F479018

General Info

Members Datasets Scaffolds Average Seq Length
749 251 748 131

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0080447|Ga0495638_0080447_441_908
Length 155
Sequence LAPRGAARILTRETPSPEDAMPLELKILAWGCVLALVHILAASHVRTRQFGIAWNTGPRDTDPAAPAPIVGRLLRAQANYFETFPIAAAALLIDGLFPLSSALTQLGAALWLGARIIYLPLYAAGVPVLRSLVWLVSLLGIALLLWPALWASLVA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
225 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
230 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
231 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
245 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.13
Rhizoplane 3.2
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10020127 3300001979 Bacteria 2335
2 JGI24740J21852_10034420 3300001979 Bacteria 1596
3 JGI24739J22299_10000453 3300001989 Bacteria 14331
4 JGI24739J22299_10027197 3300001989 Unclassified 2001
5 JGI24737J22298_10000021 3300001990 Bacteria 45543
6 JGI24737J22298_10056449 3300001990 Bacteria 1186
7 JGI24735J21928_10017771 3300002067 Bacteria 2198
8 JGI24748J21848_1024486 3300002074 Bacteria 735
9 JGI24738J21930_10000062 3300002075 Bacteria 22279
10 JGI24749J21850_1007519 3300002076 Bacteria 1519
11 JGI24035J26624_1005815 3300002126 Bacteria 1184
12 Ga0065712_10031930 3300005290 Bacteria 1229
13 Ga0070658_10034989 3300005327 Bacteria 4044
14 Ga0070658_10169474 3300005327 Bacteria 1834
15 Ga0070658_10410767 3300005327 Bacteria 1163
16 Ga0070658_10857287 3300005327 Bacteria 789
17 Ga0070658_11090690 3300005327 Bacteria 694
18 Ga0070658_11141804 3300005327 Bacteria 677
19 Ga0070658_11327575 3300005327 Unclassified 624
20 Ga0070676_10003504 3300005328 Bacteria 8192
21 Ga0070676_10011228 3300005328 Bacteria 4871
22 Ga0070676_10169095 3300005328 Bacteria 1412
23 Ga0070676_10218065 3300005328 Bacteria 1259
24 Ga0070683_101497744 3300005329 Bacteria 649
25 Ga0070683_101765478 3300005329 Bacteria 595
26 Ga0070690_100018652 3300005330 Bacteria 4194
27 Ga0070670_100010365 3300005331 Bacteria 7955
28 Ga0070670_100075676 3300005331 Bacteria 2892
29 Ga0070670_100197748 3300005331 Bacteria 1746
30 Ga0070670_100211938 3300005331 Bacteria 1684
31 Ga0070670_100301085 3300005331 Bacteria 1403
32 Ga0070677_10004566 3300005333 Bacteria 4525
33 Ga0070677_10061063 3300005333 Bacteria 1555
34 Ga0070677_10560965 3300005333 Bacteria 627
35 Ga0068869_100034193 3300005334 Bacteria 3594
36 Ga0068869_100071883 3300005334 Bacteria 2562
37 Ga0068869_100339175 3300005334 Bacteria 1223
38 Ga0070666_10049262 3300005335 Bacteria 2830
39 Ga0070666_10052157 3300005335 Bacteria 2756
40 Ga0070666_10162447 3300005335 Bacteria 1561
41 Ga0070666_10657553 3300005335 Bacteria 767
42 Ga0070680_100294940 3300005336 Bacteria 1374
43 Ga0070680_101054807 3300005336 Bacteria 702
44 Ga0070682_100123267 3300005337 Bacteria 1743
45 Ga0070682_100214281 3300005337 Bacteria 1367
46 Ga0068868_100000637 3300005338 Bacteria 23618
47 Ga0068868_101126191 3300005338 Bacteria 723
48 Ga0070660_100001821 3300005339 Bacteria 14639
49 Ga0070660_100002082 3300005339 Bacteria 13818
50 Ga0070660_100023740 3300005339 Bacteria 4544
51 Ga0070660_100152967 3300005339 Unclassified 1856
52 Ga0070660_100219149 3300005339 Bacteria 1546
53 Ga0070660_100387183 3300005339 Bacteria 1154
54 Ga0070660_100419199 3300005339 Bacteria 1108
55 Ga0070660_100429773 3300005339 Bacteria 1094
56 Ga0070660_100478065 3300005339 Bacteria 1035
57 Ga0070660_100542317 3300005339 Bacteria 970
58 Ga0070660_100973574 3300005339 Bacteria 716
59 Ga0070689_100009615 3300005340 Bacteria 6863
60 Ga0070689_100013741 3300005340 Bacteria 5865
61 Ga0070689_101226884 3300005340 Bacteria 674
62 Ga0070687_100216472 3300005343 Bacteria 1170
63 Ga0070661_100007377 3300005344 Bacteria 7580
64 Ga0070661_100031513 3300005344 Bacteria 3836
65 Ga0070661_100074768 3300005344 Bacteria 2495
66 Ga0070661_100109407 3300005344 Bacteria 2062
67 Ga0070661_100314557 3300005344 Bacteria 1222
68 Ga0070661_100342559 3300005344 Bacteria 1171
69 Ga0070661_100445614 3300005344 Bacteria 1029
70 Ga0070661_100514389 3300005344 Bacteria 959
71 Ga0070661_100795031 3300005344 Bacteria 776
72 Ga0070661_101052675 3300005344 Bacteria 676
73 Ga0070661_101105657 3300005344 Bacteria 660
74 Ga0070661_101334919 3300005344 Bacteria 602
75 Ga0070668_100005175 3300005347 Bacteria 9673
76 Ga0070668_100032860 3300005347 Bacteria 3949
77 Ga0070668_100359173 3300005347 Bacteria 1235
78 Ga0070668_101547510 3300005347 Bacteria 607
79 Ga0070669_100000009 3300005353 Bacteria 224683
80 Ga0070669_100000862 3300005353 Bacteria 22037
81 Ga0070669_100096778 3300005353 Bacteria 2221
82 Ga0070669_100118774 3300005353 Bacteria 2014
83 Ga0070669_100171760 3300005353 Bacteria 1690
84 Ga0070669_100199231 3300005353 Bacteria 1574
85 Ga0070675_100007443 3300005354 Bacteria 8456
86 Ga0070675_100047334 3300005354 Bacteria 3524
87 Ga0070675_100302676 3300005354 Bacteria 1409
88 Ga0070675_100858179 3300005354 Bacteria 831
89 Ga0070671_100001012 3300005355 Bacteria 20660
90 Ga0070671_100002229 3300005355 Bacteria 14965
91 Ga0070671_100076910 3300005355 Bacteria 2789
92 Ga0070671_100503647 3300005355 Bacteria 1042
93 Ga0070671_100732538 3300005355 Bacteria 859
94 Ga0070671_100772397 3300005355 Bacteria 836
95 Ga0070671_101167974 3300005355 Bacteria 677
96 Ga0070674_100001982 3300005356 Bacteria 11206
97 Ga0070674_100051087 3300005356 Bacteria 2848
98 Ga0070674_100139092 3300005356 Bacteria 1820
99 Ga0070674_100196996 3300005356 Bacteria 1553
100 Ga0070674_100330914 3300005356 Unclassified 1224
101 Ga0070673_100000209 3300005364 Bacteria 29078
102 Ga0070673_100057133 3300005364 Bacteria 3082
103 Ga0070673_100096310 3300005364 Bacteria 2428
104 Ga0070673_100161093 3300005364 Bacteria 1908
105 Ga0070673_100933179 3300005364 Bacteria 806
106 Ga0070673_100967289 3300005364 Bacteria 791
107 Ga0070659_100006023 3300005366 Bacteria 8743
108 Ga0070659_100007835 3300005366 Bacteria 7774
109 Ga0070659_100028371 3300005366 Bacteria 4322
110 Ga0070659_100323638 3300005366 Bacteria 1289
111 Ga0070659_100427468 3300005366 Bacteria 1121
112 Ga0070659_101220277 3300005366 Bacteria 665
113 Ga0070667_100004734 3300005367 Bacteria 11402
114 Ga0070667_100005313 3300005367 Bacteria 10759
115 Ga0070667_100090330 3300005367 Bacteria 2632
116 Ga0070667_100116585 3300005367 Bacteria 2319
117 Ga0070667_100264669 3300005367 Bacteria 1540
118 Ga0070667_100322181 3300005367 Bacteria 1395
119 Ga0070705_100765159 3300005440 Bacteria 765
120 Ga0070663_100013706 3300005455 Bacteria 5180
121 Ga0070663_100050307 3300005455 Bacteria 2963
122 Ga0070663_100094108 3300005455 Bacteria 2224
123 Ga0070663_100217564 3300005455 Bacteria 1498
124 Ga0070663_100237306 3300005455 Bacteria 1438
125 Ga0070663_100303531 3300005455 Bacteria 1279
126 Ga0070663_101003971 3300005455 Bacteria 726
127 Ga0070663_101017456 3300005455 Unclassified 721
128 Ga0070663_101026257 3300005455 Bacteria 718
129 Ga0070663_101370813 3300005455 Bacteria 625
130 Ga0070663_101525893 3300005455 Bacteria 594
131 Ga0070678_100089929 3300005456 Bacteria 2351
132 Ga0070678_100123475 3300005456 Bacteria 2046
133 Ga0070678_100197779 3300005456 Bacteria 1657
134 Ga0070662_100001955 3300005457 Bacteria 12662
135 Ga0070662_100044295 3300005457 Bacteria 3187
136 Ga0070662_100083028 3300005457 Bacteria 2390
137 Ga0070662_100255675 3300005457 Bacteria 1410
138 Ga0070662_100293262 3300005457 Bacteria 1319
139 Ga0070662_100346368 3300005457 Bacteria 1216
140 Ga0070662_100638120 3300005457 Bacteria 898
141 Ga0070662_100833426 3300005457 Bacteria 785
142 Ga0070662_101187810 3300005457 Bacteria 656
143 Ga0070681_10051638 3300005458 Bacteria 4101
144 Ga0070681_10246249 3300005458 Bacteria 1700
145 Ga0070681_11901214 3300005458 Unclassified 523
146 Ga0068867_100000633 3300005459 Bacteria 23213
147 Ga0068867_100011413 3300005459 Bacteria 6269
148 Ga0068867_100329452 3300005459 Bacteria 1268
149 Ga0068867_100401748 3300005459 Bacteria 1156
150 Ga0068867_101063450 3300005459 Bacteria 737
151 Ga0070685_10000225 3300005466 Bacteria 37151
152 Ga0070679_100000750 3300005530 Bacteria 28064
153 Ga0070679_100091968 3300005530 Bacteria 3021
154 Ga0070679_101202036 3300005530 Unclassified 703
155 Ga0070679_101246968 3300005530 Bacteria 689
156 Ga0070679_101472415 3300005530 Bacteria 627
157 Ga0070679_101551282 3300005530 Bacteria 610
158 Ga0068853_100002063 3300005539 Bacteria 14889
159 Ga0068853_100060675 3300005539 Bacteria 3269
160 Ga0068853_100342356 3300005539 Bacteria 1390
161 Ga0068853_100444925 3300005539 Unclassified 1218
162 Ga0068853_100621954 3300005539 Bacteria 1026
163 Ga0068853_100885472 3300005539 Bacteria 857
164 Ga0068853_101259303 3300005539 Bacteria 714
165 Ga0068853_101934244 3300005539 Bacteria 572
166 Ga0070672_100000770 3300005543 Bacteria 19069
167 Ga0070672_100012771 3300005543 Bacteria 5912
168 Ga0070672_100332309 3300005543 Bacteria 1293
169 Ga0070672_100743794 3300005543 Bacteria 860
170 Ga0070695_101420361 3300005545 Unclassified 576
171 Ga0070696_100054831 3300005546 Bacteria 2779
172 Ga0070693_100039946 3300005547 Unclassified 2631
173 Ga0070693_100369905 3300005547 Bacteria 986
174 Ga0070665_100000004 3300005548 Bacteria 785500
175 Ga0070665_100000590 3300005548 Bacteria 50563
176 Ga0070665_101003374 3300005548 Bacteria 847
177 Ga0070665_101415786 3300005548 Bacteria 704
178 Ga0068855_100039372 3300005563 Bacteria 5611
179 Ga0068855_100659183 3300005563 Unclassified 1123
180 Ga0068855_101588504 3300005563 Bacteria 669
181 Ga0070664_100002427 3300005564 Bacteria 14988
182 Ga0070664_100009081 3300005564 Bacteria 8067
183 Ga0070664_100010866 3300005564 Bacteria 7383
184 Ga0070664_100046060 3300005564 Bacteria 3683
185 Ga0070664_100183983 3300005564 Bacteria 1858
186 Ga0070664_100518830 3300005564 Bacteria 1100
187 Ga0068857_100004161 3300005577 Bacteria 12189
188 Ga0068857_100105577 3300005577 Bacteria 2529
189 Ga0068857_100150925 3300005577 Unclassified 2105
190 Ga0068857_100857248 3300005577 Bacteria 869
191 Ga0068857_101202536 3300005577 Bacteria 734
192 Ga0068857_101902702 3300005577 Bacteria 583
193 Ga0068854_100000614 3300005578 Bacteria 21116
194 Ga0068854_100068281 3300005578 Bacteria 2592
195 Ga0068854_100103296 3300005578 Bacteria 2139
196 Ga0068854_100337004 3300005578 Bacteria 1231
197 Ga0068854_100523947 3300005578 Bacteria 1001
198 Ga0068854_100724192 3300005578 Bacteria 861
199 Ga0068854_101022875 3300005578 Bacteria 733
