacteria | 1561 |
| 41 | Ga0070666_10657553 | 3300005335 | Bacteria | 767 |
| 42 | Ga0070680_100294940 | 3300005336 | Bacteria | 1374 |
| 43 | Ga0070680_101054807 | 3300005336 | Bacteria | 702 |
| 44 | Ga0070682_100123267 | 3300005337 | Bacteria | 1743 |
| 45 | Ga0070682_100214281 | 3300005337 | Bacteria | 1367 |
| 46 | Ga0068868_100000637 | 3300005338 | Bacteria | 23618 |
| 47 | Ga0068868_101126191 | 3300005338 | Bacteria | 723 |
| 48 | Ga0070660_100001821 | 3300005339 | Bacteria | 14639 |
| 49 | Ga0070660_100002082 | 3300005339 | Bacteria | 13818 |
| 50 | Ga0070660_100023740 | 3300005339 | Bacteria | 4544 |
| 51 | Ga0070660_100152967 | 3300005339 | Unclassified | 1856 |
| 52 | Ga0070660_100219149 | 3300005339 | Bacteria | 1546 |
| 53 | Ga0070660_100387183 | 3300005339 | Bacteria | 1154 |
| 54 | Ga0070660_100419199 | 3300005339 | Bacteria | 1108 |
| 55 | Ga0070660_100429773 | 3300005339 | Bacteria | 1094 |
| 56 | Ga0070660_100478065 | 3300005339 | Bacteria | 1035 |
| 57 | Ga0070660_100542317 | 3300005339 | Bacteria | 970 |
| 58 | Ga0070660_100973574 | 3300005339 | Bacteria | 716 |
| 59 | Ga0070689_100009615 | 3300005340 | Bacteria | 6863 |
| 60 | Ga0070689_100013741 | 3300005340 | Bacteria | 5865 |
| 61 | Ga0070689_101226884 | 3300005340 | Bacteria | 674 |
| 62 | Ga0070687_100216472 | 3300005343 | Bacteria | 1170 |
| 63 | Ga0070661_100007377 | 3300005344 | Bacteria | 7580 |
| 64 | Ga0070661_100031513 | 3300005344 | Bacteria | 3836 |
| 65 | Ga0070661_100074768 | 3300005344 | Bacteria | 2495 |
| 66 | Ga0070661_100109407 | 3300005344 | Bacteria | 2062 |
| 67 | Ga0070661_100314557 | 3300005344 | Bacteria | 1222 |
| 68 | Ga0070661_100342559 | 3300005344 | Bacteria | 1171 |
| 69 | Ga0070661_100445614 | 3300005344 | Bacteria | 1029 |
| 70 | Ga0070661_100514389 | 3300005344 | Bacteria | 959 |
| 71 | Ga0070661_100795031 | 3300005344 | Bacteria | 776 |
| 72 | Ga0070661_101052675 | 3300005344 | Bacteria | 676 |
| 73 | Ga0070661_101105657 | 3300005344 | Bacteria | 660 |
| 74 | Ga0070661_101334919 | 3300005344 | Bacteria | 602 |
| 75 | Ga0070668_100005175 | 3300005347 | Bacteria | 9673 |
| 76 | Ga0070668_100032860 | 3300005347 | Bacteria | 3949 |
| 77 | Ga0070668_100359173 | 3300005347 | Bacteria | 1235 |
| 78 | Ga0070668_101547510 | 3300005347 | Bacteria | 607 |
| 79 | Ga0070669_100000009 | 3300005353 | Bacteria | 224683 |
| 80 | Ga0070669_100000862 | 3300005353 | Bacteria | 22037 |
| 81 | Ga0070669_100096778 | 3300005353 | Bacteria | 2221 |
| 82 | Ga0070669_100118774 | 3300005353 | Bacteria | 2014 |
| 83 | Ga0070669_100171760 | 3300005353 | Bacteria | 1690 |
| 84 | Ga0070669_100199231 | 3300005353 | Bacteria | 1574 |
| 85 | Ga0070675_100007443 | 3300005354 | Bacteria | 8456 |
| 86 | Ga0070675_100047334 | 3300005354 | Bacteria | 3524 |
| 87 | Ga0070675_100302676 | 3300005354 | Bacteria | 1409 |
| 88 | Ga0070675_100858179 | 3300005354 | Bacteria | 831 |
| 89 | Ga0070671_100001012 | 3300005355 | Bacteria | 20660 |
| 90 | Ga0070671_100002229 | 3300005355 | Bacteria | 14965 |
| 91 | Ga0070671_100076910 | 3300005355 | Bacteria | 2789 |
| 92 | Ga0070671_100503647 | 3300005355 | Bacteria | 1042 |
| 93 | Ga0070671_100732538 | 3300005355 | Bacteria | 859 |
| 94 | Ga0070671_100772397 | 3300005355 | Bacteria | 836 |
| 95 | Ga0070671_101167974 | 3300005355 | Bacteria | 677 |
| 96 | Ga0070674_100001982 | 3300005356 | Bacteria | 11206 |
| 97 | Ga0070674_100051087 | 3300005356 | Bacteria | 2848 |
| 98 | Ga0070674_100139092 | 3300005356 | Bacteria | 1820 |
| 99 | Ga0070674_100196996 | 3300005356 | Bacteria | 1553 |
| 100 | Ga0070674_100330914 | 3300005356 | Unclassified | 1224 |
| 101 | Ga0070673_100000209 | 3300005364 | Bacteria | 29078 |
| 102 | Ga0070673_100057133 | 3300005364 | Bacteria | 3082 |
| 103 | Ga0070673_100096310 | 3300005364 | Bacteria | 2428 |
| 104 | Ga0070673_100161093 | 3300005364 | Bacteria | 1908 |
| 105 | Ga0070673_100933179 | 3300005364 | Bacteria | 806 |
| 106 | Ga0070673_100967289 | 3300005364 | Bacteria | 791 |
| 107 | Ga0070659_100006023 | 3300005366 | Bacteria | 8743 |
| 108 | Ga0070659_100007835 | 3300005366 | Bacteria | 7774 |
| 109 | Ga0070659_100028371 | 3300005366 | Bacteria | 4322 |
| 110 | Ga0070659_100323638 | 3300005366 | Bacteria | 1289 |
| 111 | Ga0070659_100427468 | 3300005366 | Bacteria | 1121 |
| 112 | Ga0070659_101220277 | 3300005366 | Bacteria | 665 |
| 113 | Ga0070667_100004734 | 3300005367 | Bacteria | 11402 |
| 114 | Ga0070667_100005313 | 3300005367 | Bacteria | 10759 |
| 115 | Ga0070667_100090330 | 3300005367 | Bacteria | 2632 |
| 116 | Ga0070667_100116585 | 3300005367 | Bacteria | 2319 |
| 117 | Ga0070667_100264669 | 3300005367 | Bacteria | 1540 |
| 118 | Ga0070667_100322181 | 3300005367 | Bacteria | 1395 |
| 119 | Ga0070705_100765159 | 3300005440 | Bacteria | 765 |
| 120 | Ga0070663_100013706 | 3300005455 | Bacteria | 5180 |
| 121 | Ga0070663_100050307 | 3300005455 | Bacteria | 2963 |
| 122 | Ga0070663_100094108 | 3300005455 | Bacteria | 2224 |
| 123 | Ga0070663_100217564 | 3300005455 | Bacteria | 1498 |
| 124 | Ga0070663_100237306 | 3300005455 | Bacteria | 1438 |
| 125 | Ga0070663_100303531 | 3300005455 | Bacteria | 1279 |
| 126 | Ga0070663_101003971 | 3300005455 | Bacteria | 726 |
| 127 | Ga0070663_101017456 | 3300005455 | Unclassified | 721 |
| 128 | Ga0070663_101026257 | 3300005455 | Bacteria | 718 |
| 129 | Ga0070663_101370813 | 3300005455 | Bacteria | 625 |
| 130 | Ga0070663_101525893 | 3300005455 | Bacteria | 594 |
| 131 | Ga0070678_100089929 | 3300005456 | Bacteria | 2351 |
| 132 | Ga0070678_100123475 | 3300005456 | Bacteria | 2046 |
| 133 | Ga0070678_100197779 | 3300005456 | Bacteria | 1657 |
| 134 | Ga0070662_100001955 | 3300005457 | Bacteria | 12662 |
| 135 | Ga0070662_100044295 | 3300005457 | Bacteria | 3187 |
| 136 | Ga0070662_100083028 | 3300005457 | Bacteria | 2390 |
| 137 | Ga0070662_100255675 | 3300005457 | Bacteria | 1410 |
| 138 | Ga0070662_100293262 | 3300005457 | Bacteria | 1319 |
| 139 | Ga0070662_100346368 | 3300005457 | Bacteria | 1216 |
| 140 | Ga0070662_100638120 | 3300005457 | Bacteria | 898 |
| 141 | Ga0070662_100833426 | 3300005457 | Bacteria | 785 |
| 142 | Ga0070662_101187810 | 3300005457 | Bacteria | 656 |
| 143 | Ga0070681_10051638 | 3300005458 | Bacteria | 4101 |
| 144 | Ga0070681_10246249 | 3300005458 | Bacteria | 1700 |
| 145 | Ga0070681_11901214 | 3300005458 | Unclassified | 523 |
| 146 | Ga0068867_100000633 | 3300005459 | Bacteria | 23213 |
| 147 | Ga0068867_100011413 | 3300005459 | Bacteria | 6269 |
| 148 | Ga0068867_100329452 | 3300005459 | Bacteria | 1268 |
| 149 | Ga0068867_100401748 | 3300005459 | Bacteria | 1156 |
| 150 | Ga0068867_101063450 | 3300005459 | Bacteria | 737 |
| 151 | Ga0070685_10000225 | 3300005466 | Bacteria | 37151 |
| 152 | Ga0070679_100000750 | 3300005530 | Bacteria | 28064 |
| 153 | Ga0070679_100091968 | 3300005530 | Bacteria | 3021 |
| 154 | Ga0070679_101202036 | 3300005530 | Unclassified | 703 |
| 155 | Ga0070679_101246968 | 3300005530 | Bacteria | 689 |
| 156 | Ga0070679_101472415 | 3300005530 | Bacteria | 627 |
| 157 | Ga0070679_101551282 | 3300005530 | Bacteria | 610 |
| 158 | Ga0068853_100002063 | 3300005539 | Bacteria | 14889 |
| 159 | Ga0068853_100060675 | 3300005539 | Bacteria | 3269 |
| 160 | Ga0068853_100342356 | 3300005539 | Bacteria | 1390 |
| 161 | Ga0068853_100444925 | 3300005539 | Unclassified | 1218 |
| 162 | Ga0068853_100621954 | 3300005539 | Bacteria | 1026 |
| 163 | Ga0068853_100885472 | 3300005539 | Bacteria | 857 |
| 164 | Ga0068853_101259303 | 3300005539 | Bacteria | 714 |
| 165 | Ga0068853_101934244 | 3300005539 | Bacteria | 572 |
| 166 | Ga0070672_100000770 | 3300005543 | Bacteria | 19069 |
| 167 | Ga0070672_100012771 | 3300005543 | Bacteria | 5912 |
| 168 | Ga0070672_100332309 | 3300005543 | Bacteria | 1293 |
| 169 | Ga0070672_100743794 | 3300005543 | Bacteria | 860 |
| 170 | Ga0070695_101420361 | 3300005545 | Unclassified | 576 |
| 171 | Ga0070696_100054831 | 3300005546 | Bacteria | 2779 |
| 172 | Ga0070693_100039946 | 3300005547 | Unclassified | 2631 |
| 173 | Ga0070693_100369905 | 3300005547 | Bacteria | 986 |
| 174 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 175 | Ga0070665_100000590 | 3300005548 | Bacteria | 50563 |
| 176 | Ga0070665_101003374 | 3300005548 | Bacteria | 847 |
| 177 | Ga0070665_101415786 | 3300005548 | Bacteria | 704 |
| 178 | Ga0068855_100039372 | 3300005563 | Bacteria | 5611 |
| 179 | Ga0068855_100659183 | 3300005563 | Unclassified | 1123 |
| 180 | Ga0068855_101588504 | 3300005563 | Bacteria | 669 |
| 181 | Ga0070664_100002427 | 3300005564 | Bacteria | 14988 |
| 182 | Ga0070664_100009081 | 3300005564 | Bacteria | 8067 |
| 183 | Ga0070664_100010866 | 3300005564 | Bacteria | 7383 |
| 184 | Ga0070664_100046060 | 3300005564 | Bacteria | 3683 |
| 185 | Ga0070664_100183983 | 3300005564 | Bacteria | 1858 |
| 186 | Ga0070664_100518830 | 3300005564 | Bacteria | 1100 |
| 187 | Ga0068857_100004161 | 3300005577 | Bacteria | 12189 |
| 188 | Ga0068857_100105577 | 3300005577 | Bacteria | 2529 |
| 189 | Ga0068857_100150925 | 3300005577 | Unclassified | 2105 |
| 190 | Ga0068857_100857248 | 3300005577 | Bacteria | 869 |
| 191 | Ga0068857_101202536 | 3300005577 | Bacteria | 734 |
| 192 | Ga0068857_101902702 | 3300005577 | Bacteria | 583 |
| 193 | Ga0068854_100000614 | 3300005578 | Bacteria | 21116 |
| 194 | Ga0068854_100068281 | 3300005578 | Bacteria | 2592 |
| 195 | Ga0068854_100103296 | 3300005578 | Bacteria | 2139 |
| 196 | Ga0068854_100337004 | 3300005578 | Bacteria | 1231 |
| 197 | Ga0068854_100523947 | 3300005578 | Bacteria | 1001 |
| 198 | Ga0068854_100724192 | 3300005578 | Bacteria | 861 |
| 199 | Ga0068854_101022875 | 3300005578 | Bacteria | 733 |
| 200 | Ga0068856_100057609 | 3300005614 | Bacteria | 3836 |
| 201 | Ga0068856_100182730 | 3300005614 | Bacteria | 2111 |
| 202 | Ga0068856_100801697 | 3300005614 | Bacteria | 961 |
| 203 | Ga0068856_100850295 | 3300005614 | Bacteria | 931 |
| 204 | Ga0068856_101015343 | 3300005614 | Bacteria | 848 |
| 205 | Ga0070702_100102565 | 3300005615 | Bacteria | 1758 |
| 206 | Ga0068852_100000804 | 3300005616 | Bacteria | 20664 |
| 207 | Ga0068852_100039331 | 3300005616 | Bacteria | 3982 |
| 208 | Ga0068852_100086339 | 3300005616 | Bacteria | 2797 |
| 209 | Ga0068852_100086868 | 3300005616 | Unclassified | 2789 |
| 210 | Ga0068852_100439777 | 3300005616 | Bacteria | 1289 |
| 211 | Ga0068852_100463930 | 3300005616 | Bacteria | 1256 |
| 212 | Ga0068852_100655564 | 3300005616 | Bacteria | 1057 |
| 213 | Ga0068852_101059328 | 3300005616 | Bacteria | 830 |
| 214 | Ga0068852_101280805 | 3300005616 | Bacteria | 755 |
| 215 | Ga0068859_100000104 | 3300005617 | Bacteria | 78653 |
| 216 | Ga0068859_100000478 | 3300005617 | Bacteria | 39430 |
| 217 | Ga0068859_100022547 | 3300005617 | Bacteria | 6315 |
| 218 | Ga0068859_100119080 | 3300005617 | Unclassified | 2706 |
| 219 | Ga0068859_100362012 | 3300005617 | Bacteria | 1546 |
| 220 | Ga0068859_100409780 | 3300005617 | Bacteria | 1451 |
| 221 | Ga0068864_100000118 | 3300005618 | Bacteria | 77800 |
| 222 | Ga0068864_100000174 | 3300005618 | Bacteria | 59338 |
| 223 | Ga0068864_100017446 | 3300005618 | Bacteria | 5985 |
| 224 | Ga0068864_100136248 | 3300005618 | Bacteria | 2211 |
| 225 | Ga0068864_100756044 | 3300005618 | Bacteria | 953 |
| 226 | Ga0068864_101332917 | 3300005618 | Bacteria | 718 |
| 227 | Ga0068866_10754807 | 3300005718 | Bacteria | 672 |
| 228 | Ga0068866_10957279 | 3300005718 | Bacteria | 606 |
| 229 | Ga0068861_100001151 | 3300005719 | Bacteria | 16469 |
| 230 | Ga0068861_100010621 | 3300005719 | Bacteria | 6394 |
| 231 | Ga0068861_100481942 | 3300005719 | Bacteria | 1118 |
| 232 | Ga0068861_102360272 | 3300005719 | Unclassified | 534 |
| 233 | Ga0068851_10157421 | 3300005834 | Unclassified | 1246 |
| 234 | Ga0068851_10299332 | 3300005834 | Bacteria | 924 |
| 235 | Ga0068851_10300744 | 3300005834 | Bacteria | 922 |
| 236 | Ga0068851_10375744 | 3300005834 | Bacteria | 832 |
| 237 | Ga0068870_10184423 | 3300005840 | Bacteria | 1255 |
| 238 | Ga0068863_100000152 | 3300005841 | Bacteria | 72823 |
| 239 | Ga0068863_100004878 | 3300005841 | Bacteria | 13216 |
| 240 | Ga0068863_100076008 | 3300005841 | Bacteria | 3177 |
| 241 | Ga0068863_100208726 | 3300005841 | Bacteria | 1880 |
