F478993

General Info

Members Datasets Scaffolds Average Seq Length
749 385 1496 132

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100477748|Ga0070669_1004777481
Length 148
Sequence LCSFNPQTNFMITKISHTSLFVTDQEKAYDFYINKLGFKVHTDVKMDNGFRWLTVTAPEQPELEIVLFPAKNNGFDEETNKALQLLLEKGAMGAGAMHTPDCRATYEELKAKGVTFKSEPKEQFYGIEAIITDGCGNWFSMTQPKEGF

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
138 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
213 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
214 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
237 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
270 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
271 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
274 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
275 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
364 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
365 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
366 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
367 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
371 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.93
Metatranscriptomes 5.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 3.2
Rhizosphere 90.25
Stem 0
Stem Tuber 0
Unclassified 5.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100477748 3300005353 Bacteria 1031
2 JGI24745J21846_1004033 3300002073 Bacteria 1558
3 JGI24748J21848_1035448 3300002074 Bacteria 625
4 rootH1_10088351 3300003316 Bacteria 3728
5 rootH2_10016315 3300003320 Bacteria 3833
6 rootL2_10167048 3300003322 Bacteria 4792
7 rootL2_10221496 3300003322 Viruses 1185
8 rootH1_10056336 3300003323 Bacteria 10897
9 Ga0058861_10614056 3300004800 Bacteria 556
10 Ga0065704_10117726 3300005289 Unclassified 1829
11 Ga0065712_10700569 3300005290 Bacteria 547
12 Ga0070658_10422367 3300005327 Bacteria 1147
13 Ga0070658_10828599 3300005327 Bacteria 804
14 Ga0070683_100117695 3300005329 Bacteria 2509
15 Ga0070683_100284712 3300005329 Bacteria 1572
16 Ga0070690_100005680 3300005330 Bacteria 7024
17 Ga0070690_100209669 3300005330 Bacteria 1360
18 Ga0070670_100162390 3300005331 Bacteria 1936
19 Ga0070670_100474455 3300005331 Bacteria 1110
20 Ga0068869_100037532 3300005334 Bacteria 3445
21 Ga0070666_10071957 3300005335 Bacteria 2354
22 Ga0070666_10097272 3300005335 Bacteria 2026
23 Ga0070666_10188642 3300005335 Bacteria 1448
24 Ga0070680_100129305 3300005336 Bacteria 2112
25 Ga0070682_100148291 3300005337 Bacteria 1607
26 Ga0070682_100324885 3300005337 Bacteria 1138
27 Ga0070682_102056377 3300005337 Bacteria 503
28 Ga0068868_100018789 3300005338 Bacteria 5170
29 Ga0068868_100069163 3300005338 Bacteria 2813
30 Ga0068868_100457941 3300005338 Bacteria 1110
31 Ga0070660_100190611 3300005339 Bacteria 1661
32 Ga0070660_100203750 3300005339 Bacteria 1605
33 Ga0070660_100861812 3300005339 Bacteria 763
34 Ga0070689_100326481 3300005340 Bacteria 1283
35 Ga0070689_101807647 3300005340 Bacteria 557
36 Ga0070691_10088557 3300005341 Bacteria 1524
37 Ga0070687_100584409 3300005343 Bacteria 765
38 Ga0070661_100101749 3300005344 Bacteria 2138
39 Ga0070661_100126292 3300005344 Bacteria 1919
40 Ga0070661_100990066 3300005344 Bacteria 697
41 Ga0070692_10013034 3300005345 Bacteria 3867
42 Ga0070669_100200732 3300005353 Bacteria 1569
43 Ga0070675_100193201 3300005354 Bacteria 1764
44 Ga0070671_100044063 3300005355 Bacteria 3707
45 Ga0070671_100052927 3300005355 Bacteria 3375
46 Ga0070674_100792676 3300005356 Bacteria 818
47 Ga0070674_100887440 3300005356 Bacteria 776
48 Ga0070673_100171372 3300005364 Bacteria 1853
49 Ga0070673_100606590 3300005364 Bacteria 999
50 Ga0070673_100749627 3300005364 Bacteria 899
51 Ga0070688_100070236 3300005365 Bacteria 2238
52 Ga0070688_101449584 3300005365 Bacteria 557
53 Ga0070659_100092902 3300005366 Bacteria 2420
54 Ga0070667_100082679 3300005367 Bacteria 2750
55 Ga0070667_100123232 3300005367 Bacteria 2257
56 Ga0070667_100273343 3300005367 Bacteria 1515
57 Ga0070703_10007183 3300005406 Bacteria 3127
58 Ga0070703_10192767 3300005406 Bacteria 795
59 Ga0070709_10000355 3300005434 Bacteria 28324
60 Ga0070709_10126689 3300005434 Unclassified 1738
61 Ga0070709_10331934 3300005434 Bacteria 1119
62 Ga0070709_11259895 3300005434 Bacteria 596
63 Ga0070714_100038920 3300005435 Bacteria 4001
64 Ga0070714_100183217 3300005435 Bacteria 1906
65 Ga0070714_100291866 3300005435 Bacteria 1518
66 Ga0070714_100613366 3300005435 Bacteria 1045
67 Ga0070714_100901144 3300005435 Bacteria 859
68 Ga0070714_101840103 3300005435 Bacteria 591
69 Ga0070713_100001016 3300005436 Bacteria 17953
70 Ga0070713_101550420 3300005436 Bacteria 643
71 Ga0070710_10014671 3300005437 Bacteria 3948
72 Ga0070710_10262107 3300005437 Bacteria 1115
73 Ga0070710_10315883 3300005437 Bacteria 1024
74 Ga0070701_10820183 3300005438 Bacteria 636
75 Ga0070711_100000185 3300005439 Bacteria 32884
76 Ga0070711_100043172 3300005439 Bacteria 3052
77 Ga0070711_100197600 3300005439 Bacteria 1550
78 Ga0070711_100316864 3300005439 Bacteria 1245
79 Ga0070705_100056053 3300005440 Bacteria 2319
80 Ga0070705_101313772 3300005440 Bacteria 600
81 Ga0070700_100130968 3300005441 Bacteria 1693
82 Ga0070694_100314417 3300005444 Bacteria 1204
83 Ga0070708_100086105 3300005445 Bacteria 2853
84 Ga0070708_100089783 3300005445 Bacteria 2796
85 Ga0070708_100206226 3300005445 Bacteria 1841
86 Ga0070708_100295829 3300005445 Bacteria 1524
87 Ga0070708_100438871 3300005445 Bacteria 1231
88 Ga0070708_100514161 3300005445 Bacteria 1129
89 Ga0070708_101320497 3300005445 Bacteria 674
90 Ga0070663_100005015 3300005455 Bacteria 7818
91 Ga0070678_100391028 3300005456 Bacteria 1206
92 Ga0070678_100970163 3300005456 Bacteria 780
93 Ga0070662_100250831 3300005457 Bacteria 1423
94 Ga0070662_100646229 3300005457 Bacteria 892
95 Ga0070681_10081160 3300005458 Bacteria 3199
96 Ga0070681_10314608 3300005458 Bacteria 1475
97 Ga0070681_10719264 3300005458 Bacteria 914
98 Ga0068867_100215206 3300005459 Bacteria 1545
99 Ga0068867_100454069 3300005459 Bacteria 1093
100 Ga0070685_10171021 3300005466 Bacteria 1392
101 Ga0070685_10440534 3300005466 Bacteria 910
102 Ga0070706_100022427 3300005467 Bacteria 5812
103 Ga0070706_100024327 3300005467 Bacteria 5575
104 Ga0070706_100818074 3300005467 Bacteria 862
105 Ga0070706_101467642 3300005467 Bacteria 624
106 Ga0070706_101982083 3300005467 Bacteria 528
107 Ga0070707_100020453 3300005468 Bacteria 6243
108 Ga0070707_100131724 3300005468 Bacteria 2431
109 Ga0070707_100943344 3300005468 Bacteria 828
110 Ga0070707_101124702 3300005468 Bacteria 751
111 Ga0070707_101767703 3300005468 Bacteria 585
112 Ga0070698_100018752 3300005471 Bacteria 7283
113 Ga0070698_100260753 3300005471 Bacteria 1665
114 Ga0070698_100414824 3300005471 Bacteria 1280
115 Ga0070698_101677376 3300005471 Bacteria 588
116 Ga0070699_100043316 3300005518 Bacteria 3896
117 Ga0070699_100147336 3300005518 Bacteria 2080
118 Ga0070699_100316184 3300005518 Bacteria 1403
119 Ga0070699_100344045 3300005518 Bacteria 1342