200 Ga0068856_100057609 3300005614 Bacteria 3836
201 Ga0068856_100182730 3300005614 Bacteria 2111
202 Ga0068856_100801697 3300005614 Bacteria 961
203 Ga0068856_100850295 3300005614 Bacteria 931
204 Ga0068856_101015343 3300005614 Bacteria 848
205 Ga0070702_100102565 3300005615 Bacteria 1758
206 Ga0068852_100000804 3300005616 Bacteria 20664
207 Ga0068852_100039331 3300005616 Bacteria 3982
208 Ga0068852_100086339 3300005616 Bacteria 2797
209 Ga0068852_100086868 3300005616 Unclassified 2789
210 Ga0068852_100439777 3300005616 Bacteria 1289
211 Ga0068852_100463930 3300005616 Bacteria 1256
212 Ga0068852_100655564 3300005616 Bacteria 1057
213 Ga0068852_101059328 3300005616 Bacteria 830
214 Ga0068852_101280805 3300005616 Bacteria 755
215 Ga0068859_100000104 3300005617 Bacteria 78653
216 Ga0068859_100000478 3300005617 Bacteria 39430
217 Ga0068859_100022547 3300005617 Bacteria 6315
218 Ga0068859_100119080 3300005617 Unclassified 2706
219 Ga0068859_100362012 3300005617 Bacteria 1546
220 Ga0068859_100409780 3300005617 Bacteria 1451
221 Ga0068864_100000118 3300005618 Bacteria 77800
222 Ga0068864_100000174 3300005618 Bacteria 59338
223 Ga0068864_100017446 3300005618 Bacteria 5985
224 Ga0068864_100136248 3300005618 Bacteria 2211
225 Ga0068864_100756044 3300005618 Bacteria 953
226 Ga0068864_101332917 3300005618 Bacteria 718
227 Ga0068866_10754807 3300005718 Bacteria 672
228 Ga0068866_10957279 3300005718 Bacteria 606
229 Ga0068861_100001151 3300005719 Bacteria 16469
230 Ga0068861_100010621 3300005719 Bacteria 6394
231 Ga0068861_100481942 3300005719 Bacteria 1118
232 Ga0068861_102360272 3300005719 Unclassified 534
233 Ga0068851_10157421 3300005834 Unclassified 1246
234 Ga0068851_10299332 3300005834 Bacteria 924
235 Ga0068851_10300744 3300005834 Bacteria 922
236 Ga0068851_10375744 3300005834 Bacteria 832
237 Ga0068870_10184423 3300005840 Bacteria 1255
238 Ga0068863_100000152 3300005841 Bacteria 72823
239 Ga0068863_100004878 3300005841 Bacteria 13216
240 Ga0068863_100076008 3300005841 Bacteria 3177
241 Ga0068863_100208726 3300005841 Bacteria 1880
242 Ga0068863_100285525 3300005841 Bacteria 1599
243 Ga0068863_101763628 3300005841 Bacteria 629
244 Ga0068858_100028224 3300005842 Bacteria 5214
245 Ga0068858_100068281 3300005842 Bacteria 3294
246 Ga0068858_100283369 3300005842 Bacteria 1578
247 Ga0068860_100003157 3300005843 Bacteria 17012
248 Ga0068860_100005690 3300005843 Bacteria 12583
249 Ga0068860_100007725 3300005843 Bacteria 10751
250 Ga0068860_100341159 3300005843 Bacteria 1473
251 Ga0068860_100658460 3300005843 Bacteria 1055
252 Ga0068862_100000421 3300005844 Bacteria 45988
253 Ga0068862_100005596 3300005844 Bacteria 10498
254 Ga0068862_100026268 3300005844 Bacteria 4894
255 Ga0068862_100054895 3300005844 Bacteria 3412
256 Ga0068862_100149447 3300005844 Bacteria 2078
257 Ga0068862_100727452 3300005844 Bacteria 963
258 Ga0081539_10040175 3300005985 Bacteria 2749
259 Ga0097621_100013235 3300006237 Bacteria 6141
260 Ga0097621_100088606 3300006237 Bacteria 2586
261 Ga0068871_100135529 3300006358 Bacteria 2091
262 Ga0068871_100180491 3300006358 Bacteria 1814
263 Ga0068871_100468183 3300006358 Bacteria 1132
264 Ga0068865_100000240 3300006881 Bacteria 30384
265 Ga0097620_100000104 3300006931 Bacteria 78653
266 Ga0097620_100000478 3300006931 Bacteria 39430
267 Ga0097620_100022548 3300006931 Bacteria 6315
268 Ga0097620_100119090 3300006931 Unclassified 2706
269 Ga0097620_100361978 3300006931 Bacteria 1546
270 Ga0097620_100409763 3300006931 Bacteria 1451
271 Ga0105251_10405572 3300009011 Bacteria 627
272 Ga0105250_10017923 3300009092 Bacteria 2873
273 Ga0105240_10073297 3300009093 Bacteria 4228
274 Ga0105240_10745376 3300009093 Bacteria 1065
275 Ga0105245_10000300 3300009098 Bacteria 47446
276 Ga0105247_10006055 3300009101 Bacteria 7524
277 Ga0105247_10170804 3300009101 Bacteria 1445
278 Ga0114129_11975131 3300009147 Bacteria 706
279 Ga0105241_10022584 3300009174 Bacteria 4661
280 Ga0105242_11884389 3300009176 Bacteria 638
281 Ga0105248_10000295 3300009177 Bacteria 59247
282 Ga0105248_10002741 3300009177 Bacteria 19562
283 Ga0105248_10006633 3300009177 Bacteria 12692
284 Ga0105248_10014716 3300009177 Bacteria 8612
285 Ga0105248_10017802 3300009177 Bacteria 7840
286 Ga0105248_10390186 3300009177 Bacteria 1568
287 Ga0105248_10559403 3300009177 Bacteria 1290
288 Ga0105248_11151389 3300009177 Bacteria 877
289 Ga0105237_10950039 3300009545 Bacteria 866
290 Ga0105238_10049432 3300009551 Bacteria 4235
291 Ga0105238_10507330 3300009551 Bacteria 1208
292 Ga0105238_10981814 3300009551 Bacteria 865
293 Ga0105249_11261345 3300009553 Bacteria 810
294 Ga0105249_13262366 3300009553 Bacteria 522
295 Ga0105239_10044676 3300010375 Bacteria 4856
296 Ga0105239_11858988 3300010375 Bacteria 698
297 Ga0105246_10021355 3300011119 Bacteria 4166
298 Ga0105246_10647241 3300011119 Bacteria 920
299 Ga0157373_10006164 3300013100 Bacteria 8961
300 Ga0157373_10085912 3300013100 Bacteria 2217
301 Ga0157373_10278215 3300013100 Unclassified 1186
302 Ga0157373_10463670 3300013100 Bacteria 913
303 Ga0157371_10000677 3300013102 Bacteria 40414
304 Ga0157371_10424834 3300013102 Bacteria 975
305 Ga0157371_10441020 3300013102 Bacteria 956
306 Ga0157371_10754115 3300013102 Bacteria 731
307 Ga0157370_10115511 3300013104 Unclassified 2507
308 Ga0157370_10244964 3300013104 Bacteria 1658
309 Ga0157370_10748181 3300013104 Bacteria 891
310 Ga0157370_10855001 3300013104 Bacteria 826
311 Ga0157369_10391583 3300013105 Bacteria 1442
312 Ga0157374_11086772 3300013296 Bacteria 820
313 Ga0157378_10002011 3300013297 Bacteria 18196
314 Ga0157378_11188894 3300013297 Bacteria 802
315 Ga0163162_10045123 3300013306 Bacteria 4415
316 Ga0163162_10202482 3300013306 Bacteria 2114
317 Ga0157372_10045485 3300013307 Bacteria 4870
318 Ga0157372_10088817 3300013307 Bacteria 3510
319 Ga0157372_10754899 3300013307 Unclassified 1131
320 Ga0157372_11547760 3300013307 Bacteria 764
321 Ga0157375_10124625 3300013308 Bacteria 2690
322 Ga0157375_10499140 3300013308 Bacteria 1381
323 Ga0157375_11854929 3300013308 Bacteria 715
324 Ga0163163_10000882 3300014325 Bacteria 25516
325 Ga0163163_10400460 3300014325 Bacteria 1431
326 Ga0157380_10853842 3300014326 Bacteria 932
327 Ga0157377_10033043 3300014745 Bacteria 2821
328 Ga0157379_10009073 3300014968 Bacteria 8666
329 Ga0157379_10054102 3300014968 Bacteria 3587
330 Ga0163161_11058312 3300017792 Bacteria 695
331 Ga0213876_10010656 3300021384 Bacteria 4925
332 Ga0207673_1001669 3300025290 Bacteria 2454
333 Ga0207697_10000026 3300025315 Bacteria 52498
334 Ga0207697_10186033 3300025315 Bacteria 911
335 Ga0207697_10373337 3300025315 Bacteria 633
336 Ga0207656_10072117 3300025321 Bacteria 1537
337 Ga0207656_10494086 3300025321 Bacteria 621
338 Ga0207696_1048263 3300025711 Bacteria 1224
339 Ga0207713_1166571 3300025735 Unclassified 698
340 Ga0207713_1196393 3300025735 Bacteria 621
341 Ga0207682_10009951 3300025893 Bacteria 3735
342 Ga0207682_10100070 3300025893 Bacteria 1266
343 Ga0207642_10147168 3300025899 Bacteria 1249
344 Ga0207710_10018640 3300025900 Bacteria 2954
345 Ga0207710_10079543 3300025900 Bacteria 1518
346 Ga0207688_10000055 3300025901 Bacteria 41067
347 Ga0207688_10011889 3300025901 Bacteria 4736
348 Ga0207680_10036791 3300025903 Bacteria 2821
349 Ga0207680_10680949 3300025903 Bacteria 737
350 Ga0207647_10006361 3300025904 Bacteria 8588
351 Ga0207647_10222636 3300025904 Bacteria 1087
352 Ga0207645_10001667 3300025907 Bacteria 18069
353 Ga0207645_10006444 3300025907 Bacteria 8421
354 Ga0207645_10086464 3300025907 Bacteria 2014
355 Ga0207645_10115763 3300025907 Bacteria 1738
356 Ga0207643_10166873 3300025908 Bacteria 1327
357 Ga0207705_10021828 3300025909 Bacteria 4567
358 Ga0207705_10105183 3300025909 Bacteria 2080
359 Ga0207705_10382308 3300025909 Bacteria 1087
360 Ga0207705_10388709 3300025909 Bacteria 1078
361 Ga0207705_10645806 3300025909 Bacteria 823
362 Ga0207705_10684759 3300025909 Bacteria 797
363 Ga0207705_10737343 3300025909 Bacteria 765
364 Ga0207705_11138284 3300025909 Bacteria 600
365 Ga0207654_10477819 3300025911 Bacteria 877
366 Ga0207707_10016712 3300025912 Bacteria 6395
367 Ga0207707_10713216 3300025912 Bacteria 841
368 Ga0207695_10009319 3300025913 Bacteria 12153
369 Ga0207695_10942521 3300025913 Unclassified 743
370 Ga0207660_10007761 3300025917 Bacteria 6947
371 Ga0207660_10883860 3300025917 Bacteria 729
372 Ga0207660_11260820 3300025917 Bacteria 601
373 Ga0207662_10242073 3300025918 Bacteria 1181
374 Ga0207657_10001574 3300025919 Bacteria 24502
375 Ga0207657_10003629 3300025919 Bacteria 16433
376 Ga0207657_10077813 3300025919 Bacteria 2795
377 Ga0207657_10078938 3300025919 Bacteria 2770
378 Ga0207657_10088943 3300025919 Bacteria 2581
379 Ga0207657_10284189 3300025919 Bacteria 1313
380 Ga0207657_10393461 3300025919 Bacteria 1090
381 Ga0207657_10496323 3300025919 Bacteria 956
382 Ga0207657_10685154 3300025919 Bacteria 797
383 Ga0207657_10852268 3300025919 Unclassified 703
384 Ga0207657_10867747 3300025919 Bacteria 696
385 Ga0207649_10031780 3300025920 Bacteria 3141
386 Ga0207649_10063331 3300025920 Bacteria 2334
387 Ga0207649_10116587 3300025920 Unclassified 1794
388 Ga0207649_10117121 3300025920 Bacteria 1790
389 Ga0207649_10200440 3300025920 Bacteria 1409
390 Ga0207649_10533279 3300025920 Bacteria 896
391 Ga0207649_10672194 3300025920 Bacteria 802
392 Ga0207649_10986334 3300025920 Bacteria 663
393 Ga0207652_10000001 3300025921 Bacteria 1006643
394 Ga0207681_10000020 3300025923 Bacteria 240498
395 Ga0207681_10001514 3300025923 Bacteria 14993
396 Ga0207681_10005327 3300025923 Bacteria 7903
397 Ga0207681_10121455 3300025923 Bacteria 1916
398 Ga0207681_10419369 3300025923 Bacteria 1084
399 Ga0207694_10225304 3300025924 Bacteria 1530
400 Ga0207694_10761855 3300025924 Unclassified 817
401 Ga0207650_10044004 3300025925 Bacteria 3280
402 Ga0207650_10066692 3300025925 Bacteria 2699
403 Ga0207650_10143822 3300025925 Bacteria 1877
404 Ga0207650_11297963 3300025925 Unclassified 620
405 Ga0207659_10028105 3300025926 Bacteria 3818
406 Ga0207659_10287965 3300025926 Bacteria 1345
407 Ga0207687_10003666 3300025927 Bacteria 10346
408 Ga0207644_10000052 3300025931 Bacteria 91473
409 Ga0207644_10059162 3300025931 Bacteria 2771
410 Ga0207644_10063446 3300025931 Bacteria 2682
411 Ga0207644_10114557 3300025931 Bacteria 2043
412 Ga0207644_10185747 3300025931 Bacteria 1632
413 Ga0207644_10481092 3300025931 Bacteria 1023