| 242 | Ga0068863_100285525 | 3300005841 | Bacteria | 1599 |
| 243 | Ga0068863_101763628 | 3300005841 | Bacteria | 629 |
| 244 | Ga0068858_100028224 | 3300005842 | Bacteria | 5214 |
| 245 | Ga0068858_100068281 | 3300005842 | Bacteria | 3294 |
| 246 | Ga0068858_100283369 | 3300005842 | Bacteria | 1578 |
| 247 | Ga0068860_100003157 | 3300005843 | Bacteria | 17012 |
| 248 | Ga0068860_100005690 | 3300005843 | Bacteria | 12583 |
| 249 | Ga0068860_100007725 | 3300005843 | Bacteria | 10751 |
| 250 | Ga0068860_100341159 | 3300005843 | Bacteria | 1473 |
| 251 | Ga0068860_100658460 | 3300005843 | Bacteria | 1055 |
| 252 | Ga0068862_100000421 | 3300005844 | Bacteria | 45988 |
| 253 | Ga0068862_100005596 | 3300005844 | Bacteria | 10498 |
| 254 | Ga0068862_100026268 | 3300005844 | Bacteria | 4894 |
| 255 | Ga0068862_100054895 | 3300005844 | Bacteria | 3412 |
| 256 | Ga0068862_100149447 | 3300005844 | Bacteria | 2078 |
| 257 | Ga0068862_100727452 | 3300005844 | Bacteria | 963 |
| 258 | Ga0081539_10040175 | 3300005985 | Bacteria | 2749 |
| 259 | Ga0097621_100013235 | 3300006237 | Bacteria | 6141 |
| 260 | Ga0097621_100088606 | 3300006237 | Bacteria | 2586 |
| 261 | Ga0068871_100135529 | 3300006358 | Bacteria | 2091 |
| 262 | Ga0068871_100180491 | 3300006358 | Bacteria | 1814 |
| 263 | Ga0068871_100468183 | 3300006358 | Bacteria | 1132 |
| 264 | Ga0068865_100000240 | 3300006881 | Bacteria | 30384 |
| 265 | Ga0097620_100000104 | 3300006931 | Bacteria | 78653 |
| 266 | Ga0097620_100000478 | 3300006931 | Bacteria | 39430 |
| 267 | Ga0097620_100022548 | 3300006931 | Bacteria | 6315 |
| 268 | Ga0097620_100119090 | 3300006931 | Unclassified | 2706 |
| 269 | Ga0097620_100361978 | 3300006931 | Bacteria | 1546 |
| 270 | Ga0097620_100409763 | 3300006931 | Bacteria | 1451 |
| 271 | Ga0105251_10405572 | 3300009011 | Bacteria | 627 |
| 272 | Ga0105250_10017923 | 3300009092 | Bacteria | 2873 |
| 273 | Ga0105240_10073297 | 3300009093 | Bacteria | 4228 |
| 274 | Ga0105240_10745376 | 3300009093 | Bacteria | 1065 |
| 275 | Ga0105245_10000300 | 3300009098 | Bacteria | 47446 |
| 276 | Ga0105247_10006055 | 3300009101 | Bacteria | 7524 |
| 277 | Ga0105247_10170804 | 3300009101 | Bacteria | 1445 |
| 278 | Ga0114129_11975131 | 3300009147 | Bacteria | 706 |
| 279 | Ga0105241_10022584 | 3300009174 | Bacteria | 4661 |
| 280 | Ga0105242_11884389 | 3300009176 | Bacteria | 638 |
| 281 | Ga0105248_10000295 | 3300009177 | Bacteria | 59247 |
| 282 | Ga0105248_10002741 | 3300009177 | Bacteria | 19562 |
| 283 | Ga0105248_10006633 | 3300009177 | Bacteria | 12692 |
| 284 | Ga0105248_10014716 | 3300009177 | Bacteria | 8612 |
| 285 | Ga0105248_10017802 | 3300009177 | Bacteria | 7840 |
| 286 | Ga0105248_10390186 | 3300009177 | Bacteria | 1568 |
| 287 | Ga0105248_10559403 | 3300009177 | Bacteria | 1290 |
| 288 | Ga0105248_11151389 | 3300009177 | Bacteria | 877 |
| 289 | Ga0105237_10950039 | 3300009545 | Bacteria | 866 |
| 290 | Ga0105238_10049432 | 3300009551 | Bacteria | 4235 |
| 291 | Ga0105238_10507330 | 3300009551 | Bacteria | 1208 |
| 292 | Ga0105238_10981814 | 3300009551 | Bacteria | 865 |
| 293 | Ga0105249_11261345 | 3300009553 | Bacteria | 810 |
| 294 | Ga0105249_13262366 | 3300009553 | Bacteria | 522 |
| 295 | Ga0105239_10044676 | 3300010375 | Bacteria | 4856 |
| 296 | Ga0105239_11858988 | 3300010375 | Bacteria | 698 |
| 297 | Ga0105246_10021355 | 3300011119 | Bacteria | 4166 |
| 298 | Ga0105246_10647241 | 3300011119 | Bacteria | 920 |
| 299 | Ga0157373_10006164 | 3300013100 | Bacteria | 8961 |
| 300 | Ga0157373_10085912 | 3300013100 | Bacteria | 2217 |
| 301 | Ga0157373_10278215 | 3300013100 | Unclassified | 1186 |
| 302 | Ga0157373_10463670 | 3300013100 | Bacteria | 913 |
| 303 | Ga0157371_10000677 | 3300013102 | Bacteria | 40414 |
| 304 | Ga0157371_10424834 | 3300013102 | Bacteria | 975 |
| 305 | Ga0157371_10441020 | 3300013102 | Bacteria | 956 |
| 306 | Ga0157371_10754115 | 3300013102 | Bacteria | 731 |
| 307 | Ga0157370_10115511 | 3300013104 | Unclassified | 2507 |
| 308 | Ga0157370_10244964 | 3300013104 | Bacteria | 1658 |
| 309 | Ga0157370_10748181 | 3300013104 | Bacteria | 891 |
| 310 | Ga0157370_10855001 | 3300013104 | Bacteria | 826 |
| 311 | Ga0157369_10391583 | 3300013105 | Bacteria | 1442 |
| 312 | Ga0157374_11086772 | 3300013296 | Bacteria | 820 |
| 313 | Ga0157378_10002011 | 3300013297 | Bacteria | 18196 |
| 314 | Ga0157378_11188894 | 3300013297 | Bacteria | 802 |
| 315 | Ga0163162_10045123 | 3300013306 | Bacteria | 4415 |
| 316 | Ga0163162_10202482 | 3300013306 | Bacteria | 2114 |
| 317 | Ga0157372_10045485 | 3300013307 | Bacteria | 4870 |
| 318 | Ga0157372_10088817 | 3300013307 | Bacteria | 3510 |
| 319 | Ga0157372_10754899 | 3300013307 | Unclassified | 1131 |
| 320 | Ga0157372_11547760 | 3300013307 | Bacteria | 764 |
| 321 | Ga0157375_10124625 | 3300013308 | Bacteria | 2690 |
| 322 | Ga0157375_10499140 | 3300013308 | Bacteria | 1381 |
| 323 | Ga0157375_11854929 | 3300013308 | Bacteria | 715 |
| 324 | Ga0163163_10000882 | 3300014325 | Bacteria | 25516 |
| 325 | Ga0163163_10400460 | 3300014325 | Bacteria | 1431 |
| 326 | Ga0157380_10853842 | 3300014326 | Bacteria | 932 |
| 327 | Ga0157377_10033043 | 3300014745 | Bacteria | 2821 |
| 328 | Ga0157379_10009073 | 3300014968 | Bacteria | 8666 |
| 329 | Ga0157379_10054102 | 3300014968 | Bacteria | 3587 |
| 330 | Ga0163161_11058312 | 3300017792 | Bacteria | 695 |
| 331 | Ga0213876_10010656 | 3300021384 | Bacteria | 4925 |
| 332 | Ga0207673_1001669 | 3300025290 | Bacteria | 2454 |
| 333 | Ga0207697_10000026 | 3300025315 | Bacteria | 52498 |
| 334 | Ga0207697_10186033 | 3300025315 | Bacteria | 911 |
| 335 | Ga0207697_10373337 | 3300025315 | Bacteria | 633 |
| 336 | Ga0207656_10072117 | 3300025321 | Bacteria | 1537 |
| 337 | Ga0207656_10494086 | 3300025321 | Bacteria | 621 |
| 338 | Ga0207696_1048263 | 3300025711 | Bacteria | 1224 |
| 339 | Ga0207713_1166571 | 3300025735 | Unclassified | 698 |
| 340 | Ga0207713_1196393 | 3300025735 | Bacteria | 621 |
| 341 | Ga0207682_10009951 | 3300025893 | Bacteria | 3735 |
| 342 | Ga0207682_10100070 | 3300025893 | Bacteria | 1266 |
| 343 | Ga0207642_10147168 | 3300025899 | Bacteria | 1249 |
| 344 | Ga0207710_10018640 | 3300025900 | Bacteria | 2954 |
| 345 | Ga0207710_10079543 | 3300025900 | Bacteria | 1518 |
| 346 | Ga0207688_10000055 | 3300025901 | Bacteria | 41067 |
| 347 | Ga0207688_10011889 | 3300025901 | Bacteria | 4736 |
| 348 | Ga0207680_10036791 | 3300025903 | Bacteria | 2821 |
| 349 | Ga0207680_10680949 | 3300025903 | Bacteria | 737 |
| 350 | Ga0207647_10006361 | 3300025904 | Bacteria | 8588 |
| 351 | Ga0207647_10222636 | 3300025904 | Bacteria | 1087 |
| 352 | Ga0207645_10001667 | 3300025907 | Bacteria | 18069 |
| 353 | Ga0207645_10006444 | 3300025907 | Bacteria | 8421 |
| 354 | Ga0207645_10086464 | 3300025907 | Bacteria | 2014 |
| 355 | Ga0207645_10115763 | 3300025907 | Bacteria | 1738 |
| 356 | Ga0207643_10166873 | 3300025908 | Bacteria | 1327 |
| 357 | Ga0207705_10021828 | 3300025909 | Bacteria | 4567 |
| 358 | Ga0207705_10105183 | 3300025909 | Bacteria | 2080 |
| 359 | Ga0207705_10382308 | 3300025909 | Bacteria | 1087 |
| 360 | Ga0207705_10388709 | 3300025909 | Bacteria | 1078 |
| 361 | Ga0207705_10645806 | 3300025909 | Bacteria | 823 |
| 362 | Ga0207705_10684759 | 3300025909 | Bacteria | 797 |
| 363 | Ga0207705_10737343 | 3300025909 | Bacteria | 765 |
| 364 | Ga0207705_11138284 | 3300025909 | Bacteria | 600 |
| 365 | Ga0207654_10477819 | 3300025911 | Bacteria | 877 |
| 366 | Ga0207707_10016712 | 3300025912 | Bacteria | 6395 |
| 367 | Ga0207707_10713216 | 3300025912 | Bacteria | 841 |
| 368 | Ga0207695_10009319 | 3300025913 | Bacteria | 12153 |
| 369 | Ga0207695_10942521 | 3300025913 | Unclassified | 743 |
| 370 | Ga0207660_10007761 | 3300025917 | Bacteria | 6947 |
| 371 | Ga0207660_10883860 | 3300025917 | Bacteria | 729 |
| 372 | Ga0207660_11260820 | 3300025917 | Bacteria | 601 |
| 373 | Ga0207662_10242073 | 3300025918 | Bacteria | 1181 |
| 374 | Ga0207657_10001574 | 3300025919 | Bacteria | 24502 |
| 375 | Ga0207657_10003629 | 3300025919 | Bacteria | 16433 |
| 376 | Ga0207657_10077813 | 3300025919 | Bacteria | 2795 |
| 377 | Ga0207657_10078938 | 3300025919 | Bacteria | 2770 |
| 378 | Ga0207657_10088943 | 3300025919 | Bacteria | 2581 |
| 379 | Ga0207657_10284189 | 3300025919 | Bacteria | 1313 |
| 380 | Ga0207657_10393461 | 3300025919 | Bacteria | 1090 |
| 381 | Ga0207657_10496323 | 3300025919 | Bacteria | 956 |
| 382 | Ga0207657_10685154 | 3300025919 | Bacteria | 797 |
| 383 | Ga0207657_10852268 | 3300025919 | Unclassified | 703 |
| 384 | Ga0207657_10867747 | 3300025919 | Bacteria | 696 |
| 385 | Ga0207649_10031780 | 3300025920 | Bacteria | 3141 |
| 386 | Ga0207649_10063331 | 3300025920 | Bacteria | 2334 |
| 387 | Ga0207649_10116587 | 3300025920 | Unclassified | 1794 |
| 388 | Ga0207649_10117121 | 3300025920 | Bacteria | 1790 |
| 389 | Ga0207649_10200440 | 3300025920 | Bacteria | 1409 |
| 390 | Ga0207649_10533279 | 3300025920 | Bacteria | 896 |
| 391 | Ga0207649_10672194 | 3300025920 | Bacteria | 802 |
| 392 | Ga0207649_10986334 | 3300025920 | Bacteria | 663 |
| 393 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 394 | Ga0207681_10000020 | 3300025923 | Bacteria | 240498 |
| 395 | Ga0207681_10001514 | 3300025923 | Bacteria | 14993 |
| 396 | Ga0207681_10005327 | 3300025923 | Bacteria | 7903 |
| 397 | Ga0207681_10121455 | 3300025923 | Bacteria | 1916 |
| 398 | Ga0207681_10419369 | 3300025923 | Bacteria | 1084 |
| 399 | Ga0207694_10225304 | 3300025924 | Bacteria | 1530 |
| 400 | Ga0207694_10761855 | 3300025924 | Unclassified | 817 |
| 401 | Ga0207650_10044004 | 3300025925 | Bacteria | 3280 |
| 402 | Ga0207650_10066692 | 3300025925 | Bacteria | 2699 |
| 403 | Ga0207650_10143822 | 3300025925 | Bacteria | 1877 |
| 404 | Ga0207650_11297963 | 3300025925 | Unclassified | 620 |
| 405 | Ga0207659_10028105 | 3300025926 | Bacteria | 3818 |
| 406 | Ga0207659_10287965 | 3300025926 | Bacteria | 1345 |
| 407 | Ga0207687_10003666 | 3300025927 | Bacteria | 10346 |
| 408 | Ga0207644_10000052 | 3300025931 | Bacteria | 91473 |
| 409 | Ga0207644_10059162 | 3300025931 | Bacteria | 2771 |
| 410 | Ga0207644_10063446 | 3300025931 | Bacteria | 2682 |
| 411 | Ga0207644_10114557 | 3300025931 | Bacteria | 2043 |
| 412 | Ga0207644_10185747 | 3300025931 | Bacteria | 1632 |
| 413 | Ga0207644_10481092 | 3300025931 | Bacteria | 1023 |
| 414 | Ga0207690_10007026 | 3300025932 | Bacteria | 6676 |
| 415 | Ga0207690_10066792 | 3300025932 | Bacteria | 2464 |
| 416 | Ga0207690_10070989 | 3300025932 | Unclassified | 2401 |
| 417 | Ga0207690_11290549 | 3300025932 | Bacteria | 610 |
| 418 | Ga0207706_10000278 | 3300025933 | Bacteria | 55758 |
| 419 | Ga0207706_10014921 | 3300025933 | Bacteria | 7036 |
| 420 | Ga0207706_10015386 | 3300025933 | Bacteria | 6911 |
| 421 | Ga0207706_10045118 | 3300025933 | Bacteria | 3906 |
| 422 | Ga0207706_10135438 | 3300025933 | Bacteria | 2167 |
| 423 | Ga0207706_10524191 | 3300025933 | Bacteria | 1021 |
| 424 | Ga0207706_10608876 | 3300025933 | Bacteria | 938 |
| 425 | Ga0207706_10628496 | 3300025933 | Bacteria | 921 |
| 426 | Ga0207706_10832642 | 3300025933 | Unclassified | 782 |
| 427 | Ga0207706_10999102 | 3300025933 | Bacteria | 703 |
| 428 | Ga0207709_10220259 | 3300025935 | Bacteria | 1368 |
| 429 | Ga0207670_10049248 | 3300025936 | Bacteria | 2817 |
| 430 | Ga0207670_10096032 | 3300025936 | Bacteria | 2107 |
| 431 | Ga0207669_10013438 | 3300025937 | Bacteria | 4066 |
| 432 | Ga0207669_10028194 | 3300025937 | Bacteria | 3086 |
| 433 | Ga0207669_10037936 | 3300025937 | Bacteria | 2770 |
| 434 | Ga0207669_10178597 | 3300025937 | Bacteria | 1519 |
| 435 | Ga0207704_10005707 | 3300025938 | Bacteria | 5753 |
| 436 | Ga0207691_10000045 | 3300025940 | Bacteria | 99798 |
| 437 | Ga0207691_10023749 | 3300025940 | Bacteria | 5771 |
| 438 | Ga0207691_10029849 | 3300025940 | Bacteria | 5099 |
| 439 | Ga0207691_10141127 | 3300025940 | Bacteria | 2123 |
| 440 | Ga0207711_10000153 | 3300025941 | Bacteria | 73814 |
| 441 | Ga0207711_10003154 | 3300025941 | Bacteria | 14370 |
| 442 | Ga0207711_10004637 | 3300025941 | Bacteria | 11679 |
| 443 | Ga0207711_10007319 | 3300025941 | Bacteria | 9240 |
| 444 | Ga0207711_10047780 | 3300025941 | Bacteria | 3661 |
