F478957

General Info

Members Datasets Scaffolds Average Seq Length
748 283 1496 172

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10909075|Ga0207708_109090751
Length 186
Sequence MSEKDVIKETRPRMEGAVDDFKRKITTIRTGRAAVSILDTVVVDYYGTPTPLNQMASVHAPEPQMLTVQPWDQTQIGAVEKAIRAADLGLNPSNDGKLVRVPIPPLTEERRRQLAKQIHDVAEDHRTAVRNVRRDANDRLKKMLKDKTISEDAERDSLAEVQKLTDGHIKQIDELAKSKEQEILSV

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
210 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.21
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10909075 3300026075 Unclassified 762
2 SwRhRL2b_contig_3181706 2162886007 Bacteria 950
3 MRS1b_contig_7392549 2162886011 Bacteria 882
4 JGI24751J29686_10001906 3300002459 Bacteria 4264
5 Ga0058862_12374949 3300004803 Unclassified 780
6 Ga0065704_10025299 3300005289 Bacteria 1466
7 Ga0065712_10032885 3300005290 Bacteria 1285
8 Ga0065712_10086516 3300005290 Bacteria 2631
9 Ga0065712_10155174 3300005290 Bacteria 1333
10 Ga0065715_10089447 3300005293 Bacteria 10128
11 Ga0065715_10173661 3300005293 Bacteria 1528
12 Ga0065715_10189832 3300005293 Bacteria 1422
13 Ga0065707_10083745 3300005295 Bacteria 8334
14 Ga0065707_10101877 3300005295 Bacteria 2841
15 Ga0065707_10272809 3300005295 Bacteria 1067
16 Ga0065707_10373122 3300005295 Bacteria 887
17 Ga0070658_10575796 3300005327 Bacteria 975
18 Ga0070676_10109671 3300005328 Bacteria 1717
19 Ga0070683_100214025 3300005329 Bacteria 1831
20 Ga0070683_100422151 3300005329 Bacteria 1272
21 Ga0070683_100491740 3300005329 Unclassified 1172
22 Ga0070690_100023302 3300005330 Bacteria 3796
23 Ga0070690_100571123 3300005330 Bacteria 855
24 Ga0070670_100002347 3300005331 Bacteria 15589
25 Ga0070670_100034706 3300005331 Bacteria 4341
26 Ga0070670_100418034 3300005331 Bacteria 1185
27 Ga0070670_100424196 3300005331 Bacteria 1176
28 Ga0070670_100804841 3300005331 Bacteria 849
29 Ga0070677_10028118 3300005333 Bacteria 2122
30 Ga0068869_100491312 3300005334 Bacteria 1023
31 Ga0070666_10009157 3300005335 Bacteria 6172
32 Ga0070666_10135228 3300005335 Bacteria 1715
33 Ga0070666_10175809 3300005335 Bacteria 1501
34 Ga0070680_100079394 3300005336 Bacteria 2705
35 Ga0070682_100148856 3300005337 Bacteria 1604
36 Ga0070682_101241778 3300005337 Bacteria 631
37 Ga0068868_100561835 3300005338 Bacteria 1007
38 Ga0070660_100012244 3300005339 Bacteria 6122
39 Ga0070660_100130489 3300005339 Bacteria 2011
40 Ga0070660_100567599 3300005339 Bacteria 947
41 Ga0070660_100723930 3300005339 Bacteria 835
42 Ga0070689_100153008 3300005340 Bacteria 1861
43 Ga0070687_100326773 3300005343 Bacteria 982
44 Ga0070687_100436072 3300005343 Bacteria 868
45 Ga0070668_100104422 3300005347 Bacteria 2249
46 Ga0070669_100001373 3300005353 Bacteria 17563
47 Ga0070669_100040264 3300005353 Bacteria 3397
48 Ga0070669_100045667 3300005353 Bacteria 3193
49 Ga0070669_100076099 3300005353 Bacteria 2490
50 Ga0070669_100079821 3300005353 Bacteria 2434
51 Ga0070675_100113009 3300005354 Bacteria 2300
52 Ga0070675_100140434 3300005354 Bacteria 2064
53 Ga0070675_100270944 3300005354 Bacteria 1490
54 Ga0070675_100522728 3300005354 Bacteria 1071
55 Ga0070675_100750312 3300005354 Bacteria 891
56 Ga0070675_101321027 3300005354 Unclassified 665
57 Ga0070671_100005643 3300005355 Bacteria 9957
58 Ga0070671_100064404 3300005355 Bacteria 3053
59 Ga0070671_100414103 3300005355 Bacteria 1154
60 Ga0070674_100078066 3300005356 Bacteria 2359
61 Ga0070674_100318598 3300005356 Bacteria 1246
62 Ga0070674_100358954 3300005356 Bacteria 1179
63 Ga0070674_100427674 3300005356 Bacteria 1088
64 Ga0070674_100678257 3300005356 Bacteria 879
65 Ga0070673_100067482 3300005364 Bacteria 2860
66 Ga0070673_100102553 3300005364 Bacteria 2359
67 Ga0070673_100315794 3300005364 Bacteria 1379
68 Ga0070673_100607733 3300005364 Bacteria 998
69 Ga0070673_101069890 3300005364 Bacteria 753
70 Ga0070688_100002960 3300005365 Bacteria 8657
71 Ga0070688_100016655 3300005365 Bacteria 4205
72 Ga0070688_100227841 3300005365 Bacteria 1317
73 Ga0070688_100303170 3300005365 Bacteria 1155
74 Ga0070659_100169086 3300005366 Bacteria 1790
75 Ga0070659_100305224 3300005366 Bacteria 1328
76 Ga0070667_100235121 3300005367 Bacteria 1635
77 Ga0070711_100084742 3300005439 Bacteria 2268
78 Ga0070705_100067347 3300005440 Bacteria 2151
79 Ga0070705_100200800 3300005440 Bacteria 1367
80 Ga0070705_100794924 3300005440 Bacteria 752
81 Ga0070700_100165270 3300005441 Bacteria 1527
82 Ga0070694_100026503 3300005444 Bacteria 3757
83 Ga0070694_100464340 3300005444 Bacteria 1002
84 Ga0070694_100766151 3300005444 Bacteria 789
85 Ga0070708_100043579 3300005445 Bacteria 3943
86 Ga0070708_100189798 3300005445 Bacteria 1922
87 Ga0070708_100305319 3300005445 Bacteria 1499
88 Ga0070708_100621696 3300005445 Unclassified 1018
89 Ga0070708_100924291 3300005445 Bacteria 819
90 Ga0070663_100299404 3300005455 Bacteria 1287
91 Ga0070663_100530915 3300005455 Bacteria 981
92 Ga0070678_100019556 3300005456 Bacteria 4420
93 Ga0070678_100042628 3300005456 Bacteria 3227
94 Ga0070678_100086206 3300005456 Bacteria 2395
95 Ga0070662_100053417 3300005457 Bacteria 2924
96 Ga0070662_100292551 3300005457 Bacteria 1321
97 Ga0070662_100611760 3300005457 Bacteria 917
98 Ga0070681_10022019 3300005458 Bacteria 6395
99 Ga0070681_10076512 3300005458 Bacteria 3305
100 Ga0070681_10252986 3300005458 Bacteria 1674
101 Ga0070681_10541639 3300005458 Bacteria 1077
102 Ga0068867_100032508 3300005459 Bacteria 3774
103 Ga0068867_100240852 3300005459 Bacteria 1467
104 Ga0068867_100316304 3300005459 Bacteria 1292
105 Ga0068867_100400168 3300005459 Bacteria 1158
106 Ga0070685_10020352 3300005466 Bacteria 3590
107 Ga0070685_10057586 3300005466 Bacteria 2262
108 Ga0070685_10552915 3300005466 Bacteria 822
109 Ga0070706_100656173 3300005467 Bacteria 974
110 Ga0070707_100094736 3300005468 Bacteria 2891
111 Ga0070707_100103003 3300005468 Bacteria 2766
112 Ga0070707_100199746 3300005468 Bacteria 1949
113 Ga0070707_100708928 3300005468 Bacteria 969
114 Ga0070698_100098715 3300005471 Bacteria 2894
115 Ga0070698_100168353 3300005471 Bacteria 2133
116 Ga0070698_100447627 3300005471 Bacteria 1227
117 Ga0070698_100708319 3300005471 Bacteria 949
118 Ga0070698_101090346 3300005471 Bacteria 747
119 Ga0070699_100011351 3300005518 Bacteria 7691
120 Ga0070699_100048831 3300005518 Bacteria 3663
121 Ga0070699_100145338 3300005518 Bacteria 2095
122 Ga0070679_100165560 3300005530 Bacteria 2184
123 Ga0070684_100000085 3300005535 Bacteria 61530
124 Ga0068853_100117095 3300005539 Bacteria 2373
125 Ga0068853_100257842 3300005539 Bacteria 1602
126 Ga0068853_100607363 3300005539 Bacteria 1039
127 Ga0070672_100021287 3300005543 Bacteria 4743
128 Ga0070672_100090097 3300005543 Bacteria 2473
129 Ga0070672_100183130 3300005543 Bacteria 1746
130 Ga0070672_100440212 3300005543 Bacteria 1121
131 Ga0070672_100550322 3300005543 Bacteria 1002
132 Ga0070672_100550943 3300005543 Unclassified 1001
133 Ga0070686_100025139 3300005544 Bacteria 3579
134 Ga0070686_100795604 3300005544 Bacteria 762
135 Ga0070695_100019190 3300005545 Bacteria 4160