414 Ga0207690_10007026 3300025932 Bacteria 6676
415 Ga0207690_10066792 3300025932 Bacteria 2464
416 Ga0207690_10070989 3300025932 Unclassified 2401
417 Ga0207690_11290549 3300025932 Bacteria 610
418 Ga0207706_10000278 3300025933 Bacteria 55758
419 Ga0207706_10014921 3300025933 Bacteria 7036
420 Ga0207706_10015386 3300025933 Bacteria 6911
421 Ga0207706_10045118 3300025933 Bacteria 3906
422 Ga0207706_10135438 3300025933 Bacteria 2167
423 Ga0207706_10524191 3300025933 Bacteria 1021
424 Ga0207706_10608876 3300025933 Bacteria 938
425 Ga0207706_10628496 3300025933 Bacteria 921
426 Ga0207706_10832642 3300025933 Unclassified 782
427 Ga0207706_10999102 3300025933 Bacteria 703
428 Ga0207709_10220259 3300025935 Bacteria 1368
429 Ga0207670_10049248 3300025936 Bacteria 2817
430 Ga0207670_10096032 3300025936 Bacteria 2107
431 Ga0207669_10013438 3300025937 Bacteria 4066
432 Ga0207669_10028194 3300025937 Bacteria 3086
433 Ga0207669_10037936 3300025937 Bacteria 2770
434 Ga0207669_10178597 3300025937 Bacteria 1519
435 Ga0207704_10005707 3300025938 Bacteria 5753
436 Ga0207691_10000045 3300025940 Bacteria 99798
437 Ga0207691_10023749 3300025940 Bacteria 5771
438 Ga0207691_10029849 3300025940 Bacteria 5099
439 Ga0207691_10141127 3300025940 Bacteria 2123
440 Ga0207711_10000153 3300025941 Bacteria 73814
441 Ga0207711_10003154 3300025941 Bacteria 14370
442 Ga0207711_10004637 3300025941 Bacteria 11679
443 Ga0207711_10007319 3300025941 Bacteria 9240
444 Ga0207711_10047780 3300025941 Bacteria 3661
445 Ga0207689_10000182 3300025942 Bacteria 54476
446 Ga0207689_10065887 3300025942 Bacteria 2979
447 Ga0207689_10647788 3300025942 Bacteria 890
448 Ga0207661_10467236 3300025944 Bacteria 1151
449 Ga0207679_10007082 3300025945 Bacteria 7108
450 Ga0207679_10008820 3300025945 Bacteria 6428
451 Ga0207679_10067699 3300025945 Bacteria 2680
452 Ga0207679_11762215 3300025945 Unclassified 566
453 Ga0207667_10000603 3300025949 Bacteria 46518
454 Ga0207667_10007486 3300025949 Bacteria 13111
455 Ga0207667_10010624 3300025949 Bacteria 10748
456 Ga0207667_10446882 3300025949 Unclassified 1314
457 Ga0207667_11242090 3300025949 Bacteria 723
458 Ga0207651_10004393 3300025960 Bacteria 7096
459 Ga0207651_10014814 3300025960 Bacteria 4513
460 Ga0207651_10024827 3300025960 Bacteria 3715
461 Ga0207651_10451071 3300025960 Bacteria 1103
462 Ga0207651_11023146 3300025960 Bacteria 739
463 Ga0207651_11151170 3300025960 Bacteria 696
464 Ga0207712_10269352 3300025961 Bacteria 1385
465 Ga0207712_11890913 3300025961 Bacteria 534
466 Ga0207668_10000050 3300025972 Bacteria 98767
467 Ga0207668_10006477 3300025972 Bacteria 6924
468 Ga0207668_10230583 3300025972 Bacteria 1493
469 Ga0207640_10000849 3300025981 Bacteria 17357
470 Ga0207640_10048450 3300025981 Bacteria 2747
471 Ga0207640_10124633 3300025981 Bacteria 1852
472 Ga0207640_10280024 3300025981 Bacteria 1309
473 Ga0207640_10597310 3300025981 Bacteria 934
474 Ga0207640_11996386 3300025981 Bacteria 525
475 Ga0207658_10000453 3300025986 Bacteria 38410
476 Ga0207658_10002786 3300025986 Bacteria 12583
477 Ga0207658_10013766 3300025986 Bacteria 5534
478 Ga0207658_10018210 3300025986 Bacteria 4846
479 Ga0207658_10112529 3300025986 Bacteria 2154
480 Ga0207658_10255372 3300025986 Bacteria 1491
481 Ga0207658_10393221 3300025986 Bacteria 1217
482 Ga0207658_10436661 3300025986 Bacteria 1157
483 Ga0207658_11361972 3300025986 Bacteria 649
484 Ga0207677_10003889 3300026023 Bacteria 7950
485 Ga0207677_10505333 3300026023 Bacteria 1046
486 Ga0207677_11066296 3300026023 Bacteria 735
487 Ga0207703_10202580 3300026035 Bacteria 1764
488 Ga0207703_10518864 3300026035 Bacteria 1120
489 Ga0207703_10536251 3300026035 Bacteria 1102
490 Ga0207639_10028229 3300026041 Bacteria 4095
491 Ga0207639_10092070 3300026041 Bacteria 2429
492 Ga0207639_10205450 3300026041 Bacteria 1692
493 Ga0207639_10245146 3300026041 Bacteria 1560
494 Ga0207639_10249195 3300026041 Unclassified 1548
495 Ga0207639_10363808 3300026041 Bacteria 1295
496 Ga0207639_10961805 3300026041 Unclassified 799
497 Ga0207639_11759584 3300026041 Unclassified 580
498 Ga0207678_10027360 3300026067 Bacteria 4974
499 Ga0207678_10055329 3300026067 Bacteria 3418
500 Ga0207678_10156283 3300026067 Bacteria 1947
501 Ga0207678_10278998 3300026067 Bacteria 1434
502 Ga0207678_10320777 3300026067 Bacteria 1333
503 Ga0207678_10332886 3300026067 Bacteria 1307
504 Ga0207678_10401866 3300026067 Bacteria 1186
505 Ga0207678_10759924 3300026067 Bacteria 855
506 Ga0207678_11804206 3300026067 Bacteria 535
507 Ga0207702_10072998 3300026078 Unclassified 2958
508 Ga0207702_10894069 3300026078 Bacteria 880
509 Ga0207702_11033197 3300026078 Bacteria 815
510 Ga0207641_10000205 3300026088 Bacteria 78692
511 Ga0207641_10004210 3300026088 Bacteria 12546
512 Ga0207641_10020495 3300026088 Bacteria 5430
513 Ga0207641_10039788 3300026088 Bacteria 3933
514 Ga0207641_10318857 3300026088 Bacteria 1473
515 Ga0207648_10000222 3300026089 Bacteria 61156
516 Ga0207648_10000477 3300026089 Bacteria 44735
517 Ga0207648_10406247 3300026089 Bacteria 1235
518 Ga0207648_10699294 3300026089 Bacteria 939
519 Ga0207676_10000702 3300026095 Bacteria 26358
520 Ga0207676_10000878 3300026095 Bacteria 23329
521 Ga0207676_10004741 3300026095 Bacteria 9642
522 Ga0207676_10030670 3300026095 Bacteria 4038
523 Ga0207676_10041510 3300026095 Bacteria 3532
524 Ga0207676_10719904 3300026095 Bacteria 968
525 Ga0207674_10006997 3300026116 Bacteria 13192
526 Ga0207674_10007144 3300026116 Bacteria 13044
527 Ga0207674_10045072 3300026116 Bacteria 4539
528 Ga0207675_100017759 3300026118 Bacteria 6636
529 Ga0207675_100634490 3300026118 Bacteria 1073
530 Ga0207675_101092001 3300026118 Bacteria 818
531 Ga0207675_101435600 3300026118 Bacteria 711
532 Ga0207683_10518164 3300026121 Bacteria 1102
533 Ga0207683_10649869 3300026121 Bacteria 977
534 Ga0207698_10019294 3300026142 Bacteria 4665
535 Ga0207698_10078028 3300026142 Bacteria 2657
536 Ga0207698_10093920 3300026142 Bacteria 2464
537 Ga0207698_10141609 3300026142 Unclassified 2073
538 Ga0207698_10416833 3300026142 Bacteria 1288
539 Ga0207698_10575268 3300026142 Bacteria 1107
540 Ga0268266_10000009 3300028379 Bacteria 1097737
541 Ga0268266_10001084 3300028379 Bacteria 34117
542 Ga0268266_10898387 3300028379 Unclassified 856
543 Ga0268266_11175193 3300028379 Bacteria 742
544 Ga0268265_10000149 3300028380 Bacteria 86376
545 Ga0268265_10002738 3300028380 Bacteria 13007
546 Ga0268265_10012277 3300028380 Bacteria 5806
547 Ga0268265_10021229 3300028380 Bacteria 4545
548 Ga0268265_10094838 3300028380 Bacteria 2394
549 Ga0268265_10573781 3300028380 Bacteria 1074
550 Ga0268264_10004932 3300028381 Bacteria 11301
551 Ga0268264_10012724 3300028381 Bacteria 6924
552 Ga0268264_10054777 3300028381 Bacteria 3331
553 Ga0268264_10136528 3300028381 Bacteria 2181
554 Ga0268264_10345616 3300028381 Bacteria 1414
555 Ga0268264_10408759 3300028381 Bacteria 1306
556 Ga0307513_10136335 3300031456 Bacteria 2390
557 Ga0307408_100007319 3300031548 Bacteria 7302
558 Ga0307408_100090381 3300031548 Bacteria 2310
559 Ga0307408_100122842 3300031548 Bacteria 2014
560 Ga0307408_101116847 3300031548 Bacteria 732
561 Ga0307405_10540024 3300031731 Unclassified 941
562 Ga0307413_10011502 3300031824 Bacteria 4358
563 Ga0307413_10021142 3300031824 Bacteria 3476
564 Ga0307413_10054220 3300031824 Bacteria 2431
565 Ga0307413_10624651 3300031824 Bacteria 885
566 Ga0307413_11728035 3300031824 Bacteria 558
567 Ga0307410_10000294 3300031852 Bacteria 19366
568 Ga0307410_10031350 3300031852 Bacteria 3410
569 Ga0307410_10127667 3300031852 Bacteria 1864
570 Ga0307410_10336432 3300031852 Bacteria 1202
571 Ga0307410_10539211 3300031852 Bacteria 965
572 Ga0307410_10736831 3300031852 Bacteria 833
573 Ga0307410_11713883 3300031852 Unclassified 557
574 Ga0307406_10026936 3300031901 Bacteria 3458
575 Ga0307406_11346552 3300031901 Unclassified 624
576 Ga0307407_10153128 3300031903 Bacteria 1500
577 Ga0307407_11052616 3300031903 Bacteria 631
578 Ga0307412_10104276 3300031911 Bacteria 2012
579 Ga0307409_100004079 3300031995 Bacteria 8121
580 Ga0307409_100023780 3300031995 Bacteria 4255
581 Ga0307409_100034240 3300031995 Bacteria 3706
582 Ga0307409_100124178 3300031995 Bacteria 2192
583 Ga0307409_100185104 3300031995 Bacteria 1848
584 Ga0307409_102592124 3300031995 Bacteria 535
585 Ga0307416_100008181 3300032002 Bacteria 6723
586 Ga0307416_100015063 3300032002 Bacteria 5325
587 Ga0307416_100776354 3300032002 Bacteria 1052
588 Ga0307414_10001887 3300032004 Bacteria 10822
589 Ga0307414_10002479 3300032004 Bacteria 9673
590 Ga0307414_10037950 3300032004 Bacteria 3230
591 Ga0307414_10126072 3300032004 Bacteria 1978
592 Ga0307414_11231579 3300032004 Bacteria 693
593 Ga0307411_10003224 3300032005 Bacteria 7512
594 Ga0307411_10010236 3300032005 Bacteria 4986
595 Ga0307411_10031850 3300032005 Bacteria 3250
596 Ga0307411_10519482 3300032005 Bacteria 1010
597 Ga0307411_10618040 3300032005 Bacteria 934
598 Ga0307411_11808158 3300032005 Bacteria 567
599 Ga0307415_100001215 3300032126 Bacteria 12074
600 Ga0307415_100064778 3300032126 Bacteria 2544
601 Ga0307415_100862530 3300032126 Unclassified 832
602 Ga0373931_0435445 3300035691 Bacteria 836
603 Ga0395899_0047184 3300037312 Bacteria 3208
604 Ga0395899_0074345 3300037312 Bacteria 2483
605 Ga0395899_0098646 3300037312 Bacteria 2111
606 Ga0395899_0128456 3300037312 Bacteria 1811
607 Ga0395899_0166143 3300037312 Bacteria 1556
608 Ga0395900_0052135 3300037418 Bacteria 4212
609 Ga0395900_0079130 3300037418 Bacteria 3377
610 Ga0395900_0099438 3300037418 Bacteria 2988
611 Ga0395900_0245655 3300037418 Bacteria 1793
612 Ga0395900_0314478 3300037418 Bacteria 1548
613 Ga0395900_0417574 3300037418 Bacteria 1303
614 Ga0395900_0572578 3300037418 Bacteria 1072
615 Ga0395900_0602294 3300037418 Bacteria 1039
616 Ga0395900_0622435 3300037418 Bacteria 1018
617 Ga0395900_0654002 3300037418 Unclassified 987
618 Ga0395900_1444797 3300037418 Bacteria 600
619 Ga0395898_0124483 3300037466 Bacteria 2470
620 Ga0395898_0236923 3300037466 Bacteria 1740
621 Ga0395898_0247117 3300037466 Bacteria 1701
622 Ga0395898_1384655 3300037466 Unclassified 631
623 Ga0395905_0007984 3300037471 Bacteria 10459
624 Ga0395905_0012758 3300037471 Bacteria 8083
625 Ga0395905_0041636 3300037471 Bacteria 4310
626 Ga0395905_0042251 3300037471 Bacteria 4278
627 Ga0395905_0085792 3300037471 Bacteria 2950
628 Ga0395905_0091148 3300037471 Bacteria 2858