| 445 | Ga0207689_10000182 | 3300025942 | Bacteria | 54476 |
| 446 | Ga0207689_10065887 | 3300025942 | Bacteria | 2979 |
| 447 | Ga0207689_10647788 | 3300025942 | Bacteria | 890 |
| 448 | Ga0207661_10467236 | 3300025944 | Bacteria | 1151 |
| 449 | Ga0207679_10007082 | 3300025945 | Bacteria | 7108 |
| 450 | Ga0207679_10008820 | 3300025945 | Bacteria | 6428 |
| 451 | Ga0207679_10067699 | 3300025945 | Bacteria | 2680 |
| 452 | Ga0207679_11762215 | 3300025945 | Unclassified | 566 |
| 453 | Ga0207667_10000603 | 3300025949 | Bacteria | 46518 |
| 454 | Ga0207667_10007486 | 3300025949 | Bacteria | 13111 |
| 455 | Ga0207667_10010624 | 3300025949 | Bacteria | 10748 |
| 456 | Ga0207667_10446882 | 3300025949 | Unclassified | 1314 |
| 457 | Ga0207667_11242090 | 3300025949 | Bacteria | 723 |
| 458 | Ga0207651_10004393 | 3300025960 | Bacteria | 7096 |
| 459 | Ga0207651_10014814 | 3300025960 | Bacteria | 4513 |
| 460 | Ga0207651_10024827 | 3300025960 | Bacteria | 3715 |
| 461 | Ga0207651_10451071 | 3300025960 | Bacteria | 1103 |
| 462 | Ga0207651_11023146 | 3300025960 | Bacteria | 739 |
| 463 | Ga0207651_11151170 | 3300025960 | Bacteria | 696 |
| 464 | Ga0207712_10269352 | 3300025961 | Bacteria | 1385 |
| 465 | Ga0207712_11890913 | 3300025961 | Bacteria | 534 |
| 466 | Ga0207668_10000050 | 3300025972 | Bacteria | 98767 |
| 467 | Ga0207668_10006477 | 3300025972 | Bacteria | 6924 |
| 468 | Ga0207668_10230583 | 3300025972 | Bacteria | 1493 |
| 469 | Ga0207640_10000849 | 3300025981 | Bacteria | 17357 |
| 470 | Ga0207640_10048450 | 3300025981 | Bacteria | 2747 |
| 471 | Ga0207640_10124633 | 3300025981 | Bacteria | 1852 |
| 472 | Ga0207640_10280024 | 3300025981 | Bacteria | 1309 |
| 473 | Ga0207640_10597310 | 3300025981 | Bacteria | 934 |
| 474 | Ga0207640_11996386 | 3300025981 | Bacteria | 525 |
| 475 | Ga0207658_10000453 | 3300025986 | Bacteria | 38410 |
| 476 | Ga0207658_10002786 | 3300025986 | Bacteria | 12583 |
| 477 | Ga0207658_10013766 | 3300025986 | Bacteria | 5534 |
| 478 | Ga0207658_10018210 | 3300025986 | Bacteria | 4846 |
| 479 | Ga0207658_10112529 | 3300025986 | Bacteria | 2154 |
| 480 | Ga0207658_10255372 | 3300025986 | Bacteria | 1491 |
| 481 | Ga0207658_10393221 | 3300025986 | Bacteria | 1217 |
| 482 | Ga0207658_10436661 | 3300025986 | Bacteria | 1157 |
| 483 | Ga0207658_11361972 | 3300025986 | Bacteria | 649 |
| 484 | Ga0207677_10003889 | 3300026023 | Bacteria | 7950 |
| 485 | Ga0207677_10505333 | 3300026023 | Bacteria | 1046 |
| 486 | Ga0207677_11066296 | 3300026023 | Bacteria | 735 |
| 487 | Ga0207703_10202580 | 3300026035 | Bacteria | 1764 |
| 488 | Ga0207703_10518864 | 3300026035 | Bacteria | 1120 |
| 489 | Ga0207703_10536251 | 3300026035 | Bacteria | 1102 |
| 490 | Ga0207639_10028229 | 3300026041 | Bacteria | 4095 |
| 491 | Ga0207639_10092070 | 3300026041 | Bacteria | 2429 |
| 492 | Ga0207639_10205450 | 3300026041 | Bacteria | 1692 |
| 493 | Ga0207639_10245146 | 3300026041 | Bacteria | 1560 |
| 494 | Ga0207639_10249195 | 3300026041 | Unclassified | 1548 |
| 495 | Ga0207639_10363808 | 3300026041 | Bacteria | 1295 |
| 496 | Ga0207639_10961805 | 3300026041 | Unclassified | 799 |
| 497 | Ga0207639_11759584 | 3300026041 | Unclassified | 580 |
| 498 | Ga0207678_10027360 | 3300026067 | Bacteria | 4974 |
| 499 | Ga0207678_10055329 | 3300026067 | Bacteria | 3418 |
| 500 | Ga0207678_10156283 | 3300026067 | Bacteria | 1947 |
| 501 | Ga0207678_10278998 | 3300026067 | Bacteria | 1434 |
| 502 | Ga0207678_10320777 | 3300026067 | Bacteria | 1333 |
| 503 | Ga0207678_10332886 | 3300026067 | Bacteria | 1307 |
| 504 | Ga0207678_10401866 | 3300026067 | Bacteria | 1186 |
| 505 | Ga0207678_10759924 | 3300026067 | Bacteria | 855 |
| 506 | Ga0207678_11804206 | 3300026067 | Bacteria | 535 |
| 507 | Ga0207702_10072998 | 3300026078 | Unclassified | 2958 |
| 508 | Ga0207702_10894069 | 3300026078 | Bacteria | 880 |
| 509 | Ga0207702_11033197 | 3300026078 | Bacteria | 815 |
| 510 | Ga0207641_10000205 | 3300026088 | Bacteria | 78692 |
| 511 | Ga0207641_10004210 | 3300026088 | Bacteria | 12546 |
| 512 | Ga0207641_10020495 | 3300026088 | Bacteria | 5430 |
| 513 | Ga0207641_10039788 | 3300026088 | Bacteria | 3933 |
| 514 | Ga0207641_10318857 | 3300026088 | Bacteria | 1473 |
| 515 | Ga0207648_10000222 | 3300026089 | Bacteria | 61156 |
| 516 | Ga0207648_10000477 | 3300026089 | Bacteria | 44735 |
| 517 | Ga0207648_10406247 | 3300026089 | Bacteria | 1235 |
| 518 | Ga0207648_10699294 | 3300026089 | Bacteria | 939 |
| 519 | Ga0207676_10000702 | 3300026095 | Bacteria | 26358 |
| 520 | Ga0207676_10000878 | 3300026095 | Bacteria | 23329 |
| 521 | Ga0207676_10004741 | 3300026095 | Bacteria | 9642 |
| 522 | Ga0207676_10030670 | 3300026095 | Bacteria | 4038 |
| 523 | Ga0207676_10041510 | 3300026095 | Bacteria | 3532 |
| 524 | Ga0207676_10719904 | 3300026095 | Bacteria | 968 |
| 525 | Ga0207674_10006997 | 3300026116 | Bacteria | 13192 |
| 526 | Ga0207674_10007144 | 3300026116 | Bacteria | 13044 |
| 527 | Ga0207674_10045072 | 3300026116 | Bacteria | 4539 |
| 528 | Ga0207675_100017759 | 3300026118 | Bacteria | 6636 |
| 529 | Ga0207675_100634490 | 3300026118 | Bacteria | 1073 |
| 530 | Ga0207675_101092001 | 3300026118 | Bacteria | 818 |
| 531 | Ga0207675_101435600 | 3300026118 | Bacteria | 711 |
| 532 | Ga0207683_10518164 | 3300026121 | Bacteria | 1102 |
| 533 | Ga0207683_10649869 | 3300026121 | Bacteria | 977 |
| 534 | Ga0207698_10019294 | 3300026142 | Bacteria | 4665 |
| 535 | Ga0207698_10078028 | 3300026142 | Bacteria | 2657 |
| 536 | Ga0207698_10093920 | 3300026142 | Bacteria | 2464 |
| 537 | Ga0207698_10141609 | 3300026142 | Unclassified | 2073 |
| 538 | Ga0207698_10416833 | 3300026142 | Bacteria | 1288 |
| 539 | Ga0207698_10575268 | 3300026142 | Bacteria | 1107 |
| 540 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 541 | Ga0268266_10001084 | 3300028379 | Bacteria | 34117 |
| 542 | Ga0268266_10898387 | 3300028379 | Unclassified | 856 |
| 543 | Ga0268266_11175193 | 3300028379 | Bacteria | 742 |
| 544 | Ga0268265_10000149 | 3300028380 | Bacteria | 86376 |
| 545 | Ga0268265_10002738 | 3300028380 | Bacteria | 13007 |
| 546 | Ga0268265_10012277 | 3300028380 | Bacteria | 5806 |
| 547 | Ga0268265_10021229 | 3300028380 | Bacteria | 4545 |
| 548 | Ga0268265_10094838 | 3300028380 | Bacteria | 2394 |
| 549 | Ga0268265_10573781 | 3300028380 | Bacteria | 1074 |
| 550 | Ga0268264_10004932 | 3300028381 | Bacteria | 11301 |
| 551 | Ga0268264_10012724 | 3300028381 | Bacteria | 6924 |
| 552 | Ga0268264_10054777 | 3300028381 | Bacteria | 3331 |
| 553 | Ga0268264_10136528 | 3300028381 | Bacteria | 2181 |
| 554 | Ga0268264_10345616 | 3300028381 | Bacteria | 1414 |
| 555 | Ga0268264_10408759 | 3300028381 | Bacteria | 1306 |
| 556 | Ga0307513_10136335 | 3300031456 | Bacteria | 2390 |
| 557 | Ga0307408_100007319 | 3300031548 | Bacteria | 7302 |
| 558 | Ga0307408_100090381 | 3300031548 | Bacteria | 2310 |
| 559 | Ga0307408_100122842 | 3300031548 | Bacteria | 2014 |
| 560 | Ga0307408_101116847 | 3300031548 | Bacteria | 732 |
| 561 | Ga0307405_10540024 | 3300031731 | Unclassified | 941 |
| 562 | Ga0307413_10011502 | 3300031824 | Bacteria | 4358 |
| 563 | Ga0307413_10021142 | 3300031824 | Bacteria | 3476 |
| 564 | Ga0307413_10054220 | 3300031824 | Bacteria | 2431 |
| 565 | Ga0307413_10624651 | 3300031824 | Bacteria | 885 |
| 566 | Ga0307413_11728035 | 3300031824 | Bacteria | 558 |
| 567 | Ga0307410_10000294 | 3300031852 | Bacteria | 19366 |
| 568 | Ga0307410_10031350 | 3300031852 | Bacteria | 3410 |
| 569 | Ga0307410_10127667 | 3300031852 | Bacteria | 1864 |
| 570 | Ga0307410_10336432 | 3300031852 | Bacteria | 1202 |
| 571 | Ga0307410_10539211 | 3300031852 | Bacteria | 965 |
| 572 | Ga0307410_10736831 | 3300031852 | Bacteria | 833 |
| 573 | Ga0307410_11713883 | 3300031852 | Unclassified | 557 |
| 574 | Ga0307406_10026936 | 3300031901 | Bacteria | 3458 |
| 575 | Ga0307406_11346552 | 3300031901 | Unclassified | 624 |
| 576 | Ga0307407_10153128 | 3300031903 | Bacteria | 1500 |
| 577 | Ga0307407_11052616 | 3300031903 | Bacteria | 631 |
| 578 | Ga0307412_10104276 | 3300031911 | Bacteria | 2012 |
| 579 | Ga0307409_100004079 | 3300031995 | Bacteria | 8121 |
| 580 | Ga0307409_100023780 | 3300031995 | Bacteria | 4255 |
| 581 | Ga0307409_100034240 | 3300031995 | Bacteria | 3706 |
| 582 | Ga0307409_100124178 | 3300031995 | Bacteria | 2192 |
| 583 | Ga0307409_100185104 | 3300031995 | Bacteria | 1848 |
| 584 | Ga0307409_102592124 | 3300031995 | Bacteria | 535 |
| 585 | Ga0307416_100008181 | 3300032002 | Bacteria | 6723 |
| 586 | Ga0307416_100015063 | 3300032002 | Bacteria | 5325 |
| 587 | Ga0307416_100776354 | 3300032002 | Bacteria | 1052 |
| 588 | Ga0307414_10001887 | 3300032004 | Bacteria | 10822 |
| 589 | Ga0307414_10002479 | 3300032004 | Bacteria | 9673 |
| 590 | Ga0307414_10037950 | 3300032004 | Bacteria | 3230 |
| 591 | Ga0307414_10126072 | 3300032004 | Bacteria | 1978 |
| 592 | Ga0307414_11231579 | 3300032004 | Bacteria | 693 |
| 593 | Ga0307411_10003224 | 3300032005 | Bacteria | 7512 |
| 594 | Ga0307411_10010236 | 3300032005 | Bacteria | 4986 |
| 595 | Ga0307411_10031850 | 3300032005 | Bacteria | 3250 |
| 596 | Ga0307411_10519482 | 3300032005 | Bacteria | 1010 |
| 597 | Ga0307411_10618040 | 3300032005 | Bacteria | 934 |
| 598 | Ga0307411_11808158 | 3300032005 | Bacteria | 567 |
| 599 | Ga0307415_100001215 | 3300032126 | Bacteria | 12074 |
| 600 | Ga0307415_100064778 | 3300032126 | Bacteria | 2544 |
| 601 | Ga0307415_100862530 | 3300032126 | Unclassified | 832 |
| 602 | Ga0373931_0435445 | 3300035691 | Bacteria | 836 |
| 603 | Ga0395899_0047184 | 3300037312 | Bacteria | 3208 |
| 604 | Ga0395899_0074345 | 3300037312 | Bacteria | 2483 |
| 605 | Ga0395899_0098646 | 3300037312 | Bacteria | 2111 |
| 606 | Ga0395899_0128456 | 3300037312 | Bacteria | 1811 |
| 607 | Ga0395899_0166143 | 3300037312 | Bacteria | 1556 |
| 608 | Ga0395900_0052135 | 3300037418 | Bacteria | 4212 |
| 609 | Ga0395900_0079130 | 3300037418 | Bacteria | 3377 |
| 610 | Ga0395900_0099438 | 3300037418 | Bacteria | 2988 |
| 611 | Ga0395900_0245655 | 3300037418 | Bacteria | 1793 |
| 612 | Ga0395900_0314478 | 3300037418 | Bacteria | 1548 |
| 613 | Ga0395900_0417574 | 3300037418 | Bacteria | 1303 |
| 614 | Ga0395900_0572578 | 3300037418 | Bacteria | 1072 |
| 615 | Ga0395900_0602294 | 3300037418 | Bacteria | 1039 |
| 616 | Ga0395900_0622435 | 3300037418 | Bacteria | 1018 |
| 617 | Ga0395900_0654002 | 3300037418 | Unclassified | 987 |
| 618 | Ga0395900_1444797 | 3300037418 | Bacteria | 600 |
| 619 | Ga0395898_0124483 | 3300037466 | Bacteria | 2470 |
| 620 | Ga0395898_0236923 | 3300037466 | Bacteria | 1740 |
| 621 | Ga0395898_0247117 | 3300037466 | Bacteria | 1701 |
| 622 | Ga0395898_1384655 | 3300037466 | Unclassified | 631 |
| 623 | Ga0395905_0007984 | 3300037471 | Bacteria | 10459 |
| 624 | Ga0395905_0012758 | 3300037471 | Bacteria | 8083 |
| 625 | Ga0395905_0041636 | 3300037471 | Bacteria | 4310 |
| 626 | Ga0395905_0042251 | 3300037471 | Bacteria | 4278 |
| 627 | Ga0395905_0085792 | 3300037471 | Bacteria | 2950 |
| 628 | Ga0395905_0091148 | 3300037471 | Bacteria | 2858 |
| 629 | Ga0395905_0100758 | 3300037471 | Bacteria | 2712 |
| 630 | Ga0395905_0158392 | 3300037471 | Bacteria | 2129 |
| 631 | Ga0395905_0199182 | 3300037471 | Bacteria | 1878 |
| 632 | Ga0395905_0315488 | 3300037471 | Bacteria | 1452 |
| 633 | Ga0395905_0345006 | 3300037471 | Bacteria | 1380 |
| 634 | Ga0395905_0617162 | 3300037471 | Bacteria | 986 |
| 635 | Ga0395905_0894553 | 3300037471 | Bacteria | 791 |
| 636 | Ga0395905_1684179 | 3300037471 | Bacteria | 539 |
| 637 | Ga0395901_0045185 | 3300038443 | Bacteria | 4569 |
| 638 | Ga0395901_0052588 | 3300038443 | Bacteria | 4233 |
| 639 | Ga0395901_0055707 | 3300038443 | Bacteria | 4112 |
| 640 | Ga0395901_0110501 | 3300038443 | Bacteria | 2886 |
| 641 | Ga0395901_0317203 | 3300038443 | Bacteria | 1613 |
| 642 | Ga0395901_1742331 | 3300038443 | Unclassified | 573 |
| 643 | Ga0395901_2009600 | 3300038443 | Bacteria | 524 |
| 644 | Ga0436365_0616364 | 3300039437 | Bacteria | 2274 |
| 645 | Ga0466969_0010103 | 3300044656 | Bacteria | 5008 |
| 646 | Ga0466972_0122315 | 3300044658 | Unclassified | 1227 |
| 647 | Ga0466963_0023577 | 3300044694 | Bacteria | 3910 |
| 648 | Ga0466963_0518154 | 3300044694 | Unclassified | 842 |