120 Ga0070699_100628797 3300005518 Bacteria 979
121 Ga0070679_101269574 3300005530 Bacteria 682
122 Ga0070684_100209959 3300005535 Bacteria 1774
123 Ga0070684_100320326 3300005535 Bacteria 1424
124 Ga0070684_101239389 3300005535 Bacteria 702
125 Ga0070697_100013062 3300005536 Bacteria 6509
126 Ga0070697_100148230 3300005536 Bacteria 1976
127 Ga0070697_100448571 3300005536 Unclassified 1123
128 Ga0070697_101187974 3300005536 Bacteria 680
129 Ga0068853_100286655 3300005539 Bacteria 1519
130 Ga0068853_100475878 3300005539 Bacteria 1177
131 Ga0068853_100499949 3300005539 Bacteria 1148
132 Ga0070672_100385687 3300005543 Bacteria 1199
133 Ga0070686_100376465 3300005544 Bacteria 1073
134 Ga0070695_100246442 3300005545 Bacteria 1298
135 Ga0070695_100579634 3300005545 Bacteria 878
136 Ga0070696_100180339 3300005546 Bacteria 1566
137 Ga0070696_100504309 3300005546 Bacteria 963
138 Ga0070693_100000041 3300005547 Bacteria 49532
139 Ga0070693_100044138 3300005547 Bacteria 2521
140 Ga0070693_100348388 3300005547 Bacteria 1013
141 Ga0070693_100643514 3300005547 Bacteria 770
142 Ga0070665_100757126 3300005548 Bacteria 984
143 Ga0070665_101020549 3300005548 Unclassified 839
144 Ga0070665_101592977 3300005548 Bacteria 661
145 Ga0070704_100012379 3300005549 Bacteria 5269
146 Ga0068855_100241224 3300005563 Bacteria 2020
147 Ga0068855_100623453 3300005563 Bacteria 1161
148 Ga0070664_100612527 3300005564 Bacteria 1010
149 Ga0070664_100867514 3300005564 Bacteria 845
150 Ga0070664_101188334 3300005564 Unclassified 719
151 Ga0068854_100290816 3300005578 Bacteria 1318
152 Ga0068856_100666407 3300005614 Bacteria 1061
153 Ga0070702_100044990 3300005615 Bacteria 2495
154 Ga0070702_101103225 3300005615 Bacteria 634
155 Ga0070702_101347845 3300005615 Bacteria 581
156 Ga0068852_100018334 3300005616 Bacteria 5514
157 Ga0068852_100081620 3300005616 Bacteria 2871
158 Ga0068852_100298604 3300005616 Bacteria 1558
159 Ga0068852_100398896 3300005616 Bacteria 1353
160 Ga0068852_101050451 3300005616 Bacteria 834
161 Ga0068852_101179987 3300005616 Bacteria 786
162 Ga0068859_100213561 3300005617 Bacteria 2016
163 Ga0068859_100254232 3300005617 Bacteria 1847
164 Ga0068859_100499895 3300005617 Bacteria 1311
165 Ga0068859_100582864 3300005617 Unclassified 1212
166 Ga0068864_101699369 3300005618 Bacteria 636
167 Ga0068866_10121649 3300005718 Bacteria 1472
168 Ga0068866_10288874 3300005718 Bacteria 1019
169 Ga0068866_10820838 3300005718 Bacteria 648
170 Ga0068861_100028272 3300005719 Bacteria 4091
171 Ga0068861_101224984 3300005719 Bacteria 727
172 Ga0068851_10458332 3300005834 Bacteria 759
173 Ga0068870_10234154 3300005840 Bacteria 1131
174 Ga0068863_100040002 3300005841 Bacteria 4459
175 Ga0068863_101356195 3300005841 Bacteria 718
176 Ga0068858_100006749 3300005842 Bacteria 11171
177 Ga0068858_100045526 3300005842 Bacteria 4066
178 Ga0068858_101137789 3300005842 Bacteria 767
179 Ga0068860_100006592 3300005843 Bacteria 11657
180 Ga0068860_100131109 3300005843 Bacteria 2406
181 Ga0068860_100157383 3300005843 Bacteria 2190
182 Ga0068862_100548347 3300005844 Bacteria 1104
183 Ga0068862_100963096 3300005844 Bacteria 842
184 Ga0068862_101116209 3300005844 Bacteria 784
185 Ga0081539_10159233 3300005985 Bacteria 1078
186 Ga0070717_10002209 3300006028 Bacteria 13690
187 Ga0070717_10002763 3300006028 Bacteria 12416
188 Ga0070717_10008386 3300006028 Bacteria 7717
189 Ga0070717_10101833 3300006028 Bacteria 2439
190 Ga0070717_10877640 3300006028 Bacteria 816
191 Ga0070717_11202947 3300006028 Bacteria 689
192 Ga0075368_10062759 3300006042 Bacteria 1490
193 Ga0075364_10366389 3300006051 Bacteria 982
194 Ga0070715_10009822 3300006163 Bacteria 3389
195 Ga0070716_100078130 3300006173 Bacteria 1967
196 Ga0070716_101448384 3300006173 Unclassified 560
197 Ga0070712_100001530 3300006175 Bacteria 14108
198 Ga0070712_100013853 3300006175 Bacteria 5161
199 Ga0070712_100137847 3300006175 Bacteria 1858
200 Ga0075362_10668751 3300006177 Bacteria 540
201 Ga0075367_10081226 3300006178 Bacteria 1961
202 Ga0097621_100001121 3300006237 Bacteria 18657
203 Ga0075370_10701814 3300006353 Bacteria 615
204 Ga0068871_100000554 3300006358 Bacteria 25473
205 Ga0068871_100303750 3300006358 Bacteria 1401
206 Ga0068871_100667874 3300006358 Bacteria 950
207 Ga0075428_100445162 3300006844 Bacteria 1388
208 Ga0075428_102653846 3300006844 Bacteria 511
209 Ga0075430_100137539 3300006846 Bacteria 2035
210 Ga0075430_100517128 3300006846 Bacteria 985
211 Ga0075431_100236123 3300006847 Bacteria 1861
212 Ga0075433_10004003 3300006852 Bacteria 11403
213 Ga0075433_10142286 3300006852 Bacteria 2132
214 Ga0075434_100407908 3300006871 Bacteria 1380
215 Ga0075434_101760994 3300006871 Bacteria 627
216 Ga0075429_100176338 3300006880 Bacteria 1873
217 Ga0075429_100380962 3300006880 Bacteria 1235
218 Ga0075429_100564077 3300006880 Bacteria 998
219 Ga0068865_100032826 3300006881 Bacteria 3472
220 Ga0068865_100890048 3300006881 Bacteria 774
221 Ga0075436_100058904 3300006914 Bacteria 2653
222 Ga0075436_100190285 3300006914 Bacteria 1452
223 Ga0097620_100254248 3300006931 Bacteria 1847
224 Ga0097620_100499926 3300006931 Bacteria 1311
225 Ga0097620_100582924 3300006931 Unclassified 1212
226 Ga0075435_101036261 3300007076 Bacteria 717
227 Ga0099794_10041309 3300007265 Bacteria 2196
228 Ga0099794_10465390 3300007265 Bacteria 664
229 Ga0105251_10174536 3300009011 Bacteria 968
230 Ga0105244_10217296 3300009036 Bacteria 897
231 Ga0105240_10376103 3300009093 Bacteria 1605
232 Ga0105240_11916647 3300009093 Unclassified 616
233 Ga0111539_10031448 3300009094 Bacteria 6447
234 Ga0111539_10337480 3300009094 Bacteria 1754
235 Ga0105245_10012430 3300009098 Bacteria 7409
236 Ga0105245_10842136 3300009098 Bacteria 957
237 Ga0105247_10629219 3300009101 Bacteria 799
238 Ga0105247_10834842 3300009101 Bacteria 706
239 Ga0114129_10430656 3300009147 Bacteria 1733
240 Ga0114129_12016705 3300009147 Bacteria 697
241 Ga0105243_10166282 3300009148 Bacteria 1906
242 Ga0105241_10000365 3300009174 Bacteria 34388
243 Ga0105241_10062088 3300009174 Bacteria 2880
244 Ga0105241_10071279 3300009174 Bacteria 2697
245 Ga0105241_10286364 3300009174 Bacteria 1409
246 Ga0105241_10316092 3300009174 Bacteria 1345
247 Ga0105242_10083423 3300009176 Bacteria 2676
248 Ga0105242_10760784 3300009176 Bacteria 955
249 Ga0105248_10611425 3300009177 Bacteria 1230
250 Ga0105248_11277738 3300009177 Bacteria 830
251 Ga0105237_10263816 3300009545 Bacteria 1725
252 Ga0105237_10280608 3300009545 Bacteria 1668
253 Ga0105237_10668312 3300009545 Bacteria 1045
254 Ga0105237_11029390 3300009545 Bacteria 830
255 Ga0105238_10755230 3300009551 Bacteria 987
256 Ga0105249_10082616 3300009553 Bacteria 2989
257 Ga0105249_10328876 3300009553 Bacteria 1542
258 Ga0105249_12277816 3300009553 Bacteria 614
259 Ga0105239_10982985 3300010375 Bacteria 970
260 Ga0157373_10037353 3300013100 Bacteria 3482
261 Ga0157373_10347341 3300013100 Bacteria 1058
262 Ga0157373_10650520 3300013100 Bacteria 770
263 Ga0157371_10061320 3300013102 Bacteria 2667