629 Ga0395905_0100758 3300037471 Bacteria 2712
630 Ga0395905_0158392 3300037471 Bacteria 2129
631 Ga0395905_0199182 3300037471 Bacteria 1878
632 Ga0395905_0315488 3300037471 Bacteria 1452
633 Ga0395905_0345006 3300037471 Bacteria 1380
634 Ga0395905_0617162 3300037471 Bacteria 986
635 Ga0395905_0894553 3300037471 Bacteria 791
636 Ga0395905_1684179 3300037471 Bacteria 539
637 Ga0395901_0045185 3300038443 Bacteria 4569
638 Ga0395901_0052588 3300038443 Bacteria 4233
639 Ga0395901_0055707 3300038443 Bacteria 4112
640 Ga0395901_0110501 3300038443 Bacteria 2886
641 Ga0395901_0317203 3300038443 Bacteria 1613
642 Ga0395901_1742331 3300038443 Unclassified 573
643 Ga0395901_2009600 3300038443 Bacteria 524
644 Ga0436365_0616364 3300039437 Bacteria 2274
645 Ga0466969_0010103 3300044656 Bacteria 5008
646 Ga0466972_0122315 3300044658 Unclassified 1227
647 Ga0466963_0023577 3300044694 Bacteria 3910
648 Ga0466963_0518154 3300044694 Unclassified 842
649 Ga0466963_0964393 3300044694 Unclassified 601
650 Ga0466970_0276733 3300044765 Bacteria 943
651 Ga0466957_0713726 3300044842 Bacteria 708
652 Ga0466959_0284970 3300045049 Bacteria 1133
653 Ga0451576_2664736 3300045051 Unclassified 509
654 Ga0466958_0044797 3300045836 Bacteria 2667
655 Ga0466967_0121344 3300045976 Bacteria 2415
656 Ga0466967_0360583 3300045976 Bacteria 1408
657 Ga0466967_1294656 3300045976 Bacteria 726
658 Ga0466967_2050601 3300045976 Bacteria 568
659 Ga0495617_083767 3300046452 Bacteria 1044
660 Ga0495629_0255686 3300046459 Bacteria 1205
661 Ga0495638_0060556 3300046460 Bacteria 2341
662 Ga0495638_0080447 3300046460 Bacteria 1980
663 Ga0495605_0247781 3300046474 Bacteria 763
664 Ga0495622_0016233 3300046557 Bacteria 3467
665 Ga0495668_0038263 3300046616 Bacteria 2681
666 Ga0495668_0042044 3300046616 Bacteria 2544
667 Ga0495668_0151708 3300046616 Unclassified 1269
668 Ga0495611_0141707 3300046648 Bacteria 1122
669 Ga0495625_0013331 3300046660 Bacteria 6609
670 Ga0495625_0116964 3300046660 Bacteria 1818
671 Ga0495625_0241179 3300046660 Bacteria 1177
672 Ga0495625_0445590 3300046660 Bacteria 801
673 Ga0495588_0257948 3300046674 Bacteria 919
674 Ga0495669_0059532 3300046684 Bacteria 1725
675 Ga0495669_0358940 3300046684 Bacteria 704
676 Ga0495677_0096589 3300047445 Bacteria 1116
677 Ga0496100_0115291 3300048903 Bacteria 1873
678 Ga0496101_0265240 3300048904 Bacteria 1340
679 Ga0496101_0299489 3300048904 Bacteria 1259
680 Ga0496101_0601246 3300048904 Bacteria 869
681 Ga0496102_0883830 3300048905 Bacteria 815
682 Ga0496103_0702866 3300048906 Bacteria 641
683 Ga0496106_0325797 3300048909 Bacteria 1233
684 Ga0496107_0074078 3300048910 Bacteria 2477
685 Ga0496107_0133434 3300048910 Bacteria 1834
686 Ga0496107_0219518 3300048910 Bacteria 1414
687 Ga0496107_0319613 3300048910 Bacteria 1155
688 Ga0496107_0671866 3300048910 Unclassified 763
689 Ga0496108_0147581 3300048911 Bacteria 2028
690 Ga0496109_0384718 3300048912 Bacteria 1325
691 Ga0496109_1042603 3300048912 Bacteria 755
692 Ga0496111_0347342 3300048914 Unclassified 1098
693 Ga0496112_0021492 3300048915 Bacteria 6138
694 Ga0496112_0231321 3300048915 Bacteria 1803
695 Ga0496112_0695931 3300048915 Unclassified 944
696 Ga0496113_0031718 3300048916 Bacteria 3837
697 Ga0496114_0012689 3300048917 Bacteria 6749
698 Ga0496114_0761960 3300048917 Bacteria 845
699 Ga0496115_0009567 3300048918 Bacteria 7201
700 Ga0496115_0304248 3300048918 Bacteria 1306
701 Ga0496124_0891598 3300048927 Bacteria 541
702 Ga0501034_0625661 3300049571 Bacteria 980
703 Ga0501037_0048103 3300049573 Archaea 3126
704 Ga0501038_0016555 3300049574 Bacteria 6684
705 Ga0501039_0609705 3300049575 Bacteria 855
706 Ga0501043_0031737 3300049579 Bacteria 4153
707 Ga0501046_0163598 3300049580 Bacteria 1672
708 Ga0501047_0030675 3300049581 Bacteria 5182
709 Ga0501067_0047296 3300049583 Bacteria 2386
710 Ga0501068_0251906 3300049584 Bacteria 1125
711 Ga0501073_0013519 3300049589 Bacteria 5935
712 Ga0501073_0393653 3300049589 Bacteria 957
713 Ga0501074_0106547 3300049590 Bacteria 2006
714 Ga0501075_1232063 3300049591 Bacteria 567
715 Ga0501242_051722 3300049674 Bacteria 605
716 Ga0501253_165979 3300049683 Bacteria 566
717 Ga0501079_0274399 3300049741 Bacteria 1318
718 Ga0501079_1139578 3300049741 Bacteria 614
719 Ga0501080_0025952 3300049742 Bacteria 5443
720 Ga0501080_0043551 3300049742 Bacteria 4180
721 Ga0501083_0018333 3300049744 Bacteria 4878
722 Ga0501241_007349 3300049758 Bacteria 2018
723 Ga0501262_081513 3300049759 Unclassified 541
724 Ga0501268_176367 3300049765 Unclassified 507
725 Ga0501035_0541344 3300049822 Bacteria 955
726 Ga0501044_0044001 3300049823 Bacteria 4636
727 Ga0501204_040309 3300049850 Bacteria 682
728 nmdc:mga09592_295816_c1 3300050508 Bacteria 1403
729 Ga0500643_000311 3300053087 Bacteria 39950
730 Ga0500643_004317 3300053087 Bacteria 6483
731 Ga0500643_029458 3300053087 Bacteria 1688
732 Ga0500643_043433 3300053087 Bacteria 1310
733 Ga0500644_0053585 3300053088 Bacteria 1393
734 Ga0500556_0000144 3300053104 Bacteria 59354
735 Ga0500608_186366 3300053122 Bacteria 873
736 Ga0500618_012926 3300053125 Bacteria 2173
737 Ga0500642_0000001 3300053130 Bacteria 1468402
738 Ga0500658_0000147 3300053134 Bacteria 33394
739 Ga0500559_0003490 3300053136 Bacteria 7715
740 Ga0500559_0069243 3300053136 Bacteria 1586
741 Ga0500620_005699 3300053155 Bacteria 2910
742 Ga0500624_000027 3300053157 Bacteria 108821
743 Ga0500645_000414 3300053730 Bacteria 29750
744 Ga0501084_0581921 3300054114 Bacteria 946
745 Ga0500661_003397 3300055283 Bacteria 2984
746 Ga0501082_0130738 3300060353 Bacteria 2178
747 Ga0466962_0083666 3300061719 Bacteria 1527
748 Ga0466962_0508108 3300061719 Bacteria 610

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_101902702 Ga0068857_1019027021 105
2 3300014326 Ga0157380_10853842 Ga0157380_108538422 118
3 3300005440 Ga0070705_100765159 Ga0070705_1007651591 121
4 iso_pu_bacteria 8055617313 8055620604 127
5 3300005985 Ga0081539_10040175 Ga0081539_100401754 130
6 3300009551 Ga0105238_10507330 Ga0105238_105073301 130
7 3300013104 Ga0157370_10748181 Ga0157370_107481811 130
8 3300046460 Ga0495638_0060556 Ga0495638_0060556_1830_2222 130
9 3300053087 Ga0500643_000311 Ga0500643_000311_38400_38792 130
10 3300053087 Ga0500643_004317 Ga0500643_004317_5932_6324 130
11 3300053125 Ga0500618_012926 Ga0500618_012926_1497_1889 130
12 3300053136 Ga0500559_0003490 Ga0500559_0003490_5884_6276 130
13 3300053157 Ga0500624_000027 Ga0500624_000027_19457_19849 130
14 3300055283 Ga0500661_003397 Ga0500661_003397_1157_1549 130
15 3300001979 JGI24740J21852_10020127 JGI24740J21852_100201272 131
16 3300001979 JGI24740J21852_10034420 JGI24740J21852_100344202 131
17 3300001989 JGI24739J22299_10000453 JGI24739J22299_100004534 131
18 3300001989 JGI24739J22299_10027197 JGI24739J22299_100271971 131
19 3300001990 JGI24737J22298_10000021 JGI24737J22298_1000002121 131
20 3300001990 JGI24737J22298_10056449 JGI24737J22298_100564492 131
21 3300002067 JGI24735J21928_10017771 JGI24735J21928_100177712 131
22 3300002074 JGI24748J21848_1024486 JGI24748J21848_10244862 131
23 3300002075 JGI24738J21930_10000062 JGI24738J21930_1000006222 131
24 3300002076 JGI24749J21850_1007519 JGI24749J21850_10075192 131
25 3300002126 JGI24035J26624_1005815 JGI24035J26624_10058152 131
26 3300005290 Ga0065712_10031930 Ga0065712_100319302 131
27 3300005327 Ga0070658_10034989 Ga0070658_100349892 131
28 3300005327 Ga0070658_10169474 Ga0070658_101694742 131
29 3300005327 Ga0070658_10410767 Ga0070658_104107672 131
30 3300005327 Ga0070658_10857287 Ga0070658_108572871 131
31 3300005327 Ga0070658_11090690 Ga0070658_110906901 131
32 3300005327 Ga0070658_11141804 Ga0070658_111418041 131
33 3300005327 Ga0070658_11327575 Ga0070658_113275752 131
34 3300005328 Ga0070676_10003504 Ga0070676_100035045 131
35 3300005328 Ga0070676_10011228 Ga0070676_100112287 131
36 3300005328 Ga0070676_10169095 Ga0070676_101690951 131
37 3300005328 Ga0070676_10218065 Ga0070676_102180652 131
38 3300005329 Ga0070683_101497744 Ga0070683_1014977441 131
39 3300005329 Ga0070683_101765478 Ga0070683_1017654782 131
40 3300005330 Ga0070690_100018652 Ga0070690_1000186522 131
41 3300005331 Ga0070670_100010365 Ga0070670_1000103656 131
42 3300005331 Ga0070670_100075676 Ga0070670_1000756764 131
43 3300005331 Ga0070670_100197748 Ga0070670_1001977481 131
44 3300005331 Ga0070670_100211938 Ga0070670_1002119381 131
45 3300005331 Ga0070670_100301085 Ga0070670_1003010852 131
46 3300005333 Ga0070677_10004566 Ga0070677_100045662 131
47 3300005333 Ga0070677_10061063 Ga0070677_100610632 131
48 3300005333 Ga0070677_10560965 Ga0070677_105609652 131
49 3300005334 Ga0068869_100034193 Ga0068869_1000341933 131
50 3300005334 Ga0068869_100071883 Ga0068869_1000718833 131
51 3300005334 Ga0068869_100339175 Ga0068869_1003391752 131
52 3300005335 Ga0070666_10049262 Ga0070666_100492623 131
53 3300005335 Ga0070666_10052157 Ga0070666_100521572 131
54 3300005335 Ga0070666_10162447 Ga0070666_101624472 131
55 3300005335 Ga0070666_10657553 Ga0070666_106575532 131
56 3300005336 Ga0070680_100294940 Ga0070680_1002949401 131
57 3300005336 Ga0070680_101054807 Ga0070680_1010548072 131
58 3300005337 Ga0070682_100123267 Ga0070682_1001232672 131
59 3300005337 Ga0070682_100214281 Ga0070682_1002142811 131
60 3300005338 Ga0068868_100000637 Ga0068868_10000063711 131
61 3300005338 Ga0068868_101126191 Ga0068868_1011261912 131
62 3300005339 Ga0070660_100001821 Ga0070660_1000018219 131
63 3300005339 Ga0070660_100002082 Ga0070660_10000208215 131
64 3300005339 Ga0070660_100023740 Ga0070660_1000237404 131
65 3300005339 Ga0070660_100152967 Ga0070660_1001529672 131
66 3300005339 Ga0070660_100219149 Ga0070660_1002191491 131
67 3300005339 Ga0070660_100387183 Ga0070660_1003871832 131
68 3300005339 Ga0070660_100419199 Ga0070660_1004191992 131
69 3300005339 Ga0070660_100429773 Ga0070660_1004297732 131
70 3300005339 Ga0070660_100478065 Ga0070660_1004780651 131
71 3300005339 Ga0070660_100542317 Ga0070660_1005423172 131
72 3300005339 Ga0070660_100973574 Ga0070660_1009735741 131
73 3300005340 Ga0070689_100009615 Ga0070689_1000096152 131
74 3300005340 Ga0070689_100013741 Ga0070689_1000137419 131
75 3300005340 Ga0070689_101226884 Ga0070689_1012268842 131
76 3300005343 Ga0070687_100216472 Ga0070687_1002164722 131
77 3300005344 Ga0070661_100007377 Ga0070661_1000073775 131
78 3300005344 Ga0070661_100031513 Ga0070661_1000315134 131
79 3300005344 Ga0070661_100074768 Ga0070661_1000747682 131