| 649 | Ga0466963_0964393 | 3300044694 | Unclassified | 601 |
| 650 | Ga0466970_0276733 | 3300044765 | Bacteria | 943 |
| 651 | Ga0466957_0713726 | 3300044842 | Bacteria | 708 |
| 652 | Ga0466959_0284970 | 3300045049 | Bacteria | 1133 |
| 653 | Ga0451576_2664736 | 3300045051 | Unclassified | 509 |
| 654 | Ga0466958_0044797 | 3300045836 | Bacteria | 2667 |
| 655 | Ga0466967_0121344 | 3300045976 | Bacteria | 2415 |
| 656 | Ga0466967_0360583 | 3300045976 | Bacteria | 1408 |
| 657 | Ga0466967_1294656 | 3300045976 | Bacteria | 726 |
| 658 | Ga0466967_2050601 | 3300045976 | Bacteria | 568 |
| 659 | Ga0495617_083767 | 3300046452 | Bacteria | 1044 |
| 660 | Ga0495629_0255686 | 3300046459 | Bacteria | 1205 |
| 661 | Ga0495638_0060556 | 3300046460 | Bacteria | 2341 |
| 662 | Ga0495638_0080447 | 3300046460 | Bacteria | 1980 |
| 663 | Ga0495605_0247781 | 3300046474 | Bacteria | 763 |
| 664 | Ga0495622_0016233 | 3300046557 | Bacteria | 3467 |
| 665 | Ga0495668_0038263 | 3300046616 | Bacteria | 2681 |
| 666 | Ga0495668_0042044 | 3300046616 | Bacteria | 2544 |
| 667 | Ga0495668_0151708 | 3300046616 | Unclassified | 1269 |
| 668 | Ga0495611_0141707 | 3300046648 | Bacteria | 1122 |
| 669 | Ga0495625_0013331 | 3300046660 | Bacteria | 6609 |
| 670 | Ga0495625_0116964 | 3300046660 | Bacteria | 1818 |
| 671 | Ga0495625_0241179 | 3300046660 | Bacteria | 1177 |
| 672 | Ga0495625_0445590 | 3300046660 | Bacteria | 801 |
| 673 | Ga0495588_0257948 | 3300046674 | Bacteria | 919 |
| 674 | Ga0495669_0059532 | 3300046684 | Bacteria | 1725 |
| 675 | Ga0495669_0358940 | 3300046684 | Bacteria | 704 |
| 676 | Ga0495677_0096589 | 3300047445 | Bacteria | 1116 |
| 677 | Ga0496100_0115291 | 3300048903 | Bacteria | 1873 |
| 678 | Ga0496101_0265240 | 3300048904 | Bacteria | 1340 |
| 679 | Ga0496101_0299489 | 3300048904 | Bacteria | 1259 |
| 680 | Ga0496101_0601246 | 3300048904 | Bacteria | 869 |
| 681 | Ga0496102_0883830 | 3300048905 | Bacteria | 815 |
| 682 | Ga0496103_0702866 | 3300048906 | Bacteria | 641 |
| 683 | Ga0496106_0325797 | 3300048909 | Bacteria | 1233 |
| 684 | Ga0496107_0074078 | 3300048910 | Bacteria | 2477 |
| 685 | Ga0496107_0133434 | 3300048910 | Bacteria | 1834 |
| 686 | Ga0496107_0219518 | 3300048910 | Bacteria | 1414 |
| 687 | Ga0496107_0319613 | 3300048910 | Bacteria | 1155 |
| 688 | Ga0496107_0671866 | 3300048910 | Unclassified | 763 |
| 689 | Ga0496108_0147581 | 3300048911 | Bacteria | 2028 |
| 690 | Ga0496109_0384718 | 3300048912 | Bacteria | 1325 |
| 691 | Ga0496109_1042603 | 3300048912 | Bacteria | 755 |
| 692 | Ga0496111_0347342 | 3300048914 | Unclassified | 1098 |
| 693 | Ga0496112_0021492 | 3300048915 | Bacteria | 6138 |
| 694 | Ga0496112_0231321 | 3300048915 | Bacteria | 1803 |
| 695 | Ga0496112_0695931 | 3300048915 | Unclassified | 944 |
| 696 | Ga0496113_0031718 | 3300048916 | Bacteria | 3837 |
| 697 | Ga0496114_0012689 | 3300048917 | Bacteria | 6749 |
| 698 | Ga0496114_0761960 | 3300048917 | Bacteria | 845 |
| 699 | Ga0496115_0009567 | 3300048918 | Bacteria | 7201 |
| 700 | Ga0496115_0304248 | 3300048918 | Bacteria | 1306 |
| 701 | Ga0496124_0891598 | 3300048927 | Bacteria | 541 |
| 702 | Ga0501034_0625661 | 3300049571 | Bacteria | 980 |
| 703 | Ga0501037_0048103 | 3300049573 | Archaea | 3126 |
| 704 | Ga0501038_0016555 | 3300049574 | Bacteria | 6684 |
| 705 | Ga0501039_0609705 | 3300049575 | Bacteria | 855 |
| 706 | Ga0501043_0031737 | 3300049579 | Bacteria | 4153 |
| 707 | Ga0501046_0163598 | 3300049580 | Bacteria | 1672 |
| 708 | Ga0501047_0030675 | 3300049581 | Bacteria | 5182 |
| 709 | Ga0501067_0047296 | 3300049583 | Bacteria | 2386 |
| 710 | Ga0501068_0251906 | 3300049584 | Bacteria | 1125 |
| 711 | Ga0501073_0013519 | 3300049589 | Bacteria | 5935 |
| 712 | Ga0501073_0393653 | 3300049589 | Bacteria | 957 |
| 713 | Ga0501074_0106547 | 3300049590 | Bacteria | 2006 |
| 714 | Ga0501075_1232063 | 3300049591 | Bacteria | 567 |
| 715 | Ga0501242_051722 | 3300049674 | Bacteria | 605 |
| 716 | Ga0501253_165979 | 3300049683 | Bacteria | 566 |
| 717 | Ga0501079_0274399 | 3300049741 | Bacteria | 1318 |
| 718 | Ga0501079_1139578 | 3300049741 | Bacteria | 614 |
| 719 | Ga0501080_0025952 | 3300049742 | Bacteria | 5443 |
| 720 | Ga0501080_0043551 | 3300049742 | Bacteria | 4180 |
| 721 | Ga0501083_0018333 | 3300049744 | Bacteria | 4878 |
| 722 | Ga0501241_007349 | 3300049758 | Bacteria | 2018 |
| 723 | Ga0501262_081513 | 3300049759 | Unclassified | 541 |
| 724 | Ga0501268_176367 | 3300049765 | Unclassified | 507 |
| 725 | Ga0501035_0541344 | 3300049822 | Bacteria | 955 |
| 726 | Ga0501044_0044001 | 3300049823 | Bacteria | 4636 |
| 727 | Ga0501204_040309 | 3300049850 | Bacteria | 682 |
| 728 | nmdc:mga09592_295816_c1 | 3300050508 | Bacteria | 1403 |
| 729 | Ga0500643_000311 | 3300053087 | Bacteria | 39950 |
| 730 | Ga0500643_004317 | 3300053087 | Bacteria | 6483 |
| 731 | Ga0500643_029458 | 3300053087 | Bacteria | 1688 |
| 732 | Ga0500643_043433 | 3300053087 | Bacteria | 1310 |
| 733 | Ga0500644_0053585 | 3300053088 | Bacteria | 1393 |
| 734 | Ga0500556_0000144 | 3300053104 | Bacteria | 59354 |
| 735 | Ga0500608_186366 | 3300053122 | Bacteria | 873 |
| 736 | Ga0500618_012926 | 3300053125 | Bacteria | 2173 |
| 737 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 738 | Ga0500658_0000147 | 3300053134 | Bacteria | 33394 |
| 739 | Ga0500559_0003490 | 3300053136 | Bacteria | 7715 |
| 740 | Ga0500559_0069243 | 3300053136 | Bacteria | 1586 |
| 741 | Ga0500620_005699 | 3300053155 | Bacteria | 2910 |
| 742 | Ga0500624_000027 | 3300053157 | Bacteria | 108821 |
| 743 | Ga0500645_000414 | 3300053730 | Bacteria | 29750 |
| 744 | Ga0501084_0581921 | 3300054114 | Bacteria | 946 |
| 745 | Ga0500661_003397 | 3300055283 | Bacteria | 2984 |
| 746 | Ga0501082_0130738 | 3300060353 | Bacteria | 2178 |
| 747 | Ga0466962_0083666 | 3300061719 | Bacteria | 1527 |
| 748 | Ga0466962_0508108 | 3300061719 | Bacteria | 610 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_101902702 | Ga0068857_1019027021 | 105 |
| 2 | 3300014326 | Ga0157380_10853842 | Ga0157380_108538422 | 118 |
| 3 | 3300005440 | Ga0070705_100765159 | Ga0070705_1007651591 | 121 |
| 4 | iso_pu_bacteria | 8055617313 | 8055620604 | 127 |
| 5 | 3300005985 | Ga0081539_10040175 | Ga0081539_100401754 | 130 |
| 6 | 3300009551 | Ga0105238_10507330 | Ga0105238_105073301 | 130 |
| 7 | 3300013104 | Ga0157370_10748181 | Ga0157370_107481811 | 130 |
| 8 | 3300046460 | Ga0495638_0060556 | Ga0495638_0060556_1830_2222 | 130 |
| 9 | 3300053087 | Ga0500643_000311 | Ga0500643_000311_38400_38792 | 130 |
| 10 | 3300053087 | Ga0500643_004317 | Ga0500643_004317_5932_6324 | 130 |
| 11 | 3300053125 | Ga0500618_012926 | Ga0500618_012926_1497_1889 | 130 |
| 12 | 3300053136 | Ga0500559_0003490 | Ga0500559_0003490_5884_6276 | 130 |
| 13 | 3300053157 | Ga0500624_000027 | Ga0500624_000027_19457_19849 | 130 |
| 14 | 3300055283 | Ga0500661_003397 | Ga0500661_003397_1157_1549 | 130 |
| 15 | 3300001979 | JGI24740J21852_10020127 | JGI24740J21852_100201272 | 131 |
| 16 | 3300001979 | JGI24740J21852_10034420 | JGI24740J21852_100344202 | 131 |
| 17 | 3300001989 | JGI24739J22299_10000453 | JGI24739J22299_100004534 | 131 |
| 18 | 3300001989 | JGI24739J22299_10027197 | JGI24739J22299_100271971 | 131 |
| 19 | 3300001990 | JGI24737J22298_10000021 | JGI24737J22298_1000002121 | 131 |
| 20 | 3300001990 | JGI24737J22298_10056449 | JGI24737J22298_100564492 | 131 |
| 21 | 3300002067 | JGI24735J21928_10017771 | JGI24735J21928_100177712 | 131 |
| 22 | 3300002074 | JGI24748J21848_1024486 | JGI24748J21848_10244862 | 131 |
| 23 | 3300002075 | JGI24738J21930_10000062 | JGI24738J21930_1000006222 | 131 |
| 24 | 3300002076 | JGI24749J21850_1007519 | JGI24749J21850_10075192 | 131 |
| 25 | 3300002126 | JGI24035J26624_1005815 | JGI24035J26624_10058152 | 131 |
| 26 | 3300005290 | Ga0065712_10031930 | Ga0065712_100319302 | 131 |
| 27 | 3300005327 | Ga0070658_10034989 | Ga0070658_100349892 | 131 |
| 28 | 3300005327 | Ga0070658_10169474 | Ga0070658_101694742 | 131 |
| 29 | 3300005327 | Ga0070658_10410767 | Ga0070658_104107672 | 131 |
| 30 | 3300005327 | Ga0070658_10857287 | Ga0070658_108572871 | 131 |
| 31 | 3300005327 | Ga0070658_11090690 | Ga0070658_110906901 | 131 |
| 32 | 3300005327 | Ga0070658_11141804 | Ga0070658_111418041 | 131 |
| 33 | 3300005327 | Ga0070658_11327575 | Ga0070658_113275752 | 131 |
| 34 | 3300005328 | Ga0070676_10003504 | Ga0070676_100035045 | 131 |
| 35 | 3300005328 | Ga0070676_10011228 | Ga0070676_100112287 | 131 |
| 36 | 3300005328 | Ga0070676_10169095 | Ga0070676_101690951 | 131 |
| 37 | 3300005328 | Ga0070676_10218065 | Ga0070676_102180652 | 131 |
| 38 | 3300005329 | Ga0070683_101497744 | Ga0070683_1014977441 | 131 |
| 39 | 3300005329 | Ga0070683_101765478 | Ga0070683_1017654782 | 131 |
| 40 | 3300005330 | Ga0070690_100018652 | Ga0070690_1000186522 | 131 |
| 41 | 3300005331 | Ga0070670_100010365 | Ga0070670_1000103656 | 131 |
| 42 | 3300005331 | Ga0070670_100075676 | Ga0070670_1000756764 | 131 |
| 43 | 3300005331 | Ga0070670_100197748 | Ga0070670_1001977481 | 131 |
| 44 | 3300005331 | Ga0070670_100211938 | Ga0070670_1002119381 | 131 |
| 45 | 3300005331 | Ga0070670_100301085 | Ga0070670_1003010852 | 131 |
| 46 | 3300005333 | Ga0070677_10004566 | Ga0070677_100045662 | 131 |
| 47 | 3300005333 | Ga0070677_10061063 | Ga0070677_100610632 | 131 |
| 48 | 3300005333 | Ga0070677_10560965 | Ga0070677_105609652 | 131 |
| 49 | 3300005334 | Ga0068869_100034193 | Ga0068869_1000341933 | 131 |
| 50 | 3300005334 | Ga0068869_100071883 | Ga0068869_1000718833 | 131 |
| 51 | 3300005334 | Ga0068869_100339175 | Ga0068869_1003391752 | 131 |
| 52 | 3300005335 | Ga0070666_10049262 | Ga0070666_100492623 | 131 |
| 53 | 3300005335 | Ga0070666_10052157 | Ga0070666_100521572 | 131 |
| 54 | 3300005335 | Ga0070666_10162447 | Ga0070666_101624472 | 131 |
| 55 | 3300005335 | Ga0070666_10657553 | Ga0070666_106575532 | 131 |
| 56 | 3300005336 | Ga0070680_100294940 | Ga0070680_1002949401 | 131 |
| 57 | 3300005336 | Ga0070680_101054807 | Ga0070680_1010548072 | 131 |
| 58 | 3300005337 | Ga0070682_100123267 | Ga0070682_1001232672 | 131 |
| 59 | 3300005337 | Ga0070682_100214281 | Ga0070682_1002142811 | 131 |
| 60 | 3300005338 | Ga0068868_100000637 | Ga0068868_10000063711 | 131 |
| 61 | 3300005338 | Ga0068868_101126191 | Ga0068868_1011261912 | 131 |
| 62 | 3300005339 | Ga0070660_100001821 | Ga0070660_1000018219 | 131 |
| 63 | 3300005339 | Ga0070660_100002082 | Ga0070660_10000208215 | 131 |
| 64 | 3300005339 | Ga0070660_100023740 | Ga0070660_1000237404 | 131 |
| 65 | 3300005339 | Ga0070660_100152967 | Ga0070660_1001529672 | 131 |
| 66 | 3300005339 | Ga0070660_100219149 | Ga0070660_1002191491 | 131 |
| 67 | 3300005339 | Ga0070660_100387183 | Ga0070660_1003871832 | 131 |
| 68 | 3300005339 | Ga0070660_100419199 | Ga0070660_1004191992 | 131 |
| 69 | 3300005339 | Ga0070660_100429773 | Ga0070660_1004297732 | 131 |
| 70 | 3300005339 | Ga0070660_100478065 | Ga0070660_1004780651 | 131 |
| 71 | 3300005339 | Ga0070660_100542317 | Ga0070660_1005423172 | 131 |
| 72 | 3300005339 | Ga0070660_100973574 | Ga0070660_1009735741 | 131 |
| 73 | 3300005340 | Ga0070689_100009615 | Ga0070689_1000096152 | 131 |
| 74 | 3300005340 | Ga0070689_100013741 | Ga0070689_1000137419 | 131 |
| 75 | 3300005340 | Ga0070689_101226884 | Ga0070689_1012268842 | 131 |
| 76 | 3300005343 | Ga0070687_100216472 | Ga0070687_1002164722 | 131 |
| 77 | 3300005344 | Ga0070661_100007377 | Ga0070661_1000073775 | 131 |
| 78 | 3300005344 | Ga0070661_100031513 | Ga0070661_1000315134 | 131 |
| 79 | 3300005344 | Ga0070661_100074768 | Ga0070661_1000747682 | 131 |
| 80 | 3300005344 | Ga0070661_100109407 | Ga0070661_1001094072 | 131 |
| 81 | 3300005344 | Ga0070661_100314557 | Ga0070661_1003145572 | 131 |
| 82 | 3300005344 | Ga0070661_100342559 | Ga0070661_1003425592 | 131 |
| 83 | 3300005344 | Ga0070661_100445614 | Ga0070661_1004456141 | 131 |
| 84 | 3300005344 | Ga0070661_100514389 | Ga0070661_1005143891 | 131 |
| 85 | 3300005344 | Ga0070661_100795031 | Ga0070661_1007950312 | 131 |
| 86 | 3300005344 | Ga0070661_101052675 | Ga0070661_1010526752 | 131 |
| 87 | 3300005344 | Ga0070661_101105657 | Ga0070661_1011056572 | 131 |
| 88 | 3300005344 | Ga0070661_101334919 | Ga0070661_1013349191 | 131 |
| 89 | 3300005347 | Ga0070668_100005175 | Ga0070668_10000517511 | 131 |