264 Ga0157371_10130584 3300013102 Bacteria 1787
265 Ga0157369_10016049 3300013105 Bacteria 8427
266 Ga0157369_10073332 3300013105 Bacteria 3673
267 Ga0157369_10133670 3300013105 Bacteria 2627
268 Ga0157374_10038676 3300013296 Bacteria 4386
269 Ga0157374_10116594 3300013296 Bacteria 2573
270 Ga0157374_10161027 3300013296 Unclassified 2186
271 Ga0157374_10887642 3300013296 Bacteria 909
272 Ga0157374_11660905 3300013296 Bacteria 663
273 Ga0157378_10000108 3300013297 Bacteria 78677
274 Ga0157378_10006544 3300013297 Bacteria 10185
275 Ga0157378_10179835 3300013297 Bacteria 1989
276 Ga0157378_10256502 3300013297 Bacteria 1676
277 Ga0157378_10890447 3300013297 Bacteria 920
278 Ga0163162_10004606 3300013306 Bacteria 13287
279 Ga0163162_10699142 3300013306 Bacteria 1136
280 Ga0163162_11476121 3300013306 Bacteria 774
281 Ga0157372_10009307 3300013307 Bacteria 10448
282 Ga0157372_10033302 3300013307 Bacteria 5658
283 Ga0157372_10034697 3300013307 Bacteria 5549
284 Ga0157372_10247953 3300013307 Bacteria 2067
285 Ga0157372_10248458 3300013307 Bacteria 2065
286 Ga0157372_10434524 3300013307 Unclassified 1530
287 Ga0157372_10494325 3300013307 Bacteria 1426
288 Ga0157372_10609628 3300013307 Bacteria 1272
289 Ga0157372_11016242 3300013307 Bacteria 960
290 Ga0157375_10025362 3300013308 Bacteria 5507
291 Ga0157380_10201515 3300014326 Bacteria 1766
292 Ga0157377_10402996 3300014745 Bacteria 932
293 Ga0157379_11100098 3300014968 Bacteria 761
294 Ga0157376_10400513 3300014969 Bacteria 1327
295 Ga0157376_10590583 3300014969 Bacteria 1104
296 Ga0182007_10318231 3300015262 Unclassified 576
297 Ga0182005_1249086 3300015265 Bacteria 549
298 Ga0163161_10045993 3300017792 Bacteria 3148
299 Ga0197907_10124161 3300020069 Bacteria 602
300 Ga0197907_10174520 3300020069 Bacteria 1077
301 Ga0197907_11474041 3300020069 Bacteria 522
302 Ga0206356_10165377 3300020070 Bacteria 659
303 Ga0206356_10598576 3300020070 Bacteria 517
304 Ga0206356_11740095 3300020070 Bacteria 632
305 Ga0206349_1863247 3300020075 Bacteria 518
306 Ga0206355_1128891 3300020076 Bacteria 822
307 Ga0206351_10399282 3300020077 Bacteria 829
308 Ga0206351_10993264 3300020077 Bacteria 591
309 Ga0206350_10271088 3300020080 Bacteria 543
310 Ga0206350_10828970 3300020080 Bacteria 957
311 Ga0206353_10588230 3300020082 Bacteria 1054
312 Ga0213872_10000669 3300021361 Bacteria 25970
313 Ga0213874_10060208 3300021377 Bacteria 1187
314 Ga0213875_10029958 3300021388 Bacteria 2580
315 Ga0213871_10047713 3300021441 Bacteria 1165
316 Ga0224712_10292352 3300022467 Bacteria 760
317 Ga0228598_1070672 3300024227 Bacteria 698
318 Ga0207656_10019408 3300025321 Bacteria 2689
319 Ga0207653_10007242 3300025885 Bacteria 3460
320 Ga0207653_10075648 3300025885 Bacteria 1157
321 Ga0207692_10009698 3300025898 Bacteria 4032
322 Ga0207692_10189425 3300025898 Bacteria 1203
323 Ga0207692_10262614 3300025898 Bacteria 1039
324 Ga0207642_10737990 3300025899 Bacteria 623
325 Ga0207710_10031662 3300025900 Bacteria 2314
326 Ga0207688_10009773 3300025901 Bacteria 5221
327 Ga0207680_10225151 3300025903 Bacteria 1287
328 Ga0207680_10493436 3300025903 Bacteria 872
329 Ga0207680_10943581 3300025903 Bacteria 618
330 Ga0207647_10009387 3300025904 Bacteria 6953
331 Ga0207647_10056345 3300025904 Bacteria 2411
332 Ga0207685_10003094 3300025905 Bacteria 3973
333 Ga0207699_10058635 3300025906 Bacteria 2304
334 Ga0207699_10170952 3300025906 Unclassified 1454
335 Ga0207645_10105751 3300025907 Bacteria 1819
336 Ga0207643_10015825 3300025908 Bacteria 4108
337 Ga0207705_10025998 3300025909 Bacteria 4177
338 Ga0207684_10015802 3300025910 Bacteria 6492
339 Ga0207684_10030942 3300025910 Bacteria 4555
340 Ga0207684_10042876 3300025910 Bacteria 3836
341 Ga0207684_10058713 3300025910 Bacteria 3265
342 Ga0207684_10336034 3300025910 Bacteria 1301
343 Ga0207684_10670256 3300025910 Bacteria 883
344 Ga0207684_11134242 3300025910 Bacteria 650
345 Ga0207654_10000112 3300025911 Bacteria 53345
346 Ga0207654_10171791 3300025911 Bacteria 1408
347 Ga0207654_10684013 3300025911 Bacteria 736
348 Ga0207707_10064044 3300025912 Bacteria 3200
349 Ga0207707_10342924 3300025912 Bacteria 1288
350 Ga0207695_10346649 3300025913 Bacteria 1373
351 Ga0207671_10502356 3300025914 Bacteria 967
352 Ga0207671_10974456 3300025914 Bacteria 669
353 Ga0207693_10000249 3300025915 Bacteria 49872
354 Ga0207693_10035580 3300025915 Bacteria 3925
355 Ga0207693_10153006 3300025915 Bacteria 1814
356 Ga0207663_10001419 3300025916 Bacteria 11122
357 Ga0207663_10035676 3300025916 Bacteria 2986
358 Ga0207663_10272105 3300025916 Bacteria 1255
359 Ga0207663_10931217 3300025916 Bacteria 695
360 Ga0207660_10099670 3300025917 Bacteria 2168
361 Ga0207660_10463501 3300025917 Bacteria 1026
362 Ga0207662_10154079 3300025918 Bacteria 1464
363 Ga0207657_10080171 3300025919 Bacteria 2745
364 Ga0207657_10156141 3300025919 Bacteria 1855
365 Ga0207649_10052457 3300025920 Bacteria 2530
366 Ga0207652_11293829 3300025921 Bacteria 632
367 Ga0207652_11439185 3300025921 Unclassified 593
368 Ga0207652_11802283 3300025921 Bacteria 517
369 Ga0207646_10033630 3300025922 Bacteria 4636
370 Ga0207646_10723274 3300025922 Bacteria 889
371 Ga0207646_10872098 3300025922 Bacteria 799
372 Ga0207694_10285009 3300025924 Bacteria 1357
373 Ga0207694_11137095 3300025924 Bacteria 661
374 Ga0207650_10241768 3300025925 Bacteria 1459
375 Ga0207659_10320769 3300025926 Bacteria 1278
376 Ga0207659_11347839 3300025926 Bacteria 612
377 Ga0207687_10051198 3300025927 Bacteria 2878
378 Ga0207687_10143594 3300025927 Bacteria 1814
379 Ga0207687_10424740 3300025927 Bacteria 1097
380 Ga0207700_10000137 3300025928 Bacteria 43639
381 Ga0207700_10518834 3300025928 Bacteria 1055
382 Ga0207700_11016720 3300025928 Bacteria 742
383 Ga0207664_10005767 3300025929 Bacteria 8470
384 Ga0207664_10055333 3300025929 Bacteria 3148
385 Ga0207664_10122797 3300025929 Bacteria 2176
386 Ga0207664_10191551 3300025929 Bacteria 1761
387 Ga0207664_10236054 3300025929 Bacteria 1591
388 Ga0207664_11078217 3300025929 Bacteria 718
389 Ga0207664_11491171 3300025929 Bacteria 598
390 Ga0207690_11349642 3300025932 Bacteria 596
391 Ga0207706_10251386 3300025933 Bacteria 1544
392 Ga0207706_10325223 3300025933 Bacteria 1338
393 Ga0207686_10253558 3300025934 Bacteria 1287
394 Ga0207670_10278990 3300025936 Bacteria 1302
395 Ga0207670_11294985 3300025936 Bacteria 618
396 Ga0207669_11561059 3300025937 Bacteria 563
397 Ga0207704_10442569 3300025938 Bacteria 1035
398 Ga0207665_10008803 3300025939 Bacteria 6635
399 Ga0207665_10347094 3300025939 Bacteria 1120
400 Ga0207665_11288556 3300025939 Bacteria 583
401 Ga0207691_10470153 3300025940 Bacteria 1069
402 Ga0207711_10126630 3300025941 Bacteria 2285
403 Ga0207711_10440041 3300025941 Bacteria 1213
404 Ga0207711_10617901 3300025941 Bacteria 1011
405 Ga0207689_10006188 3300025942 Bacteria 10598
406 Ga0207689_10055418 3300025942 Bacteria 3263
407 Ga0207689_10531510 3300025942 Bacteria 987
408 Ga0207661_10221272 3300025944 Bacteria 1673