80 3300005344 Ga0070661_100109407 Ga0070661_1001094072 131
81 3300005344 Ga0070661_100314557 Ga0070661_1003145572 131
82 3300005344 Ga0070661_100342559 Ga0070661_1003425592 131
83 3300005344 Ga0070661_100445614 Ga0070661_1004456141 131
84 3300005344 Ga0070661_100514389 Ga0070661_1005143891 131
85 3300005344 Ga0070661_100795031 Ga0070661_1007950312 131
86 3300005344 Ga0070661_101052675 Ga0070661_1010526752 131
87 3300005344 Ga0070661_101105657 Ga0070661_1011056572 131
88 3300005344 Ga0070661_101334919 Ga0070661_1013349191 131
89 3300005347 Ga0070668_100005175 Ga0070668_10000517511 131
90 3300005347 Ga0070668_100032860 Ga0070668_1000328606 131
91 3300005347 Ga0070668_100359173 Ga0070668_1003591731 131
92 3300005347 Ga0070668_101547510 Ga0070668_1015475101 131
93 3300005353 Ga0070669_100000009 Ga0070669_100000009122 131
94 3300005353 Ga0070669_100000862 Ga0070669_1000008623 131
95 3300005353 Ga0070669_100096778 Ga0070669_1000967783 131
96 3300005353 Ga0070669_100118774 Ga0070669_1001187744 131
97 3300005353 Ga0070669_100171760 Ga0070669_1001717602 131
98 3300005353 Ga0070669_100199231 Ga0070669_1001992311 131
99 3300005354 Ga0070675_100007443 Ga0070675_1000074436 131
100 3300005354 Ga0070675_100047334 Ga0070675_1000473346 131
101 3300005354 Ga0070675_100302676 Ga0070675_1003026763 131
102 3300005354 Ga0070675_100858179 Ga0070675_1008581792 131
103 3300005355 Ga0070671_100001012 Ga0070671_10000101216 131
104 3300005355 Ga0070671_100002229 Ga0070671_10000222915 131
105 3300005355 Ga0070671_100076910 Ga0070671_1000769104 131
106 3300005355 Ga0070671_100503647 Ga0070671_1005036472 131
107 3300005355 Ga0070671_100732538 Ga0070671_1007325382 131
108 3300005355 Ga0070671_100772397 Ga0070671_1007723971 131
109 3300005355 Ga0070671_101167974 Ga0070671_1011679741 131
110 3300005356 Ga0070674_100001982 Ga0070674_1000019826 131
111 3300005356 Ga0070674_100051087 Ga0070674_1000510875 131
112 3300005356 Ga0070674_100139092 Ga0070674_1001390922 131
113 3300005356 Ga0070674_100196996 Ga0070674_1001969962 131
114 3300005356 Ga0070674_100330914 Ga0070674_1003309142 131
115 3300005364 Ga0070673_100000209 Ga0070673_10000020914 131
116 3300005364 Ga0070673_100057133 Ga0070673_1000571332 131
117 3300005364 Ga0070673_100096310 Ga0070673_1000963103 131
118 3300005364 Ga0070673_100161093 Ga0070673_1001610932 131
119 3300005364 Ga0070673_100933179 Ga0070673_1009331792 131
120 3300005364 Ga0070673_100967289 Ga0070673_1009672892 131
121 3300005366 Ga0070659_100006023 Ga0070659_1000060233 131
122 3300005366 Ga0070659_100007835 Ga0070659_1000078353 131
123 3300005366 Ga0070659_100028371 Ga0070659_1000283712 131
124 3300005366 Ga0070659_100323638 Ga0070659_1003236381 131
125 3300005366 Ga0070659_100427468 Ga0070659_1004274681 131
126 3300005366 Ga0070659_101220277 Ga0070659_1012202771 131
127 3300005367 Ga0070667_100004734 Ga0070667_1000047344 131
128 3300005367 Ga0070667_100005313 Ga0070667_1000053135 131
129 3300005367 Ga0070667_100090330 Ga0070667_1000903302 131
130 3300005367 Ga0070667_100116585 Ga0070667_1001165854 131
131 3300005367 Ga0070667_100264669 Ga0070667_1002646692 131
132 3300005367 Ga0070667_100322181 Ga0070667_1003221812 131
133 3300005455 Ga0070663_100013706 Ga0070663_1000137066 131
134 3300005455 Ga0070663_100050307 Ga0070663_1000503071 131
135 3300005455 Ga0070663_100094108 Ga0070663_1000941082 131
136 3300005455 Ga0070663_100217564 Ga0070663_1002175641 131
137 3300005455 Ga0070663_100237306 Ga0070663_1002373061 131
138 3300005455 Ga0070663_100303531 Ga0070663_1003035312 131
139 3300005455 Ga0070663_101003971 Ga0070663_1010039712 131
140 3300005455 Ga0070663_101017456 Ga0070663_1010174561 131
141 3300005455 Ga0070663_101026257 Ga0070663_1010262572 131
142 3300005455 Ga0070663_101370813 Ga0070663_1013708131 131
143 3300005455 Ga0070663_101525893 Ga0070663_1015258931 131
144 3300005456 Ga0070678_100089929 Ga0070678_1000899293 131
145 3300005456 Ga0070678_100123475 Ga0070678_1001234752 131
146 3300005456 Ga0070678_100197779 Ga0070678_1001977793 131
147 3300005457 Ga0070662_100001955 Ga0070662_1000019552 131
148 3300005457 Ga0070662_100044295 Ga0070662_1000442954 131
149 3300005457 Ga0070662_100083028 Ga0070662_1000830284 131
150 3300005457 Ga0070662_100255675 Ga0070662_1002556751 131
151 3300005457 Ga0070662_100293262 Ga0070662_1002932621 131
152 3300005457 Ga0070662_100346368 Ga0070662_1003463683 131
153 3300005457 Ga0070662_100638120 Ga0070662_1006381201 131
154 3300005457 Ga0070662_100833426 Ga0070662_1008334262 131
155 3300005457 Ga0070662_101187810 Ga0070662_1011878102 131
156 3300005458 Ga0070681_10051638 Ga0070681_100516384 131
157 3300005458 Ga0070681_10246249 Ga0070681_102462492 131
158 3300005458 Ga0070681_11901214 Ga0070681_119012141 131
159 3300005459 Ga0068867_100000633 Ga0068867_10000063323 131
160 3300005459 Ga0068867_100011413 Ga0068867_1000114136 131
161 3300005459 Ga0068867_100329452 Ga0068867_1003294522 131
162 3300005459 Ga0068867_100401748 Ga0068867_1004017482 131
163 3300005459 Ga0068867_101063450 Ga0068867_1010634502 131
164 3300005466 Ga0070685_10000225 Ga0070685_1000022510 131
165 3300005530 Ga0070679_100000750 Ga0070679_10000075014 131
166 3300005530 Ga0070679_100091968 Ga0070679_1000919682 131
167 3300005530 Ga0070679_101202036 Ga0070679_1012020362 131
168 3300005530 Ga0070679_101246968 Ga0070679_1012469682 131
169 3300005530 Ga0070679_101472415 Ga0070679_1014724151 131
170 3300005530 Ga0070679_101551282 Ga0070679_1015512821 131
171 3300005539 Ga0068853_100002063 Ga0068853_10000206312 131
172 3300005539 Ga0068853_100060675 Ga0068853_1000606753 131
173 3300005539 Ga0068853_100342356 Ga0068853_1003423562 131
174 3300005539 Ga0068853_100444925 Ga0068853_1004449252 131
175 3300005539 Ga0068853_100621954 Ga0068853_1006219542 131
176 3300005539 Ga0068853_100885472 Ga0068853_1008854721 131
177 3300005539 Ga0068853_101259303 Ga0068853_1012593032 131
178 3300005539 Ga0068853_101934244 Ga0068853_1019342441 131
179 3300005543 Ga0070672_100000770 Ga0070672_10000077020 131
180 3300005543 Ga0070672_100012771 Ga0070672_1000127714 131
181 3300005543 Ga0070672_100332309 Ga0070672_1003323092 131
182 3300005543 Ga0070672_100743794 Ga0070672_1007437941 131
183 3300005545 Ga0070695_101420361 Ga0070695_1014203611 131
184 3300005546 Ga0070696_100054831 Ga0070696_1000548313 131
185 3300005547 Ga0070693_100039946 Ga0070693_1000399461 131
186 3300005547 Ga0070693_100369905 Ga0070693_1003699051 131
187 3300005548 Ga0070665_100000004 Ga0070665_100000004169 131
188 3300005548 Ga0070665_100000590 Ga0070665_10000059043 131
189 3300005548 Ga0070665_101003374 Ga0070665_1010033741 131
190 3300005548 Ga0070665_101415786 Ga0070665_1014157861 131
191 3300005563 Ga0068855_100039372 Ga0068855_1000393723 131
192 3300005563 Ga0068855_100659183 Ga0068855_1006591832 131
193 3300005563 Ga0068855_101588504 Ga0068855_1015885041 131
194 3300005564 Ga0070664_100002427 Ga0070664_1000024276 131
195 3300005564 Ga0070664_100009081 Ga0070664_1000090812 131
196 3300005564 Ga0070664_100010866 Ga0070664_1000108662 131
197 3300005564 Ga0070664_100046060 Ga0070664_1000460602 131
198 3300005564 Ga0070664_100183983 Ga0070664_1001839832 131
199 3300005564 Ga0070664_100518830 Ga0070664_1005188302 131
200 3300005577 Ga0068857_100004161 Ga0068857_1000041612 131
201 3300005577 Ga0068857_100105577 Ga0068857_1001055773 131
202 3300005577 Ga0068857_100150925 Ga0068857_1001509253 131
203 3300005577 Ga0068857_100857248 Ga0068857_1008572481 131
204 3300005577 Ga0068857_101202536 Ga0068857_1012025362 131
205 3300005578 Ga0068854_100000614 Ga0068854_10000061423 131
206 3300005578 Ga0068854_100068281 Ga0068854_1000682812 131
207 3300005578 Ga0068854_100103296 Ga0068854_1001032963 131
208 3300005578 Ga0068854_100337004 Ga0068854_1003370042 131
209 3300005578 Ga0068854_100523947 Ga0068854_1005239472 131
210 3300005578 Ga0068854_100724192 Ga0068854_1007241922 131
211 3300005578 Ga0068854_101022875 Ga0068854_1010228752 131
212 3300005614 Ga0068856_100057609 Ga0068856_1000576092 131
213 3300005614 Ga0068856_100182730 Ga0068856_1001827305 131
214 3300005614 Ga0068856_100801697 Ga0068856_1008016972 131
215 3300005614 Ga0068856_100850295 Ga0068856_1008502952 131
216 3300005614 Ga0068856_101015343 Ga0068856_1010153432 131
217 3300005615 Ga0070702_100102565 Ga0070702_1001025653 131
218 3300005616 Ga0068852_100000804 Ga0068852_10000080424 131
219 3300005616 Ga0068852_100039331 Ga0068852_1000393312 131
220 3300005616 Ga0068852_100086339 Ga0068852_1000863392 131
221 3300005616 Ga0068852_100086868 Ga0068852_1000868682 131
222 3300005616 Ga0068852_100439777 Ga0068852_1004397772 131
223 3300005616 Ga0068852_100463930 Ga0068852_1004639303 131
224 3300005616 Ga0068852_100655564 Ga0068852_1006555643 131
225 3300005616 Ga0068852_101059328 Ga0068852_1010593282 131
226 3300005616 Ga0068852_101280805 Ga0068852_1012808052 131
227 3300005617 Ga0068859_100000104 Ga0068859_10000010470 131
228 3300005617 Ga0068859_100000478 Ga0068859_10000047832 131
229 3300005617 Ga0068859_100022547 Ga0068859_1000225477 131
230 3300005617 Ga0068859_100119080 Ga0068859_1001190801 131
231 3300005617 Ga0068859_100362012 Ga0068859_1003620123 131
232 3300005617 Ga0068859_100409780 Ga0068859_1004097802 131
233 3300005618 Ga0068864_100000118 Ga0068864_10000011850 131
234 3300005618 Ga0068864_100000174 Ga0068864_10000017467 131
235 3300005618 Ga0068864_100017446 Ga0068864_1000174466 131
236 3300005618 Ga0068864_100136248 Ga0068864_1001362482 131
237 3300005618 Ga0068864_100756044 Ga0068864_1007560442 131
238 3300005618 Ga0068864_101332917 Ga0068864_1013329171 131
239 3300005718 Ga0068866_10754807 Ga0068866_107548072 131
240 3300005718 Ga0068866_10957279 Ga0068866_109572791 131
241 3300005719 Ga0068861_100001151 Ga0068861_10000115112 131
242 3300005719 Ga0068861_100010621 Ga0068861_1000106216 131
243 3300005719 Ga0068861_100481942 Ga0068861_1004819422 131
244 3300005719 Ga0068861_102360272 Ga0068861_1023602721 131
245 3300005834 Ga0068851_10157421 Ga0068851_101574212 131
246 3300005834 Ga0068851_10299332 Ga0068851_102993322 131
247 3300005834 Ga0068851_10300744 Ga0068851_103007442 131
248 3300005834 Ga0068851_10375744 Ga0068851_103757442 131
249 3300005840 Ga0068870_10184423 Ga0068870_101844233 131
250 3300005841 Ga0068863_100000152 Ga0068863_10000015248 131
251 3300005841 Ga0068863_100004878 Ga0068863_1000048783 131
252 3300005841 Ga0068863_100076008 Ga0068863_1000760084 131