| 90 | 3300005347 | Ga0070668_100032860 | Ga0070668_1000328606 | 131 |
| 91 | 3300005347 | Ga0070668_100359173 | Ga0070668_1003591731 | 131 |
| 92 | 3300005347 | Ga0070668_101547510 | Ga0070668_1015475101 | 131 |
| 93 | 3300005353 | Ga0070669_100000009 | Ga0070669_100000009122 | 131 |
| 94 | 3300005353 | Ga0070669_100000862 | Ga0070669_1000008623 | 131 |
| 95 | 3300005353 | Ga0070669_100096778 | Ga0070669_1000967783 | 131 |
| 96 | 3300005353 | Ga0070669_100118774 | Ga0070669_1001187744 | 131 |
| 97 | 3300005353 | Ga0070669_100171760 | Ga0070669_1001717602 | 131 |
| 98 | 3300005353 | Ga0070669_100199231 | Ga0070669_1001992311 | 131 |
| 99 | 3300005354 | Ga0070675_100007443 | Ga0070675_1000074436 | 131 |
| 100 | 3300005354 | Ga0070675_100047334 | Ga0070675_1000473346 | 131 |
| 101 | 3300005354 | Ga0070675_100302676 | Ga0070675_1003026763 | 131 |
| 102 | 3300005354 | Ga0070675_100858179 | Ga0070675_1008581792 | 131 |
| 103 | 3300005355 | Ga0070671_100001012 | Ga0070671_10000101216 | 131 |
| 104 | 3300005355 | Ga0070671_100002229 | Ga0070671_10000222915 | 131 |
| 105 | 3300005355 | Ga0070671_100076910 | Ga0070671_1000769104 | 131 |
| 106 | 3300005355 | Ga0070671_100503647 | Ga0070671_1005036472 | 131 |
| 107 | 3300005355 | Ga0070671_100732538 | Ga0070671_1007325382 | 131 |
| 108 | 3300005355 | Ga0070671_100772397 | Ga0070671_1007723971 | 131 |
| 109 | 3300005355 | Ga0070671_101167974 | Ga0070671_1011679741 | 131 |
| 110 | 3300005356 | Ga0070674_100001982 | Ga0070674_1000019826 | 131 |
| 111 | 3300005356 | Ga0070674_100051087 | Ga0070674_1000510875 | 131 |
| 112 | 3300005356 | Ga0070674_100139092 | Ga0070674_1001390922 | 131 |
| 113 | 3300005356 | Ga0070674_100196996 | Ga0070674_1001969962 | 131 |
| 114 | 3300005356 | Ga0070674_100330914 | Ga0070674_1003309142 | 131 |
| 115 | 3300005364 | Ga0070673_100000209 | Ga0070673_10000020914 | 131 |
| 116 | 3300005364 | Ga0070673_100057133 | Ga0070673_1000571332 | 131 |
| 117 | 3300005364 | Ga0070673_100096310 | Ga0070673_1000963103 | 131 |
| 118 | 3300005364 | Ga0070673_100161093 | Ga0070673_1001610932 | 131 |
| 119 | 3300005364 | Ga0070673_100933179 | Ga0070673_1009331792 | 131 |
| 120 | 3300005364 | Ga0070673_100967289 | Ga0070673_1009672892 | 131 |
| 121 | 3300005366 | Ga0070659_100006023 | Ga0070659_1000060233 | 131 |
| 122 | 3300005366 | Ga0070659_100007835 | Ga0070659_1000078353 | 131 |
| 123 | 3300005366 | Ga0070659_100028371 | Ga0070659_1000283712 | 131 |
| 124 | 3300005366 | Ga0070659_100323638 | Ga0070659_1003236381 | 131 |
| 125 | 3300005366 | Ga0070659_100427468 | Ga0070659_1004274681 | 131 |
| 126 | 3300005366 | Ga0070659_101220277 | Ga0070659_1012202771 | 131 |
| 127 | 3300005367 | Ga0070667_100004734 | Ga0070667_1000047344 | 131 |
| 128 | 3300005367 | Ga0070667_100005313 | Ga0070667_1000053135 | 131 |
| 129 | 3300005367 | Ga0070667_100090330 | Ga0070667_1000903302 | 131 |
| 130 | 3300005367 | Ga0070667_100116585 | Ga0070667_1001165854 | 131 |
| 131 | 3300005367 | Ga0070667_100264669 | Ga0070667_1002646692 | 131 |
| 132 | 3300005367 | Ga0070667_100322181 | Ga0070667_1003221812 | 131 |
| 133 | 3300005455 | Ga0070663_100013706 | Ga0070663_1000137066 | 131 |
| 134 | 3300005455 | Ga0070663_100050307 | Ga0070663_1000503071 | 131 |
| 135 | 3300005455 | Ga0070663_100094108 | Ga0070663_1000941082 | 131 |
| 136 | 3300005455 | Ga0070663_100217564 | Ga0070663_1002175641 | 131 |
| 137 | 3300005455 | Ga0070663_100237306 | Ga0070663_1002373061 | 131 |
| 138 | 3300005455 | Ga0070663_100303531 | Ga0070663_1003035312 | 131 |
| 139 | 3300005455 | Ga0070663_101003971 | Ga0070663_1010039712 | 131 |
| 140 | 3300005455 | Ga0070663_101017456 | Ga0070663_1010174561 | 131 |
| 141 | 3300005455 | Ga0070663_101026257 | Ga0070663_1010262572 | 131 |
| 142 | 3300005455 | Ga0070663_101370813 | Ga0070663_1013708131 | 131 |
| 143 | 3300005455 | Ga0070663_101525893 | Ga0070663_1015258931 | 131 |
| 144 | 3300005456 | Ga0070678_100089929 | Ga0070678_1000899293 | 131 |
| 145 | 3300005456 | Ga0070678_100123475 | Ga0070678_1001234752 | 131 |
| 146 | 3300005456 | Ga0070678_100197779 | Ga0070678_1001977793 | 131 |
| 147 | 3300005457 | Ga0070662_100001955 | Ga0070662_1000019552 | 131 |
| 148 | 3300005457 | Ga0070662_100044295 | Ga0070662_1000442954 | 131 |
| 149 | 3300005457 | Ga0070662_100083028 | Ga0070662_1000830284 | 131 |
| 150 | 3300005457 | Ga0070662_100255675 | Ga0070662_1002556751 | 131 |
| 151 | 3300005457 | Ga0070662_100293262 | Ga0070662_1002932621 | 131 |
| 152 | 3300005457 | Ga0070662_100346368 | Ga0070662_1003463683 | 131 |
| 153 | 3300005457 | Ga0070662_100638120 | Ga0070662_1006381201 | 131 |
| 154 | 3300005457 | Ga0070662_100833426 | Ga0070662_1008334262 | 131 |
| 155 | 3300005457 | Ga0070662_101187810 | Ga0070662_1011878102 | 131 |
| 156 | 3300005458 | Ga0070681_10051638 | Ga0070681_100516384 | 131 |
| 157 | 3300005458 | Ga0070681_10246249 | Ga0070681_102462492 | 131 |
| 158 | 3300005458 | Ga0070681_11901214 | Ga0070681_119012141 | 131 |
| 159 | 3300005459 | Ga0068867_100000633 | Ga0068867_10000063323 | 131 |
| 160 | 3300005459 | Ga0068867_100011413 | Ga0068867_1000114136 | 131 |
| 161 | 3300005459 | Ga0068867_100329452 | Ga0068867_1003294522 | 131 |
| 162 | 3300005459 | Ga0068867_100401748 | Ga0068867_1004017482 | 131 |
| 163 | 3300005459 | Ga0068867_101063450 | Ga0068867_1010634502 | 131 |
| 164 | 3300005466 | Ga0070685_10000225 | Ga0070685_1000022510 | 131 |
| 165 | 3300005530 | Ga0070679_100000750 | Ga0070679_10000075014 | 131 |
| 166 | 3300005530 | Ga0070679_100091968 | Ga0070679_1000919682 | 131 |
| 167 | 3300005530 | Ga0070679_101202036 | Ga0070679_1012020362 | 131 |
| 168 | 3300005530 | Ga0070679_101246968 | Ga0070679_1012469682 | 131 |
| 169 | 3300005530 | Ga0070679_101472415 | Ga0070679_1014724151 | 131 |
| 170 | 3300005530 | Ga0070679_101551282 | Ga0070679_1015512821 | 131 |
| 171 | 3300005539 | Ga0068853_100002063 | Ga0068853_10000206312 | 131 |
| 172 | 3300005539 | Ga0068853_100060675 | Ga0068853_1000606753 | 131 |
| 173 | 3300005539 | Ga0068853_100342356 | Ga0068853_1003423562 | 131 |
| 174 | 3300005539 | Ga0068853_100444925 | Ga0068853_1004449252 | 131 |
| 175 | 3300005539 | Ga0068853_100621954 | Ga0068853_1006219542 | 131 |
| 176 | 3300005539 | Ga0068853_100885472 | Ga0068853_1008854721 | 131 |
| 177 | 3300005539 | Ga0068853_101259303 | Ga0068853_1012593032 | 131 |
| 178 | 3300005539 | Ga0068853_101934244 | Ga0068853_1019342441 | 131 |
| 179 | 3300005543 | Ga0070672_100000770 | Ga0070672_10000077020 | 131 |
| 180 | 3300005543 | Ga0070672_100012771 | Ga0070672_1000127714 | 131 |
| 181 | 3300005543 | Ga0070672_100332309 | Ga0070672_1003323092 | 131 |
| 182 | 3300005543 | Ga0070672_100743794 | Ga0070672_1007437941 | 131 |
| 183 | 3300005545 | Ga0070695_101420361 | Ga0070695_1014203611 | 131 |
| 184 | 3300005546 | Ga0070696_100054831 | Ga0070696_1000548313 | 131 |
| 185 | 3300005547 | Ga0070693_100039946 | Ga0070693_1000399461 | 131 |
| 186 | 3300005547 | Ga0070693_100369905 | Ga0070693_1003699051 | 131 |
| 187 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004169 | 131 |
| 188 | 3300005548 | Ga0070665_100000590 | Ga0070665_10000059043 | 131 |
| 189 | 3300005548 | Ga0070665_101003374 | Ga0070665_1010033741 | 131 |
| 190 | 3300005548 | Ga0070665_101415786 | Ga0070665_1014157861 | 131 |
| 191 | 3300005563 | Ga0068855_100039372 | Ga0068855_1000393723 | 131 |
| 192 | 3300005563 | Ga0068855_100659183 | Ga0068855_1006591832 | 131 |
| 193 | 3300005563 | Ga0068855_101588504 | Ga0068855_1015885041 | 131 |
| 194 | 3300005564 | Ga0070664_100002427 | Ga0070664_1000024276 | 131 |
| 195 | 3300005564 | Ga0070664_100009081 | Ga0070664_1000090812 | 131 |
| 196 | 3300005564 | Ga0070664_100010866 | Ga0070664_1000108662 | 131 |
| 197 | 3300005564 | Ga0070664_100046060 | Ga0070664_1000460602 | 131 |
| 198 | 3300005564 | Ga0070664_100183983 | Ga0070664_1001839832 | 131 |
| 199 | 3300005564 | Ga0070664_100518830 | Ga0070664_1005188302 | 131 |
| 200 | 3300005577 | Ga0068857_100004161 | Ga0068857_1000041612 | 131 |
| 201 | 3300005577 | Ga0068857_100105577 | Ga0068857_1001055773 | 131 |
| 202 | 3300005577 | Ga0068857_100150925 | Ga0068857_1001509253 | 131 |
| 203 | 3300005577 | Ga0068857_100857248 | Ga0068857_1008572481 | 131 |
| 204 | 3300005577 | Ga0068857_101202536 | Ga0068857_1012025362 | 131 |
| 205 | 3300005578 | Ga0068854_100000614 | Ga0068854_10000061423 | 131 |
| 206 | 3300005578 | Ga0068854_100068281 | Ga0068854_1000682812 | 131 |
| 207 | 3300005578 | Ga0068854_100103296 | Ga0068854_1001032963 | 131 |
| 208 | 3300005578 | Ga0068854_100337004 | Ga0068854_1003370042 | 131 |
| 209 | 3300005578 | Ga0068854_100523947 | Ga0068854_1005239472 | 131 |
| 210 | 3300005578 | Ga0068854_100724192 | Ga0068854_1007241922 | 131 |
| 211 | 3300005578 | Ga0068854_101022875 | Ga0068854_1010228752 | 131 |
| 212 | 3300005614 | Ga0068856_100057609 | Ga0068856_1000576092 | 131 |
| 213 | 3300005614 | Ga0068856_100182730 | Ga0068856_1001827305 | 131 |
| 214 | 3300005614 | Ga0068856_100801697 | Ga0068856_1008016972 | 131 |
| 215 | 3300005614 | Ga0068856_100850295 | Ga0068856_1008502952 | 131 |
| 216 | 3300005614 | Ga0068856_101015343 | Ga0068856_1010153432 | 131 |
| 217 | 3300005615 | Ga0070702_100102565 | Ga0070702_1001025653 | 131 |
| 218 | 3300005616 | Ga0068852_100000804 | Ga0068852_10000080424 | 131 |
| 219 | 3300005616 | Ga0068852_100039331 | Ga0068852_1000393312 | 131 |
| 220 | 3300005616 | Ga0068852_100086339 | Ga0068852_1000863392 | 131 |
| 221 | 3300005616 | Ga0068852_100086868 | Ga0068852_1000868682 | 131 |
| 222 | 3300005616 | Ga0068852_100439777 | Ga0068852_1004397772 | 131 |
| 223 | 3300005616 | Ga0068852_100463930 | Ga0068852_1004639303 | 131 |
| 224 | 3300005616 | Ga0068852_100655564 | Ga0068852_1006555643 | 131 |
| 225 | 3300005616 | Ga0068852_101059328 | Ga0068852_1010593282 | 131 |
| 226 | 3300005616 | Ga0068852_101280805 | Ga0068852_1012808052 | 131 |
| 227 | 3300005617 | Ga0068859_100000104 | Ga0068859_10000010470 | 131 |
| 228 | 3300005617 | Ga0068859_100000478 | Ga0068859_10000047832 | 131 |
| 229 | 3300005617 | Ga0068859_100022547 | Ga0068859_1000225477 | 131 |
| 230 | 3300005617 | Ga0068859_100119080 | Ga0068859_1001190801 | 131 |
| 231 | 3300005617 | Ga0068859_100362012 | Ga0068859_1003620123 | 131 |
| 232 | 3300005617 | Ga0068859_100409780 | Ga0068859_1004097802 | 131 |
| 233 | 3300005618 | Ga0068864_100000118 | Ga0068864_10000011850 | 131 |
| 234 | 3300005618 | Ga0068864_100000174 | Ga0068864_10000017467 | 131 |
| 235 | 3300005618 | Ga0068864_100017446 | Ga0068864_1000174466 | 131 |
| 236 | 3300005618 | Ga0068864_100136248 | Ga0068864_1001362482 | 131 |
| 237 | 3300005618 | Ga0068864_100756044 | Ga0068864_1007560442 | 131 |
| 238 | 3300005618 | Ga0068864_101332917 | Ga0068864_1013329171 | 131 |
| 239 | 3300005718 | Ga0068866_10754807 | Ga0068866_107548072 | 131 |
| 240 | 3300005718 | Ga0068866_10957279 | Ga0068866_109572791 | 131 |
| 241 | 3300005719 | Ga0068861_100001151 | Ga0068861_10000115112 | 131 |
| 242 | 3300005719 | Ga0068861_100010621 | Ga0068861_1000106216 | 131 |
| 243 | 3300005719 | Ga0068861_100481942 | Ga0068861_1004819422 | 131 |
| 244 | 3300005719 | Ga0068861_102360272 | Ga0068861_1023602721 | 131 |
| 245 | 3300005834 | Ga0068851_10157421 | Ga0068851_101574212 | 131 |
| 246 | 3300005834 | Ga0068851_10299332 | Ga0068851_102993322 | 131 |
| 247 | 3300005834 | Ga0068851_10300744 | Ga0068851_103007442 | 131 |
| 248 | 3300005834 | Ga0068851_10375744 | Ga0068851_103757442 | 131 |
| 249 | 3300005840 | Ga0068870_10184423 | Ga0068870_101844233 | 131 |
| 250 | 3300005841 | Ga0068863_100000152 | Ga0068863_10000015248 | 131 |
| 251 | 3300005841 | Ga0068863_100004878 | Ga0068863_1000048783 | 131 |
| 252 | 3300005841 | Ga0068863_100076008 | Ga0068863_1000760084 | 131 |
| 253 | 3300005841 | Ga0068863_100208726 | Ga0068863_1002087261 | 131 |
| 254 | 3300005841 | Ga0068863_100285525 | Ga0068863_1002855252 | 131 |
| 255 | 3300005841 | Ga0068863_101763628 | Ga0068863_1017636282 | 131 |
| 256 | 3300005842 | Ga0068858_100028224 | Ga0068858_1000282246 | 131 |
| 257 | 3300005842 | Ga0068858_100068281 | Ga0068858_1000682816 | 131 |
| 258 | 3300005842 | Ga0068858_100283369 | Ga0068858_1002833692 | 131 |
| 259 | 3300005843 | Ga0068860_100003157 | Ga0068860_1000031579 | 131 |