409 Ga0207679_10436444 3300025945 Bacteria 1159
410 Ga0207679_10572899 3300025945 Bacteria 1015
411 Ga0207679_10972874 3300025945 Bacteria 778
412 Ga0207667_10017468 3300025949 Bacteria 8071
413 Ga0207651_10122959 3300025960 Bacteria 1972
414 Ga0207651_10591330 3300025960 Bacteria 969
415 Ga0207712_10644909 3300025961 Bacteria 920
416 Ga0207668_10334577 3300025972 Bacteria 1261
417 Ga0207658_10350130 3300025986 Bacteria 1286
418 Ga0207677_10059068 3300026023 Bacteria 2644
419 Ga0207677_10065721 3300026023 Bacteria 2532
420 Ga0207677_10244917 3300026023 Bacteria 1452
421 Ga0207677_11045014 3300026023 Bacteria 742
422 Ga0207703_10009729 3300026035 Bacteria 7545
423 Ga0207703_10176167 3300026035 Bacteria 1884
424 Ga0207703_12149088 3300026035 Bacteria 534
425 Ga0207703_12196767 3300026035 Bacteria 528
426 Ga0207639_10462733 3300026041 Bacteria 1153
427 Ga0207639_10474932 3300026041 Bacteria 1139
428 Ga0207678_10065005 3300026067 Bacteria 3134
429 Ga0207702_10480940 3300026078 Bacteria 1208
430 Ga0207702_10521683 3300026078 Bacteria 1160
431 Ga0207641_10020602 3300026088 Bacteria 5418
432 Ga0207648_10025589 3300026089 Bacteria 5255
433 Ga0207648_10408538 3300026089 Bacteria 1231
434 Ga0207648_11428544 3300026089 Bacteria 650
435 Ga0207648_11445276 3300026089 Bacteria 646
436 Ga0207676_11402853 3300026095 Bacteria 694
437 Ga0207674_10101965 3300026116 Bacteria 2850
438 Ga0207675_100035692 3300026118 Bacteria 4637
439 Ga0207675_100298194 3300026118 Bacteria 1569
440 Ga0207675_101110443 3300026118 Bacteria 811
441 Ga0207683_10115576 3300026121 Bacteria 2405
442 Ga0207683_10976856 3300026121 Bacteria 786
443 Ga0207698_10079694 3300026142 Bacteria 2635
444 Ga0207698_10368634 3300026142 Bacteria 1362
445 Ga0207698_10411405 3300026142 Bacteria 1295
446 Ga0207698_10717923 3300026142 Unclassified 996
447 Ga0207698_10842995 3300026142 Bacteria 921
448 Ga0209995_1017431 3300027471 Bacteria 1182
449 Ga0209968_1007375 3300027526 Bacteria 1664
450 Ga0209813_10076608 3300027866 Bacteria 1098
451 Ga0207428_10183675 3300027907 Unclassified 1579
452 Ga0207428_10331972 3300027907 Bacteria 1121
453 Ga0265354_1000056 3300028016 Bacteria 18570
454 Ga0265354_1000379 3300028016 Bacteria 7822
455 Ga0265356_1004603 3300028017 Bacteria 1675
456 Ga0265357_1000791 3300028023 Bacteria 2068
457 Ga0265357_1012262 3300028023 Bacteria 881
458 Ga0265357_1012351 3300028023 Bacteria 879
459 Ga0268266_10056267 3300028379 Bacteria 3383
460 Ga0268266_10688007 3300028379 Bacteria 985
461 Ga0268266_11230646 3300028379 Bacteria 724
462 Ga0268265_10942613 3300028380 Bacteria 850
463 Ga0268264_10105672 3300028381 Bacteria 2456
464 Ga0268264_10509034 3300028381 Bacteria 1175
465 Ga0268264_10856598 3300028381 Bacteria 910
466 Ga0307517_10418951 3300028786 Bacteria 703
467 Ga0265338_10078015 3300028800 Bacteria 2796
468 Ga0265762_1007586 3300030760 Bacteria 1934
469 Ga0265762_1189819 3300030760 Bacteria 510
470 Ga0265763_1039779 3300030763 Bacteria 563
471 Ga0265771_1006369 3300031010 Bacteria 777
472 Ga0265760_10003395 3300031090 Bacteria 4636
473 Ga0265760_10020644 3300031090 Unclassified 1902
474 Ga0265760_10028062 3300031090 Bacteria 1651
475 Ga0265760_10091366 3300031090 Bacteria 953
476 Ga0265330_10000218 3300031235 Bacteria 44183
477 Ga0265325_10332502 3300031241 Bacteria 673
478 Ga0265340_10239067 3300031247 Bacteria 811
479 Ga0265339_10025327 3300031249 Bacteria 3405
480 Ga0265316_10002427 3300031344 Bacteria 19369
481 Ga0265316_10002771 3300031344 Bacteria 17961
482 Ga0265316_10472606 3300031344 Bacteria 898
483 Ga0307509_10004584 3300031507 Bacteria 19816
484 Ga0307509_10269121 3300031507 Bacteria 1473
485 Ga0265313_10014320 3300031595 Bacteria 4693
486 Ga0307508_10047595 3300031616 Bacteria 3823
487 Ga0265314_10001871 3300031711 Bacteria 22565
488 Ga0265342_10006456 3300031712 Bacteria 8731
489 Ga0307406_11055016 3300031901 Bacteria 700
490 Ga0307510_10390937 3300033180 Bacteria 835
491 Ga0316212_1000542 3300033547 Bacteria 4693
492 Ga0316212_1029551 3300033547 Bacteria 770
493 Ga0373958_0049298 3300034819 Bacteria 885
494 Ga0373926_0138971 3300035083 Unclassified 922
495 Ga0373934_0002814 3300035086 Bacteria 6371
496 Ga0373934_0004660 3300035086 Bacteria 5069
497 Ga0373934_0151240 3300035086 Bacteria 951
498 Ga0373940_0213219 3300035088 Bacteria 639
499 Ga0373944_0030705 3300035089 Unclassified 1613
500 Ga0373923_0140656 3300035111 Bacteria 1091
501 Ga0373923_0342824 3300035111 Bacteria 712
502 Ga0373936_0015015 3300035113 Unclassified 2965
503 Ga0373945_0030857 3300035116 Unclassified 1890
504 Ga0373953_0044129 3300035117 Bacteria 1782
505 Ga0373953_0225938 3300035117 Bacteria 811
506 Ga0373954_0000464 3300035118 Bacteria 15203
507 Ga0373954_0122132 3300035118 Bacteria 1265
508 Ga0373956_0001113 3300035119 Bacteria 11080
509 Ga0373956_0012944 3300035119 Bacteria 3466
510 Ga0373957_0064162 3300035120 Bacteria 1427
511 Ga0373943_0044220 3300035170 Unclassified 2167
512 Ga0373943_0655197 3300035170 Bacteria 621
513 Ga0373946_0064362 3300035171 Unclassified 1568
514 Ga0373946_0346695 3300035171 Bacteria 742
515 Ga0373946_0529763 3300035171 Bacteria 606
516 Ga0373955_0001393 3300035172 Bacteria 10287
517 Ga0373955_0002548 3300035172 Bacteria 7975
518 Ga0373955_0085740 3300035172 Unclassified 1788
519 Ga0373955_0171661 3300035172 Bacteria 1284
520 Ga0373955_0171773 3300035172 Bacteria 1283
521 Ga0373955_0471338 3300035172 Bacteria 766
522 Ga0373962_0154645 3300035242 Bacteria 753
523 Ga0373924_0185473 3300035410 Unclassified 916
524 Ga0373931_0240923 3300035691 Bacteria 1096
525 Ga0373935_0005446 3300035692 Bacteria 7499
526 Ga0373935_0128027 3300035692 Unclassified 1703
527 Ga0373935_0883559 3300035692 Bacteria 662
528 Ga0373933_0000659 3300035724 Bacteria 21433
529 Ga0373933_0008737 3300035724 Bacteria 5524
530 Ga0373933_0683012 3300035724 Bacteria 675
531 Ga0373947_0046354 3300035725 Bacteria 2603
532 Ga0373947_0097555 3300035725 Unclassified 1842
533 Ga0373947_0263154 3300035725 Bacteria 1143
534 Ga0373947_0430929 3300035725 Bacteria 892
535 Ga0373947_0436685 3300035725 Bacteria 886
536 Ga0373947_0996204 3300035725 Bacteria 572
537 Ga0373937_0000406 3300036401 Bacteria 40149
538 Ga0373937_0000764 3300036401 Bacteria 27786
539 Ga0373937_0132421 3300036401 Bacteria 2329
540 Ga0373937_0161356 3300036401 Bacteria 2102
541 Ga0373937_0186649 3300036401 Bacteria 1948
542 Ga0373937_0261801 3300036401 Bacteria 1631
543 Ga0373937_0544183 3300036401 Bacteria 1103
544 Ga0373937_0978132 3300036401 Unclassified 795
545 Ga0373925_0169837 3300037068 Unclassified 1721
546 Ga0373925_0247965 3300037068 Bacteria 1428
547 Ga0373925_0400859 3300037068 Bacteria 1119
548 Ga0373925_0802751 3300037068 Bacteria 776
549 Ga0395900_0754678 3300037418 Bacteria 903
550 Ga0395900_1189333 3300037418 Bacteria 678
551 Ga0395905_1171800 3300037471 Bacteria 672
552 Ga0436364_0303302 3300037853 Bacteria 1793
553 Ga0436364_0395106 3300037853 Bacteria 576
554 Ga0436364_1482428 3300037853 Bacteria 1802
555 Ga0242419_020307 3300038698 Bacteria 554