253 3300005841 Ga0068863_100208726 Ga0068863_1002087261 131
254 3300005841 Ga0068863_100285525 Ga0068863_1002855252 131
255 3300005841 Ga0068863_101763628 Ga0068863_1017636282 131
256 3300005842 Ga0068858_100028224 Ga0068858_1000282246 131
257 3300005842 Ga0068858_100068281 Ga0068858_1000682816 131
258 3300005842 Ga0068858_100283369 Ga0068858_1002833692 131
259 3300005843 Ga0068860_100003157 Ga0068860_1000031579 131
260 3300005843 Ga0068860_100005690 Ga0068860_1000056907 131
261 3300005843 Ga0068860_100007725 Ga0068860_1000077255 131
262 3300005843 Ga0068860_100341159 Ga0068860_1003411592 131
263 3300005843 Ga0068860_100658460 Ga0068860_1006584603 131
264 3300005844 Ga0068862_100000421 Ga0068862_10000042113 131
265 3300005844 Ga0068862_100005596 Ga0068862_10000559610 131
266 3300005844 Ga0068862_100026268 Ga0068862_1000262683 131
267 3300005844 Ga0068862_100054895 Ga0068862_1000548953 131
268 3300005844 Ga0068862_100149447 Ga0068862_1001494471 131
269 3300005844 Ga0068862_100727452 Ga0068862_1007274522 131
270 3300006237 Ga0097621_100013235 Ga0097621_1000132352 131
271 3300006237 Ga0097621_100088606 Ga0097621_1000886063 131
272 3300006358 Ga0068871_100135529 Ga0068871_1001355292 131
273 3300006358 Ga0068871_100180491 Ga0068871_1001804912 131
274 3300006358 Ga0068871_100468183 Ga0068871_1004681832 131
275 3300006881 Ga0068865_100000240 Ga0068865_10000024015 131
276 3300006931 Ga0097620_100000104 Ga0097620_10000010470 131
277 3300006931 Ga0097620_100000478 Ga0097620_10000047832 131
278 3300006931 Ga0097620_100022548 Ga0097620_1000225487 131
279 3300006931 Ga0097620_100119090 Ga0097620_1001190903 131
280 3300006931 Ga0097620_100361978 Ga0097620_1003619783 131
281 3300006931 Ga0097620_100409763 Ga0097620_1004097632 131
282 3300009011 Ga0105251_10405572 Ga0105251_104055722 131
283 3300009092 Ga0105250_10017923 Ga0105250_100179234 131
284 3300009093 Ga0105240_10073297 Ga0105240_100732977 131
285 3300009093 Ga0105240_10745376 Ga0105240_107453762 131
286 3300009098 Ga0105245_10000300 Ga0105245_1000030023 131
287 3300009101 Ga0105247_10006055 Ga0105247_100060555 131
288 3300009101 Ga0105247_10170804 Ga0105247_101708042 131
289 3300009147 Ga0114129_11975131 Ga0114129_119751311 131
290 3300009174 Ga0105241_10022584 Ga0105241_100225843 131
291 3300009176 Ga0105242_11884389 Ga0105242_118843892 131
292 3300009177 Ga0105248_10000295 Ga0105248_1000029545 131
293 3300009177 Ga0105248_10002741 Ga0105248_1000274110 131
294 3300009177 Ga0105248_10006633 Ga0105248_100066332 131
295 3300009177 Ga0105248_10014716 Ga0105248_100147166 131
296 3300009177 Ga0105248_10017802 Ga0105248_100178027 131
297 3300009177 Ga0105248_10390186 Ga0105248_103901862 131
298 3300009177 Ga0105248_10559403 Ga0105248_105594033 131
299 3300009177 Ga0105248_11151389 Ga0105248_111513892 131
300 3300009545 Ga0105237_10950039 Ga0105237_109500391 131
301 3300009551 Ga0105238_10049432 Ga0105238_100494322 131
302 3300009551 Ga0105238_10981814 Ga0105238_109818141 131
303 3300009553 Ga0105249_11261345 Ga0105249_112613452 131
304 3300009553 Ga0105249_13262366 Ga0105249_132623661 131
305 3300010375 Ga0105239_10044676 Ga0105239_100446763 131
306 3300010375 Ga0105239_11858988 Ga0105239_118589881 131
307 3300011119 Ga0105246_10021355 Ga0105246_100213555 131
308 3300011119 Ga0105246_10647241 Ga0105246_106472412 131
309 3300013100 Ga0157373_10006164 Ga0157373_100061642 131
310 3300013100 Ga0157373_10085912 Ga0157373_100859121 131
311 3300013100 Ga0157373_10278215 Ga0157373_102782151 131
312 3300013100 Ga0157373_10463670 Ga0157373_104636702 131
313 3300013102 Ga0157371_10000677 Ga0157371_1000067726 131
314 3300013102 Ga0157371_10424834 Ga0157371_104248342 131
315 3300013102 Ga0157371_10441020 Ga0157371_104410201 131
316 3300013102 Ga0157371_10754115 Ga0157371_107541152 131
317 3300013104 Ga0157370_10115511 Ga0157370_101155113 131
318 3300013104 Ga0157370_10244964 Ga0157370_102449642 131
319 3300013104 Ga0157370_10855001 Ga0157370_108550012 131
320 3300013105 Ga0157369_10391583 Ga0157369_103915832 131
321 3300013296 Ga0157374_11086772 Ga0157374_110867721 131
322 3300013297 Ga0157378_10002011 Ga0157378_1000201111 131
323 3300013297 Ga0157378_11188894 Ga0157378_111888941 131
324 3300013306 Ga0163162_10045123 Ga0163162_100451234 131
325 3300013306 Ga0163162_10202482 Ga0163162_102024822 131
326 3300013307 Ga0157372_10045485 Ga0157372_100454858 131
327 3300013307 Ga0157372_10088817 Ga0157372_100888175 131
328 3300013307 Ga0157372_10754899 Ga0157372_107548992 131
329 3300013307 Ga0157372_11547760 Ga0157372_115477601 131
330 3300013308 Ga0157375_10124625 Ga0157375_101246253 131
331 3300013308 Ga0157375_10499140 Ga0157375_104991402 131
332 3300013308 Ga0157375_11854929 Ga0157375_118549292 131
333 3300014325 Ga0163163_10000882 Ga0163163_100008826 131
334 3300014325 Ga0163163_10400460 Ga0163163_104004602 131
335 3300014745 Ga0157377_10033043 Ga0157377_100330433 131
336 3300014968 Ga0157379_10009073 Ga0157379_100090732 131
337 3300014968 Ga0157379_10054102 Ga0157379_100541023 131
338 3300017792 Ga0163161_11058312 Ga0163161_110583122 131
339 3300021384 Ga0213876_10010656 Ga0213876_100106563 131
340 3300025290 Ga0207673_1001669 Ga0207673_10016694 131
341 3300025315 Ga0207697_10000026 Ga0207697_1000002632 131
342 3300025315 Ga0207697_10186033 Ga0207697_101860332 131
343 3300025315 Ga0207697_10373337 Ga0207697_103733372 131
344 3300025321 Ga0207656_10072117 Ga0207656_100721172 131
345 3300025321 Ga0207656_10494086 Ga0207656_104940861 131
346 3300025711 Ga0207696_1048263 Ga0207696_10482632 131
347 3300025735 Ga0207713_1166571 Ga0207713_11665712 131
348 3300025735 Ga0207713_1196393 Ga0207713_11963931 131
349 3300025893 Ga0207682_10009951 Ga0207682_100099512 131
350 3300025893 Ga0207682_10100070 Ga0207682_101000703 131
351 3300025899 Ga0207642_10147168 Ga0207642_101471682 131
352 3300025900 Ga0207710_10018640 Ga0207710_100186402 131
353 3300025900 Ga0207710_10079543 Ga0207710_100795432 131
354 3300025901 Ga0207688_10000055 Ga0207688_1000005516 131
355 3300025901 Ga0207688_10011889 Ga0207688_100118893 131
356 3300025903 Ga0207680_10036791 Ga0207680_100367912 131
357 3300025903 Ga0207680_10680949 Ga0207680_106809491 131
358 3300025904 Ga0207647_10006361 Ga0207647_1000636113 131
359 3300025904 Ga0207647_10222636 Ga0207647_102226362 131
360 3300025907 Ga0207645_10001667 Ga0207645_1000166715 131
361 3300025907 Ga0207645_10006444 Ga0207645_100064442 131
362 3300025907 Ga0207645_10086464 Ga0207645_100864642 131
363 3300025907 Ga0207645_10115763 Ga0207645_101157632 131
364 3300025908 Ga0207643_10166873 Ga0207643_101668732 131
365 3300025909 Ga0207705_10021828 Ga0207705_100218282 131
366 3300025909 Ga0207705_10105183 Ga0207705_101051832 131
367 3300025909 Ga0207705_10382308 Ga0207705_103823081 131
368 3300025909 Ga0207705_10388709 Ga0207705_103887092 131
369 3300025909 Ga0207705_10645806 Ga0207705_106458062 131
370 3300025909 Ga0207705_10684759 Ga0207705_106847592 131
371 3300025909 Ga0207705_10737343 Ga0207705_107373431 131
372 3300025909 Ga0207705_11138284 Ga0207705_111382842 131
373 3300025911 Ga0207654_10477819 Ga0207654_104778192 131
374 3300025912 Ga0207707_10016712 Ga0207707_100167124 131
375 3300025912 Ga0207707_10713216 Ga0207707_107132162 131
376 3300025913 Ga0207695_10009319 Ga0207695_1000931910 131
377 3300025913 Ga0207695_10942521 Ga0207695_109425211 131
378 3300025917 Ga0207660_10007761 Ga0207660_100077616 131
379 3300025917 Ga0207660_10883860 Ga0207660_108838601 131
380 3300025917 Ga0207660_11260820 Ga0207660_112608202 131
381 3300025918 Ga0207662_10242073 Ga0207662_102420732 131
382 3300025919 Ga0207657_10001574 Ga0207657_100015742 131
383 3300025919 Ga0207657_10003629 Ga0207657_1000362916 131
384 3300025919 Ga0207657_10077813 Ga0207657_100778132 131
385 3300025919 Ga0207657_10078938 Ga0207657_100789381 131
386 3300025919 Ga0207657_10088943 Ga0207657_100889432 131
387 3300025919 Ga0207657_10284189 Ga0207657_102841892 131
388 3300025919 Ga0207657_10393461 Ga0207657_103934612 131
389 3300025919 Ga0207657_10496323 Ga0207657_104963232 131
390 3300025919 Ga0207657_10685154 Ga0207657_106851542 131
391 3300025919 Ga0207657_10852268 Ga0207657_108522681 131
392 3300025919 Ga0207657_10867747 Ga0207657_108677472 131
393 3300025920 Ga0207649_10031780 Ga0207649_100317803 131
394 3300025920 Ga0207649_10063331 Ga0207649_100633314 131
395 3300025920 Ga0207649_10116587 Ga0207649_101165872 131
396 3300025920 Ga0207649_10117121 Ga0207649_101171211 131
397 3300025920 Ga0207649_10200440 Ga0207649_102004402 131
398 3300025920 Ga0207649_10533279 Ga0207649_105332792 131
399 3300025920 Ga0207649_10672194 Ga0207649_106721941 131
400 3300025920 Ga0207649_10986334 Ga0207649_109863342 131
401 3300025921 Ga0207652_10000001 Ga0207652_1000000116 131
402 3300025923 Ga0207681_10000020 Ga0207681_10000020105 131
403 3300025923 Ga0207681_10001514 Ga0207681_1000151416 131
404 3300025923 Ga0207681_10005327 Ga0207681_100053275 131
405 3300025923 Ga0207681_10121455 Ga0207681_101214552 131
406 3300025923 Ga0207681_10419369 Ga0207681_104193692 131
407 3300025924 Ga0207694_10225304 Ga0207694_102253042 131
408 3300025924 Ga0207694_10761855 Ga0207694_107618551 131
409 3300025925 Ga0207650_10044004 Ga0207650_100440042 131
410 3300025925 Ga0207650_10066692 Ga0207650_100666922 131
411 3300025925 Ga0207650_10143822 Ga0207650_101438222 131
412 3300025925 Ga0207650_11297963 Ga0207650_112979632 131
413 3300025926 Ga0207659_10028105 Ga0207659_100281056 131
414 3300025926 Ga0207659_10287965 Ga0207659_102879653 131
415 3300025927 Ga0207687_10003666 Ga0207687_100036667 131
416 3300025931 Ga0207644_10000052 Ga0207644_1000005292 131
417 3300025931 Ga0207644_10059162 Ga0207644_100591623 131
418 3300025931 Ga0207644_10063446 Ga0207644_100634462 131
419 3300025931 Ga0207644_10114557 Ga0207644_101145574 131
420 3300025931 Ga0207644_10185747 Ga0207644_101857472 131
421 3300025931 Ga0207644_10481092 Ga0207644_104810921 131
422 3300025932 Ga0207690_10007026 Ga0207690_100070262 131
423 3300025932 Ga0207690_10066792 Ga0207690_100667922 131
424 3300025932 Ga0207690_10070989 Ga0207690_100709893 131
425 3300025932 Ga0207690_11290549 Ga0207690_112905491 131
426 3300025933 Ga0207706_10000278 Ga0207706_1000027828 131
427 3300025933 Ga0207706_10014921 Ga0207706_100149212 131
428 3300025933 Ga0207706_10015386 Ga0207706_100153864 131
429 3300025933 Ga0207706_10045118 Ga0207706_100451183 131
430 3300025933 Ga0207706_10135438 Ga0207706_101354383 131