| 260 | 3300005843 | Ga0068860_100005690 | Ga0068860_1000056907 | 131 |
| 261 | 3300005843 | Ga0068860_100007725 | Ga0068860_1000077255 | 131 |
| 262 | 3300005843 | Ga0068860_100341159 | Ga0068860_1003411592 | 131 |
| 263 | 3300005843 | Ga0068860_100658460 | Ga0068860_1006584603 | 131 |
| 264 | 3300005844 | Ga0068862_100000421 | Ga0068862_10000042113 | 131 |
| 265 | 3300005844 | Ga0068862_100005596 | Ga0068862_10000559610 | 131 |
| 266 | 3300005844 | Ga0068862_100026268 | Ga0068862_1000262683 | 131 |
| 267 | 3300005844 | Ga0068862_100054895 | Ga0068862_1000548953 | 131 |
| 268 | 3300005844 | Ga0068862_100149447 | Ga0068862_1001494471 | 131 |
| 269 | 3300005844 | Ga0068862_100727452 | Ga0068862_1007274522 | 131 |
| 270 | 3300006237 | Ga0097621_100013235 | Ga0097621_1000132352 | 131 |
| 271 | 3300006237 | Ga0097621_100088606 | Ga0097621_1000886063 | 131 |
| 272 | 3300006358 | Ga0068871_100135529 | Ga0068871_1001355292 | 131 |
| 273 | 3300006358 | Ga0068871_100180491 | Ga0068871_1001804912 | 131 |
| 274 | 3300006358 | Ga0068871_100468183 | Ga0068871_1004681832 | 131 |
| 275 | 3300006881 | Ga0068865_100000240 | Ga0068865_10000024015 | 131 |
| 276 | 3300006931 | Ga0097620_100000104 | Ga0097620_10000010470 | 131 |
| 277 | 3300006931 | Ga0097620_100000478 | Ga0097620_10000047832 | 131 |
| 278 | 3300006931 | Ga0097620_100022548 | Ga0097620_1000225487 | 131 |
| 279 | 3300006931 | Ga0097620_100119090 | Ga0097620_1001190903 | 131 |
| 280 | 3300006931 | Ga0097620_100361978 | Ga0097620_1003619783 | 131 |
| 281 | 3300006931 | Ga0097620_100409763 | Ga0097620_1004097632 | 131 |
| 282 | 3300009011 | Ga0105251_10405572 | Ga0105251_104055722 | 131 |
| 283 | 3300009092 | Ga0105250_10017923 | Ga0105250_100179234 | 131 |
| 284 | 3300009093 | Ga0105240_10073297 | Ga0105240_100732977 | 131 |
| 285 | 3300009093 | Ga0105240_10745376 | Ga0105240_107453762 | 131 |
| 286 | 3300009098 | Ga0105245_10000300 | Ga0105245_1000030023 | 131 |
| 287 | 3300009101 | Ga0105247_10006055 | Ga0105247_100060555 | 131 |
| 288 | 3300009101 | Ga0105247_10170804 | Ga0105247_101708042 | 131 |
| 289 | 3300009147 | Ga0114129_11975131 | Ga0114129_119751311 | 131 |
| 290 | 3300009174 | Ga0105241_10022584 | Ga0105241_100225843 | 131 |
| 291 | 3300009176 | Ga0105242_11884389 | Ga0105242_118843892 | 131 |
| 292 | 3300009177 | Ga0105248_10000295 | Ga0105248_1000029545 | 131 |
| 293 | 3300009177 | Ga0105248_10002741 | Ga0105248_1000274110 | 131 |
| 294 | 3300009177 | Ga0105248_10006633 | Ga0105248_100066332 | 131 |
| 295 | 3300009177 | Ga0105248_10014716 | Ga0105248_100147166 | 131 |
| 296 | 3300009177 | Ga0105248_10017802 | Ga0105248_100178027 | 131 |
| 297 | 3300009177 | Ga0105248_10390186 | Ga0105248_103901862 | 131 |
| 298 | 3300009177 | Ga0105248_10559403 | Ga0105248_105594033 | 131 |
| 299 | 3300009177 | Ga0105248_11151389 | Ga0105248_111513892 | 131 |
| 300 | 3300009545 | Ga0105237_10950039 | Ga0105237_109500391 | 131 |
| 301 | 3300009551 | Ga0105238_10049432 | Ga0105238_100494322 | 131 |
| 302 | 3300009551 | Ga0105238_10981814 | Ga0105238_109818141 | 131 |
| 303 | 3300009553 | Ga0105249_11261345 | Ga0105249_112613452 | 131 |
| 304 | 3300009553 | Ga0105249_13262366 | Ga0105249_132623661 | 131 |
| 305 | 3300010375 | Ga0105239_10044676 | Ga0105239_100446763 | 131 |
| 306 | 3300010375 | Ga0105239_11858988 | Ga0105239_118589881 | 131 |
| 307 | 3300011119 | Ga0105246_10021355 | Ga0105246_100213555 | 131 |
| 308 | 3300011119 | Ga0105246_10647241 | Ga0105246_106472412 | 131 |
| 309 | 3300013100 | Ga0157373_10006164 | Ga0157373_100061642 | 131 |
| 310 | 3300013100 | Ga0157373_10085912 | Ga0157373_100859121 | 131 |
| 311 | 3300013100 | Ga0157373_10278215 | Ga0157373_102782151 | 131 |
| 312 | 3300013100 | Ga0157373_10463670 | Ga0157373_104636702 | 131 |
| 313 | 3300013102 | Ga0157371_10000677 | Ga0157371_1000067726 | 131 |
| 314 | 3300013102 | Ga0157371_10424834 | Ga0157371_104248342 | 131 |
| 315 | 3300013102 | Ga0157371_10441020 | Ga0157371_104410201 | 131 |
| 316 | 3300013102 | Ga0157371_10754115 | Ga0157371_107541152 | 131 |
| 317 | 3300013104 | Ga0157370_10115511 | Ga0157370_101155113 | 131 |
| 318 | 3300013104 | Ga0157370_10244964 | Ga0157370_102449642 | 131 |
| 319 | 3300013104 | Ga0157370_10855001 | Ga0157370_108550012 | 131 |
| 320 | 3300013105 | Ga0157369_10391583 | Ga0157369_103915832 | 131 |
| 321 | 3300013296 | Ga0157374_11086772 | Ga0157374_110867721 | 131 |
| 322 | 3300013297 | Ga0157378_10002011 | Ga0157378_1000201111 | 131 |
| 323 | 3300013297 | Ga0157378_11188894 | Ga0157378_111888941 | 131 |
| 324 | 3300013306 | Ga0163162_10045123 | Ga0163162_100451234 | 131 |
| 325 | 3300013306 | Ga0163162_10202482 | Ga0163162_102024822 | 131 |
| 326 | 3300013307 | Ga0157372_10045485 | Ga0157372_100454858 | 131 |
| 327 | 3300013307 | Ga0157372_10088817 | Ga0157372_100888175 | 131 |
| 328 | 3300013307 | Ga0157372_10754899 | Ga0157372_107548992 | 131 |
| 329 | 3300013307 | Ga0157372_11547760 | Ga0157372_115477601 | 131 |
| 330 | 3300013308 | Ga0157375_10124625 | Ga0157375_101246253 | 131 |
| 331 | 3300013308 | Ga0157375_10499140 | Ga0157375_104991402 | 131 |
| 332 | 3300013308 | Ga0157375_11854929 | Ga0157375_118549292 | 131 |
| 333 | 3300014325 | Ga0163163_10000882 | Ga0163163_100008826 | 131 |
| 334 | 3300014325 | Ga0163163_10400460 | Ga0163163_104004602 | 131 |
| 335 | 3300014745 | Ga0157377_10033043 | Ga0157377_100330433 | 131 |
| 336 | 3300014968 | Ga0157379_10009073 | Ga0157379_100090732 | 131 |
| 337 | 3300014968 | Ga0157379_10054102 | Ga0157379_100541023 | 131 |
| 338 | 3300017792 | Ga0163161_11058312 | Ga0163161_110583122 | 131 |
| 339 | 3300021384 | Ga0213876_10010656 | Ga0213876_100106563 | 131 |
| 340 | 3300025290 | Ga0207673_1001669 | Ga0207673_10016694 | 131 |
| 341 | 3300025315 | Ga0207697_10000026 | Ga0207697_1000002632 | 131 |
| 342 | 3300025315 | Ga0207697_10186033 | Ga0207697_101860332 | 131 |
| 343 | 3300025315 | Ga0207697_10373337 | Ga0207697_103733372 | 131 |
| 344 | 3300025321 | Ga0207656_10072117 | Ga0207656_100721172 | 131 |
| 345 | 3300025321 | Ga0207656_10494086 | Ga0207656_104940861 | 131 |
| 346 | 3300025711 | Ga0207696_1048263 | Ga0207696_10482632 | 131 |
| 347 | 3300025735 | Ga0207713_1166571 | Ga0207713_11665712 | 131 |
| 348 | 3300025735 | Ga0207713_1196393 | Ga0207713_11963931 | 131 |
| 349 | 3300025893 | Ga0207682_10009951 | Ga0207682_100099512 | 131 |
| 350 | 3300025893 | Ga0207682_10100070 | Ga0207682_101000703 | 131 |
| 351 | 3300025899 | Ga0207642_10147168 | Ga0207642_101471682 | 131 |
| 352 | 3300025900 | Ga0207710_10018640 | Ga0207710_100186402 | 131 |
| 353 | 3300025900 | Ga0207710_10079543 | Ga0207710_100795432 | 131 |
| 354 | 3300025901 | Ga0207688_10000055 | Ga0207688_1000005516 | 131 |
| 355 | 3300025901 | Ga0207688_10011889 | Ga0207688_100118893 | 131 |
| 356 | 3300025903 | Ga0207680_10036791 | Ga0207680_100367912 | 131 |
| 357 | 3300025903 | Ga0207680_10680949 | Ga0207680_106809491 | 131 |
| 358 | 3300025904 | Ga0207647_10006361 | Ga0207647_1000636113 | 131 |
| 359 | 3300025904 | Ga0207647_10222636 | Ga0207647_102226362 | 131 |
| 360 | 3300025907 | Ga0207645_10001667 | Ga0207645_1000166715 | 131 |
| 361 | 3300025907 | Ga0207645_10006444 | Ga0207645_100064442 | 131 |
| 362 | 3300025907 | Ga0207645_10086464 | Ga0207645_100864642 | 131 |
| 363 | 3300025907 | Ga0207645_10115763 | Ga0207645_101157632 | 131 |
| 364 | 3300025908 | Ga0207643_10166873 | Ga0207643_101668732 | 131 |
| 365 | 3300025909 | Ga0207705_10021828 | Ga0207705_100218282 | 131 |
| 366 | 3300025909 | Ga0207705_10105183 | Ga0207705_101051832 | 131 |
| 367 | 3300025909 | Ga0207705_10382308 | Ga0207705_103823081 | 131 |
| 368 | 3300025909 | Ga0207705_10388709 | Ga0207705_103887092 | 131 |
| 369 | 3300025909 | Ga0207705_10645806 | Ga0207705_106458062 | 131 |
| 370 | 3300025909 | Ga0207705_10684759 | Ga0207705_106847592 | 131 |
| 371 | 3300025909 | Ga0207705_10737343 | Ga0207705_107373431 | 131 |
| 372 | 3300025909 | Ga0207705_11138284 | Ga0207705_111382842 | 131 |
| 373 | 3300025911 | Ga0207654_10477819 | Ga0207654_104778192 | 131 |
| 374 | 3300025912 | Ga0207707_10016712 | Ga0207707_100167124 | 131 |
| 375 | 3300025912 | Ga0207707_10713216 | Ga0207707_107132162 | 131 |
| 376 | 3300025913 | Ga0207695_10009319 | Ga0207695_1000931910 | 131 |
| 377 | 3300025913 | Ga0207695_10942521 | Ga0207695_109425211 | 131 |
| 378 | 3300025917 | Ga0207660_10007761 | Ga0207660_100077616 | 131 |
| 379 | 3300025917 | Ga0207660_10883860 | Ga0207660_108838601 | 131 |
| 380 | 3300025917 | Ga0207660_11260820 | Ga0207660_112608202 | 131 |
| 381 | 3300025918 | Ga0207662_10242073 | Ga0207662_102420732 | 131 |
| 382 | 3300025919 | Ga0207657_10001574 | Ga0207657_100015742 | 131 |
| 383 | 3300025919 | Ga0207657_10003629 | Ga0207657_1000362916 | 131 |
| 384 | 3300025919 | Ga0207657_10077813 | Ga0207657_100778132 | 131 |
| 385 | 3300025919 | Ga0207657_10078938 | Ga0207657_100789381 | 131 |
| 386 | 3300025919 | Ga0207657_10088943 | Ga0207657_100889432 | 131 |
| 387 | 3300025919 | Ga0207657_10284189 | Ga0207657_102841892 | 131 |
| 388 | 3300025919 | Ga0207657_10393461 | Ga0207657_103934612 | 131 |
| 389 | 3300025919 | Ga0207657_10496323 | Ga0207657_104963232 | 131 |
| 390 | 3300025919 | Ga0207657_10685154 | Ga0207657_106851542 | 131 |
| 391 | 3300025919 | Ga0207657_10852268 | Ga0207657_108522681 | 131 |
| 392 | 3300025919 | Ga0207657_10867747 | Ga0207657_108677472 | 131 |
| 393 | 3300025920 | Ga0207649_10031780 | Ga0207649_100317803 | 131 |
| 394 | 3300025920 | Ga0207649_10063331 | Ga0207649_100633314 | 131 |
| 395 | 3300025920 | Ga0207649_10116587 | Ga0207649_101165872 | 131 |
| 396 | 3300025920 | Ga0207649_10117121 | Ga0207649_101171211 | 131 |
| 397 | 3300025920 | Ga0207649_10200440 | Ga0207649_102004402 | 131 |
| 398 | 3300025920 | Ga0207649_10533279 | Ga0207649_105332792 | 131 |
| 399 | 3300025920 | Ga0207649_10672194 | Ga0207649_106721941 | 131 |
| 400 | 3300025920 | Ga0207649_10986334 | Ga0207649_109863342 | 131 |
| 401 | 3300025921 | Ga0207652_10000001 | Ga0207652_1000000116 | 131 |
| 402 | 3300025923 | Ga0207681_10000020 | Ga0207681_10000020105 | 131 |
| 403 | 3300025923 | Ga0207681_10001514 | Ga0207681_1000151416 | 131 |
| 404 | 3300025923 | Ga0207681_10005327 | Ga0207681_100053275 | 131 |
| 405 | 3300025923 | Ga0207681_10121455 | Ga0207681_101214552 | 131 |
| 406 | 3300025923 | Ga0207681_10419369 | Ga0207681_104193692 | 131 |
| 407 | 3300025924 | Ga0207694_10225304 | Ga0207694_102253042 | 131 |
| 408 | 3300025924 | Ga0207694_10761855 | Ga0207694_107618551 | 131 |
| 409 | 3300025925 | Ga0207650_10044004 | Ga0207650_100440042 | 131 |
| 410 | 3300025925 | Ga0207650_10066692 | Ga0207650_100666922 | 131 |
| 411 | 3300025925 | Ga0207650_10143822 | Ga0207650_101438222 | 131 |
| 412 | 3300025925 | Ga0207650_11297963 | Ga0207650_112979632 | 131 |
| 413 | 3300025926 | Ga0207659_10028105 | Ga0207659_100281056 | 131 |
| 414 | 3300025926 | Ga0207659_10287965 | Ga0207659_102879653 | 131 |
| 415 | 3300025927 | Ga0207687_10003666 | Ga0207687_100036667 | 131 |
| 416 | 3300025931 | Ga0207644_10000052 | Ga0207644_1000005292 | 131 |
| 417 | 3300025931 | Ga0207644_10059162 | Ga0207644_100591623 | 131 |
| 418 | 3300025931 | Ga0207644_10063446 | Ga0207644_100634462 | 131 |
| 419 | 3300025931 | Ga0207644_10114557 | Ga0207644_101145574 | 131 |
| 420 | 3300025931 | Ga0207644_10185747 | Ga0207644_101857472 | 131 |
| 421 | 3300025931 | Ga0207644_10481092 | Ga0207644_104810921 | 131 |
| 422 | 3300025932 | Ga0207690_10007026 | Ga0207690_100070262 | 131 |
| 423 | 3300025932 | Ga0207690_10066792 | Ga0207690_100667922 | 131 |
| 424 | 3300025932 | Ga0207690_10070989 | Ga0207690_100709893 | 131 |
| 425 | 3300025932 | Ga0207690_11290549 | Ga0207690_112905491 | 131 |
| 426 | 3300025933 | Ga0207706_10000278 | Ga0207706_1000027828 | 131 |
| 427 | 3300025933 | Ga0207706_10014921 | Ga0207706_100149212 | 131 |
| 428 | 3300025933 | Ga0207706_10015386 | Ga0207706_100153864 | 131 |
| 429 | 3300025933 | Ga0207706_10045118 | Ga0207706_100451183 | 131 |
| 430 | 3300025933 | Ga0207706_10135438 | Ga0207706_101354383 | 131 |
| 431 | 3300025933 | Ga0207706_10524191 | Ga0207706_105241912 | 131 |
| 432 | 3300025933 | Ga0207706_10608876 | Ga0207706_106088762 | 131 |
| 433 | 3300025933 | Ga0207706_10628496 | Ga0207706_106284962 | 131 |