556 Ga0436365_0404064 3300039437 Bacteria 875
557 Ga0436365_1140712 3300039437 Bacteria 969
558 Ga0436360_0089952 3300039438 Bacteria 1591
559 Ga0436360_0096505 3300039438 Bacteria 1201
560 Ga0436360_1051703 3300039438 Bacteria 652
561 Ga0436360_1183723 3300039438 Bacteria 7529
562 Ga0436360_1289623 3300039438 Bacteria 661
563 Ga0436361_0811412 3300039447 Bacteria 4729
564 Ga0436361_1020706 3300039447 Bacteria 66534
565 Ga0436363_0155876 3300039450 Bacteria 805
566 Ga0436363_0231529 3300039450 Bacteria 825
567 Ga0436363_0966681 3300039450 Bacteria 657
568 Ga0436363_1229529 3300039450 Bacteria 714
569 Ga0436363_1688511 3300039450 Bacteria 2641
570 Ga0436362_0428925 3300039453 Bacteria 940
571 Ga0436362_0521307 3300039453 Bacteria 874
572 Ga0436362_1002765 3300039453 Bacteria 1165
573 Ga0451789_0181068 3300041443 Bacteria 1044
574 Ga0451795_0475007 3300041456 Bacteria 663
575 Ga0451804_0827498 3300041463 Bacteria 626
576 Ga0451807_1730667 3300041486 Bacteria 508
577 Ga0451807_1946998 3300041486 Bacteria 744
578 Ga0451837_1032190 3300041494 Bacteria 677
579 Ga0451841_0685633 3300041498 Bacteria 639
580 Ga0451849_0882118 3300041505 Bacteria 701
581 Ga0451853_0585474 3300041512 Bacteria 2627
582 Ga0439441_098056 3300042001 Bacteria 654
583 Ga0439448_0367129 3300042005 Bacteria 514
584 Ga0439444_0120775 3300042437 Bacteria 611
585 Ga0466969_0064803 3300044656 Bacteria 1768
586 Ga0466963_1222411 3300044694 Bacteria 528
587 Ga0466957_0494796 3300044842 Bacteria 847
588 Ga0466959_0206040 3300045049 Bacteria 1368
589 Ga0466958_0162688 3300045836 Bacteria 1411
590 Ga0466958_0357185 3300045836 Bacteria 941
591 Ga0466967_0267566 3300045976 Bacteria 1637
592 Ga0466967_1282677 3300045976 Bacteria 730
593 Ga0466967_1289279 3300045976 Bacteria 728
594 Ga0495592_0029906 3300046454 Bacteria 4121
595 Ga0495603_0255835 3300046455 Unclassified 1008
596 Ga0495629_0161724 3300046459 Bacteria 1555
597 Ga0495629_0780430 3300046459 Bacteria 631
598 Ga0495638_0173233 3300046460 Bacteria 1237
599 Ga0495651_0116043 3300046462 Bacteria 1973
600 Ga0495651_0221738 3300046462 Bacteria 1308
601 Ga0495651_0284214 3300046462 Bacteria 1116
602 Ga0495653_0280664 3300046463 Bacteria 1093
603 Ga0495653_0626798 3300046463 Bacteria 659
604 Ga0495580_0003590 3300046472 Bacteria 13163
605 Ga0495582_0025858 3300046473 Bacteria 3216
606 Ga0495582_0510457 3300046473 Bacteria 695
607 Ga0495662_0023745 3300046476 Bacteria 2961
608 Ga0495662_0084865 3300046476 Unclassified 1542
609 Ga0495664_0006955 3300046477 Bacteria 6265
610 Ga0495664_0092917 3300046477 Unclassified 1815
611 Ga0495608_0078192 3300046511 Bacteria 2153
612 Ga0495608_0138356 3300046511 Bacteria 1555
613 Ga0495618_0573735 3300046514 Bacteria 673
614 Ga0495618_0594498 3300046514 Bacteria 659
615 Ga0495628_0043840 3300046516 Bacteria 3561
616 Ga0495628_0920740 3300046516 Bacteria 606
617 Ga0495630_0015604 3300046517 Bacteria 5551
618 Ga0495630_0073971 3300046517 Bacteria 2566
619 Ga0495630_0104082 3300046517 Unclassified 2148
620 Ga0495652_0026519 3300046529 Bacteria 5118
621 Ga0495652_0683857 3300046529 Unclassified 692
622 Ga0495665_0069037 3300046531 Bacteria 1863
623 Ga0495665_0180822 3300046531 Unclassified 1096
624 Ga0495640_0143345 3300046533 Bacteria 1539
625 Ga0495587_0003483 3300046536 Bacteria 10483
626 Ga0495587_0020300 3300046536 Bacteria 4102
627 Ga0495587_0047179 3300046536 Bacteria 2555
628 Ga0495587_0071709 3300046536 Bacteria 2014
629 Ga0495645_0001318 3300046543 Bacteria 16837
630 Ga0495667_0082629 3300046559 Bacteria 2086
631 Ga0495667_0198905 3300046559 Bacteria 1283
632 Ga0495625_0241755 3300046660 Bacteria 1175
633 Ga0495599_0001515 3300046678 Bacteria 13372
634 Ga0495623_0028129 3300046679 Bacteria 3619
635 Ga0495623_0028484 3300046679 Bacteria 3593
636 Ga0495623_0212447 3300046679 Bacteria 1107
637 Ga0495646_0030404 3300046680 Bacteria 3373
638 Ga0495658_0039652 3300046683 Bacteria 2614
639 Ga0495658_1078397 3300046683 Bacteria 512
640 Ga0495669_0115655 3300046684 Bacteria 1255
641 Ga0495669_0149577 3300046684 Bacteria 1105
642 Ga0495613_0105212 3300046689 Bacteria 2037
643 Ga0495624_0160390 3300046690 Unclassified 1374
644 Ga0495589_0141843 3300046794 Bacteria 1150
645 Ga0495600_0133785 3300046809 Bacteria 1611
646 Ga0495581_0235509 3300047315 Bacteria 1071
647 Ga0495604_0014595 3300047317 Bacteria 6261
648 Ga0495604_0072484 3300047317 Bacteria 2603
649 Ga0495674_0024468 3300047319 Bacteria 5548
650 Ga0495674_0221565 3300047319 Bacteria 1563
651 Ga0495680_0188893 3300047322 Bacteria 1483
652 Ga0495680_0231815 3300047322 Bacteria 1314
653 Ga0495675_0023033 3300047444 Bacteria 3969
654 Ga0495675_0185928 3300047444 Bacteria 1270
655 Ga0495675_0269621 3300047444 Unclassified 1018
656 Ga0495684_0039461 3300047471 Bacteria 3619
657 Ga0495684_0055953 3300047471 Bacteria 3008
658 Ga0495602_0020292 3300048088 Bacteria 6570
659 Ga0495602_0087891 3300048088 Bacteria 2589
660 Ga0495602_0177871 3300048088 Bacteria 1644
661 Ga0496100_1369976 3300048903 Bacteria 558
662 Ga0496101_0386931 3300048904 Bacteria 1101
663 Ga0496102_0281103 3300048905 Bacteria 1569
664 Ga0496102_0364849 3300048905 Bacteria 1360
665 Ga0496103_0154658 3300048906 Bacteria 1470
666 Ga0496105_0119952 3300048908 Bacteria 2169
667 Ga0496105_0620045 3300048908 Bacteria 838
668 Ga0496106_0153412 3300048909 Bacteria 1818
669 Ga0496108_0665424 3300048911 Bacteria 904
670 Ga0496109_0535133 3300048912 Bacteria 1105
671 Ga0496109_1535040 3300048912 Bacteria 601
672 Ga0496109_1693547 3300048912 Bacteria 566
673 Ga0496110_0271874 3300048913 Bacteria 1543
674 Ga0496110_1281565 3300048913 Bacteria 642
675 Ga0496111_1286085 3300048914 Bacteria 516
676 Ga0496112_0020533 3300048915 Bacteria 6263
677 Ga0496113_0967408 3300048916 Bacteria 671
678 Ga0496115_0012540 3300048918 Bacteria 6384
679 Ga0496115_0119657 3300048918 Bacteria 2166
680 Ga0501031_0025853 3300049568 Bacteria 3830
681 Ga0501032_0124998 3300049569 Bacteria 1699
682 Ga0501033_0058567 3300049570 Bacteria 2845
683 Ga0501034_0120109 3300049571 Bacteria 2615
684 Ga0501034_0339775 3300049571 Bacteria 1431
685 Ga0501036_0272395 3300049572 Bacteria 1417
686 Ga0501037_0092134 3300049573 Bacteria 2192
687 Ga0501038_0311127 3300049574 Bacteria 1234
688 Ga0501043_0077401 3300049579 Bacteria 2613
689 Ga0501046_0989391 3300049580 Bacteria 584
690 Ga0501047_0163100 3300049581 Bacteria 2100
691 Ga0501047_1040015 3300049581 Bacteria 632
692 Ga0501047_1332254 3300049581 Bacteria 532
693 Ga0501070_0046593 3300049586 Bacteria 3605
694 Ga0501071_1377940 3300049587 Bacteria 545
695 Ga0501072_0770769 3300049588 Bacteria 754
696 Ga0501044_0001024 3300049823 Bacteria 33666
697 Ga0501044_0102103 3300049823 Bacteria 2884
698 Ga0501044_0262113 3300049823 Unclassified 1667
699 Ga0501044_1499829 3300049823 Bacteria 539
700 nmdc:mga03n38_584808_c1 3300050490 Bacteria 634
701 nmdc:mga0k408_284645_c1 3300050493 Bacteria 987
702 nmdc:mga04h51_63717_c1 3300050495 Bacteria 1270
703 nmdc:mga05p37_110882_c2 3300050507 Bacteria 2898