431 3300025933 Ga0207706_10524191 Ga0207706_105241912 131
432 3300025933 Ga0207706_10608876 Ga0207706_106088762 131
433 3300025933 Ga0207706_10628496 Ga0207706_106284962 131
434 3300025933 Ga0207706_10832642 Ga0207706_108326421 131
435 3300025933 Ga0207706_10999102 Ga0207706_109991021 131
436 3300025935 Ga0207709_10220259 Ga0207709_102202592 131
437 3300025936 Ga0207670_10049248 Ga0207670_100492486 131
438 3300025936 Ga0207670_10096032 Ga0207670_100960323 131
439 3300025937 Ga0207669_10013438 Ga0207669_100134382 131
440 3300025937 Ga0207669_10028194 Ga0207669_100281942 131
441 3300025937 Ga0207669_10037936 Ga0207669_100379362 131
442 3300025937 Ga0207669_10178597 Ga0207669_101785971 131
443 3300025938 Ga0207704_10005707 Ga0207704_100057074 131
444 3300025940 Ga0207691_10000045 Ga0207691_1000004528 131
445 3300025940 Ga0207691_10023749 Ga0207691_100237495 131
446 3300025940 Ga0207691_10029849 Ga0207691_100298495 131
447 3300025940 Ga0207691_10141127 Ga0207691_101411273 131
448 3300025941 Ga0207711_10000153 Ga0207711_1000015333 131
449 3300025941 Ga0207711_10003154 Ga0207711_100031543 131
450 3300025941 Ga0207711_10004637 Ga0207711_100046377 131
451 3300025941 Ga0207711_10007319 Ga0207711_100073198 131
452 3300025941 Ga0207711_10047780 Ga0207711_100477802 131
453 3300025942 Ga0207689_10000182 Ga0207689_1000018229 131
454 3300025942 Ga0207689_10065887 Ga0207689_100658875 131
455 3300025942 Ga0207689_10647788 Ga0207689_106477882 131
456 3300025944 Ga0207661_10467236 Ga0207661_104672362 131
457 3300025945 Ga0207679_10007082 Ga0207679_100070826 131
458 3300025945 Ga0207679_10008820 Ga0207679_100088206 131
459 3300025945 Ga0207679_10067699 Ga0207679_100676995 131
460 3300025945 Ga0207679_11762215 Ga0207679_117622151 131
461 3300025949 Ga0207667_10000603 Ga0207667_100006032 131
462 3300025949 Ga0207667_10007486 Ga0207667_1000748615 131
463 3300025949 Ga0207667_10010624 Ga0207667_1001062410 131
464 3300025949 Ga0207667_10446882 Ga0207667_104468822 131
465 3300025949 Ga0207667_11242090 Ga0207667_112420901 131
466 3300025960 Ga0207651_10004393 Ga0207651_100043936 131
467 3300025960 Ga0207651_10014814 Ga0207651_100148142 131
468 3300025960 Ga0207651_10024827 Ga0207651_100248273 131
469 3300025960 Ga0207651_10451071 Ga0207651_104510713 131
470 3300025960 Ga0207651_11023146 Ga0207651_110231462 131
471 3300025960 Ga0207651_11151170 Ga0207651_111511702 131
472 3300025961 Ga0207712_10269352 Ga0207712_102693522 131
473 3300025961 Ga0207712_11890913 Ga0207712_118909131 131
474 3300025972 Ga0207668_10000050 Ga0207668_10000050110 131
475 3300025972 Ga0207668_10006477 Ga0207668_100064776 131
476 3300025972 Ga0207668_10230583 Ga0207668_102305833 131
477 3300025981 Ga0207640_10000849 Ga0207640_1000084915 131
478 3300025981 Ga0207640_10048450 Ga0207640_100484503 131
479 3300025981 Ga0207640_10124633 Ga0207640_101246332 131
480 3300025981 Ga0207640_10280024 Ga0207640_102800241 131
481 3300025981 Ga0207640_10597310 Ga0207640_105973102 131
482 3300025981 Ga0207640_11996386 Ga0207640_119963861 131
483 3300025986 Ga0207658_10000453 Ga0207658_1000045311 131
484 3300025986 Ga0207658_10002786 Ga0207658_100027865 131
485 3300025986 Ga0207658_10013766 Ga0207658_100137663 131
486 3300025986 Ga0207658_10018210 Ga0207658_100182104 131
487 3300025986 Ga0207658_10112529 Ga0207658_101125294 131
488 3300025986 Ga0207658_10255372 Ga0207658_102553722 131
489 3300025986 Ga0207658_10393221 Ga0207658_103932212 131
490 3300025986 Ga0207658_10436661 Ga0207658_104366612 131
491 3300025986 Ga0207658_11361972 Ga0207658_113619721 131
492 3300026023 Ga0207677_10003889 Ga0207677_100038893 131
493 3300026023 Ga0207677_10505333 Ga0207677_105053332 131
494 3300026023 Ga0207677_11066296 Ga0207677_110662961 131
495 3300026035 Ga0207703_10202580 Ga0207703_102025803 131
496 3300026035 Ga0207703_10518864 Ga0207703_105188642 131
497 3300026035 Ga0207703_10536251 Ga0207703_105362512 131
498 3300026041 Ga0207639_10028229 Ga0207639_100282292 131
499 3300026041 Ga0207639_10092070 Ga0207639_100920705 131
500 3300026041 Ga0207639_10205450 Ga0207639_102054503 131
501 3300026041 Ga0207639_10245146 Ga0207639_102451462 131
502 3300026041 Ga0207639_10249195 Ga0207639_102491952 131
503 3300026041 Ga0207639_10363808 Ga0207639_103638082 131
504 3300026041 Ga0207639_10961805 Ga0207639_109618052 131
505 3300026041 Ga0207639_11759584 Ga0207639_117595841 131
506 3300026067 Ga0207678_10027360 Ga0207678_100273606 131
507 3300026067 Ga0207678_10055329 Ga0207678_100553292 131
508 3300026067 Ga0207678_10156283 Ga0207678_101562831 131
509 3300026067 Ga0207678_10278998 Ga0207678_102789982 131
510 3300026067 Ga0207678_10320777 Ga0207678_103207772 131
511 3300026067 Ga0207678_10332886 Ga0207678_103328862 131
512 3300026067 Ga0207678_10401866 Ga0207678_104018662 131
513 3300026067 Ga0207678_10759924 Ga0207678_107599242 131
514 3300026067 Ga0207678_11804206 Ga0207678_118042062 131
515 3300026078 Ga0207702_10072998 Ga0207702_100729982 131
516 3300026078 Ga0207702_10894069 Ga0207702_108940692 131
517 3300026078 Ga0207702_11033197 Ga0207702_110331972 131
518 3300026088 Ga0207641_10000205 Ga0207641_1000020545 131
519 3300026088 Ga0207641_10004210 Ga0207641_100042106 131
520 3300026088 Ga0207641_10020495 Ga0207641_100204954 131
521 3300026088 Ga0207641_10039788 Ga0207641_100397883 131
522 3300026088 Ga0207641_10318857 Ga0207641_103188572 131
523 3300026089 Ga0207648_10000222 Ga0207648_1000022235 131
524 3300026089 Ga0207648_10000477 Ga0207648_1000047748 131
525 3300026089 Ga0207648_10406247 Ga0207648_104062471 131
526 3300026089 Ga0207648_10699294 Ga0207648_106992942 131
527 3300026095 Ga0207676_10000702 Ga0207676_1000070225 131
528 3300026095 Ga0207676_10000878 Ga0207676_1000087824 131
529 3300026095 Ga0207676_10004741 Ga0207676_100047412 131
530 3300026095 Ga0207676_10030670 Ga0207676_100306704 131
531 3300026095 Ga0207676_10041510 Ga0207676_100415104 131
532 3300026095 Ga0207676_10719904 Ga0207676_107199042 131
533 3300026116 Ga0207674_10006997 Ga0207674_1000699715 131
534 3300026116 Ga0207674_10007144 Ga0207674_1000714414 131
535 3300026116 Ga0207674_10045072 Ga0207674_100450722 131
536 3300026118 Ga0207675_100017759 Ga0207675_1000177596 131
537 3300026118 Ga0207675_100634490 Ga0207675_1006344902 131
538 3300026118 Ga0207675_101092001 Ga0207675_1010920011 131
539 3300026118 Ga0207675_101435600 Ga0207675_1014356001 131
540 3300026121 Ga0207683_10518164 Ga0207683_105181642 131
541 3300026121 Ga0207683_10649869 Ga0207683_106498692 131
542 3300026142 Ga0207698_10019294 Ga0207698_100192942 131
543 3300026142 Ga0207698_10078028 Ga0207698_100780283 131
544 3300026142 Ga0207698_10093920 Ga0207698_100939202 131
545 3300026142 Ga0207698_10141609 Ga0207698_101416093 131
546 3300026142 Ga0207698_10416833 Ga0207698_104168332 131
547 3300026142 Ga0207698_10575268 Ga0207698_105752682 131
548 3300028379 Ga0268266_10000009 Ga0268266_10000009620 131
549 3300028379 Ga0268266_10001084 Ga0268266_1000108414 131
550 3300028379 Ga0268266_10898387 Ga0268266_108983872 131
551 3300028379 Ga0268266_11175193 Ga0268266_111751932 131
552 3300028380 Ga0268265_10000149 Ga0268265_1000014956 131
553 3300028380 Ga0268265_10002738 Ga0268265_100027383 131
554 3300028380 Ga0268265_10012277 Ga0268265_100122772 131
555 3300028380 Ga0268265_10021229 Ga0268265_100212292 131
556 3300028380 Ga0268265_10094838 Ga0268265_100948382 131
557 3300028380 Ga0268265_10573781 Ga0268265_105737812 131
558 3300028381 Ga0268264_10004932 Ga0268264_100049326 131
559 3300028381 Ga0268264_10012724 Ga0268264_1001272410 131
560 3300028381 Ga0268264_10054777 Ga0268264_100547774 131
561 3300028381 Ga0268264_10136528 Ga0268264_101365282 131
562 3300028381 Ga0268264_10345616 Ga0268264_103456162 131
563 3300028381 Ga0268264_10408759 Ga0268264_104087592 131
564 3300031456 Ga0307513_10136335 Ga0307513_101363352 131
565 3300031548 Ga0307408_100007319 Ga0307408_1000073194 131
566 3300031548 Ga0307408_100090381 Ga0307408_1000903812 131
567 3300031548 Ga0307408_100122842 Ga0307408_1001228423 131
568 3300031548 Ga0307408_101116847 Ga0307408_1011168471 131
569 3300031731 Ga0307405_10540024 Ga0307405_105400241 131
570 3300031824 Ga0307413_10011502 Ga0307413_100115023 131
571 3300031824 Ga0307413_10021142 Ga0307413_100211423 131
572 3300031824 Ga0307413_10054220 Ga0307413_100542202 131
573 3300031824 Ga0307413_10624651 Ga0307413_106246512 131
574 3300031824 Ga0307413_11728035 Ga0307413_117280352 131
575 3300031852 Ga0307410_10000294 Ga0307410_1000029420 131
576 3300031852 Ga0307410_10031350 Ga0307410_100313504 131
577 3300031852 Ga0307410_10127667 Ga0307410_101276672 131
578 3300031852 Ga0307410_10336432 Ga0307410_103364322 131
579 3300031852 Ga0307410_10539211 Ga0307410_105392111 131
580 3300031852 Ga0307410_10736831 Ga0307410_107368311 131
581 3300031852 Ga0307410_11713883 Ga0307410_117138832 131
582 3300031901 Ga0307406_10026936 Ga0307406_100269363 131
583 3300031901 Ga0307406_11346552 Ga0307406_113465521 131
584 3300031903 Ga0307407_10153128 Ga0307407_101531282 131
585 3300031903 Ga0307407_11052616 Ga0307407_110526161 131
586 3300031911 Ga0307412_10104276 Ga0307412_101042765 131
587 3300031995 Ga0307409_100004079 Ga0307409_1000040793 131
588 3300031995 Ga0307409_100023780 Ga0307409_1000237802 131
589 3300031995 Ga0307409_100034240 Ga0307409_1000342402 131
590 3300031995 Ga0307409_100124178 Ga0307409_1001241782 131
591 3300031995 Ga0307409_100185104 Ga0307409_1001851045 131
592 3300031995 Ga0307409_102592124 Ga0307409_1025921242 131
593 3300032002 Ga0307416_100008181 Ga0307416_1000081812 131
594 3300032002 Ga0307416_100015063 Ga0307416_1000150632 131
595 3300032002 Ga0307416_100776354 Ga0307416_1007763541 131
596 3300032004 Ga0307414_10001887 Ga0307414_100018873 131
597 3300032004 Ga0307414_10002479 Ga0307414_100024794 131
598 3300032004 Ga0307414_10037950 Ga0307414_100379506 131
599 3300032004 Ga0307414_10126072 Ga0307414_101260721 131
600 3300032004 Ga0307414_11231579 Ga0307414_112315791 131
601 3300032005 Ga0307411_10003224 Ga0307411_100032244 131
602 3300032005 Ga0307411_10010236 Ga0307411_100102363 131
603 3300032005 Ga0307411_10031850 Ga0307411_100318502 131
604 3300032005 Ga0307411_10519482 Ga0307411_105194822 131
605 3300032005 Ga0307411_10618040 Ga0307411_106180402 131
606 3300032005 Ga0307411_11808158 Ga0307411_118081581 131
607 3300032126 Ga0307415_100001215 Ga0307415_1000012155 131
608 3300032126 Ga0307415_100064778 Ga0307415_1000647782 131
609 3300032126 Ga0307415_100862530 Ga0307415_1008625302 131
610 3300035691 Ga0373931_0435445 Ga0373931_0435445_71_466 131
611 3300037312 Ga0395899_0047184 Ga0395899_0047184_1236_1631 131
612 3300037312 Ga0395899_0074345 Ga0395899_0074345_932_1327 131
613 3300037312 Ga0395899_0098646 Ga0395899_0098646_1698_2099 131
614 3300037312 Ga0395899_0128456 Ga0395899_0128456_815_1210 131
615 3300037312 Ga0395899_0166143 Ga0395899_0166143_621_1016 131
616 3300037418 Ga0395900_0052135 Ga0395900_0052135_2893_3288 131
617 3300037418 Ga0395900_0079130 Ga0395900_0079130_1332_1727 131
618 3300037418 Ga0395900_0099438 Ga0395900_0099438_401_796 131
619 3300037418 Ga0395900_0245655 Ga0395900_0245655_833_1228 131
620 3300037418 Ga0395900_0314478 Ga0395900_0314478_440_835 131
621 3300037418 Ga0395900_0417574 Ga0395900_0417574_270_665 131
622 3300037418 Ga0395900_0572578 Ga0395900_0572578_556_951 131
623 3300037418 Ga0395900_0602294 Ga0395900_0602294_324_719 131
624 3300037418 Ga0395900_0622435 Ga0395900_0622435_278_673 131
625 3300037418 Ga0395900_0654002 Ga0395900_0654002_245_640 131
626 3300037418 Ga0395900_1444797 Ga0395900_1444797_100_495 131
627 3300037466 Ga0395898_0124483 Ga0395898_0124483_146_541 131
628 3300037466 Ga0395898_0236923 Ga0395898_0236923_507_902 131
629 3300037466 Ga0395898_0247117 Ga0395898_0247117_278_673 131
630 3300037466 Ga0395898_1384655 Ga0395898_1384655_140_535 131
631 3300037471 Ga0395905_0007984 Ga0395905_0007984_2452_2847 131
632 3300037471 Ga0395905_0012758 Ga0395905_0012758_2097_2492 131
633 3300037471 Ga0395905_0041636 Ga0395905_0041636_1577_1972 131
634 3300037471 Ga0395905_0042251 Ga0395905_0042251_2355_2750 131
635 3300037471 Ga0395905_0085792 Ga0395905_0085792_640_1035 131
636 3300037471 Ga0395905_0091148 Ga0395905_0091148_1594_1989 131
637 3300037471 Ga0395905_0100758 Ga0395905_0100758_200_595 131
638 3300037471 Ga0395905_0158392 Ga0395905_0158392_541_936 131
639 3300037471 Ga0395905_0199182 Ga0395905_0199182_502_897 131
640 3300037471 Ga0395905_0315488 Ga0395905_0315488_965_1360 131
641 3300037471 Ga0395905_0345006 Ga0395905_0345006_65_460 131
642 3300037471 Ga0395905_0617162 Ga0395905_0617162_266_661 131
643 3300037471 Ga0395905_0894553 Ga0395905_0894553_264_659 131
644 3300037471 Ga0395905_1684179 Ga0395905_1684179_130_525 131
645 3300038443 Ga0395901_0045185 Ga0395901_0045185_3573_3968 131
646 3300038443 Ga0395901_0052588 Ga0395901_0052588_2127_2522 131
647 3300038443 Ga0395901_0055707 Ga0395901_0055707_3036_3431 131
648 3300038443 Ga0395901_0110501 Ga0395901_0110501_1881_2276 131
649 3300038443 Ga0395901_0317203 Ga0395901_0317203_851_1246 131
650 3300038443 Ga0395901_1742331 Ga0395901_1742331_21_416 131
651 3300038443 Ga0395901_2009600 Ga0395901_2009600_60_455 131
652 3300039437 Ga0436365_0616364 Ga0436365_0616364_400_795 131
653 3300044656 Ga0466969_0010103 Ga0466969_0010103_1911_2306 131
654 3300044658 Ga0466972_0122315 Ga0466972_0122315_703_1146 131
655 3300044694 Ga0466963_0023577 Ga0466963_0023577_635_1030 131
656 3300044694 Ga0466963_0518154 Ga0466963_0518154_400_795 131
657 3300044694 Ga0466963_0964393 Ga0466963_0964393_160_555 131
658 3300044765 Ga0466970_0276733 Ga0466970_0276733_463_906 131
659 3300044842 Ga0466957_0713726 Ga0466957_0713726_35_430 131
660 3300045049 Ga0466959_0284970 Ga0466959_0284970_103_498 131
661 3300045051 Ga0451576_2664736 Ga0451576_2664736_49_444 131
662 3300045836 Ga0466958_0044797 Ga0466958_0044797_1814_2209 131
663 3300045976 Ga0466967_0121344 Ga0466967_0121344_757_1170 131
664 3300045976 Ga0466967_0360583 Ga0466967_0360583_76_471 131
665 3300045976 Ga0466967_1294656 Ga0466967_1294656_34_429 131
666 3300045976 Ga0466967_2050601 Ga0466967_2050601_131_526 131
667 3300046452 Ga0495617_083767 Ga0495617_083767_493_894 131
668 3300046459 Ga0495629_0255686 Ga0495629_0255686_67_462 131
669 3300046460 Ga0495638_0080447 Ga0495638_0080447_441_908 131
670 3300046474 Ga0495605_0247781 Ga0495605_0247781_22_417 131
671 3300046557 Ga0495622_0016233 Ga0495622_0016233_2075_2476 131
672 3300046616 Ga0495668_0038263 Ga0495668_0038263_169_564 131
673 3300046616 Ga0495668_0042044 Ga0495668_0042044_1277_1744 131
674 3300046616 Ga0495668_0151708 Ga0495668_0151708_231_626 131
675 3300046648 Ga0495611_0141707 Ga0495611_0141707_570_1037 131
676 3300046660 Ga0495625_0013331 Ga0495625_0013331_4606_5073 131
677 3300046660 Ga0495625_0116964 Ga0495625_0116964_242_637 131
678 3300046660 Ga0495625_0241179 Ga0495625_0241179_735_1139 131
679 3300046660 Ga0495625_0445590 Ga0495625_0445590_101_502 131
680 3300046674 Ga0495588_0257948 Ga0495588_0257948_323_718 131
681 3300046684 Ga0495669_0059532 Ga0495669_0059532_775_1170 131
682 3300046684 Ga0495669_0358940 Ga0495669_0358940_108_503 131
683 3300047445 Ga0495677_0096589 Ga0495677_0096589_504_899 131
684 3300048903 Ga0496100_0115291 Ga0496100_0115291_712_1107 131
685 3300048904 Ga0496101_0265240 Ga0496101_0265240_83_478 131
686 3300048904 Ga0496101_0299489 Ga0496101_0299489_12_407 131
687 3300048904 Ga0496101_0601246 Ga0496101_0601246_184_579 131
688 3300048905 Ga0496102_0883830 Ga0496102_0883830_192_587 131
689 3300048906 Ga0496103_0702866 Ga0496103_0702866_163_558 131
690 3300048909 Ga0496106_0325797 Ga0496106_0325797_186_581 131
691 3300048910 Ga0496107_0074078 Ga0496107_0074078_883_1278 131
692 3300048910 Ga0496107_0133434 Ga0496107_0133434_22_417 131
693 3300048910 Ga0496107_0219518 Ga0496107_0219518_48_443 131
694 3300048910 Ga0496107_0319613 Ga0496107_0319613_674_1069 131
695 3300048910 Ga0496107_0671866 Ga0496107_0671866_212_607 131
696 3300048911 Ga0496108_0147581 Ga0496108_0147581_1180_1575 131
697 3300048912 Ga0496109_0384718 Ga0496109_0384718_859_1254 131
698 3300048912 Ga0496109_1042603 Ga0496109_1042603_216_611 131
699 3300048914 Ga0496111_0347342 Ga0496111_0347342_212_607 131
700 3300048915 Ga0496112_0021492 Ga0496112_0021492_1264_1659 131
701 3300048915 Ga0496112_0231321 Ga0496112_0231321_107_502 131
702 3300048915 Ga0496112_0695931 Ga0496112_0695931_401_796 131
703 3300048916 Ga0496113_0031718 Ga0496113_0031718_3083_3478 131
704 3300048917 Ga0496114_0012689 Ga0496114_0012689_679_1074 131
705 3300048917 Ga0496114_0761960 Ga0496114_0761960_416_811 131
706 3300048918 Ga0496115_0009567 Ga0496115_0009567_428_823 131
707 3300048918 Ga0496115_0304248 Ga0496115_0304248_137_532 131
708 3300048927 Ga0496124_0891598 Ga0496124_0891598_105_506 131
709 3300049571 Ga0501034_0625661 Ga0501034_0625661_137_547 131
710 3300049573 Ga0501037_0048103 Ga0501037_0048103_431_826 131
711 3300049574 Ga0501038_0016555 Ga0501038_0016555_3391_3786 131
712 3300049575 Ga0501039_0609705 Ga0501039_0609705_177_572 131
713 3300049579 Ga0501043_0031737 Ga0501043_0031737_1191_1586 131
714 3300049580 Ga0501046_0163598 Ga0501046_0163598_549_944 131
715 3300049581 Ga0501047_0030675 Ga0501047_0030675_319_714 131
716 3300049583 Ga0501067_0047296 Ga0501067_0047296_252_647 131
717 3300049584 Ga0501068_0251906 Ga0501068_0251906_37_432 131
718 3300049589 Ga0501073_0013519 Ga0501073_0013519_2449_2844 131
719 3300049589 Ga0501073_0393653 Ga0501073_0393653_64_459 131
720 3300049590 Ga0501074_0106547 Ga0501074_0106547_403_798 131
721 3300049591 Ga0501075_1232063 Ga0501075_1232063_145_540 131
722 3300049674 Ga0501242_051722 Ga0501242_051722_23_418 131
723 3300049683 Ga0501253_165979 Ga0501253_165979_121_516 131
724 3300049741 Ga0501079_0274399 Ga0501079_0274399_64_459 131
725 3300049741 Ga0501079_1139578 Ga0501079_1139578_203_598 131
726 3300049742 Ga0501080_0025952 Ga0501080_0025952_2641_3036 131
727 3300049742 Ga0501080_0043551 Ga0501080_0043551_2367_2762 131
728 3300049744 Ga0501083_0018333 Ga0501083_0018333_850_1245 131
729 3300049758 Ga0501241_007349 Ga0501241_007349_1564_1971 131
730 3300049759 Ga0501262_081513 Ga0501262_081513_60_455 131
731 3300049765 Ga0501268_176367 Ga0501268_176367_47_442 131
732 3300049822 Ga0501035_0541344 Ga0501035_0541344_310_705 131
733 3300049823 Ga0501044_0044001 Ga0501044_0044001_2380_2775 131
734 3300049850 Ga0501204_040309 Ga0501204_040309_149_544 131
735 3300050508 nmdc:mga09592_295816_c1 nmdc:mga09592_295816_c1_201_596 131
736 3300053087 Ga0500643_029458 Ga0500643_029458_27_494 131
737 3300053087 Ga0500643_043433 Ga0500643_043433_85_552 131
738 3300053088 Ga0500644_0053585 Ga0500644_0053585_106_510 131
739 3300053104 Ga0500556_0000144 Ga0500556_0000144_48856_49323 131
740 3300053122 Ga0500608_186366 Ga0500608_186366_457_858 131
741 3300053130 Ga0500642_0000001 Ga0500642_0000001_351318_351755 131
742 3300053134 Ga0500658_0000147 Ga0500658_0000147_6729_7124 131
743 3300053136 Ga0500559_0069243 Ga0500559_0069243_664_1065 131
744 3300053155 Ga0500620_005699 Ga0500620_005699_2094_2489 131
745 3300053730 Ga0500645_000414 Ga0500645_000414_19329_19736 131
746 3300054114 Ga0501084_0581921 Ga0501084_0581921_163_558 131
747 3300060353 Ga0501082_0130738 Ga0501082_0130738_419_814 131
748 3300061719 Ga0466962_0083666 Ga0466962_0083666_288_683 131
749 3300061719 Ga0466962_0508108 Ga0466962_0508108_172_567 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

27

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.8427 3 131
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.8298 3 130
6r7d-assembly3.cif.gz_H crystal structure of ltc4s in complex with az13690257 0.7999 3 130
3hkk-assembly1.cif.gz_A structure of human leukotriene c4 synthase in complex with glutathione sulfonate 0.7924 3 130
3leo-assembly1.cif.gz_A structure of human leukotriene c4 synthase mutant r31q in complex with glutathione 0.791 3 130
ID Description Score Start End Superfamily
af_A1A5Y1_7_139_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8427 3 130 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8263 3 128 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7922 3 128 1.20.120.550
3leoA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.791 3 130 1.20.120.550
4jrzA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7907 3 130 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A836P0J2-F1-model_v4 Membrane protein 0.9679 47 131 GO:0016020
AF-M5CKQ2-F1-model_v4 deleted 0.9548 1 127
AF-A0A149QFF4-F1-model_v4 Membrane protein 0.9546 1 128 GO:0016020
AF-A0A246HHW7-F1-model_v4 MAPEG family protein 0.9536 1 128 GO:0016020
AF-A0A7V7PLX7-F1-model_v4 MAPEG family protein 0.9517 1 127 GO:0016020

Feature Viewer

pLDDT pTM Quality
95.36 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map