| 434 | 3300025933 | Ga0207706_10832642 | Ga0207706_108326421 | 131 |
| 435 | 3300025933 | Ga0207706_10999102 | Ga0207706_109991021 | 131 |
| 436 | 3300025935 | Ga0207709_10220259 | Ga0207709_102202592 | 131 |
| 437 | 3300025936 | Ga0207670_10049248 | Ga0207670_100492486 | 131 |
| 438 | 3300025936 | Ga0207670_10096032 | Ga0207670_100960323 | 131 |
| 439 | 3300025937 | Ga0207669_10013438 | Ga0207669_100134382 | 131 |
| 440 | 3300025937 | Ga0207669_10028194 | Ga0207669_100281942 | 131 |
| 441 | 3300025937 | Ga0207669_10037936 | Ga0207669_100379362 | 131 |
| 442 | 3300025937 | Ga0207669_10178597 | Ga0207669_101785971 | 131 |
| 443 | 3300025938 | Ga0207704_10005707 | Ga0207704_100057074 | 131 |
| 444 | 3300025940 | Ga0207691_10000045 | Ga0207691_1000004528 | 131 |
| 445 | 3300025940 | Ga0207691_10023749 | Ga0207691_100237495 | 131 |
| 446 | 3300025940 | Ga0207691_10029849 | Ga0207691_100298495 | 131 |
| 447 | 3300025940 | Ga0207691_10141127 | Ga0207691_101411273 | 131 |
| 448 | 3300025941 | Ga0207711_10000153 | Ga0207711_1000015333 | 131 |
| 449 | 3300025941 | Ga0207711_10003154 | Ga0207711_100031543 | 131 |
| 450 | 3300025941 | Ga0207711_10004637 | Ga0207711_100046377 | 131 |
| 451 | 3300025941 | Ga0207711_10007319 | Ga0207711_100073198 | 131 |
| 452 | 3300025941 | Ga0207711_10047780 | Ga0207711_100477802 | 131 |
| 453 | 3300025942 | Ga0207689_10000182 | Ga0207689_1000018229 | 131 |
| 454 | 3300025942 | Ga0207689_10065887 | Ga0207689_100658875 | 131 |
| 455 | 3300025942 | Ga0207689_10647788 | Ga0207689_106477882 | 131 |
| 456 | 3300025944 | Ga0207661_10467236 | Ga0207661_104672362 | 131 |
| 457 | 3300025945 | Ga0207679_10007082 | Ga0207679_100070826 | 131 |
| 458 | 3300025945 | Ga0207679_10008820 | Ga0207679_100088206 | 131 |
| 459 | 3300025945 | Ga0207679_10067699 | Ga0207679_100676995 | 131 |
| 460 | 3300025945 | Ga0207679_11762215 | Ga0207679_117622151 | 131 |
| 461 | 3300025949 | Ga0207667_10000603 | Ga0207667_100006032 | 131 |
| 462 | 3300025949 | Ga0207667_10007486 | Ga0207667_1000748615 | 131 |
| 463 | 3300025949 | Ga0207667_10010624 | Ga0207667_1001062410 | 131 |
| 464 | 3300025949 | Ga0207667_10446882 | Ga0207667_104468822 | 131 |
| 465 | 3300025949 | Ga0207667_11242090 | Ga0207667_112420901 | 131 |
| 466 | 3300025960 | Ga0207651_10004393 | Ga0207651_100043936 | 131 |
| 467 | 3300025960 | Ga0207651_10014814 | Ga0207651_100148142 | 131 |
| 468 | 3300025960 | Ga0207651_10024827 | Ga0207651_100248273 | 131 |
| 469 | 3300025960 | Ga0207651_10451071 | Ga0207651_104510713 | 131 |
| 470 | 3300025960 | Ga0207651_11023146 | Ga0207651_110231462 | 131 |
| 471 | 3300025960 | Ga0207651_11151170 | Ga0207651_111511702 | 131 |
| 472 | 3300025961 | Ga0207712_10269352 | Ga0207712_102693522 | 131 |
| 473 | 3300025961 | Ga0207712_11890913 | Ga0207712_118909131 | 131 |
| 474 | 3300025972 | Ga0207668_10000050 | Ga0207668_10000050110 | 131 |
| 475 | 3300025972 | Ga0207668_10006477 | Ga0207668_100064776 | 131 |
| 476 | 3300025972 | Ga0207668_10230583 | Ga0207668_102305833 | 131 |
| 477 | 3300025981 | Ga0207640_10000849 | Ga0207640_1000084915 | 131 |
| 478 | 3300025981 | Ga0207640_10048450 | Ga0207640_100484503 | 131 |
| 479 | 3300025981 | Ga0207640_10124633 | Ga0207640_101246332 | 131 |
| 480 | 3300025981 | Ga0207640_10280024 | Ga0207640_102800241 | 131 |
| 481 | 3300025981 | Ga0207640_10597310 | Ga0207640_105973102 | 131 |
| 482 | 3300025981 | Ga0207640_11996386 | Ga0207640_119963861 | 131 |
| 483 | 3300025986 | Ga0207658_10000453 | Ga0207658_1000045311 | 131 |
| 484 | 3300025986 | Ga0207658_10002786 | Ga0207658_100027865 | 131 |
| 485 | 3300025986 | Ga0207658_10013766 | Ga0207658_100137663 | 131 |
| 486 | 3300025986 | Ga0207658_10018210 | Ga0207658_100182104 | 131 |
| 487 | 3300025986 | Ga0207658_10112529 | Ga0207658_101125294 | 131 |
| 488 | 3300025986 | Ga0207658_10255372 | Ga0207658_102553722 | 131 |
| 489 | 3300025986 | Ga0207658_10393221 | Ga0207658_103932212 | 131 |
| 490 | 3300025986 | Ga0207658_10436661 | Ga0207658_104366612 | 131 |
| 491 | 3300025986 | Ga0207658_11361972 | Ga0207658_113619721 | 131 |
| 492 | 3300026023 | Ga0207677_10003889 | Ga0207677_100038893 | 131 |
| 493 | 3300026023 | Ga0207677_10505333 | Ga0207677_105053332 | 131 |
| 494 | 3300026023 | Ga0207677_11066296 | Ga0207677_110662961 | 131 |
| 495 | 3300026035 | Ga0207703_10202580 | Ga0207703_102025803 | 131 |
| 496 | 3300026035 | Ga0207703_10518864 | Ga0207703_105188642 | 131 |
| 497 | 3300026035 | Ga0207703_10536251 | Ga0207703_105362512 | 131 |
| 498 | 3300026041 | Ga0207639_10028229 | Ga0207639_100282292 | 131 |
| 499 | 3300026041 | Ga0207639_10092070 | Ga0207639_100920705 | 131 |
| 500 | 3300026041 | Ga0207639_10205450 | Ga0207639_102054503 | 131 |
| 501 | 3300026041 | Ga0207639_10245146 | Ga0207639_102451462 | 131 |
| 502 | 3300026041 | Ga0207639_10249195 | Ga0207639_102491952 | 131 |
| 503 | 3300026041 | Ga0207639_10363808 | Ga0207639_103638082 | 131 |
| 504 | 3300026041 | Ga0207639_10961805 | Ga0207639_109618052 | 131 |
| 505 | 3300026041 | Ga0207639_11759584 | Ga0207639_117595841 | 131 |
| 506 | 3300026067 | Ga0207678_10027360 | Ga0207678_100273606 | 131 |
| 507 | 3300026067 | Ga0207678_10055329 | Ga0207678_100553292 | 131 |
| 508 | 3300026067 | Ga0207678_10156283 | Ga0207678_101562831 | 131 |
| 509 | 3300026067 | Ga0207678_10278998 | Ga0207678_102789982 | 131 |
| 510 | 3300026067 | Ga0207678_10320777 | Ga0207678_103207772 | 131 |
| 511 | 3300026067 | Ga0207678_10332886 | Ga0207678_103328862 | 131 |
| 512 | 3300026067 | Ga0207678_10401866 | Ga0207678_104018662 | 131 |
| 513 | 3300026067 | Ga0207678_10759924 | Ga0207678_107599242 | 131 |
| 514 | 3300026067 | Ga0207678_11804206 | Ga0207678_118042062 | 131 |
| 515 | 3300026078 | Ga0207702_10072998 | Ga0207702_100729982 | 131 |
| 516 | 3300026078 | Ga0207702_10894069 | Ga0207702_108940692 | 131 |
| 517 | 3300026078 | Ga0207702_11033197 | Ga0207702_110331972 | 131 |
| 518 | 3300026088 | Ga0207641_10000205 | Ga0207641_1000020545 | 131 |
| 519 | 3300026088 | Ga0207641_10004210 | Ga0207641_100042106 | 131 |
| 520 | 3300026088 | Ga0207641_10020495 | Ga0207641_100204954 | 131 |
| 521 | 3300026088 | Ga0207641_10039788 | Ga0207641_100397883 | 131 |
| 522 | 3300026088 | Ga0207641_10318857 | Ga0207641_103188572 | 131 |
| 523 | 3300026089 | Ga0207648_10000222 | Ga0207648_1000022235 | 131 |
| 524 | 3300026089 | Ga0207648_10000477 | Ga0207648_1000047748 | 131 |
| 525 | 3300026089 | Ga0207648_10406247 | Ga0207648_104062471 | 131 |
| 526 | 3300026089 | Ga0207648_10699294 | Ga0207648_106992942 | 131 |
| 527 | 3300026095 | Ga0207676_10000702 | Ga0207676_1000070225 | 131 |
| 528 | 3300026095 | Ga0207676_10000878 | Ga0207676_1000087824 | 131 |
| 529 | 3300026095 | Ga0207676_10004741 | Ga0207676_100047412 | 131 |
| 530 | 3300026095 | Ga0207676_10030670 | Ga0207676_100306704 | 131 |
| 531 | 3300026095 | Ga0207676_10041510 | Ga0207676_100415104 | 131 |
| 532 | 3300026095 | Ga0207676_10719904 | Ga0207676_107199042 | 131 |
| 533 | 3300026116 | Ga0207674_10006997 | Ga0207674_1000699715 | 131 |
| 534 | 3300026116 | Ga0207674_10007144 | Ga0207674_1000714414 | 131 |
| 535 | 3300026116 | Ga0207674_10045072 | Ga0207674_100450722 | 131 |
| 536 | 3300026118 | Ga0207675_100017759 | Ga0207675_1000177596 | 131 |
| 537 | 3300026118 | Ga0207675_100634490 | Ga0207675_1006344902 | 131 |
| 538 | 3300026118 | Ga0207675_101092001 | Ga0207675_1010920011 | 131 |
| 539 | 3300026118 | Ga0207675_101435600 | Ga0207675_1014356001 | 131 |
| 540 | 3300026121 | Ga0207683_10518164 | Ga0207683_105181642 | 131 |
| 541 | 3300026121 | Ga0207683_10649869 | Ga0207683_106498692 | 131 |
| 542 | 3300026142 | Ga0207698_10019294 | Ga0207698_100192942 | 131 |
| 543 | 3300026142 | Ga0207698_10078028 | Ga0207698_100780283 | 131 |
| 544 | 3300026142 | Ga0207698_10093920 | Ga0207698_100939202 | 131 |
| 545 | 3300026142 | Ga0207698_10141609 | Ga0207698_101416093 | 131 |
| 546 | 3300026142 | Ga0207698_10416833 | Ga0207698_104168332 | 131 |
| 547 | 3300026142 | Ga0207698_10575268 | Ga0207698_105752682 | 131 |
| 548 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009620 | 131 |
| 549 | 3300028379 | Ga0268266_10001084 | Ga0268266_1000108414 | 131 |
| 550 | 3300028379 | Ga0268266_10898387 | Ga0268266_108983872 | 131 |
| 551 | 3300028379 | Ga0268266_11175193 | Ga0268266_111751932 | 131 |
| 552 | 3300028380 | Ga0268265_10000149 | Ga0268265_1000014956 | 131 |
| 553 | 3300028380 | Ga0268265_10002738 | Ga0268265_100027383 | 131 |
| 554 | 3300028380 | Ga0268265_10012277 | Ga0268265_100122772 | 131 |
| 555 | 3300028380 | Ga0268265_10021229 | Ga0268265_100212292 | 131 |
| 556 | 3300028380 | Ga0268265_10094838 | Ga0268265_100948382 | 131 |
| 557 | 3300028380 | Ga0268265_10573781 | Ga0268265_105737812 | 131 |
| 558 | 3300028381 | Ga0268264_10004932 | Ga0268264_100049326 | 131 |
| 559 | 3300028381 | Ga0268264_10012724 | Ga0268264_1001272410 | 131 |
| 560 | 3300028381 | Ga0268264_10054777 | Ga0268264_100547774 | 131 |
| 561 | 3300028381 | Ga0268264_10136528 | Ga0268264_101365282 | 131 |
| 562 | 3300028381 | Ga0268264_10345616 | Ga0268264_103456162 | 131 |
| 563 | 3300028381 | Ga0268264_10408759 | Ga0268264_104087592 | 131 |
| 564 | 3300031456 | Ga0307513_10136335 | Ga0307513_101363352 | 131 |
| 565 | 3300031548 | Ga0307408_100007319 | Ga0307408_1000073194 | 131 |
| 566 | 3300031548 | Ga0307408_100090381 | Ga0307408_1000903812 | 131 |
| 567 | 3300031548 | Ga0307408_100122842 | Ga0307408_1001228423 | 131 |
| 568 | 3300031548 | Ga0307408_101116847 | Ga0307408_1011168471 | 131 |
| 569 | 3300031731 | Ga0307405_10540024 | Ga0307405_105400241 | 131 |
| 570 | 3300031824 | Ga0307413_10011502 | Ga0307413_100115023 | 131 |
| 571 | 3300031824 | Ga0307413_10021142 | Ga0307413_100211423 | 131 |
| 572 | 3300031824 | Ga0307413_10054220 | Ga0307413_100542202 | 131 |
| 573 | 3300031824 | Ga0307413_10624651 | Ga0307413_106246512 | 131 |
| 574 | 3300031824 | Ga0307413_11728035 | Ga0307413_117280352 | 131 |
| 575 | 3300031852 | Ga0307410_10000294 | Ga0307410_1000029420 | 131 |
| 576 | 3300031852 | Ga0307410_10031350 | Ga0307410_100313504 | 131 |
| 577 | 3300031852 | Ga0307410_10127667 | Ga0307410_101276672 | 131 |
| 578 | 3300031852 | Ga0307410_10336432 | Ga0307410_103364322 | 131 |
| 579 | 3300031852 | Ga0307410_10539211 | Ga0307410_105392111 | 131 |
| 580 | 3300031852 | Ga0307410_10736831 | Ga0307410_107368311 | 131 |
| 581 | 3300031852 | Ga0307410_11713883 | Ga0307410_117138832 | 131 |
| 582 | 3300031901 | Ga0307406_10026936 | Ga0307406_100269363 | 131 |
| 583 | 3300031901 | Ga0307406_11346552 | Ga0307406_113465521 | 131 |
| 584 | 3300031903 | Ga0307407_10153128 | Ga0307407_101531282 | 131 |
| 585 | 3300031903 | Ga0307407_11052616 | Ga0307407_110526161 | 131 |
| 586 | 3300031911 | Ga0307412_10104276 | Ga0307412_101042765 | 131 |
| 587 | 3300031995 | Ga0307409_100004079 | Ga0307409_1000040793 | 131 |
| 588 | 3300031995 | Ga0307409_100023780 | Ga0307409_1000237802 | 131 |
| 589 | 3300031995 | Ga0307409_100034240 | Ga0307409_1000342402 | 131 |
| 590 | 3300031995 | Ga0307409_100124178 | Ga0307409_1001241782 | 131 |
| 591 | 3300031995 | Ga0307409_100185104 | Ga0307409_1001851045 | 131 |
| 592 | 3300031995 | Ga0307409_102592124 | Ga0307409_1025921242 | 131 |
| 593 | 3300032002 | Ga0307416_100008181 | Ga0307416_1000081812 | 131 |
| 594 | 3300032002 | Ga0307416_100015063 | Ga0307416_1000150632 | 131 |
| 595 | 3300032002 | Ga0307416_100776354 | Ga0307416_1007763541 | 131 |
| 596 | 3300032004 | Ga0307414_10001887 | Ga0307414_100018873 | 131 |
| 597 | 3300032004 | Ga0307414_10002479 | Ga0307414_100024794 | 131 |
| 598 | 3300032004 | Ga0307414_10037950 | Ga0307414_100379506 | 131 |
| 599 | 3300032004 | Ga0307414_10126072 | Ga0307414_101260721 | 131 |
| 600 | 3300032004 | Ga0307414_11231579 | Ga0307414_112315791 | 131 |
| 601 | 3300032005 | Ga0307411_10003224 | Ga0307411_100032244 | 131 |
| 602 | 3300032005 | Ga0307411_10010236 | Ga0307411_100102363 | 131 |
| 603 | 3300032005 | Ga0307411_10031850 | Ga0307411_100318502 | 131 |
| 604 | 3300032005 | Ga0307411_10519482 | Ga0307411_105194822 | 131 |
| 605 | 3300032005 | Ga0307411_10618040 | Ga0307411_106180402 | 131 |
| 606 | 3300032005 | Ga0307411_11808158 | Ga0307411_118081581 | 131 |
| 607 | 3300032126 | Ga0307415_100001215 | Ga0307415_1000012155 | 131 |