704 nmdc:mga05p37_1431624_c1 3300050507 Bacteria 693
705 nmdc:mga05p37_883485_c1 3300050507 Bacteria 966
706 nmdc:mga05p37_94364_c1 3300050507 Bacteria 3686
707 nmdc:mga09592_124966_c2 3300050508 Bacteria 1696
708 nmdc:mga09592_595959_c1 3300050508 Bacteria 947
709 nmdc:mga0qj67_802196_c1 3300050509 Bacteria 745
710 nmdc:mga08y16_178982_c1 3300050511 Unclassified 2202
711 nmdc:mga08y16_70470_c1 3300050511 Bacteria 3644
712 nmdc:mga0n895_1343766_c1 3300050512 Bacteria 684
713 nmdc:mga0rr50_8259_c1 3300050513 Bacteria 6471
714 nmdc:mga08x19_478313_c1 3300050514 Bacteria 878
715 nmdc:mga08x19_57874_c1 3300050514 Bacteria 2506
716 nmdc:mga08x19_6208_c1 3300050514 Bacteria 7067
717 nmdc:mga0a205_105063_c1 3300050515 Bacteria 2723
718 nmdc:mga0a205_676598_c1 3300050515 Bacteria 882
719 Ga0495601_0014427 3300053077 Bacteria 4762
720 Ga0495601_0110176 3300053077 Bacteria 1783
721 Ga0495619_0929850 3300053085 Bacteria 584
722 Ga0500583_0000029 3300053092 Bacteria 107304
723 Ga0500583_0004705 3300053092 Bacteria 4486
724 Ga0500641_0211829 3300053096 Bacteria 824
725 Ga0500556_0029165 3300053104 Bacteria 1859
726 Ga0500556_0109590 3300053104 Bacteria 1070
727 Ga0500652_016379 3300053131 Bacteria 2696
728 Ga0500604_0331148 3300053151 Bacteria 529
729 Ga0500616_0013629 3300053153 Unclassified 4711
730 Ga0500616_0037306 3300053153 Unclassified 2632
731 Ga0500622_0044286 3300053156 Bacteria 2306
732 Ga0500622_0255138 3300053156 Bacteria 768
733 Ga0500637_0026847 3300053178 Bacteria 3175
734 Ga0587084_150656 3300059477 Bacteria 511
735 Ga0587066_105854 3300059490 Bacteria 646
736 Ga0587070_153429 3300059491 Bacteria 579
737 Ga0587083_0021147 3300059505 Bacteria 1206
738 Ga0587085_044420 3300059506 Bacteria 787
739 Ga0587089_005627 3300059509 Bacteria 1427
740 Ga0587092_075172 3300059512 Bacteria 658
741 Ga0587099_014346 3300059622 Bacteria 835
742 Ga0587067_004710 3300059640 Bacteria 1799
743 Ga0587072_042304 3300059643 Bacteria 889
744 Ga0587075_015655 3300059644 Bacteria 1070
745 Ga0587078_003053 3300059646 Bacteria 1664
746 Ga0587079_057215 3300059647 Bacteria 835
747 Ga0587071_049999 3300060344 Bacteria 862
748 Ga0466962_0165090 3300061719 Bacteria 1077
749 Ga0070669_100477748
750 JGI24745J21846_1004033
751 JGI24748J21848_1035448
752 rootH1_10088351
753 rootH2_10016315
754 rootL2_10167048
755 rootL2_10221496
756 rootH1_10056336
757 Ga0058861_10614056
758 Ga0065704_10117726
759 Ga0065712_10700569
760 Ga0070658_10422367
761 Ga0070658_10828599
762 Ga0070683_100117695
763 Ga0070683_100284712
764 Ga0070690_100005680
765 Ga0070690_100209669
766 Ga0070670_100162390
767 Ga0070670_100474455
768 Ga0068869_100037532
769 Ga0070666_10071957
770 Ga0070666_10097272
771 Ga0070666_10188642
772 Ga0070680_100129305
773 Ga0070682_100148291
774 Ga0070682_100324885
775 Ga0070682_102056377
776 Ga0068868_100018789
777 Ga0068868_100069163
778 Ga0068868_100457941
779 Ga0070660_100190611
780 Ga0070660_100203750
781 Ga0070660_100861812
782 Ga0070689_100326481
783 Ga0070689_101807647
784 Ga0070691_10088557
785 Ga0070687_100584409
786 Ga0070661_100101749
787 Ga0070661_100126292
788 Ga0070661_100990066
789 Ga0070692_10013034
790 Ga0070669_100200732
791 Ga0070675_100193201
792 Ga0070671_100044063
793 Ga0070671_100052927
794 Ga0070674_100792676
795 Ga0070674_100887440
796 Ga0070673_100171372
797 Ga0070673_100606590
798 Ga0070673_100749627
799 Ga0070688_100070236
800 Ga0070688_101449584
801 Ga0070659_100092902
802 Ga0070667_100082679
803 Ga0070667_100123232
804 Ga0070667_100273343
805 Ga0070703_10007183
806 Ga0070703_10192767
807 Ga0070709_10000355
808 Ga0070709_10126689
809 Ga0070709_10331934
810 Ga0070709_11259895
811 Ga0070714_100038920
812 Ga0070714_100183217
813 Ga0070714_100291866
814 Ga0070714_100613366
815 Ga0070714_100901144
816 Ga0070714_101840103
817 Ga0070713_100001016
818 Ga0070713_101550420
819 Ga0070710_10014671
820 Ga0070710_10262107
821 Ga0070710_10315883
822 Ga0070701_10820183
823 Ga0070711_100000185
824 Ga0070711_100043172
825 Ga0070711_100197600
826 Ga0070711_100316864
827 Ga0070705_100056053
828 Ga0070705_101313772
829 Ga0070700_100130968
830 Ga0070694_100314417
831 Ga0070708_100086105
832 Ga0070708_100089783
833 Ga0070708_100206226
834 Ga0070708_100295829
835 Ga0070708_100438871
836 Ga0070708_100514161
837 Ga0070708_101320497
838 Ga0070663_100005015
839 Ga0070678_100391028
840 Ga0070678_100970163
841 Ga0070662_100250831
842 Ga0070662_100646229
843 Ga0070681_10081160
844 Ga0070681_10314608
845 Ga0070681_10719264
846 Ga0068867_100215206
847 Ga0068867_100454069
848 Ga0070685_10171021
849 Ga0070685_10440534
850 Ga0070706_100022427
851 Ga0070706_100024327
852 Ga0070706_100818074
853 Ga0070706_101467642
854 Ga0070706_101982083
855 Ga0070707_100020453
856 Ga0070707_100131724
857 Ga0070707_100943344
858 Ga0070707_101124702
859 Ga0070707_101767703
860 Ga0070698_100018752
861 Ga0070698_100260753
862 Ga0070698_100414824
863 Ga0070698_101677376
864 Ga0070699_100043316
865 Ga0070699_100147336
866 Ga0070699_100316184
867 Ga0070699_100344045
868 Ga0070699_100628797
869 Ga0070679_101269574
870 Ga0070684_100209959
871 Ga0070684_100320326
872 Ga0070684_101239389
873 Ga0070697_100013062
874 Ga0070697_100148230
875 Ga0070697_100448571
876 Ga0070697_101187974
877 Ga0068853_100286655
878 Ga0068853_100475878
879 Ga0068853_100499949
880 Ga0070672_100385687
881 Ga0070686_100376465
882 Ga0070695_100246442
883 Ga0070695_100579634
884 Ga0070696_100180339
885 Ga0070696_100504309
886 Ga0070693_100000041
887 Ga0070693_100044138
888 Ga0070693_100348388
889 Ga0070693_100643514
890 Ga0070665_100757126
891 Ga0070665_101020549
892 Ga0070665_101592977
893 Ga0070704_100012379
894 Ga0068855_100241224
895 Ga0068855_100623453
896 Ga0070664_100612527
897 Ga0070664_100867514
898 Ga0070664_101188334
899 Ga0068854_100290816
900 Ga0068856_100666407
901 Ga0070702_100044990
902 Ga0070702_101103225
903 Ga0070702_101347845
904 Ga0068852_100018334
905 Ga0068852_100081620
906 Ga0068852_100298604
907 Ga0068852_100398896
908 Ga0068852_101050451
909 Ga0068852_101179987
910 Ga0068859_100213561
911 Ga0068859_100254232
912 Ga0068859_100499895
913 Ga0068859_100582864
914 Ga0068864_101699369
915 Ga0068866_10121649
916 Ga0068866_10288874
917 Ga0068866_10820838
918 Ga0068861_100028272
919 Ga0068861_101224984
920 Ga0068851_10458332
921 Ga0068870_10234154
922 Ga0068863_100040002
923 Ga0068863_101356195
924 Ga0068858_100006749
925 Ga0068858_100045526
926 Ga0068858_101137789
927 Ga0068860_100006592
928 Ga0068860_100131109
929 Ga0068860_100157383
930 Ga0068862_100548347
931 Ga0068862_100963096
932 Ga0068862_101116209
933 Ga0081539_10159233
934 Ga0070717_10002209
935 Ga0070717_10002763
936 Ga0070717_10008386
937 Ga0070717_10101833
938 Ga0070717_10877640
939 Ga0070717_11202947
940 Ga0075368_10062759
941 Ga0075364_10366389
942 Ga0070715_10009822
943 Ga0070716_100078130
944 Ga0070716_101448384
945 Ga0070712_100001530
946 Ga0070712_100013853
947 Ga0070712_100137847
948 Ga0075362_10668751
949 Ga0075367_10081226
950 Ga0097621_100001121
951 Ga0075370_10701814
952 Ga0068871_100000554
953 Ga0068871_100303750
954 Ga0068871_100667874
955 Ga0075428_100445162
956 Ga0075428_102653846
957 Ga0075430_100137539
958 Ga0075430_100517128
959 Ga0075431_100236123
960 Ga0075433_10004003
961 Ga0075433_10142286
962 Ga0075434_100407908
963 Ga0075434_101760994
964 Ga0075429_100176338
965 Ga0075429_100380962
966 Ga0075429_100564077
967 Ga0068865_100032826
968 Ga0068865_100890048
969 Ga0075436_100058904
970 Ga0075436_100190285
971 Ga0097620_100254248
972 Ga0097620_100499926
973 Ga0097620_100582924
974 Ga0075435_101036261
975 Ga0099794_10041309
976 Ga0099794_10465390
977 Ga0105251_10174536
978 Ga0105244_10217296
979 Ga0105240_10376103
980 Ga0105240_11916647
981 Ga0111539_10031448
982 Ga0111539_10337480
983 Ga0105245_10012430
984 Ga0105245_10842136
985 Ga0105247_10629219
986 Ga0105247_10834842
987 Ga0114129_10430656
988 Ga0114129_12016705
989 Ga0105243_10166282
990 Ga0105241_10000365
991 Ga0105241_10062088
992 Ga0105241_10071279
993 Ga0105241_10286364
994 Ga0105241_10316092
995 Ga0105242_10083423
996 Ga0105242_10760784
997 Ga0105248_10611425
998 Ga0105248_11277738
999 Ga0105237_10263816
1000 Ga0105237_10280608
1001 Ga0105237_10668312
1002 Ga0105237_11029390
1003 Ga0105238_10755230
1004 Ga0105249_10082616
1005 Ga0105249_10328876
1006 Ga0105249_12277816
1007 Ga0105239_10982985
1008 Ga0157373_10037353
1009 Ga0157373_10347341
1010 Ga0157373_10650520
1011 Ga0157371_10061320
1012 Ga0157371_10130584
1013 Ga0157369_10016049
1014 Ga0157369_10073332
1015 Ga0157369_10133670
1016 Ga0157374_10038676
1017 Ga0157374_10116594
1018 Ga0157374_10161027
1019 Ga0157374_10887642
1020 Ga0157374_11660905
1021 Ga0157378_10000108
1022 Ga0157378_10006544
1023 Ga0157378_10179835
1024 Ga0157378_10256502
1025 Ga0157378_10890447
1026 Ga0163162_10004606
1027 Ga0163162_10699142
1028 Ga0163162_11476121
1029 Ga0157372_10009307
1030 Ga0157372_10033302
1031 Ga0157372_10034697
1032 Ga0157372_10247953
1033 Ga0157372_10248458
1034 Ga0157372_10434524
1035 Ga0157372_10494325
1036 Ga0157372_10609628
1037 Ga0157372_11016242
1038 Ga0157375_10025362
1039 Ga0157380_10201515
1040 Ga0157377_10402996
1041 Ga0157379_11100098
1042 Ga0157376_10400513
1043 Ga0157376_10590583
1044 Ga0182007_10318231
1045 Ga0182005_1249086
1046 Ga0163161_10045993
1047 Ga0197907_10124161
1048 Ga0197907_10174520
1049 Ga0197907_11474041
1050 Ga0206356_10165377
1051 Ga0206356_10598576
1052 Ga0206356_11740095
1053 Ga0206349_1863247
1054 Ga0206355_1128891
1055 Ga0206351_10399282
1056 Ga0206351_10993264
1057 Ga0206350_10271088
1058 Ga0206350_10828970
1059 Ga0206353_10588230
1060 Ga0213872_10000669
1061 Ga0213874_10060208
1062 Ga0213875_10029958
1063 Ga0213871_10047713
1064 Ga0224712_10292352
1065 Ga0228598_1070672
1066 Ga0207656_10019408
1067 Ga0207653_10007242
1068 Ga0207653_10075648
1069 Ga0207692_10009698
1070 Ga0207692_10189425
1071 Ga0207692_10262614
1072 Ga0207642_10737990
1073 Ga0207710_10031662
1074 Ga0207688_10009773
1075 Ga0207680_10225151
1076 Ga0207680_10493436
1077 Ga0207680_10943581
1078 Ga0207647_10009387
1079 Ga0207647_10056345
1080 Ga0207685_10003094
1081 Ga0207699_10058635
1082 Ga0207699_10170952
1083 Ga0207645_10105751
1084 Ga0207643_10015825
1085 Ga0207705_10025998
1086 Ga0207684_10015802
1087 Ga0207684_10030942
1088 Ga0207684_10042876
1089 Ga0207684_10058713
1090 Ga0207684_10336034
1091 Ga0207684_10670256
1092 Ga0207684_11134242
1093 Ga0207654_10000112
1094 Ga0207654_10171791
1095 Ga0207654_10684013
1096 Ga0207707_10064044
1097 Ga0207707_10342924
1098 Ga0207695_10346649
1099 Ga0207671_10502356
1100 Ga0207671_10974456
1101 Ga0207693_10000249
1102 Ga0207693_10035580
1103 Ga0207693_10153006
1104 Ga0207663_10001419
1105 Ga0207663_10035676
1106 Ga0207663_10272105
1107 Ga0207663_10931217
1108 Ga0207660_10099670
1109 Ga0207660_10463501
1110 Ga0207662_10154079
1111 Ga0207657_10080171
1112 Ga0207657_10156141
1113 Ga0207649_10052457
1114 Ga0207652_11293829
1115 Ga0207652_11439185
1116 Ga0207652_11802283
1117 Ga0207646_10033630
1118 Ga0207646_10723274
1119 Ga0207646_10872098
1120 Ga0207694_10285009
1121 Ga0207694_11137095
1122 Ga0207650_10241768
1123 Ga0207659_10320769
1124 Ga0207659_11347839
1125 Ga0207687_10051198
1126 Ga0207687_10143594
1127 Ga0207687_10424740
1128 Ga0207700_10000137
1129 Ga0207700_10518834
1130 Ga0207700_11016720
1131 Ga0207664_10005767
1132 Ga0207664_10055333
1133 Ga0207664_10122797
1134 Ga0207664_10191551
1135 Ga0207664_10236054
1136 Ga0207664_11078217
1137 Ga0207664_11491171
1138 Ga0207690_11349642
1139 Ga0207706_10251386
1140 Ga0207706_10325223
1141 Ga0207686_10253558
1142 Ga0207670_10278990
1143 Ga0207670_11294985
1144 Ga0207669_11561059
1145 Ga0207704_10442569
1146 Ga0207665_10008803
1147 Ga0207665_10347094
1148 Ga0207665_11288556
1149 Ga0207691_10470153
1150 Ga0207711_10126630
1151 Ga0207711_10440041
1152 Ga0207711_10617901
1153 Ga0207689_10006188
1154 Ga0207689_10055418
1155 Ga0207689_10531510
1156 Ga0207661_10221272
1157 Ga0207679_10436444
1158 Ga0207679_10572899
1159 Ga0207679_10972874
1160 Ga0207667_10017468
1161 Ga0207651_10122959
1162 Ga0207651_10591330
1163 Ga0207712_10644909
1164 Ga0207668_10334577
1165 Ga0207658_10350130
1166 Ga0207677_10059068
1167 Ga0207677_10065721
1168 Ga0207677_10244917
1169 Ga0207677_11045014
1170 Ga0207703_10009729
1171 Ga0207703_10176167
1172 Ga0207703_12149088
1173 Ga0207703_12196767
1174 Ga0207639_10462733
1175 Ga0207639_10474932
1176 Ga0207678_10065005
1177 Ga0207702_10480940
1178 Ga0207702_10521683
1179 Ga0207641_10020602
1180 Ga0207648_10025589
1181 Ga0207648_10408538
1182 Ga0207648_11428544
1183 Ga0207648_11445276
1184 Ga0207676_11402853
1185 Ga0207674_10101965
1186 Ga0207675_100035692
1187 Ga0207675_100298194
1188 Ga0207675_101110443
1189 Ga0207683_10115576
1190 Ga0207683_10976856
1191 Ga0207698_10079694
1192 Ga0207698_10368634
1193 Ga0207698_10411405
1194 Ga0207698_10717923
1195 Ga0207698_10842995
1196 Ga0209995_1017431
1197 Ga0209968_1007375
1198 Ga0209813_10076608
1199 Ga0207428_10183675
1200 Ga0207428_10331972
1201 Ga0265354_1000056
1202 Ga0265354_1000379
1203 Ga0265356_1004603
1204 Ga0265357_1000791
1205 Ga0265357_1012262
1206 Ga0265357_1012351
1207 Ga0268266_10056267
1208 Ga0268266_10688007
1209 Ga0268266_11230646
1210 Ga0268265_10942613
1211 Ga0268264_10105672
1212 Ga0268264_10509034
1213 Ga0268264_10856598
1214 Ga0307517_10418951
1215 Ga0265338_10078015
1216 Ga0265762_1007586
1217 Ga0265762_1189819
1218 Ga0265763_1039779
1219 Ga0265771_1006369
1220 Ga0265760_10003395
1221 Ga0265760_10020644
1222 Ga0265760_10028062
1223 Ga0265760_10091366
1224 Ga0265330_10000218
1225 Ga0265325_10332502
1226 Ga0265340_10239067
1227 Ga0265339_10025327
1228 Ga0265316_10002427
1229 Ga0265316_10002771
1230 Ga0265316_10472606
1231 Ga0307509_10004584
1232 Ga0307509_10269121
1233 Ga0265313_10014320
1234 Ga0307508_10047595
1235 Ga0265314_10001871
1236 Ga0265342_10006456
1237 Ga0307406_11055016
1238 Ga0307510_10390937
1239 Ga0316212_1000542
1240 Ga0316212_1029551
1241 Ga0373958_0049298
1242 Ga0373926_0138971
1243 Ga0373934_0002814
1244 Ga0373934_0004660
1245 Ga0373934_0151240
1246 Ga0373940_0213219
1247 Ga0373944_0030705
1248 Ga0373923_0140656
1249 Ga0373923_0342824
1250 Ga0373936_0015015
1251 Ga0373945_0030857
1252 Ga0373953_0044129
1253 Ga0373953_0225938
1254 Ga0373954_0000464
1255 Ga0373954_0122132
1256 Ga0373956_0001113
1257 Ga0373956_0012944
1258 Ga0373957_0064162
1259 Ga0373943_0044220
1260 Ga0373943_0655197
1261 Ga0373946_0064362
1262 Ga0373946_0346695
1263 Ga0373946_0529763
1264 Ga0373955_0001393
1265 Ga0373955_0002548
1266 Ga0373955_0085740
1267 Ga0373955_0171661
1268 Ga0373955_0171773
1269 Ga0373955_0471338
1270 Ga0373962_0154645
1271 Ga0373924_0185473
1272 Ga0373931_0240923
1273 Ga0373935_0005446
1274 Ga0373935_0128027
1275 Ga0373935_0883559
1276 Ga0373933_0000659
1277 Ga0373933_0008737
1278 Ga0373933_0683012
1279 Ga0373947_0046354
1280 Ga0373947_0097555
1281 Ga0373947_0263154
1282 Ga0373947_0430929
1283 Ga0373947_0436685
1284 Ga0373947_0996204
1285 Ga0373937_0000406
1286 Ga0373937_0000764
1287 Ga0373937_0132421
1288 Ga0373937_0161356
1289 Ga0373937_0186649
1290 Ga0373937_0261801
1291 Ga0373937_0544183
1292 Ga0373937_0978132
1293 Ga0373925_0169837
1294 Ga0373925_0247965
1295 Ga0373925_0400859
1296 Ga0373925_0802751
1297 Ga0395900_0754678
1298 Ga0395900_1189333
1299 Ga0395905_1171800
1300 Ga0436364_0303302
1301 Ga0436364_0395106
1302 Ga0436364_1482428
1303 Ga0242419_020307
1304 Ga0436365_0404064
1305 Ga0436365_1140712
1306 Ga0436360_0089952
1307 Ga0436360_0096505
1308 Ga0436360_1051703
1309 Ga0436360_1183723
1310 Ga0436360_1289623
1311 Ga0436361_0811412
1312 Ga0436361_1020706
1313 Ga0436363_0155876
1314 Ga0436363_0231529
1315 Ga0436363_0966681
1316 Ga0436363_1229529
1317 Ga0436363_1688511
1318 Ga0436362_0428925
1319 Ga0436362_0521307
1320 Ga0436362_1002765
1321 Ga0451789_0181068
1322 Ga0451795_0475007
1323 Ga0451804_0827498
1324 Ga0451807_1730667
1325 Ga0451807_1946998
1326 Ga0451837_1032190
1327 Ga0451841_0685633
1328 Ga0451849_0882118
1329 Ga0451853_0585474
1330 Ga0439441_098056
1331 Ga0439448_0367129
1332 Ga0439444_0120775
1333 Ga0466969_0064803
1334 Ga0466963_1222411
1335 Ga0466957_0494796
1336 Ga0466959_0206040
1337 Ga0466958_0162688
1338 Ga0466958_0357185
1339 Ga0466967_0267566
1340 Ga0466967_1282677
1341 Ga0466967_1289279
1342 Ga0495592_0029906
1343 Ga0495603_0255835
1344 Ga0495629_0161724
1345 Ga0495629_0780430
1346 Ga0495638_0173233
1347 Ga0495651_0116043
1348 Ga0495651_0221738
1349 Ga0495651_0284214
1350 Ga0495653_0280664
1351 Ga0495653_0626798
1352 Ga0495580_0003590
1353 Ga0495582_0025858
1354 Ga0495582_0510457
1355 Ga0495662_0023745
1356 Ga0495662_0084865
1357 Ga0495664_0006955
1358 Ga0495664_0092917
1359 Ga0495608_0078192
1360 Ga0495608_0138356
1361 Ga0495618_0573735
1362 Ga0495618_0594498
1363 Ga0495628_0043840
1364 Ga0495628_0920740
1365 Ga0495630_0015604
1366 Ga0495630_0073971
1367 Ga0495630_0104082
1368 Ga0495652_0026519
1369 Ga0495652_0683857
1370 Ga0495665_0069037
1371 Ga0495665_0180822
1372 Ga0495640_0143345
1373 Ga0495587_0003483
1374 Ga0495587_0020300
1375 Ga0495587_0047179
1376 Ga0495587_0071709
1377 Ga0495645_0001318
1378 Ga0495667_0082629
1379 Ga0495667_0198905
1380 Ga0495625_0241755
1381 Ga0495599_0001515
1382 Ga0495623_0028129
1383 Ga0495623_0028484
1384 Ga0495623_0212447
1385 Ga0495646_0030404
1386 Ga0495658_0039652
1387 Ga0495658_1078397
1388 Ga0495669_0115655
1389 Ga0495669_0149577
1390 Ga0495613_0105212
1391 Ga0495624_0160390
1392 Ga0495589_0141843
1393 Ga0495600_0133785
1394 Ga0495581_0235509
1395 Ga0495604_0014595
1396 Ga0495604_0072484
1397 Ga0495674_0024468
1398 Ga0495674_0221565
1399 Ga0495680_0188893
1400 Ga0495680_0231815
1401 Ga0495675_0023033
1402 Ga0495675_0185928
1403 Ga0495675_0269621
1404 Ga0495684_0039461
1405 Ga0495684_0055953
1406 Ga0495602_0020292
1407 Ga0495602_0087891
1408 Ga0495602_0177871
1409 Ga0496100_1369976
1410 Ga0496101_0386931
1411 Ga0496102_0281103
1412 Ga0496102_0364849
1413 Ga0496103_0154658
1414 Ga0496105_0119952
1415 Ga0496105_0620045
1416 Ga0496106_0153412
1417 Ga0496108_0665424
1418 Ga0496109_0535133
1419 Ga0496109_1535040
1420 Ga0496109_1693547
1421 Ga0496110_0271874
1422 Ga0496110_1281565
1423 Ga0496111_1286085
1424 Ga0496112_0020533
1425 Ga0496113_0967408
1426 Ga0496115_0012540
1427 Ga0496115_0119657
1428 Ga0501031_0025853
1429 Ga0501032_0124998
1430 Ga0501033_0058567
1431 Ga0501034_0120109
1432 Ga0501034_0339775
1433 Ga0501036_0272395
1434 Ga0501037_0092134
1435 Ga0501038_0311127
1436 Ga0501043_0077401
1437 Ga0501046_0989391
1438 Ga0501047_0163100
1439 Ga0501047_1040015
1440 Ga0501047_1332254
1441 Ga0501070_0046593
1442 Ga0501071_1377940
1443 Ga0501072_0770769
1444 Ga0501044_0001024
1445 Ga0501044_0102103
1446 Ga0501044_0262113
1447 Ga0501044_1499829
1448 nmdc:mga03n38_584808_c1
1449 nmdc:mga0k408_284645_c1
1450 nmdc:mga04h51_63717_c1
1451 nmdc:mga05p37_110882_c2
1452 nmdc:mga05p37_1431624_c1
1453 nmdc:mga05p37_883485_c1
1454 nmdc:mga05p37_94364_c1
1455 nmdc:mga09592_124966_c2
1456 nmdc:mga09592_595959_c1
1457 nmdc:mga0qj67_802196_c1
1458 nmdc:mga08y16_178982_c1
1459 nmdc:mga08y16_70470_c1
1460 nmdc:mga0n895_1343766_c1
1461 nmdc:mga0rr50_8259_c1
1462 nmdc:mga08x19_478313_c1
1463 nmdc:mga08x19_57874_c1
1464 nmdc:mga08x19_6208_c1
1465 nmdc:mga0a205_105063_c1
1466 nmdc:mga0a205_676598_c1
1467 Ga0495601_0014427
1468 Ga0495601_0110176
1469 Ga0495619_0929850
1470 Ga0500583_0000029
1471 Ga0500583_0004705
1472 Ga0500641_0211829
1473 Ga0500556_0029165
1474 Ga0500556_0109590
1475 Ga0500652_016379
1476 Ga0500604_0331148
1477 Ga0500616_0013629
1478 Ga0500616_0037306
1479 Ga0500622_0044286
1480 Ga0500622_0255138
1481 Ga0500637_0026847
1482 Ga0587084_150656
1483 Ga0587066_105854
1484 Ga0587070_153429
1485 Ga0587083_0021147
1486 Ga0587085_044420
1487 Ga0587089_005627
1488 Ga0587092_075172
1489 Ga0587099_014346
1490 Ga0587067_004710
1491 Ga0587072_042304
1492 Ga0587075_015655
1493 Ga0587078_003053
1494 Ga0587079_057215
1495 Ga0587071_049999
1496 Ga0466962_0165090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

141

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9186 2 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9172 1 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9106 1 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9081 1 131
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8889 1 131
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9541 81 130 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9113 82 134 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9074 81 134 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.891 82 131 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8823 81 130 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7I7XZ27-F1-model_v4 VOC domain-containing protein 0.9734 82 134
AF-A0A563EV54-F1-model_v4 VOC family protein 0.9717 1 134
AF-A0A2V6U8A8-F1-model_v4 Glyoxalase 0.9713 82 134
AF-A0A0L8AJK7-F1-model_v4 VOC domain-containing protein 0.9697 82 134
AF-K0K0Y4-F1-model_v4 VOC domain-containing protein 0.9672 1 134

Map