136 Ga0070695_100461502 3300005545 Bacteria 975
137 Ga0070696_100061896 3300005546 Bacteria 2619
138 Ga0070696_100105885 3300005546 Bacteria 2021
139 Ga0070696_100203222 3300005546 Bacteria 1480
140 Ga0070693_100537506 3300005547 Bacteria 835
141 Ga0070665_100009152 3300005548 Bacteria 10029
142 Ga0070665_100107181 3300005548 Bacteria 2796
143 Ga0070665_100173101 3300005548 Bacteria 2160
144 Ga0070665_100305967 3300005548 Bacteria 1593
145 Ga0070665_100818989 3300005548 Bacteria 944
146 Ga0070665_101241110 3300005548 Bacteria 756
147 Ga0070704_100270366 3300005549 Bacteria 1404
148 Ga0070704_101189696 3300005549 Bacteria 695
149 Ga0068855_100024107 3300005563 Bacteria 7283
150 Ga0070664_100000442 3300005564 Bacteria 31212
151 Ga0070664_100111623 3300005564 Bacteria 2386
152 Ga0070664_100368763 3300005564 Bacteria 1309
153 Ga0070664_101449005 3300005564 Bacteria 649
154 Ga0068857_100460418 3300005577 Bacteria 1190
155 Ga0068854_100050186 3300005578 Bacteria 2984
156 Ga0068854_100639830 3300005578 Bacteria 912
157 Ga0068856_100012203 3300005614 Bacteria 8324
158 Ga0068852_100436547 3300005616 Bacteria 1294
159 Ga0068859_100091550 3300005617 Bacteria 3092
160 Ga0068859_100145708 3300005617 Bacteria 2443
161 Ga0068859_100253435 3300005617 Bacteria 1850
162 Ga0068859_100303550 3300005617 Bacteria 1690
163 Ga0068859_100536005 3300005617 Bacteria 1265
164 Ga0068859_100609161 3300005617 Bacteria 1185
165 Ga0068859_101385408 3300005617 Bacteria 775
166 Ga0068864_100004401 3300005618 Bacteria 11567
167 Ga0068864_100014824 3300005618 Bacteria 6475
168 Ga0068864_100037415 3300005618 Bacteria 4141
169 Ga0068864_100404962 3300005618 Bacteria 1297
170 Ga0068866_10042614 3300005718 Bacteria 2260
171 Ga0068866_10069885 3300005718 Bacteria 1851
172 Ga0068866_10633127 3300005718 Bacteria 726
173 Ga0068866_10639602 3300005718 Bacteria 723
174 Ga0068861_100131328 3300005719 Bacteria 2033
175 Ga0068861_100367482 3300005719 Bacteria 1267
176 Ga0068861_100793964 3300005719 Bacteria 888
177 Ga0068870_10150032 3300005840 Bacteria 1372
178 Ga0068863_100012648 3300005841 Bacteria 8141
179 Ga0068863_100048499 3300005841 Bacteria 4027
180 Ga0068863_100112640 3300005841 Bacteria 2591
181 Ga0068858_100013804 3300005842 Bacteria 7625
182 Ga0068858_100162878 3300005842 Bacteria 2100
183 Ga0068858_100202811 3300005842 Bacteria 1876
184 Ga0068858_100424946 3300005842 Unclassified 1278
185 Ga0068858_100788367 3300005842 Bacteria 927
186 Ga0068860_100313743 3300005843 Bacteria 1538
187 Ga0068862_100004280 3300005844 Bacteria 12078
188 Ga0068862_100025823 3300005844 Bacteria 4933
189 Ga0068862_100127539 3300005844 Bacteria 2248
190 Ga0068862_100152636 3300005844 Bacteria 2057
191 Ga0068862_100168491 3300005844 Bacteria 1959
192 Ga0068862_100225703 3300005844 Bacteria 1697
193 Ga0068862_101008608 3300005844 Bacteria 824
194 Ga0081455_10058018 3300005937 Bacteria 3278
195 Ga0081455_10187169 3300005937 Bacteria 1563
196 Ga0081455_10338177 3300005937 Bacteria 1066
197 Ga0081539_10009375 3300005985 Bacteria 8199
198 Ga0075432_10069884 3300006058 Bacteria 1260
199 Ga0070716_100041817 3300006173 Bacteria 2556
200 Ga0070712_100306496 3300006175 Bacteria 1287
201 Ga0097621_100000066 3300006237 Bacteria 54619
202 Ga0097621_100004862 3300006237 Bacteria 9415
203 Ga0097621_100081888 3300006237 Bacteria 2687
204 Ga0097621_100200610 3300006237 Bacteria 1732
205 Ga0097621_100272309 3300006237 Bacteria 1488
206 Ga0097621_100427467 3300006237 Bacteria 1190
207 Ga0097621_100453499 3300006237 Bacteria 1156
208 Ga0068871_100000170 3300006358 Bacteria 43522
209 Ga0068871_100015954 3300006358 Bacteria 5643
210 Ga0068871_100337008 3300006358 Bacteria 1331
211 Ga0068871_100530007 3300006358 Bacteria 1065
212 Ga0068871_100853584 3300006358 Bacteria 842
213 Ga0075428_100000003 3300006844 Bacteria 365483
214 Ga0075428_100001358 3300006844 Bacteria 25978
215 Ga0075428_100223106 3300006844 Bacteria 2035
216 Ga0075428_100948243 3300006844 Unclassified 912
217 Ga0075430_101024709 3300006846 Bacteria 680
218 Ga0075431_100009235 3300006847 Bacteria 9896
219 Ga0075431_100046411 3300006847 Bacteria 4480
220 Ga0075431_100225036 3300006847 Bacteria 1913
221 Ga0075431_100601125 3300006847 Bacteria 1084
222 Ga0075431_101049007 3300006847 Bacteria 781
223 Ga0075433_10012184 3300006852 Bacteria 6933
224 Ga0075433_10101463 3300006852 Bacteria 2548
225 Ga0075433_10288384 3300006852 Bacteria 1454
226 Ga0075433_10540358 3300006852 Bacteria 1025
227 Ga0075433_10742730 3300006852 Bacteria 858
228 Ga0075433_10911636 3300006852 Bacteria 766
229 Ga0075434_100000260 3300006871 Bacteria 37408
230 Ga0075434_100049926 3300006871 Bacteria 4155
231 Ga0075434_100119221 3300006871 Bacteria 2653
232 Ga0075434_100201344 3300006871 Bacteria 2011
233 Ga0075434_100221818 3300006871 Bacteria 1910
234 Ga0075434_100645727 3300006871 Bacteria 1077
235 Ga0075434_100734992 3300006871 Bacteria 1004
236 Ga0075429_100095845 3300006880 Bacteria 2588
237 Ga0075429_100416474 3300006880 Bacteria 1177
238 Ga0075429_100913907 3300006880 Bacteria 768
239 Ga0068865_100021831 3300006881 Bacteria 4167
240 Ga0068865_100032362 3300006881 Bacteria 3492
241 Ga0068865_100163612 3300006881 Bacteria 1699
242 Ga0075436_100036450 3300006914 Bacteria 3394
243 Ga0075436_100104702 3300006914 Bacteria 1972
244 Ga0075436_100388785 3300006914 Bacteria 1009
245 Ga0075436_100531818 3300006914 Bacteria 862
246 Ga0097620_100091552 3300006931 Bacteria 3092
247 Ga0097620_100145711 3300006931 Bacteria 2443
248 Ga0097620_100253429 3300006931 Bacteria 1850
249 Ga0097620_100303565 3300006931 Bacteria 1690
250 Ga0097620_100536020 3300006931 Bacteria 1265
251 Ga0097620_100609196 3300006931 Bacteria 1185
252 Ga0097620_101385411 3300006931 Bacteria 775
253 Ga0075435_100000064 3300007076 Bacteria 54706
254 Ga0075435_100000956 3300007076 Bacteria 18244
255 Ga0075435_100001486 3300007076 Bacteria 15064
256 Ga0075435_100009317 3300007076 Bacteria 7100
257 Ga0075435_100030037 3300007076 Bacteria 4270
258 Ga0075435_100080563 3300007076 Bacteria 2673
259 Ga0075435_100198882 3300007076 Bacteria 1698
260 Ga0075435_100235627 3300007076 Bacteria 1556
261 Ga0075435_100263137 3300007076 Bacteria 1470
262 Ga0075435_100775402 3300007076 Bacteria 834
263 Ga0105251_10208200 3300009011 Unclassified 881
264 Ga0105240_10043908 3300009093 Bacteria 5684
265 Ga0105240_10199012 3300009093 Bacteria 2350
266 Ga0105240_10276151 3300009093 Bacteria 1933
267 Ga0105240_10450925 3300009093 Bacteria 1439
268 Ga0105240_10864923 3300009093 Bacteria 975
269 Ga0111539_10000001 3300009094 Bacteria 1035431
270 Ga0111539_10002104 3300009094 Bacteria 26607
271 Ga0111539_10024645 3300009094 Bacteria 7379
272 Ga0111539_10074840 3300009094 Bacteria 3990
273 Ga0111539_10098674 3300009094 Bacteria 3430
274 Ga0111539_10442227 3300009094 Bacteria 1514
275 Ga0105245_10068047 3300009098 Bacteria 3226
276 Ga0105245_11132201 3300009098 Bacteria 829
277 Ga0105247_10055248 3300009101 Bacteria 2451
278 Ga0114129_10006049 3300009147 Bacteria 17157
279 Ga0114129_10007288 3300009147 Bacteria 15747
280 Ga0114129_10028743 3300009147 Bacteria 7877
281 Ga0114129_10032021 3300009147 Bacteria 7433
282 Ga0114129_10041259 3300009147 Bacteria 6503
283 Ga0114129_10048371 3300009147 Bacteria 5975
284 Ga0114129_10065109 3300009147 Bacteria 5087
285 Ga0114129_10072782 3300009147 Bacteria 4790
286 Ga0114129_10085215 3300009147 Bacteria 4384
287 Ga0114129_10865377 3300009147 Bacteria 1148
288 Ga0114129_10878379 3300009147 Bacteria 1138
289 Ga0105243_10006872 3300009148 Bacteria 8771
290 Ga0105241_10551432 3300009174 Bacteria 1035
291 Ga0105242_10001351 3300009176 Bacteria 19349
292 Ga0105242_10031995 3300009176 Bacteria 4205
293 Ga0105242_10137415 3300009176 Bacteria 2117
294 Ga0105242_10172432 3300009176 Bacteria 1902
295 Ga0105242_10223217 3300009176 Bacteria 1685
296 Ga0105248_10019171 3300009177 Bacteria 7568
297 Ga0105248_10022784 3300009177 Bacteria 6951
298 Ga0105248_10077836 3300009177 Bacteria 3729
299 Ga0105248_10087056 3300009177 Bacteria 3515
300 Ga0105248_10099091 3300009177 Bacteria 3284
301 Ga0105248_10203570 3300009177 Bacteria 2230
302 Ga0105248_10215838 3300009177 Bacteria 2161
303 Ga0105248_10224887 3300009177 Bacteria 2112
304 Ga0105248_10333938 3300009177 Bacteria 1707
305 Ga0105248_10447650 3300009177 Bacteria 1455
306 Ga0105248_10530127 3300009177 Bacteria 1328
307 Ga0105248_10593224 3300009177 Bacteria 1250
308 Ga0105238_10207226 3300009551 Bacteria 1937
309 Ga0105238_10367596 3300009551 Bacteria 1428
310 Ga0105238_10377020 3300009551 Bacteria 1410
311 Ga0105238_10387080 3300009551 Bacteria 1390
312 Ga0105249_10000688 3300009553 Bacteria 30761
313 Ga0105249_10059463 3300009553 Bacteria 3505
314 Ga0105249_10393036 3300009553 Bacteria 1415
315 Ga0105249_10749306 3300009553 Bacteria 1039
316 Ga0105249_11116655 3300009553 Bacteria 859
317 Ga0105249_11647101 3300009553 Bacteria 714
318 Ga0105239_10288919 3300010375 Bacteria 1847
319 Ga0105239_10434181 3300010375 Bacteria 1489
320 Ga0105246_10167694 3300011119 Bacteria 1679
321 Ga0105246_10391354 3300011119 Bacteria 1151
322 Ga0105246_10419679 3300011119 Bacteria 1116
323 Ga0157374_10048498 3300013296 Bacteria 3940
324 Ga0157378_10115031 3300013297 Bacteria 2472
325 Ga0157378_10982756 3300013297 Bacteria 878
326 Ga0163162_10285217 3300013306 Bacteria 1783
327 Ga0163162_10427928 3300013306 Bacteria 1456
328 Ga0163162_10479723 3300013306 Bacteria 1375
329 Ga0163162_11746668 3300013306 Bacteria 711
330 Ga0157372_10644399 3300013307 Bacteria 1234
331 Ga0157372_10844899 3300013307 Bacteria 1063
332 Ga0157375_10119756 3300013308 Bacteria 2740
333 Ga0157375_10425541 3300013308 Bacteria 1494
334 Ga0157375_10725113 3300013308 Bacteria 1147
335 Ga0163163_10006749 3300014325 Bacteria 10061
336 Ga0163163_10063166 3300014325 Bacteria 3671
337 Ga0163163_10142721 3300014325 Bacteria 2437
338 Ga0163163_10881232 3300014325 Bacteria 958
339 Ga0157380_10034047 3300014326 Bacteria 3928
340 Ga0157380_10189471 3300014326 Bacteria 1814
341 Ga0157380_10859429 3300014326 Bacteria 930
342 Ga0157380_11168831 3300014326 Bacteria 812
343 Ga0157377_10190314 3300014745 Bacteria 1296
344 Ga0157377_10204807 3300014745 Bacteria 1255
345 Ga0157379_10049621 3300014968 Bacteria 3748
346 Ga0157379_10070958 3300014968 Bacteria 3117
347 Ga0157379_10211338 3300014968 Bacteria 1756
348 Ga0157379_10418094 3300014968 Bacteria 1234
349 Ga0157376_10021091 3300014969 Bacteria 5056
350 Ga0157376_10120872 3300014969 Bacteria 2321
351 Ga0157376_10210051 3300014969 Bacteria 1796
352 Ga0157376_10482257 3300014969 Bacteria 1215
353 Ga0157376_10623461 3300014969 Bacteria 1076
354 Ga0163161_10074971 3300017792 Bacteria 2482
355 Ga0207697_10183488 3300025315 Unclassified 918
356 Ga0207682_10025795 3300025893 Bacteria 2332
357 Ga0207642_10027711 3300025899 Bacteria 2322
358 Ga0207642_10439120 3300025899 Bacteria 788
359 Ga0207710_10069529 3300025900 Bacteria 1612
360 Ga0207710_10105268 3300025900 Bacteria 1335
361 Ga0207688_10330346 3300025901 Bacteria 937
362 Ga0207680_10014285 3300025903 Bacteria 4104
363 Ga0207680_10112271 3300025903 Bacteria 1770
364 Ga0207680_10170713 3300025903 Bacteria 1465
365 Ga0207699_10529356 3300025906 Unclassified 853
366 Ga0207645_10005968 3300025907 Bacteria 8770
367 Ga0207645_10276405 3300025907 Bacteria 1114
368 Ga0207643_10066487 3300025908 Bacteria 2067
369 Ga0207705_10373323 3300025909 Bacteria 1101
370 Ga0207654_10633046 3300025911 Bacteria 765
371 Ga0207707_10063397 3300025912 Bacteria 3217
372 Ga0207707_10222517 3300025912 Bacteria 1643
373 Ga0207707_10460636 3300025912 Bacteria 1087
374 Ga0207707_10746528 3300025912 Bacteria 819
375 Ga0207695_10451887 3300025913 Bacteria 1168
376 Ga0207663_10067550 3300025916 Bacteria 2293
377 Ga0207660_10201874 3300025917 Bacteria 1553
378 Ga0207662_10035840 3300025918 Bacteria 2899
379 Ga0207662_10076398 3300025918 Bacteria 2036
380 Ga0207662_10570760 3300025918 Bacteria 785
381 Ga0207657_10127678 3300025919 Bacteria 2087
382 Ga0207652_10061240 3300025921 Bacteria 3249
383 Ga0207652_10072372 3300025921 Bacteria 2998
384 Ga0207646_10042536 3300025922 Bacteria 4081
385 Ga0207646_10066661 3300025922 Bacteria 3214
386 Ga0207646_10234644 3300025922 Bacteria 1657
387 Ga0207681_10023583 3300025923 Bacteria 3938
388 Ga0207681_10030491 3300025923 Bacteria 3516
389 Ga0207681_10238130 3300025923 Bacteria 1415
390 Ga0207681_10514216 3300025923 Bacteria 982
391 Ga0207681_10596736 3300025923 Bacteria 912
392 Ga0207694_10217945 3300025924 Bacteria 1556
393 Ga0207694_10320097 3300025924 Bacteria 1280
394 Ga0207650_10019273 3300025925 Bacteria 4791
395 Ga0207650_10022579 3300025925 Bacteria 4454
396 Ga0207650_10100187 3300025925 Bacteria 2229
397 Ga0207650_10114336 3300025925 Bacteria 2093
398 Ga0207650_10187307 3300025925 Bacteria 1652
399 Ga0207650_11116792 3300025925 Bacteria 671
400 Ga0207659_10078119 3300025926 Bacteria 2438
401 Ga0207659_10150489 3300025926 Bacteria 1817
402 Ga0207659_10212040 3300025926 Bacteria 1553
403 Ga0207659_10289199 3300025926 Bacteria 1342
404 Ga0207659_10299750 3300025926 Bacteria 1320
405 Ga0207659_11005346 3300025926 Unclassified 717
406 Ga0207687_10072618 3300025927 Bacteria 2462
407 Ga0207664_10064359 3300025929 Bacteria 2933
408 Ga0207644_10026930 3300025931 Bacteria 3969
409 Ga0207644_10031768 3300025931 Bacteria 3681
410 Ga0207644_10107080 3300025931 Bacteria 2109
411 Ga0207644_10195169 3300025931 Bacteria 1594
412 Ga0207644_10329599 3300025931 Bacteria 1236
413 Ga0207690_10172692 3300025932 Bacteria 1621
414 Ga0207706_10124461 3300025933 Bacteria 2268
415 Ga0207706_10142262 3300025933 Bacteria 2110
416 Ga0207706_10271943 3300025933 Bacteria 1478
417 Ga0207706_10348297 3300025933 Bacteria 1288
418 Ga0207706_10545605 3300025933 Bacteria 998
419 Ga0207686_10206673 3300025934 Bacteria 1409
420 Ga0207686_10278301 3300025934 Bacteria 1234
421 Ga0207686_10560960 3300025934 Bacteria 894
422 Ga0207709_10056811 3300025935 Bacteria 2424
423 Ga0207709_10677679 3300025935 Bacteria 823
424 Ga0207670_10101565 3300025936 Bacteria 2055
425 Ga0207669_10086810 3300025937 Bacteria 2024
426 Ga0207669_10584577 3300025937 Bacteria 905
427 Ga0207669_10681147 3300025937 Bacteria 843
428 Ga0207669_10704385 3300025937 Bacteria 830
429 Ga0207669_10779612 3300025937 Unclassified 791
430 Ga0207704_10014059 3300025938 Bacteria 4031
431 Ga0207704_10075926 3300025938 Bacteria 2151
432 Ga0207704_10101818 3300025938 Bacteria 1917
433 Ga0207704_10688735 3300025938 Bacteria 845
434 Ga0207704_10714562 3300025938 Bacteria 831
435 Ga0207665_10012342 3300025939 Bacteria 5612
436 Ga0207691_10020300 3300025940 Bacteria 6283
437 Ga0207691_10196469 3300025940 Unclassified 1757
438 Ga0207691_10205126 3300025940 Bacteria 1715
439 Ga0207711_10008875 3300025941 Bacteria 8407
440 Ga0207711_10012469 3300025941 Bacteria 7064
441 Ga0207711_10036340 3300025941 Bacteria 4180
442 Ga0207711_10215803 3300025941 Bacteria 1753
443 Ga0207711_10268562 3300025941 Bacteria 1569
444 Ga0207711_10291277 3300025941 Bacteria 1505
445 Ga0207711_10322740 3300025941 Bacteria 1427
446 Ga0207711_10730992 3300025941 Bacteria 923
447 Ga0207711_10808736 3300025941 Bacteria 873
448 Ga0207711_10933818 3300025941 Bacteria 806
449 Ga0207711_10994333 3300025941 Bacteria 778
450 Ga0207689_10226837 3300025942 Bacteria 1544
451 Ga0207689_10446730 3300025942 Bacteria 1080
452 Ga0207661_10003551 3300025944 Bacteria 10836
453 Ga0207661_10266390 3300025944 Bacteria 1528
454 Ga0207661_10378100 3300025944 Bacteria 1282
455 Ga0207679_10005303 3300025945 Bacteria 8086
456 Ga0207679_10105085 3300025945 Bacteria 2217
457 Ga0207679_10205448 3300025945 Bacteria 1648
458 Ga0207679_10868746 3300025945 Unclassified 824
459 Ga0207651_10074198 3300025960 Bacteria 2422
460 Ga0207651_10077248 3300025960 Bacteria 2383
461 Ga0207651_10243306 3300025960 Bacteria 1468
462 Ga0207712_10298995 3300025961 Bacteria 1320
463 Ga0207712_10813594 3300025961 Bacteria 822
464 Ga0207668_10124869 3300025972 Bacteria 1955
465 Ga0207668_10244030 3300025972 Bacteria 1455
466 Ga0207640_10091380 3300025981 Bacteria 2109
467 Ga0207640_10308322 3300025981 Bacteria 1255
468 Ga0207658_10156413 3300025986 Bacteria 1863
469 Ga0207658_10334916 3300025986 Bacteria 1314
470 Ga0207658_10446924 3300025986 Bacteria 1144
471 Ga0207658_10738898 3300025986 Bacteria 891
472 Ga0207677_10092868 3300026023 Bacteria 2198
473 Ga0207703_10023951 3300026035 Bacteria 4802
474 Ga0207703_10039756 3300026035 Bacteria 3760
475 Ga0207703_10125566 3300026035 Bacteria 2209
476 Ga0207703_10728641 3300026035 Bacteria 944
477 Ga0207639_10102694 3300026041 Bacteria 2315
478 Ga0207639_10320339 3300026041 Bacteria 1376
479 Ga0207678_10191875 3300026067 Bacteria 1746
480 Ga0207678_10443220 3300026067 Bacteria 1128
481 Ga0207678_10712885 3300026067 Bacteria 883
482 Ga0207708_10032701 3300026075 Bacteria 3949
483 Ga0207708_10318845 3300026075 Bacteria 1268
484 Ga0207708_10352005 3300026075 Bacteria 1208
485 Ga0207708_10406892 3300026075 Bacteria 1126
486 Ga0207702_10008469 3300026078 Bacteria 8674
487 Ga0207641_10004712 3300026088 Bacteria 11761
488 Ga0207641_10163865 3300026088 Bacteria 2023
489 Ga0207641_10204106 3300026088 Bacteria 1824
490 Ga0207648_10032669 3300026089 Bacteria 4592
491 Ga0207648_10190712 3300026089 Bacteria 1816
492 Ga0207648_10395064 3300026089 Bacteria 1252
493 Ga0207676_10050187 3300026095 Bacteria 3251
494 Ga0207676_10181287 3300026095 Bacteria 1844
495 Ga0207674_10202922 3300026116 Bacteria 1932
496 Ga0207674_10446163 3300026116 Bacteria 1251
497 Ga0207675_100022197 3300026118 Bacteria 5909
498 Ga0207675_100226283 3300026118 Bacteria 1803
499 Ga0207675_100282159 3300026118 Bacteria 1614
500 Ga0207675_100328310 3300026118 Bacteria 1495
501 Ga0207675_100354391 3300026118 Bacteria 1438
502 Ga0207675_100451397 3300026118 Bacteria 1274
503 Ga0207675_100452166 3300026118 Bacteria 1273
504 Ga0207675_100500226 3300026118 Bacteria 1210
505 Ga0207675_100540223 3300026118 Bacteria 1164
506 Ga0207683_10018509 3300026121 Bacteria 5944
507 Ga0207683_10025896 3300026121 Bacteria 5062
508 Ga0207683_10081095 3300026121 Bacteria 2879
509 Ga0207683_10152909 3300026121 Bacteria 2083
510 Ga0207683_10214370 3300026121 Bacteria 1753
511 Ga0207683_10359937 3300026121 Bacteria 1336
512 Ga0207683_10640777 3300026121 Bacteria 984
513 Ga0207698_10764689 3300026142 Unclassified 966
514 Ga0207698_10818695 3300026142 Bacteria 934
515 Ga0209971_1005801 3300027682 Bacteria 2926
516 Ga0207428_10000002 3300027907 Bacteria 854851
517 Ga0207428_10046677 3300027907 Bacteria 3483
518 Ga0207428_10078208 3300027907 Bacteria 2588
519 Ga0207428_10088773 3300027907 Bacteria 2404
520 Ga0207428_10178434 3300027907 Bacteria 1605
521 Ga0268266_10228936 3300028379 Bacteria 1711
522 Ga0268266_10703705 3300028379 Bacteria 974
523 Ga0268265_10005753 3300028380 Bacteria 8464
524 Ga0268265_10061120 3300028380 Bacteria 2890
525 Ga0268265_10071673 3300028380 Bacteria 2699
526 Ga0268265_10182846 3300028380 Unclassified 1803
527 Ga0268265_10246916 3300028380 Bacteria 1578
528 Ga0268265_10307291 3300028380 Bacteria 1430
529 Ga0268265_10490539 3300028380 Bacteria 1156
530 Ga0268265_11527338 3300028380 Bacteria 672
531 Ga0268264_10134387 3300028381 Bacteria 2197
532 Ga0268264_10252644 3300028381 Bacteria 1638
533 Ga0268264_10818894 3300028381 Bacteria 931
534 Ga0265320_10153836 3300031240 Bacteria 1038
535 Ga0307408_100866497 3300031548 Bacteria 824
536 Ga0265314_10013713 3300031711 Bacteria 6534
537 Ga0307416_100614390 3300032002 Bacteria 1168
538 Ga0307414_10991689 3300032004 Bacteria 773
539 Ga0307415_100326313 3300032126 Bacteria 1282
540 Ga0373948_0032551 3300034817 Bacteria 1058
541 Ga0373959_0003929 3300034820 Bacteria 2379
542 Ga0373938_0012093 3300034957 Bacteria 1614
543 Ga0373928_0001191 3300035084 Bacteria 5133
544 Ga0373929_0000268 3300035085 Bacteria 9647
545 Ga0373949_0003188 3300035090 Bacteria 3984
546 Ga0373951_0001312 3300035091 Bacteria 6564
547 Ga0373952_0000777 3300035092 Bacteria 5745
548 Ga0373923_0179740 3300035111 Bacteria 972
549 Ga0373932_0000945 3300035112 Bacteria 8512
550 Ga0373939_0000488 3300035114 Bacteria 10011
551 Ga0373939_0009737 3300035114 Bacteria 2389
552 Ga0373941_0009542 3300035115 Bacteria 2448
553 Ga0373945_0224724 3300035116 Bacteria 786
554 Ga0373960_0000652 3300035121 Bacteria 7134
555 Ga0373943_0434350 3300035170 Bacteria 761
556 Ga0373942_0004030 3300035207 Bacteria 3429
557 Ga0373942_0128744 3300035207 Bacteria 797
558 Ga0373961_0001097 3300035241 Bacteria 8607
559 Ga0373962_0000586 3300035242 Bacteria 8220
560 Ga0373931_0000769 3300035691 Bacteria 13414
561 Ga0373931_0267686 3300035691 Bacteria 1045
562 Ga0373931_0422892 3300035691 Bacteria 847
563 Ga0373935_0016157 3300035692 Bacteria 4518
564 Ga0373947_0107141 3300035725 Bacteria 1762
565 Ga0373937_0337926 3300036401 Bacteria 1426
566 Ga0373937_0428246 3300036401 Bacteria 1256
567 Ga0373937_0462021 3300036401 Bacteria 1206
568 Ga0373937_0950372 3300036401 Bacteria 808
569 Ga0373925_0064919 3300037068 Bacteria 2749
570 Ga0395901_0828811 3300038443 Bacteria 912
571 Ga0436360_0379591 3300039438 Unclassified 876
572 Ga0436363_0340096 3300039450 Bacteria 1373
573 Ga0450923_014261 3300042125 Bacteria 1473
574 Ga0450896_001674 3300042133 Bacteria 2771
575 Ga0450918_013685 3300042531 Bacteria 1411
576 Ga0451577_0293325 3300042876 Bacteria 1474
577 Ga0453683_0540690 3300044673 Bacteria 758
578 Ga0451576_0079987 3300045051 Bacteria 3401
579 Ga0451576_0419301 3300045051 Bacteria 1404
580 Ga0451576_1800552 3300045051 Bacteria 633
581 Ga0495592_0105109 3300046454 Unclassified 2006
582 Ga0495603_0179976 3300046455 Bacteria 1223
583 Ga0495629_0597008 3300046459 Bacteria 739
584 Ga0495641_0032592 3300046461 Bacteria 2478
585 Ga0495653_0186621 3300046463 Bacteria 1418
586 Ga0495580_0287612 3300046472 Bacteria 1121
587 Ga0495582_0157544 3300046473 Bacteria 1291
588 Ga0495585_0394763 3300046492 Unclassified 667
589 Ga0495628_0293564 3300046516 Bacteria 1204
590 Ga0495644_0128176 3300046523 Bacteria 967
591 Ga0495642_0090823 3300046528 Bacteria 1293
592 Ga0495640_0113446 3300046533 Bacteria 1768
593 Ga0495586_0405386 3300046535 Bacteria 785
594 Ga0495645_0611104 3300046543 Bacteria 670
595 Ga0495667_0243925 3300046559 Bacteria 1144
596 Ga0495667_0292540 3300046559 Bacteria 1033
597 Ga0495667_0561643 3300046559 Bacteria 713
598 Ga0495656_0007853 3300046615 Bacteria 3791
599 Ga0495668_0403034 3300046616 Bacteria 752
600 Ga0495634_0028417 3300046642 Bacteria 3882
601 Ga0495634_0558054 3300046642 Bacteria 667
602 Ga0495635_0059317 3300046663 Bacteria 2631
603 Ga0495659_0131930 3300046664 Bacteria 991
604 Ga0495646_0176749 3300046680 Bacteria 1174
605 Ga0495647_0026691 3300046681 Unclassified 2118
606 Ga0495647_0206941 3300046681 Unclassified 862
607 Ga0495658_0040220 3300046683 Unclassified 2599
608 Ga0495658_0388732 3300046683 Bacteria 889
609 Ga0495669_0169066 3300046684 Bacteria 1039
610 Ga0495613_0126865 3300046689 Bacteria 1829
611 Ga0495613_0572587 3300046689 Unclassified 754
612 Ga0495674_0007981 3300047319 Bacteria 10101
613 Ga0495674_0062170 3300047319 Bacteria 3252
614 Ga0495674_0068429 3300047319 Bacteria 3073
615 Ga0495680_0003636 3300047322 Bacteria 15062
616 Ga0495684_0107881 3300047471 Bacteria 2103
617 Ga0495602_0617355 3300048088 Bacteria 744
618 Ga0496100_0096561 3300048903 Bacteria 2028
619 Ga0496100_0805546 3300048903 Bacteria 736
620 Ga0496101_0009325 3300048904 Bacteria 6447
621 Ga0496102_0391561 3300048905 Bacteria 1307
622 Ga0496104_0082818 3300048907 Bacteria 3060
623 Ga0496104_0111413 3300048907 Bacteria 2624
624 Ga0496104_0287112 3300048907 Bacteria 1558
625 Ga0496104_0351278 3300048907 Bacteria 1387
626 Ga0496104_0830732 3300048907 Unclassified 830
627 Ga0496104_0923537 3300048907 Unclassified 778
628 Ga0496105_0124319 3300048908 Bacteria 2127
629 Ga0496105_0296437 3300048908 Bacteria 1301
630 Ga0496106_0040814 3300048909 Bacteria 3477
631 Ga0496106_0315408 3300048909 Bacteria 1255
632 Ga0496107_0065627 3300048910 Bacteria 2632
633 Ga0496108_0004831 3300048911 Bacteria 10873
634 Ga0496108_0044963 3300048911 Bacteria 3687
635 Ga0496108_0119376 3300048911 Bacteria 2261
636 Ga0496108_0258864 3300048911 Bacteria 1514
637 Ga0496109_0000242 3300048912 Bacteria 52965
638 Ga0496109_0167629 3300048912 Bacteria 2060
639 Ga0496109_0198657 3300048912 Bacteria 1885
640 Ga0496109_0232488 3300048912 Bacteria 1734
641 Ga0496109_0432126 3300048912 Bacteria 1244
642 Ga0496109_1262175 3300048912 Unclassified 675
643 Ga0496110_0001366 3300048913 Bacteria 17576
644 Ga0496110_0004909 3300048913 Bacteria 10439
645 Ga0496110_0913132 3300048913 Bacteria 784
646 Ga0496111_0042971 3300048914 Bacteria 3247
647 Ga0496112_0000481 3300048915 Bacteria 26754
648 Ga0496112_0001340 3300048915 Bacteria 18727
649 Ga0496112_0022194 3300048915 Bacteria 6049
650 Ga0496112_0067435 3300048915 Bacteria 3532
651 Ga0496112_1663619 3300048915 Unclassified 551
652 Ga0496113_0041716 3300048916 Bacteria 3388
653 Ga0496113_0113813 3300048916 Bacteria 2109
654 Ga0496114_0181735 3300048917 Bacteria 1837
655 Ga0496114_0402391 3300048917 Bacteria 1212
656 Ga0496114_0428430 3300048917 Bacteria 1172
657 Ga0501036_0354713 3300049572 Bacteria 1225
658 Ga0501036_0421561 3300049572 Bacteria 1113
659 Ga0501036_1013160 3300049572 Bacteria 680
660 Ga0501040_0172021 3300049576 Bacteria 1534
661 Ga0501040_0977537 3300049576 Bacteria 614
662 Ga0501041_0446005 3300049577 Unclassified 821
663 Ga0501043_0602214 3300049579 Bacteria 812
664 Ga0501048_0072954 3300049582 Bacteria 2423
665 Ga0501069_0170407 3300049585 Bacteria 1256
666 Ga0501072_0301372 3300049588 Bacteria 1274
667 Ga0501073_0001250 3300049589 Bacteria 18592
668 Ga0501074_0069537 3300049590 Bacteria 2532
669 Ga0501074_0384213 3300049590 Bacteria 996
670 Ga0501075_0073759 3300049591 Bacteria 2581
671 Ga0501075_0152714 3300049591 Bacteria 1760
672 Ga0501076_0151173 3300049592 Bacteria 1889
673 Ga0501081_0033914 3300049743 Bacteria 3471
674 Ga0501081_0183996 3300049743 Bacteria 1512
675 Ga0501081_0207195 3300049743 Bacteria 1423
676 Ga0501035_0085009 3300049822 Bacteria 2790
677 Ga0501045_0042038 3300049824 Bacteria 3327
678 Ga0501045_0925251 3300049824 Bacteria 640
679 nmdc:mga05p37_114810_c1 3300050507 Bacteria 3310
680 nmdc:mga05p37_11912_c3 3300050507 Bacteria 4505
681 nmdc:mga05p37_1467_c2 3300050507 Bacteria 5862
682 nmdc:mga05p37_18492_c1 3300050507 Bacteria 8419
683 nmdc:mga05p37_18511_c1 3300050507 Bacteria 8415
684 nmdc:mga05p37_194142_c1 3300050507 Bacteria 2463
685 nmdc:mga05p37_28505_c1 3300050507 Bacteria 6808
686 nmdc:mga05p37_56816_c1 3300050507 Bacteria 4819
687 nmdc:mga05p37_62951_c1 3300050507 Bacteria 4565
688 nmdc:mga05p37_7758_c1 3300050507 Bacteria 12668
689 nmdc:mga05p37_817852_c1 3300050507 Bacteria 1017
690 nmdc:mga09592_126020_c2 3300050508 Bacteria 1237
691 nmdc:mga09592_164309_c1 3300050508 Bacteria 1918
692 nmdc:mga0qj67_153853_c1 3300050509 Bacteria 1866
693 nmdc:mga06r32_16191_c1 3300050510 Bacteria 6792
694 nmdc:mga06r32_269789_c1 3300050510 Bacteria 1689
695 nmdc:mga06r32_395942_c1 3300050510 Bacteria 1363
696 nmdc:mga06r32_72373_c1 3300050510 Bacteria 3337
697 nmdc:mga08y16_29860_c1 3300050511 Bacteria 5741
698 nmdc:mga08y16_329085_c1 3300050511 Bacteria 1572
699 nmdc:mga08y16_389430_c1 3300050511 Bacteria 1428
700 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
701 nmdc:mga08y16_55360_c1 3300050511 Bacteria 4145
702 nmdc:mga08y16_62241_c1 3300050511 Bacteria 3897
703 nmdc:mga0n895_110200_c1 3300050512 Bacteria 2768
704 nmdc:mga0n895_12860_c1 3300050512 Bacteria 7521
705 nmdc:mga0n895_130_c1 3300050512 Bacteria 44769
706 nmdc:mga0n895_151333_c1 3300050512 Bacteria 2351
707 nmdc:mga0n895_212572_c1 3300050512 Bacteria 1964
708 nmdc:mga0n895_235605_c1 3300050512 Bacteria 1858
709 nmdc:mga0n895_353422_c1 3300050512 Bacteria 1488
710 nmdc:mga0n895_42297_c1 3300050512 Bacteria 4432
711 nmdc:mga0n895_54417_c1 3300050512 Bacteria 3936
712 nmdc:mga0n895_622501_c1 3300050512 Bacteria 1080
713 nmdc:mga0n895_63626_c1 3300050512 Bacteria 3648
714 nmdc:mga0n895_676607_c1 3300050512 Bacteria 1029
715 nmdc:mga0n895_884930_c1 3300050512 Bacteria 879
716 nmdc:mga0rr50_152691_c1 3300050513 Bacteria 1868
717 nmdc:mga0rr50_42032_c1 3300050513 Bacteria 3335
718 nmdc:mga0rr50_46863_c1 3300050513 Bacteria 3185
719 nmdc:mga0rr50_49619_c1 3300050513 Bacteria 2508
720 nmdc:mga0rr50_5366_c1 3300050513 Bacteria 7639
721 nmdc:mga0rr50_5415_c1 3300050513 Bacteria 7609
722 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
723 nmdc:mga0rr50_9595_c1 3300050513 Bacteria 6095
724 nmdc:mga08x19_114381_c1 3300050514 Bacteria 1803
725 nmdc:mga08x19_17692_c1 3300050514 Bacteria 4365
726 nmdc:mga08x19_270_c1 3300050514 Bacteria 39380
727 nmdc:mga08x19_311261_c1 3300050514 Bacteria 1095
728 nmdc:mga08x19_476429_c1 3300050514 Bacteria 880
729 nmdc:mga08x19_53421_c1 3300050514 Bacteria 2600
730 nmdc:mga0a205_172898_c1 3300050515 Bacteria 2056
731 nmdc:mga0a205_178980_c1 3300050515 Bacteria 2015
732 nmdc:mga0a205_209536_c1 3300050515 Bacteria 1838
733 nmdc:mga0a205_23800_c1 3300050515 Bacteria 5812
734 nmdc:mga0a205_370252_c1 3300050515 Unclassified 1299
735 nmdc:mga0a205_38026_c1 3300050515 Bacteria 4629
736 nmdc:mga0a205_441250_c1 3300050515 Bacteria 1162
737 nmdc:mga0a205_54185_c1 3300050515 Bacteria 3872
738 nmdc:mga0a205_544813_c1 3300050515 Bacteria 1016
739 nmdc:mga0a205_72644_c1 3300050515 Bacteria 3324
740 Ga0495601_0083628 3300053077 Bacteria 2050
741 Ga0495595_0013969 3300053084 Bacteria 3400
742 Ga0495595_0155689 3300053084 Bacteria 1126
743 Ga0495619_0005033 3300053085 Bacteria 8396
744 Ga0495619_0051070 3300053085 Bacteria 2732
745 Ga0495619_0112432 3300053085 Bacteria 1862
746 Ga0495619_0187223 3300053085 Bacteria 1433
747 Ga0501082_0061166 3300060353 Bacteria 3242
748 Ga0501082_0137398 3300060353 Bacteria 2121
749 Ga0207708_10909075
750 SwRhRL2b_contig_3181706
751 MRS1b_contig_7392549
752 JGI24751J29686_10001906
753 Ga0058862_12374949
754 Ga0065704_10025299
755 Ga0065712_10032885
756 Ga0065712_10086516
757 Ga0065712_10155174
758 Ga0065715_10089447
759 Ga0065715_10173661
760 Ga0065715_10189832
761 Ga0065707_10083745
762 Ga0065707_10101877
763 Ga0065707_10272809
764 Ga0065707_10373122
765 Ga0070658_10575796
766 Ga0070676_10109671
767 Ga0070683_100214025
768 Ga0070683_100422151
769 Ga0070683_100491740
770 Ga0070690_100023302
771 Ga0070690_100571123
772 Ga0070670_100002347
773 Ga0070670_100034706
774 Ga0070670_100418034
775 Ga0070670_100424196
776 Ga0070670_100804841
777 Ga0070677_10028118
778 Ga0068869_100491312
779 Ga0070666_10009157
780 Ga0070666_10135228
781 Ga0070666_10175809
782 Ga0070680_100079394
783 Ga0070682_100148856
784 Ga0070682_101241778
785 Ga0068868_100561835
786 Ga0070660_100012244
787 Ga0070660_100130489
788 Ga0070660_100567599
789 Ga0070660_100723930
790 Ga0070689_100153008
791 Ga0070687_100326773
792 Ga0070687_100436072
793 Ga0070668_100104422
794 Ga0070669_100001373
795 Ga0070669_100040264
796 Ga0070669_100045667
797 Ga0070669_100076099
798 Ga0070669_100079821
799 Ga0070675_100113009
800 Ga0070675_100140434
801 Ga0070675_100270944
802 Ga0070675_100522728
803 Ga0070675_100750312
804 Ga0070675_101321027
805 Ga0070671_100005643
806 Ga0070671_100064404
807 Ga0070671_100414103
808 Ga0070674_100078066
809 Ga0070674_100318598
810 Ga0070674_100358954
811 Ga0070674_100427674
812 Ga0070674_100678257
813 Ga0070673_100067482
814 Ga0070673_100102553
815 Ga0070673_100315794
816 Ga0070673_100607733
817 Ga0070673_101069890
818 Ga0070688_100002960
819 Ga0070688_100016655
820 Ga0070688_100227841
821 Ga0070688_100303170
822 Ga0070659_100169086
823 Ga0070659_100305224
824 Ga0070667_100235121
825 Ga0070711_100084742
826 Ga0070705_100067347
827 Ga0070705_100200800
828 Ga0070705_100794924
829 Ga0070700_100165270
830 Ga0070694_100026503
831 Ga0070694_100464340
832 Ga0070694_100766151
833 Ga0070708_100043579
834 Ga0070708_100189798
835 Ga0070708_100305319
836 Ga0070708_100621696
837 Ga0070708_100924291
838 Ga0070663_100299404
839 Ga0070663_100530915
840 Ga0070678_100019556
841 Ga0070678_100042628
842 Ga0070678_100086206
843 Ga0070662_100053417
844 Ga0070662_100292551
845 Ga0070662_100611760
846 Ga0070681_10022019
847 Ga0070681_10076512
848 Ga0070681_10252986
849 Ga0070681_10541639
850 Ga0068867_100032508
851 Ga0068867_100240852
852 Ga0068867_100316304
853 Ga0068867_100400168
854 Ga0070685_10020352
855 Ga0070685_10057586
856 Ga0070685_10552915
857 Ga0070706_100656173
858 Ga0070707_100094736
859 Ga0070707_100103003
860 Ga0070707_100199746
861 Ga0070707_100708928
862 Ga0070698_100098715
863 Ga0070698_100168353
864 Ga0070698_100447627
865 Ga0070698_100708319
866 Ga0070698_101090346
867 Ga0070699_100011351
868 Ga0070699_100048831
869 Ga0070699_100145338
870 Ga0070679_100165560
871 Ga0070684_100000085
872 Ga0068853_100117095
873 Ga0068853_100257842
874 Ga0068853_100607363
875 Ga0070672_100021287
876 Ga0070672_100090097
877 Ga0070672_100183130
878 Ga0070672_100440212
879 Ga0070672_100550322
880 Ga0070672_100550943
881 Ga0070686_100025139
882 Ga0070686_100795604
883 Ga0070695_100019190
884 Ga0070695_100461502
885 Ga0070696_100061896
886 Ga0070696_100105885
887 Ga0070696_100203222
888 Ga0070693_100537506
889 Ga0070665_100009152
890 Ga0070665_100107181
891 Ga0070665_100173101
892 Ga0070665_100305967
893 Ga0070665_100818989
894 Ga0070665_101241110
895 Ga0070704_100270366
896 Ga0070704_101189696
897 Ga0068855_100024107
898 Ga0070664_100000442
899 Ga0070664_100111623
900 Ga0070664_100368763
901 Ga0070664_101449005
902 Ga0068857_100460418
903 Ga0068854_100050186
904 Ga0068854_100639830
905 Ga0068856_100012203
906 Ga0068852_100436547
907 Ga0068859_100091550
908 Ga0068859_100145708
909 Ga0068859_100253435
910 Ga0068859_100303550
911 Ga0068859_100536005
912 Ga0068859_100609161
913 Ga0068859_101385408
914 Ga0068864_100004401
915 Ga0068864_100014824
916 Ga0068864_100037415
917 Ga0068864_100404962
918 Ga0068866_10042614
919 Ga0068866_10069885
920 Ga0068866_10633127
921 Ga0068866_10639602
922 Ga0068861_100131328
923 Ga0068861_100367482
924 Ga0068861_100793964
925 Ga0068870_10150032
926 Ga0068863_100012648
927 Ga0068863_100048499
928 Ga0068863_100112640
929 Ga0068858_100013804
930 Ga0068858_100162878
931 Ga0068858_100202811
932 Ga0068858_100424946
933 Ga0068858_100788367
934 Ga0068860_100313743
935 Ga0068862_100004280
936 Ga0068862_100025823
937 Ga0068862_100127539
938 Ga0068862_100152636
939 Ga0068862_100168491
940 Ga0068862_100225703
941 Ga0068862_101008608
942 Ga0081455_10058018
943 Ga0081455_10187169
944 Ga0081455_10338177
945 Ga0081539_10009375
946 Ga0075432_10069884
947 Ga0070716_100041817
948 Ga0070712_100306496
949 Ga0097621_100000066
950 Ga0097621_100004862
951 Ga0097621_100081888
952 Ga0097621_100200610
953 Ga0097621_100272309
954 Ga0097621_100427467
955 Ga0097621_100453499
956 Ga0068871_100000170
957 Ga0068871_100015954
958 Ga0068871_100337008
959 Ga0068871_100530007
960 Ga0068871_100853584
961 Ga0075428_100000003
962 Ga0075428_100001358
963 Ga0075428_100223106
964 Ga0075428_100948243
965 Ga0075430_101024709
966 Ga0075431_100009235
967 Ga0075431_100046411
968 Ga0075431_100225036
969 Ga0075431_100601125
970 Ga0075431_101049007
971 Ga0075433_10012184
972 Ga0075433_10101463
973 Ga0075433_10288384
974 Ga0075433_10540358
975 Ga0075433_10742730
976 Ga0075433_10911636
977 Ga0075434_100000260
978 Ga0075434_100049926
979 Ga0075434_100119221
980 Ga0075434_100201344
981 Ga0075434_100221818
982 Ga0075434_100645727
983 Ga0075434_100734992
984 Ga0075429_100095845
985 Ga0075429_100416474
986 Ga0075429_100913907
987 Ga0068865_100021831
988 Ga0068865_100032362
989 Ga0068865_100163612
990 Ga0075436_100036450
991 Ga0075436_100104702
992 Ga0075436_100388785
993 Ga0075436_100531818
994 Ga0097620_100091552
995 Ga0097620_100145711
996 Ga0097620_100253429
997 Ga0097620_100303565
998 Ga0097620_100536020
999 Ga0097620_100609196
1000 Ga0097620_101385411
1001 Ga0075435_100000064
1002 Ga0075435_100000956
1003 Ga0075435_100001486
1004 Ga0075435_100009317
1005 Ga0075435_100030037
1006 Ga0075435_100080563
1007 Ga0075435_100198882
1008 Ga0075435_100235627
1009 Ga0075435_100263137
1010 Ga0075435_100775402
1011 Ga0105251_10208200
1012 Ga0105240_10043908
1013 Ga0105240_10199012
1014 Ga0105240_10276151
1015 Ga0105240_10450925
1016 Ga0105240_10864923
1017 Ga0111539_10000001
1018 Ga0111539_10002104
1019 Ga0111539_10024645
1020 Ga0111539_10074840
1021 Ga0111539_10098674
1022 Ga0111539_10442227
1023 Ga0105245_10068047
1024 Ga0105245_11132201
1025 Ga0105247_10055248
1026 Ga0114129_10006049
1027 Ga0114129_10007288
1028 Ga0114129_10028743
1029 Ga0114129_10032021
1030 Ga0114129_10041259
1031 Ga0114129_10048371
1032 Ga0114129_10065109
1033 Ga0114129_10072782
1034 Ga0114129_10085215
1035 Ga0114129_10865377
1036 Ga0114129_10878379
1037 Ga0105243_10006872
1038 Ga0105241_10551432
1039 Ga0105242_10001351
1040 Ga0105242_10031995
1041 Ga0105242_10137415
1042 Ga0105242_10172432
1043 Ga0105242_10223217
1044 Ga0105248_10019171
1045 Ga0105248_10022784
1046 Ga0105248_10077836
1047 Ga0105248_10087056
1048 Ga0105248_10099091
1049 Ga0105248_10203570
1050 Ga0105248_10215838
1051 Ga0105248_10224887
1052 Ga0105248_10333938
1053 Ga0105248_10447650
1054 Ga0105248_10530127
1055 Ga0105248_10593224
1056 Ga0105238_10207226
1057 Ga0105238_10367596
1058 Ga0105238_10377020
1059 Ga0105238_10387080
1060 Ga0105249_10000688
1061 Ga0105249_10059463
1062 Ga0105249_10393036
1063 Ga0105249_10749306
1064 Ga0105249_11116655
1065 Ga0105249_11647101
1066 Ga0105239_10288919
1067 Ga0105239_10434181
1068 Ga0105246_10167694
1069 Ga0105246_10391354
1070 Ga0105246_10419679
1071 Ga0157374_10048498
1072 Ga0157378_10115031
1073 Ga0157378_10982756
1074 Ga0163162_10285217
1075 Ga0163162_10427928
1076 Ga0163162_10479723
1077 Ga0163162_11746668
1078 Ga0157372_10644399
1079 Ga0157372_10844899
1080 Ga0157375_10119756
1081 Ga0157375_10425541
1082 Ga0157375_10725113
1083 Ga0163163_10006749
1084 Ga0163163_10063166
1085 Ga0163163_10142721
1086 Ga0163163_10881232
1087 Ga0157380_10034047
1088 Ga0157380_10189471
1089 Ga0157380_10859429
1090 Ga0157380_11168831
1091 Ga0157377_10190314
1092 Ga0157377_10204807
1093 Ga0157379_10049621
1094 Ga0157379_10070958
1095 Ga0157379_10211338
1096 Ga0157379_10418094
1097 Ga0157376_10021091
1098 Ga0157376_10120872
1099 Ga0157376_10210051
1100 Ga0157376_10482257
1101 Ga0157376_10623461
1102 Ga0163161_10074971
1103 Ga0207697_10183488
1104 Ga0207682_10025795
1105 Ga0207642_10027711
1106 Ga0207642_10439120
1107 Ga0207710_10069529
1108 Ga0207710_10105268
1109 Ga0207688_10330346
1110 Ga0207680_10014285
1111 Ga0207680_10112271
1112 Ga0207680_10170713
1113 Ga0207699_10529356
1114 Ga0207645_10005968
1115 Ga0207645_10276405
1116 Ga0207643_10066487
1117 Ga0207705_10373323
1118 Ga0207654_10633046
1119 Ga0207707_10063397
1120 Ga0207707_10222517
1121 Ga0207707_10460636
1122 Ga0207707_10746528
1123 Ga0207695_10451887
1124 Ga0207663_10067550
1125 Ga0207660_10201874
1126 Ga0207662_10035840
1127 Ga0207662_10076398
1128 Ga0207662_10570760
1129 Ga0207657_10127678
1130 Ga0207652_10061240
1131 Ga0207652_10072372
1132 Ga0207646_10042536
1133 Ga0207646_10066661
1134 Ga0207646_10234644
1135 Ga0207681_10023583
1136 Ga0207681_10030491
1137 Ga0207681_10238130
1138 Ga0207681_10514216
1139 Ga0207681_10596736
1140 Ga0207694_10217945
1141 Ga0207694_10320097
1142 Ga0207650_10019273
1143 Ga0207650_10022579
1144 Ga0207650_10100187
1145 Ga0207650_10114336
1146 Ga0207650_10187307
1147 Ga0207650_11116792
1148 Ga0207659_10078119
1149 Ga0207659_10150489
1150 Ga0207659_10212040
1151 Ga0207659_10289199
1152 Ga0207659_10299750
1153 Ga0207659_11005346
1154 Ga0207687_10072618
1155 Ga0207664_10064359
1156 Ga0207644_10026930
1157 Ga0207644_10031768
1158 Ga0207644_10107080
1159 Ga0207644_10195169
1160 Ga0207644_10329599
1161 Ga0207690_10172692
1162 Ga0207706_10124461
1163 Ga0207706_10142262
1164 Ga0207706_10271943
1165 Ga0207706_10348297
1166 Ga0207706_10545605
1167 Ga0207686_10206673
1168 Ga0207686_10278301
1169 Ga0207686_10560960
1170 Ga0207709_10056811
1171 Ga0207709_10677679
1172 Ga0207670_10101565
1173 Ga0207669_10086810
1174 Ga0207669_10584577
1175 Ga0207669_10681147
1176 Ga0207669_10704385
1177 Ga0207669_10779612
1178 Ga0207704_10014059
1179 Ga0207704_10075926
1180 Ga0207704_10101818
1181 Ga0207704_10688735
1182 Ga0207704_10714562
1183 Ga0207665_10012342
1184 Ga0207691_10020300
1185 Ga0207691_10196469
1186 Ga0207691_10205126
1187 Ga0207711_10008875
1188 Ga0207711_10012469
1189 Ga0207711_10036340
1190 Ga0207711_10215803
1191 Ga0207711_10268562
1192 Ga0207711_10291277
1193 Ga0207711_10322740
1194 Ga0207711_10730992
1195 Ga0207711_10808736
1196 Ga0207711_10933818
1197 Ga0207711_10994333
1198 Ga0207689_10226837
1199 Ga0207689_10446730
1200 Ga0207661_10003551
1201 Ga0207661_10266390
1202 Ga0207661_10378100
1203 Ga0207679_10005303
1204 Ga0207679_10105085
1205 Ga0207679_10205448
1206 Ga0207679_10868746
1207 Ga0207651_10074198
1208 Ga0207651_10077248
1209 Ga0207651_10243306
1210 Ga0207712_10298995
1211 Ga0207712_10813594
1212 Ga0207668_10124869
1213 Ga0207668_10244030
1214 Ga0207640_10091380
1215 Ga0207640_10308322
1216 Ga0207658_10156413
1217 Ga0207658_10334916
1218 Ga0207658_10446924
1219 Ga0207658_10738898
1220 Ga0207677_10092868
1221 Ga0207703_10023951
1222 Ga0207703_10039756
1223 Ga0207703_10125566
1224 Ga0207703_10728641
1225 Ga0207639_10102694
1226 Ga0207639_10320339
1227 Ga0207678_10191875
1228 Ga0207678_10443220
1229 Ga0207678_10712885
1230 Ga0207708_10032701
1231 Ga0207708_10318845
1232 Ga0207708_10352005
1233 Ga0207708_10406892
1234 Ga0207702_10008469
1235 Ga0207641_10004712
1236 Ga0207641_10163865
1237 Ga0207641_10204106
1238 Ga0207648_10032669
1239 Ga0207648_10190712
1240 Ga0207648_10395064
1241 Ga0207676_10050187
1242 Ga0207676_10181287
1243 Ga0207674_10202922
1244 Ga0207674_10446163
1245 Ga0207675_100022197
1246 Ga0207675_100226283
1247 Ga0207675_100282159
1248 Ga0207675_100328310
1249 Ga0207675_100354391
1250 Ga0207675_100451397
1251 Ga0207675_100452166
1252 Ga0207675_100500226
1253 Ga0207675_100540223
1254 Ga0207683_10018509
1255 Ga0207683_10025896
1256 Ga0207683_10081095
1257 Ga0207683_10152909
1258 Ga0207683_10214370
1259 Ga0207683_10359937
1260 Ga0207683_10640777
1261 Ga0207698_10764689
1262 Ga0207698_10818695
1263 Ga0209971_1005801
1264 Ga0207428_10000002
1265 Ga0207428_10046677
1266 Ga0207428_10078208
1267 Ga0207428_10088773
1268 Ga0207428_10178434
1269 Ga0268266_10228936
1270 Ga0268266_10703705
1271 Ga0268265_10005753
1272 Ga0268265_10061120
1273 Ga0268265_10071673
1274 Ga0268265_10182846
1275 Ga0268265_10246916
1276 Ga0268265_10307291
1277 Ga0268265_10490539
1278 Ga0268265_11527338
1279 Ga0268264_10134387
1280 Ga0268264_10252644
1281 Ga0268264_10818894
1282 Ga0265320_10153836
1283 Ga0307408_100866497
1284 Ga0265314_10013713
1285 Ga0307416_100614390
1286 Ga0307414_10991689
1287 Ga0307415_100326313
1288 Ga0373948_0032551
1289 Ga0373959_0003929
1290 Ga0373938_0012093
1291 Ga0373928_0001191
1292 Ga0373929_0000268
1293 Ga0373949_0003188
1294 Ga0373951_0001312
1295 Ga0373952_0000777
1296 Ga0373923_0179740
1297 Ga0373932_0000945
1298 Ga0373939_0000488
1299 Ga0373939_0009737
1300 Ga0373941_0009542
1301 Ga0373945_0224724
1302 Ga0373960_0000652
1303 Ga0373943_0434350
1304 Ga0373942_0004030
1305 Ga0373942_0128744
1306 Ga0373961_0001097
1307 Ga0373962_0000586
1308 Ga0373931_0000769
1309 Ga0373931_0267686
1310 Ga0373931_0422892
1311 Ga0373935_0016157
1312 Ga0373947_0107141
1313 Ga0373937_0337926
1314 Ga0373937_0428246
1315 Ga0373937_0462021
1316 Ga0373937_0950372
1317 Ga0373925_0064919
1318 Ga0395901_0828811
1319 Ga0436360_0379591
1320 Ga0436363_0340096
1321 Ga0450923_014261
1322 Ga0450896_001674
1323 Ga0450918_013685
1324 Ga0451577_0293325
1325 Ga0453683_0540690
1326 Ga0451576_0079987
1327 Ga0451576_0419301
1328 Ga0451576_1800552
1329 Ga0495592_0105109
1330 Ga0495603_0179976
1331 Ga0495629_0597008
1332 Ga0495641_0032592
1333 Ga0495653_0186621
1334 Ga0495580_0287612
1335 Ga0495582_0157544
1336 Ga0495585_0394763
1337 Ga0495628_0293564
1338 Ga0495644_0128176
1339 Ga0495642_0090823
1340 Ga0495640_0113446
1341 Ga0495586_0405386
1342 Ga0495645_0611104
1343 Ga0495667_0243925
1344 Ga0495667_0292540
1345 Ga0495667_0561643
1346 Ga0495656_0007853
1347 Ga0495668_0403034
1348 Ga0495634_0028417
1349 Ga0495634_0558054
1350 Ga0495635_0059317
1351 Ga0495659_0131930
1352 Ga0495646_0176749
1353 Ga0495647_0026691
1354 Ga0495647_0206941
1355 Ga0495658_0040220
1356 Ga0495658_0388732
1357 Ga0495669_0169066
1358 Ga0495613_0126865
1359 Ga0495613_0572587
1360 Ga0495674_0007981
1361 Ga0495674_0062170
1362 Ga0495674_0068429
1363 Ga0495680_0003636
1364 Ga0495684_0107881
1365 Ga0495602_0617355
1366 Ga0496100_0096561
1367 Ga0496100_0805546
1368 Ga0496101_0009325
1369 Ga0496102_0391561
1370 Ga0496104_0082818
1371 Ga0496104_0111413
1372 Ga0496104_0287112
1373 Ga0496104_0351278
1374 Ga0496104_0830732
1375 Ga0496104_0923537
1376 Ga0496105_0124319
1377 Ga0496105_0296437
1378 Ga0496106_0040814
1379 Ga0496106_0315408
1380 Ga0496107_0065627
1381 Ga0496108_0004831
1382 Ga0496108_0044963
1383 Ga0496108_0119376
1384 Ga0496108_0258864
1385 Ga0496109_0000242
1386 Ga0496109_0167629
1387 Ga0496109_0198657
1388 Ga0496109_0232488
1389 Ga0496109_0432126
1390 Ga0496109_1262175
1391 Ga0496110_0001366
1392 Ga0496110_0004909
1393 Ga0496110_0913132
1394 Ga0496111_0042971
1395 Ga0496112_0000481
1396 Ga0496112_0001340
1397 Ga0496112_0022194
1398 Ga0496112_0067435
1399 Ga0496112_1663619
1400 Ga0496113_0041716
1401 Ga0496113_0113813
1402 Ga0496114_0181735
1403 Ga0496114_0402391
1404 Ga0496114_0428430
1405 Ga0501036_0354713
1406 Ga0501036_0421561
1407 Ga0501036_1013160
1408 Ga0501040_0172021
1409 Ga0501040_0977537
1410 Ga0501041_0446005
1411 Ga0501043_0602214
1412 Ga0501048_0072954
1413 Ga0501069_0170407
1414 Ga0501072_0301372
1415 Ga0501073_0001250
1416 Ga0501074_0069537
1417 Ga0501074_0384213
1418 Ga0501075_0073759
1419 Ga0501075_0152714
1420 Ga0501076_0151173
1421 Ga0501081_0033914
1422 Ga0501081_0183996
1423 Ga0501081_0207195
1424 Ga0501035_0085009
1425 Ga0501045_0042038
1426 Ga0501045_0925251
1427 nmdc:mga05p37_114810_c1
1428 nmdc:mga05p37_11912_c3
1429 nmdc:mga05p37_1467_c2
1430 nmdc:mga05p37_18492_c1
1431 nmdc:mga05p37_18511_c1
1432 nmdc:mga05p37_194142_c1
1433 nmdc:mga05p37_28505_c1
1434 nmdc:mga05p37_56816_c1
1435 nmdc:mga05p37_62951_c1
1436 nmdc:mga05p37_7758_c1
1437 nmdc:mga05p37_817852_c1
1438 nmdc:mga09592_126020_c2
1439 nmdc:mga09592_164309_c1
1440 nmdc:mga0qj67_153853_c1
1441 nmdc:mga06r32_16191_c1
1442 nmdc:mga06r32_269789_c1
1443 nmdc:mga06r32_395942_c1
1444 nmdc:mga06r32_72373_c1
1445 nmdc:mga08y16_29860_c1
1446 nmdc:mga08y16_329085_c1
1447 nmdc:mga08y16_389430_c1
1448 nmdc:mga08y16_3_c1
1449 nmdc:mga08y16_55360_c1
1450 nmdc:mga08y16_62241_c1
1451 nmdc:mga0n895_110200_c1
1452 nmdc:mga0n895_12860_c1
1453 nmdc:mga0n895_130_c1
1454 nmdc:mga0n895_151333_c1
1455 nmdc:mga0n895_212572_c1
1456 nmdc:mga0n895_235605_c1
1457 nmdc:mga0n895_353422_c1
1458 nmdc:mga0n895_42297_c1
1459 nmdc:mga0n895_54417_c1
1460 nmdc:mga0n895_622501_c1
1461 nmdc:mga0n895_63626_c1
1462 nmdc:mga0n895_676607_c1
1463 nmdc:mga0n895_884930_c1
1464 nmdc:mga0rr50_152691_c1
1465 nmdc:mga0rr50_42032_c1
1466 nmdc:mga0rr50_46863_c1
1467 nmdc:mga0rr50_49619_c1
1468 nmdc:mga0rr50_5366_c1
1469 nmdc:mga0rr50_5415_c1
1470 nmdc:mga0rr50_5_c1
1471 nmdc:mga0rr50_9595_c1
1472 nmdc:mga08x19_114381_c1
1473 nmdc:mga08x19_17692_c1
1474 nmdc:mga08x19_270_c1
1475 nmdc:mga08x19_311261_c1
1476 nmdc:mga08x19_476429_c1
1477 nmdc:mga08x19_53421_c1
1478 nmdc:mga0a205_172898_c1
1479 nmdc:mga0a205_178980_c1
1480 nmdc:mga0a205_209536_c1
1481 nmdc:mga0a205_23800_c1
1482 nmdc:mga0a205_370252_c1
1483 nmdc:mga0a205_38026_c1
1484 nmdc:mga0a205_441250_c1
1485 nmdc:mga0a205_54185_c1
1486 nmdc:mga0a205_544813_c1
1487 nmdc:mga0a205_72644_c1
1488 Ga0495601_0083628
1489 Ga0495595_0013969
1490 Ga0495595_0155689
1491 Ga0495619_0005033
1492 Ga0495619_0051070
1493 Ga0495619_0112432
1494 Ga0495619_0187223
1495 Ga0501082_0061166
1496 Ga0501082_0137398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

21

184

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lhp-assembly2.cif.gz_T crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9623 110 186
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9546 6 187
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9463 6 187
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9348 6 187
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.9316 7 186
ID Description Score Start End Superfamily
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9941 7 187 1.10.132.20
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9852 8 187 1.10.132.20
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.982 7 182 1.10.132.20
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.981 7 189 1.10.132.20
4kawX01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9798 7 187 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A6N4TFV1-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9747 8 187 GO:0005737
GO:0006415
GO:0043023
AF-A0A7C6N339-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.971 6 187 GO:0005737
GO:0006415
GO:0043023
AF-A0A4V1UUT9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.968 6 186 GO:0005737
GO:0006415
GO:0043023
AF-P61306-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.968 6 189 GO:0005737
GO:0006415
GO:0043023
AF-A0A7D7ZIN6-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9679 6 189 GO:0005737
GO:0006415
GO:0043023

Map