| 608 | 3300032126 | Ga0307415_100064778 | Ga0307415_1000647782 | 131 |
| 609 | 3300032126 | Ga0307415_100862530 | Ga0307415_1008625302 | 131 |
| 610 | 3300035691 | Ga0373931_0435445 | Ga0373931_0435445_71_466 | 131 |
| 611 | 3300037312 | Ga0395899_0047184 | Ga0395899_0047184_1236_1631 | 131 |
| 612 | 3300037312 | Ga0395899_0074345 | Ga0395899_0074345_932_1327 | 131 |
| 613 | 3300037312 | Ga0395899_0098646 | Ga0395899_0098646_1698_2099 | 131 |
| 614 | 3300037312 | Ga0395899_0128456 | Ga0395899_0128456_815_1210 | 131 |
| 615 | 3300037312 | Ga0395899_0166143 | Ga0395899_0166143_621_1016 | 131 |
| 616 | 3300037418 | Ga0395900_0052135 | Ga0395900_0052135_2893_3288 | 131 |
| 617 | 3300037418 | Ga0395900_0079130 | Ga0395900_0079130_1332_1727 | 131 |
| 618 | 3300037418 | Ga0395900_0099438 | Ga0395900_0099438_401_796 | 131 |
| 619 | 3300037418 | Ga0395900_0245655 | Ga0395900_0245655_833_1228 | 131 |
| 620 | 3300037418 | Ga0395900_0314478 | Ga0395900_0314478_440_835 | 131 |
| 621 | 3300037418 | Ga0395900_0417574 | Ga0395900_0417574_270_665 | 131 |
| 622 | 3300037418 | Ga0395900_0572578 | Ga0395900_0572578_556_951 | 131 |
| 623 | 3300037418 | Ga0395900_0602294 | Ga0395900_0602294_324_719 | 131 |
| 624 | 3300037418 | Ga0395900_0622435 | Ga0395900_0622435_278_673 | 131 |
| 625 | 3300037418 | Ga0395900_0654002 | Ga0395900_0654002_245_640 | 131 |
| 626 | 3300037418 | Ga0395900_1444797 | Ga0395900_1444797_100_495 | 131 |
| 627 | 3300037466 | Ga0395898_0124483 | Ga0395898_0124483_146_541 | 131 |
| 628 | 3300037466 | Ga0395898_0236923 | Ga0395898_0236923_507_902 | 131 |
| 629 | 3300037466 | Ga0395898_0247117 | Ga0395898_0247117_278_673 | 131 |
| 630 | 3300037466 | Ga0395898_1384655 | Ga0395898_1384655_140_535 | 131 |
| 631 | 3300037471 | Ga0395905_0007984 | Ga0395905_0007984_2452_2847 | 131 |
| 632 | 3300037471 | Ga0395905_0012758 | Ga0395905_0012758_2097_2492 | 131 |
| 633 | 3300037471 | Ga0395905_0041636 | Ga0395905_0041636_1577_1972 | 131 |
| 634 | 3300037471 | Ga0395905_0042251 | Ga0395905_0042251_2355_2750 | 131 |
| 635 | 3300037471 | Ga0395905_0085792 | Ga0395905_0085792_640_1035 | 131 |
| 636 | 3300037471 | Ga0395905_0091148 | Ga0395905_0091148_1594_1989 | 131 |
| 637 | 3300037471 | Ga0395905_0100758 | Ga0395905_0100758_200_595 | 131 |
| 638 | 3300037471 | Ga0395905_0158392 | Ga0395905_0158392_541_936 | 131 |
| 639 | 3300037471 | Ga0395905_0199182 | Ga0395905_0199182_502_897 | 131 |
| 640 | 3300037471 | Ga0395905_0315488 | Ga0395905_0315488_965_1360 | 131 |
| 641 | 3300037471 | Ga0395905_0345006 | Ga0395905_0345006_65_460 | 131 |
| 642 | 3300037471 | Ga0395905_0617162 | Ga0395905_0617162_266_661 | 131 |
| 643 | 3300037471 | Ga0395905_0894553 | Ga0395905_0894553_264_659 | 131 |
| 644 | 3300037471 | Ga0395905_1684179 | Ga0395905_1684179_130_525 | 131 |
| 645 | 3300038443 | Ga0395901_0045185 | Ga0395901_0045185_3573_3968 | 131 |
| 646 | 3300038443 | Ga0395901_0052588 | Ga0395901_0052588_2127_2522 | 131 |
| 647 | 3300038443 | Ga0395901_0055707 | Ga0395901_0055707_3036_3431 | 131 |
| 648 | 3300038443 | Ga0395901_0110501 | Ga0395901_0110501_1881_2276 | 131 |
| 649 | 3300038443 | Ga0395901_0317203 | Ga0395901_0317203_851_1246 | 131 |
| 650 | 3300038443 | Ga0395901_1742331 | Ga0395901_1742331_21_416 | 131 |
| 651 | 3300038443 | Ga0395901_2009600 | Ga0395901_2009600_60_455 | 131 |
| 652 | 3300039437 | Ga0436365_0616364 | Ga0436365_0616364_400_795 | 131 |
| 653 | 3300044656 | Ga0466969_0010103 | Ga0466969_0010103_1911_2306 | 131 |
| 654 | 3300044658 | Ga0466972_0122315 | Ga0466972_0122315_703_1146 | 131 |
| 655 | 3300044694 | Ga0466963_0023577 | Ga0466963_0023577_635_1030 | 131 |
| 656 | 3300044694 | Ga0466963_0518154 | Ga0466963_0518154_400_795 | 131 |
| 657 | 3300044694 | Ga0466963_0964393 | Ga0466963_0964393_160_555 | 131 |
| 658 | 3300044765 | Ga0466970_0276733 | Ga0466970_0276733_463_906 | 131 |
| 659 | 3300044842 | Ga0466957_0713726 | Ga0466957_0713726_35_430 | 131 |
| 660 | 3300045049 | Ga0466959_0284970 | Ga0466959_0284970_103_498 | 131 |
| 661 | 3300045051 | Ga0451576_2664736 | Ga0451576_2664736_49_444 | 131 |
| 662 | 3300045836 | Ga0466958_0044797 | Ga0466958_0044797_1814_2209 | 131 |
| 663 | 3300045976 | Ga0466967_0121344 | Ga0466967_0121344_757_1170 | 131 |
| 664 | 3300045976 | Ga0466967_0360583 | Ga0466967_0360583_76_471 | 131 |
| 665 | 3300045976 | Ga0466967_1294656 | Ga0466967_1294656_34_429 | 131 |
| 666 | 3300045976 | Ga0466967_2050601 | Ga0466967_2050601_131_526 | 131 |
| 667 | 3300046452 | Ga0495617_083767 | Ga0495617_083767_493_894 | 131 |
| 668 | 3300046459 | Ga0495629_0255686 | Ga0495629_0255686_67_462 | 131 |
| 669 | 3300046460 | Ga0495638_0080447 | Ga0495638_0080447_441_908 | 131 |
| 670 | 3300046474 | Ga0495605_0247781 | Ga0495605_0247781_22_417 | 131 |
| 671 | 3300046557 | Ga0495622_0016233 | Ga0495622_0016233_2075_2476 | 131 |
| 672 | 3300046616 | Ga0495668_0038263 | Ga0495668_0038263_169_564 | 131 |
| 673 | 3300046616 | Ga0495668_0042044 | Ga0495668_0042044_1277_1744 | 131 |
| 674 | 3300046616 | Ga0495668_0151708 | Ga0495668_0151708_231_626 | 131 |
| 675 | 3300046648 | Ga0495611_0141707 | Ga0495611_0141707_570_1037 | 131 |
| 676 | 3300046660 | Ga0495625_0013331 | Ga0495625_0013331_4606_5073 | 131 |
| 677 | 3300046660 | Ga0495625_0116964 | Ga0495625_0116964_242_637 | 131 |
| 678 | 3300046660 | Ga0495625_0241179 | Ga0495625_0241179_735_1139 | 131 |
| 679 | 3300046660 | Ga0495625_0445590 | Ga0495625_0445590_101_502 | 131 |
| 680 | 3300046674 | Ga0495588_0257948 | Ga0495588_0257948_323_718 | 131 |
| 681 | 3300046684 | Ga0495669_0059532 | Ga0495669_0059532_775_1170 | 131 |
| 682 | 3300046684 | Ga0495669_0358940 | Ga0495669_0358940_108_503 | 131 |
| 683 | 3300047445 | Ga0495677_0096589 | Ga0495677_0096589_504_899 | 131 |
| 684 | 3300048903 | Ga0496100_0115291 | Ga0496100_0115291_712_1107 | 131 |
| 685 | 3300048904 | Ga0496101_0265240 | Ga0496101_0265240_83_478 | 131 |
| 686 | 3300048904 | Ga0496101_0299489 | Ga0496101_0299489_12_407 | 131 |
| 687 | 3300048904 | Ga0496101_0601246 | Ga0496101_0601246_184_579 | 131 |
| 688 | 3300048905 | Ga0496102_0883830 | Ga0496102_0883830_192_587 | 131 |
| 689 | 3300048906 | Ga0496103_0702866 | Ga0496103_0702866_163_558 | 131 |
| 690 | 3300048909 | Ga0496106_0325797 | Ga0496106_0325797_186_581 | 131 |
| 691 | 3300048910 | Ga0496107_0074078 | Ga0496107_0074078_883_1278 | 131 |
| 692 | 3300048910 | Ga0496107_0133434 | Ga0496107_0133434_22_417 | 131 |
| 693 | 3300048910 | Ga0496107_0219518 | Ga0496107_0219518_48_443 | 131 |
| 694 | 3300048910 | Ga0496107_0319613 | Ga0496107_0319613_674_1069 | 131 |
| 695 | 3300048910 | Ga0496107_0671866 | Ga0496107_0671866_212_607 | 131 |
| 696 | 3300048911 | Ga0496108_0147581 | Ga0496108_0147581_1180_1575 | 131 |
| 697 | 3300048912 | Ga0496109_0384718 | Ga0496109_0384718_859_1254 | 131 |
| 698 | 3300048912 | Ga0496109_1042603 | Ga0496109_1042603_216_611 | 131 |
| 699 | 3300048914 | Ga0496111_0347342 | Ga0496111_0347342_212_607 | 131 |
| 700 | 3300048915 | Ga0496112_0021492 | Ga0496112_0021492_1264_1659 | 131 |
| 701 | 3300048915 | Ga0496112_0231321 | Ga0496112_0231321_107_502 | 131 |
| 702 | 3300048915 | Ga0496112_0695931 | Ga0496112_0695931_401_796 | 131 |
| 703 | 3300048916 | Ga0496113_0031718 | Ga0496113_0031718_3083_3478 | 131 |
| 704 | 3300048917 | Ga0496114_0012689 | Ga0496114_0012689_679_1074 | 131 |
| 705 | 3300048917 | Ga0496114_0761960 | Ga0496114_0761960_416_811 | 131 |
| 706 | 3300048918 | Ga0496115_0009567 | Ga0496115_0009567_428_823 | 131 |
| 707 | 3300048918 | Ga0496115_0304248 | Ga0496115_0304248_137_532 | 131 |
| 708 | 3300048927 | Ga0496124_0891598 | Ga0496124_0891598_105_506 | 131 |
| 709 | 3300049571 | Ga0501034_0625661 | Ga0501034_0625661_137_547 | 131 |
| 710 | 3300049573 | Ga0501037_0048103 | Ga0501037_0048103_431_826 | 131 |
| 711 | 3300049574 | Ga0501038_0016555 | Ga0501038_0016555_3391_3786 | 131 |
| 712 | 3300049575 | Ga0501039_0609705 | Ga0501039_0609705_177_572 | 131 |
| 713 | 3300049579 | Ga0501043_0031737 | Ga0501043_0031737_1191_1586 | 131 |
| 714 | 3300049580 | Ga0501046_0163598 | Ga0501046_0163598_549_944 | 131 |
| 715 | 3300049581 | Ga0501047_0030675 | Ga0501047_0030675_319_714 | 131 |
| 716 | 3300049583 | Ga0501067_0047296 | Ga0501067_0047296_252_647 | 131 |
| 717 | 3300049584 | Ga0501068_0251906 | Ga0501068_0251906_37_432 | 131 |
| 718 | 3300049589 | Ga0501073_0013519 | Ga0501073_0013519_2449_2844 | 131 |
| 719 | 3300049589 | Ga0501073_0393653 | Ga0501073_0393653_64_459 | 131 |
| 720 | 3300049590 | Ga0501074_0106547 | Ga0501074_0106547_403_798 | 131 |
| 721 | 3300049591 | Ga0501075_1232063 | Ga0501075_1232063_145_540 | 131 |
| 722 | 3300049674 | Ga0501242_051722 | Ga0501242_051722_23_418 | 131 |
| 723 | 3300049683 | Ga0501253_165979 | Ga0501253_165979_121_516 | 131 |
| 724 | 3300049741 | Ga0501079_0274399 | Ga0501079_0274399_64_459 | 131 |
| 725 | 3300049741 | Ga0501079_1139578 | Ga0501079_1139578_203_598 | 131 |
| 726 | 3300049742 | Ga0501080_0025952 | Ga0501080_0025952_2641_3036 | 131 |
| 727 | 3300049742 | Ga0501080_0043551 | Ga0501080_0043551_2367_2762 | 131 |
| 728 | 3300049744 | Ga0501083_0018333 | Ga0501083_0018333_850_1245 | 131 |
| 729 | 3300049758 | Ga0501241_007349 | Ga0501241_007349_1564_1971 | 131 |
| 730 | 3300049759 | Ga0501262_081513 | Ga0501262_081513_60_455 | 131 |
| 731 | 3300049765 | Ga0501268_176367 | Ga0501268_176367_47_442 | 131 |
| 732 | 3300049822 | Ga0501035_0541344 | Ga0501035_0541344_310_705 | 131 |
| 733 | 3300049823 | Ga0501044_0044001 | Ga0501044_0044001_2380_2775 | 131 |
| 734 | 3300049850 | Ga0501204_040309 | Ga0501204_040309_149_544 | 131 |
| 735 | 3300050508 | nmdc:mga09592_295816_c1 | nmdc:mga09592_295816_c1_201_596 | 131 |
| 736 | 3300053087 | Ga0500643_029458 | Ga0500643_029458_27_494 | 131 |
| 737 | 3300053087 | Ga0500643_043433 | Ga0500643_043433_85_552 | 131 |
| 738 | 3300053088 | Ga0500644_0053585 | Ga0500644_0053585_106_510 | 131 |
| 739 | 3300053104 | Ga0500556_0000144 | Ga0500556_0000144_48856_49323 | 131 |
| 740 | 3300053122 | Ga0500608_186366 | Ga0500608_186366_457_858 | 131 |
| 741 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_351318_351755 | 131 |
| 742 | 3300053134 | Ga0500658_0000147 | Ga0500658_0000147_6729_7124 | 131 |
| 743 | 3300053136 | Ga0500559_0069243 | Ga0500559_0069243_664_1065 | 131 |
| 744 | 3300053155 | Ga0500620_005699 | Ga0500620_005699_2094_2489 | 131 |
| 745 | 3300053730 | Ga0500645_000414 | Ga0500645_000414_19329_19736 | 131 |
| 746 | 3300054114 | Ga0501084_0581921 | Ga0501084_0581921_163_558 | 131 |
| 747 | 3300060353 | Ga0501082_0130738 | Ga0501082_0130738_419_814 | 131 |
| 748 | 3300061719 | Ga0466962_0083666 | Ga0466962_0083666_288_683 | 131 |
| 749 | 3300061719 | Ga0466962_0508108 | Ga0466962_0508108_172_567 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ntb-assembly1.cif.gz_A | mus musculus ltc4 synthase in gsh complex form | 0.8427 | 3 | 131 |
| 4j7t-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.8298 | 3 | 130 |
| 6r7d-assembly3.cif.gz_H | crystal structure of ltc4s in complex with az13690257 | 0.7999 | 3 | 130 |
| 3hkk-assembly1.cif.gz_A | structure of human leukotriene c4 synthase in complex with glutathione sulfonate | 0.7924 | 3 | 130 |
| 3leo-assembly1.cif.gz_A | structure of human leukotriene c4 synthase mutant r31q in complex with glutathione | 0.791 | 3 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1A5Y1_7_139_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8427 | 3 | 130 | 1.20.120.550 |
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8263 | 3 | 128 | 1.20.120.550 |
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7922 | 3 | 128 | 1.20.120.550 |
| 3leoA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.791 | 3 | 130 | 1.20.120.550 |
| 4jrzA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7907 | 3 | 130 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836P0J2-F1-model_v4 | Membrane protein | 0.9679 | 47 | 131 |
GO:0016020
|
| AF-M5CKQ2-F1-model_v4 | deleted | 0.9548 | 1 | 127 |
|
| AF-A0A149QFF4-F1-model_v4 | Membrane protein | 0.9546 | 1 | 128 |
GO:0016020
|
| AF-A0A246HHW7-F1-model_v4 | MAPEG family protein | 0.9536 | 1 | 128 |
GO:0016020
|
| AF-A0A7V7PLX7-F1-model_v4 | MAPEG family protein | 0.9517 | 1 | 127 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar