F478945
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 275 | 1496 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10049523|Ga0070709_100495232 |
| Length | 127 |
| Sequence | VARSSSASVNSTMLDVKIDRQEPTELFEQVAAEIRRAIADGEAKPGERLPPARDLAAVLGVNTNTVLRSLRLLRDEGMLEFRRGRGVTVAGTPEKGAVIARARELVRFARQQGYRRDELIQLIDDLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 133 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 137 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 142 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 143 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 161 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 162 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 163 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 164 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 165 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 166 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 167 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 168 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 169 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 170 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 171 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 172 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 173 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 180 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 181 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 1.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 8.69 |
| Rhizosphere | 90.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10049523 | 3300005434 | Bacteria | 2627 |
| 2 | rootH2_10121284 | 3300003320 | Bacteria | 1114 |
| 3 | rootH1_10247950 | 3300003323 | Bacteria | 1132 |
| 4 | Ga0070658_10156803 | 3300005327 | Bacteria | 1909 |
| 5 | Ga0070683_100768477 | 3300005329 | Bacteria | 923 |
| 6 | Ga0070680_100222339 | 3300005336 | Bacteria | 1594 |
| 7 | Ga0070680_100636560 | 3300005336 | Bacteria | 916 |
| 8 | Ga0070680_100771367 | 3300005336 | Bacteria | 828 |
| 9 | Ga0068868_100733843 | 3300005338 | Bacteria | 886 |
| 10 | Ga0070660_100501791 | 3300005339 | Bacteria | 1009 |
| 11 | Ga0070660_101083770 | 3300005339 | Bacteria | 678 |
| 12 | Ga0070689_100392689 | 3300005340 | Unclassified | 1171 |
| 13 | Ga0070691_10135712 | 3300005341 | Bacteria | 1250 |
| 14 | Ga0070661_100338969 | 3300005344 | Unclassified | 1177 |
| 15 | Ga0070661_100581771 | 3300005344 | Bacteria | 903 |
| 16 | Ga0070692_10277561 | 3300005345 | Bacteria | 1014 |
| 17 | Ga0070668_100016897 | 3300005347 | Bacteria | 5458 |
| 18 | Ga0070671_100098536 | 3300005355 | Unclassified | 2452 |
| 19 | Ga0070659_100143603 | 3300005366 | Bacteria | 1944 |
| 20 | Ga0070659_100932591 | 3300005366 | Bacteria | 760 |
| 21 | Ga0070659_101264253 | 3300005366 | Bacteria | 654 |
| 22 | Ga0070709_10438988 | 3300005434 | Bacteria | 981 |
| 23 | Ga0070714_100027979 | 3300005435 | Bacteria | 4672 |
| 24 | Ga0070714_100144214 | 3300005435 | Bacteria | 2140 |
| 25 | Ga0070714_100151916 | 3300005435 | Bacteria | 2088 |
| 26 | Ga0070714_100172913 | 3300005435 | Bacteria | 1961 |
| 27 | Ga0070714_100198653 | 3300005435 | Bacteria | 1834 |
| 28 | Ga0070714_100275815 | 3300005435 | Bacteria | 1561 |
| 29 | Ga0070714_100363651 | 3300005435 | Bacteria | 1361 |
| 30 | Ga0070714_100423545 | 3300005435 | Unclassified | 1261 |
| 31 | Ga0070714_100568239 | 3300005435 | Bacteria | 1087 |
| 32 | Ga0070714_100900104 | 3300005435 | Unclassified | 859 |
| 33 | Ga0070714_101466297 | 3300005435 | Bacteria | 666 |
| 34 | Ga0070713_100090964 | 3300005436 | Bacteria | 2624 |
| 35 | Ga0070713_100128337 | 3300005436 | Bacteria | 2233 |
| 36 | Ga0070713_100210407 | 3300005436 | Bacteria | 1760 |
| 37 | Ga0070710_10002886 | 3300005437 | Bacteria | 8189 |
| 38 | Ga0070710_10007484 | 3300005437 | Bacteria | 5290 |
| 39 | Ga0070711_100012826 | 3300005439 | Bacteria | 5248 |
| 40 | Ga0070711_100258721 | 3300005439 | Unclassified | 1368 |
| 41 | Ga0070711_101132192 | 3300005439 | Bacteria | 675 |
| 42 | Ga0070694_100043570 | 3300005444 | Bacteria | 3001 |
| 43 | Ga0070694_100087909 | 3300005444 | Bacteria | 2175 |
| 44 | Ga0070694_100552678 | 3300005444 | Bacteria | 922 |
| 45 | Ga0070708_100035442 | 3300005445 | Bacteria | 4347 |
| 46 | Ga0070708_100329749 | 3300005445 | Bacteria | 1438 |
| 47 | Ga0070662_100009058 | 3300005457 | Bacteria | 6495 |
| 48 | Ga0070662_100129743 | 3300005457 | Bacteria | 1942 |
| 49 | Ga0070681_10020159 | 3300005458 | Bacteria | 6683 |
| 50 | Ga0070681_10020314 | 3300005458 | Bacteria | 6658 |
| 51 | Ga0070681_10075699 | 3300005458 | Bacteria | 3326 |
| 52 | Ga0070681_10484645 | 3300005458 | Unclassified | 1149 |
| 53 | Ga0070707_100000130 | 3300005468 | Bacteria | 70270 |
| 54 | Ga0070707_100083902 | 3300005468 | Plasmid | 3078 |
| 55 | Ga0070698_100079829 | 3300005471 | Bacteria | 3268 |
| 56 | Ga0070699_100805646 | 3300005518 | Unclassified | 860 |
| 57 | Ga0070679_100126972 | 3300005530 | Bacteria | 2532 |
| 58 | Ga0070679_100128599 | 3300005530 | Unclassified | 2514 |
| 59 | Ga0070679_100185302 | 3300005530 | Bacteria | 2052 |
| 60 | Ga0070679_101970639 | 3300005530 | Bacteria | 533 |
| 61 | Ga0070684_100180941 | 3300005535 | Bacteria | 1917 |
| 62 | Ga0070684_100404522 | 3300005535 | Unclassified | 1259 |
| 63 | Ga0070684_100539869 | 3300005535 | Bacteria | 1082 |
| 64 | Ga0070684_101181626 | 3300005535 | Bacteria | 719 |
| 65 | Ga0070684_102204675 | 3300005535 | Unclassified | 520 |
| 66 | Ga0070697_100853464 | 3300005536 | Bacteria | 807 |
| 67 | Ga0070686_100556504 | 3300005544 | Unclassified | 898 |
| 68 | Ga0070695_100000284 | 3300005545 | Bacteria | 25552 |
| 69 | Ga0070695_100084197 | 3300005545 | Bacteria | 2109 |
| 70 | Ga0070695_100639675 | 3300005545 | Bacteria | 839 |
| 71 | Ga0070696_100682591 | 3300005546 | Bacteria | 836 |
| 72 | Ga0070696_101370815 | 3300005546 | Bacteria | 602 |
| 73 | Ga0070696_101741134 | 3300005546 | Bacteria | 538 |
| 74 | Ga0070693_100468645 | 3300005547 | Bacteria | 887 |
| 75 | Ga0070693_100489649 | 3300005547 | Bacteria | 870 |
| 76 | Ga0068855_100015091 | 3300005563 | Bacteria | 9300 |
| 77 | Ga0068855_100054162 | 3300005563 | Bacteria | 4716 |
| 78 | Ga0068855_100113063 | 3300005563 | Bacteria | 3115 |
| 79 | Ga0068855_100396535 | 3300005563 | Bacteria | 1513 |
| 80 | Ga0068855_100839797 | 3300005563 | Bacteria | 974 |
| 81 | Ga0070664_100141634 | 3300005564 | Bacteria | 2118 |
| 82 | Ga0070664_102236380 | 3300005564 | Bacteria | 519 |
| 83 | Ga0068857_100544618 | 3300005577 | Bacteria | 1093 |
| 84 | Ga0068854_101326353 | 3300005578 | Bacteria | 648 |
| 85 | Ga0068854_101478116 | 3300005578 | Bacteria | 616 |
| 86 | Ga0068856_100255928 | 3300005614 | Bacteria | 1766 |
| 87 | Ga0068856_100314196 | 3300005614 | Bacteria | 1584 |
| 88 | Ga0068856_101088811 | 3300005614 | Unclassified | 817 |
| 89 | Ga0070702_100358314 | 3300005615 | Bacteria | 1030 |
| 90 | Ga0068852_100079839 | 3300005616 | Unclassified | 2899 |
| 91 | Ga0068852_101307297 | 3300005616 | Bacteria | 747 |
| 92 | Ga0068852_101345545 | 3300005616 | Bacteria | 736 |
| 93 | Ga0068864_101632480 | 3300005618 | Bacteria | 649 |
| 94 | Ga0068861_100026596 | 3300005719 | Bacteria | 4208 |
| 95 | Ga0068861_100196332 | 3300005719 | Bacteria | 1691 |
| 96 | Ga0081455_10005176 | 3300005937 | Bacteria | 14357 |
| 97 | Ga0081455_10807258 | 3300005937 | Bacteria | 589 |
| 98 | Ga0081540_1001617 | 3300005983 | Bacteria | 19187 |
| 99 | Ga0070717_10010121 | 3300006028 | Bacteria | 7100 |
| 100 | Ga0070717_10072379 | 3300006028 | Bacteria | 2878 |
| 101 | Ga0070717_10093402 | 3300006028 | Bacteria | 2543 |
| 102 | Ga0070717_10137344 | 3300006028 | Bacteria | 2106 |
| 103 | Ga0070717_10149401 | 3300006028 | Bacteria | 2020 |
| 104 | Ga0070717_10638495 | 3300006028 | Bacteria | 966 |
| 105 | Ga0075432_10027384 | 3300006058 | Bacteria | 1963 |
| 106 | Ga0070715_10001530 | 3300006163 | Bacteria | 6755 |
| 107 | Ga0070716_100016698 | 3300006173 | Bacteria | 3794 |
| 108 | Ga0070716_100139485 | 3300006173 | Bacteria | 1544 |
| 109 | Ga0070716_100516790 | 3300006173 | Bacteria | 884 |
| 110 | Ga0070712_100058471 | 3300006175 | Bacteria | 2712 |
| 111 | Ga0070712_101420431 | 3300006175 | Bacteria | 606 |
| 112 | Ga0075428_100681297 | 3300006844 | Bacteria | 1096 |
| 113 | Ga0075428_100842678 | 3300006844 | Bacteria | 974 |
| 114 | Ga0075431_100381015 | 3300006847 | Bacteria | 1414 |
| 115 | Ga0075433_10155955 | 3300006852 | Bacteria | 2031 |
| 116 | Ga0075433_10646711 | 3300006852 | Bacteria | 927 |
| 117 | Ga0075434_100061498 | 3300006871 | Bacteria | 3736 |
| 118 | Ga0075434_100062752 | 3300006871 | Bacteria | 3699 |
| 119 | Ga0075434_100322812 | 3300006871 | Bacteria | 1564 |
| 120 | Ga0068865_100164541 | 3300006881 | Bacteria | 1695 |
| 121 | Ga0075436_100172592 | 3300006914 | Bacteria | 1527 |
| 122 | Ga0075436_100877252 | 3300006914 | Bacteria | 670 |
| 123 | Ga0075436_100941138 | 3300006914 | Bacteria | 647 |
| 124 | Ga0075435_100060201 | 3300007076 | Bacteria | 3078 |
| 125 | Ga0075435_100170108 | 3300007076 | Bacteria | 1838 |
| 126 | Ga0075435_100225387 | 3300007076 | Bacteria | 1592 |
| 127 | Ga0075435_100586995 | 3300007076 | Bacteria | 966 |
| 128 | Ga0105240_10015883 | 3300009093 | Bacteria | 10214 |
| 129 | Ga0105240_10030635 | 3300009093 | Bacteria | 6990 |
| 130 | Ga0105240_10192696 | 3300009093 | Bacteria | 2395 |
| 131 | Ga0105240_10470317 | 3300009093 | Bacteria | 1403 |
| 132 | Ga0111539_10132270 | 3300009094 | Bacteria | 2921 |
| 133 | Ga0111539_10264642 | 3300009094 | Bacteria | 2002 |
| 134 | Ga0111539_12796702 | 3300009094 | Bacteria | 565 |
| 135 | Ga0105245_10005406 | 3300009098 | Bacteria | 11225 |
| 136 | Ga0105245_10015395 | 3300009098 | Bacteria | 6667 |
| 137 | Ga0105245_10110030 | 3300009098 | Bacteria | 2561 |
| 138 | Ga0105245_10371898 | 3300009098 | Unclassified | 1421 |
| 139 | Ga0105245_10705055 | 3300009098 | Bacteria | 1043 |
| 140 | Ga0105247_10574314 | 3300009101 | Bacteria | 832 |
| 141 | Ga0114129_10380712 | 3300009147 | Bacteria | 1864 |
| 142 | Ga0114129_10741727 | 3300009147 | Bacteria | 1258 |
| 143 | Ga0114129_12449435 | 3300009147 | Bacteria | 624 |
| 144 | Ga0105243_10109815 | 3300009148 | Bacteria | 2305 |
| 145 | Ga0105243_10140014 | 3300009148 | Bacteria | 2063 |
| 146 | Ga0105248_10765253 | 3300009177 | Bacteria | 1090 |
| 147 | Ga0105248_11382237 | 3300009177 | Unclassified | 796 |
| 148 | Ga0105237_10014676 | 3300009545 | Bacteria | 8180 |
| 149 | Ga0105237_11181752 | 3300009545 | Unclassified | 772 |
| 150 | Ga0105238_10538009 | 3300009551 | Unclassified | 1172 |
| 151 | Ga0105249_10090542 | 3300009553 | Bacteria | 2860 |
| 152 | Ga0105239_10008805 | 3300010375 | Bacteria | 11422 |
| 153 | Ga0105239_10027083 | 3300010375 | Bacteria | 6310 |
| 154 | Ga0105239_10217516 | 3300010375 | Bacteria | 2142 |
| 155 | Ga0105239_12311908 | 3300010375 | Unclassified | 626 |
| 156 | Ga0105246_10113443 | 3300011119 | Bacteria | 1995 |
| 157 | Ga0105246_11963656 | 3300011119 | Unclassified | 563 |
| 158 | Ga0157371_10140362 | 3300013102 | Unclassified | 1721 |
| 159 | Ga0157371_11433661 | 3300013102 | Bacteria | 537 |
| 160 | Ga0157370_10002093 | 3300013104 | Bacteria | 24386 |
| 161 | Ga0157370_10269534 | 3300013104 | Bacteria | 1573 |
| 162 | Ga0157369_10342212 | 3300013105 | Bacteria | 1554 |
| 163 | Ga0157369_11129158 | 3300013105 | Bacteria | 801 |
| 164 | Ga0157374_10144865 | 3300013296 | Bacteria | 2307 |
| 165 | Ga0157374_10536571 | 3300013296 | Bacteria | 1177 |
| 166 | Ga0163162_10406399 | 3300013306 | Bacteria | 1494 |
| 167 | Ga0163162_10572683 | 3300013306 | Bacteria | 1256 |
| 168 | Ga0163162_11691240 | 3300013306 | Bacteria | 723 |
| 169 | Ga0157372_10081916 | 3300013307 | Bacteria | 3653 |
| 170 | Ga0157372_10193822 | 3300013307 | Bacteria | 2354 |
| 171 | Ga0157372_10941133 | 3300013307 | Bacteria | 1002 |
| 172 | Ga0157372_11607066 | 3300013307 | Unclassified | 748 |
| 173 | Ga0157372_12718446 | 3300013307 | Bacteria | 568 |
| 174 | Ga0182008_10109342 | 3300014497 | Bacteria | 1369 |
| 175 | Ga0182008_10535837 | 3300014497 | Unclassified | 648 |
| 176 | Ga0182008_10644535 | 3300014497 | Bacteria | 599 |
| 177 | Ga0157376_10017738 | 3300014969 | Bacteria | 5439 |
| 178 | Ga0197907_11184908 | 3300020069 | Unclassified | 2385 |
| 179 | Ga0206356_10932773 | 3300020070 | Bacteria | 1272 |
| 180 | Ga0206356_11009747 | 3300020070 | Bacteria | 4792 |
| 181 | Ga0206356_11299398 | 3300020070 | Bacteria | 543 |
| 182 | Ga0206354_11445060 | 3300020081 | Bacteria | 806 |
| 183 | Ga0206353_11308727 | 3300020082 | Bacteria | 1651 |
| 184 | Ga0206353_11874886 | 3300020082 | Bacteria | 4943 |
| 185 | Ga0224712_10412117 | 3300022467 | Bacteria | 645 |
| 186 | Ga0207692_10003151 | 3300025898 | Bacteria | 6400 |
| 187 | Ga0207692_10208640 | 3300025898 | Bacteria | 1152 |
| 188 | Ga0207710_10438973 | 3300025900 | Bacteria | 673 |
| 189 | Ga0207685_10002273 | 3300025905 | Bacteria | 4362 |
| 190 | Ga0207699_10306504 | 3300025906 | Bacteria | 1110 |
| 191 | Ga0207699_10338325 | 3300025906 | Unclassified | 1060 |
| 192 | Ga0207699_10612841 | 3300025906 | Unclassified | 793 |
| 193 | Ga0207705_10028003 | 3300025909 | Bacteria | 4017 |
| 194 | Ga0207705_10391360 | 3300025909 | Bacteria | 1074 |
| 195 | Ga0207707_10063452 | 3300025912 | Unclassified | 3215 |
| 196 | Ga0207707_10090509 | 3300025912 | Bacteria | 2674 |
| 197 | Ga0207707_10312288 | 3300025912 | Bacteria | 1358 |
| 198 | Ga0207707_10358120 | 3300025912 | Bacteria | 1256 |
| 199 | Ga0207707_10937042 | 3300025912 | Unclassified | 714 |
| 200 | Ga0207695_10248026 | 3300025913 | Bacteria | 1680 |
| 201 | Ga0207671_10638810 | 3300025914 | Bacteria | 848 |
| 202 | Ga0207693_10003532 | 3300025915 | Bacteria | 13350 |
| 203 | Ga0207663_10097779 | 3300025916 | Bacteria | 1964 |
| 204 | Ga0207663_10110138 | 3300025916 | Bacteria | 1867 |
| 205 | Ga0207660_10131028 | 3300025917 | Bacteria | 1909 |
| 206 | Ga0207660_10683651 | 3300025917 | Bacteria | 837 |
| 207 | Ga0207657_10003627 | 3300025919 | Bacteria | 16442 |
| 208 | Ga0207657_10009590 | 3300025919 | Bacteria | 9717 |
| 209 | Ga0207652_10012030 | 3300025921 | Bacteria | 6985 |
| 210 | Ga0207652_10060751 | 3300025921 | Bacteria | 3261 |
| 211 | Ga0207652_11816655 | 3300025921 | Bacteria | 515 |
| 212 | Ga0207646_10001067 | 3300025922 | Bacteria | 34900 |
| 213 | Ga0207646_10002873 | 3300025922 | Bacteria | 19985 |
| 214 | Ga0207694_10424645 | 3300025924 | Unclassified | 1108 |
| 215 | Ga0207687_10004725 | 3300025927 | Bacteria | 9061 |
| 216 | Ga0207687_10107716 | 3300025927 | Bacteria | 2062 |
| 217 | Ga0207687_10264907 | 3300025927 | Bacteria | 1371 |
| 218 | Ga0207687_10563603 | 3300025927 | Unclassified | 957 |
| 219 | Ga0207687_10573892 | 3300025927 | Bacteria | 948 |
| 220 | Ga0207700_10010748 | 3300025928 | Bacteria | 5798 |
| 221 | Ga0207700_10119575 | 3300025928 | Bacteria | 2134 |
| 222 | Ga0207700_10166095 | 3300025928 | Bacteria | 1837 |
| 223 | Ga0207700_10286693 | 3300025928 | Bacteria | 1418 |
| 224 | Ga0207700_10587736 | 3300025928 | Bacteria | 990 |
| 225 | Ga0207700_10893626 | 3300025928 | Bacteria | 795 |
| 226 | Ga0207700_11889828 | 3300025928 | Bacteria | 523 |
| 227 | Ga0207664_10032304 | 3300025929 | Bacteria | 4010 |
| 228 | Ga0207664_10052892 | 3300025929 | Bacteria | 3213 |
| 229 | Ga0207664_10078207 | 3300025929 | Bacteria | 2682 |
| 230 | Ga0207664_10106560 | 3300025929 | Bacteria | 2324 |
| 231 | Ga0207664_10289946 | 3300025929 | Bacteria | 1438 |
| 232 | Ga0207664_10337070 | 3300025929 | Bacteria | 1333 |
| 233 | Ga0207664_10555508 | 3300025929 | Bacteria | 1030 |
| 234 | Ga0207664_10580982 | 3300025929 | Bacteria | 1006 |
| 235 | Ga0207664_11366636 | 3300025929 | Bacteria | 629 |
| 236 | Ga0207644_10011885 | 3300025931 | Bacteria | 5771 |
| 237 | Ga0207706_10003709 | 3300025933 | Bacteria | 14569 |
| 238 | Ga0207706_10092431 | 3300025933 | Bacteria | 2660 |
| 239 | Ga0207670_10315436 | 3300025936 | Unclassified | 1229 |
| 240 | Ga0207704_10517881 | 3300025938 | Unclassified | 964 |
| 241 | Ga0207665_10004921 | 3300025939 | Bacteria | 8904 |
| 242 | Ga0207665_10539283 | 3300025939 | Bacteria | 905 |
| 243 | Ga0207711_10686617 | 3300025941 | Bacteria | 955 |
| 244 | Ga0207711_10966540 | 3300025941 | Unclassified | 791 |
| 245 | Ga0207711_11113722 | 3300025941 | Bacteria | 730 |
| 246 | Ga0207661_10618723 | 3300025944 | Bacteria | 994 |
| 247 | Ga0207661_11861371 | 3300025944 | Bacteria | 547 |
| 248 | Ga0207679_10913752 | 3300025945 | Bacteria | 803 |
| 249 | Ga0207667_10069710 | 3300025949 | Unclassified | 3660 |
| 250 | Ga0207667_10135113 | 3300025949 | Bacteria | 2540 |
| 251 | Ga0207667_10759852 | 3300025949 | Bacteria | 968 |
| 252 | Ga0207667_10807887 | 3300025949 | Bacteria | 934 |
| 253 | Ga0207667_10907760 | 3300025949 | Bacteria | 872 |
| 254 | Ga0207712_10014725 | 3300025961 | Bacteria | 5036 |
| 255 | Ga0207712_11125039 | 3300025961 | Bacteria | 699 |
| 256 | Ga0207668_10011739 | 3300025972 | Bacteria | 5337 |
| 257 | Ga0207668_10114793 | 3300025972 | Bacteria | 2028 |
| 258 | Ga0207677_10014913 | 3300026023 | Bacteria | 4552 |
| 259 | Ga0207677_10749934 | 3300026023 | Bacteria | 870 |
| 260 | Ga0207702_10675111 | 3300026078 | Bacteria | 1017 |
| 261 | Ga0207702_11407724 | 3300026078 | Unclassified | 691 |
| 262 | Ga0207674_10744294 | 3300026116 | Bacteria | 946 |
| 263 | Ga0207674_10760651 | 3300026116 | Bacteria | 935 |
| 264 | Ga0207675_100002375 | 3300026118 | Bacteria | 18646 |
| 265 | Ga0207675_100212144 | 3300026118 | Bacteria | 1863 |
| 266 | Ga0207675_100265298 | 3300026118 | Bacteria | 1665 |
| 267 | Ga0207698_10633311 | 3300026142 | Bacteria | 1057 |
| 268 | Ga0207698_11016816 | 3300026142 | Bacteria | 840 |
| 269 | Ga0207698_11570611 | 3300026142 | Bacteria | 673 |
| 270 | Ga0209998_10024157 | 3300027717 | Bacteria | 1318 |
| 271 | Ga0207428_11165914 | 3300027907 | Bacteria | 537 |
| 272 | Ga0265319_1019399 | 3300028563 | Bacteria | 2537 |
| 273 | Ga0265334_10004153 | 3300028573 | Bacteria | 6489 |
| 274 | Ga0265334_10033646 | 3300028573 | Unclassified | 2038 |
| 275 | Ga0265318_10002949 | 3300028577 | Bacteria | 8823 |
| 276 | Ga0265318_10003267 | 3300028577 | Bacteria | 8257 |
| 277 | Ga0265336_10002289 | 3300028666 | Bacteria | 8002 |
| 278 | Ga0265338_10025290 | 3300028800 | Bacteria | 6030 |
| 279 | Ga0265338_10037762 | 3300028800 | Bacteria | 4588 |
| 280 | Ga0265338_10065777 | 3300028800 | Bacteria | 3142 |
| 281 | Ga0265338_10098994 | 3300028800 | Bacteria | 2383 |
| 282 | Ga0265338_10205016 | 3300028800 | Bacteria | 1484 |
| 283 | Ga0265324_10058440 | 3300029957 | Unclassified | 1319 |
| 284 | Ga0265320_10041011 | 3300031240 | Bacteria | 2304 |
| 285 | Ga0265320_10083421 | 3300031240 | Bacteria | 1489 |
| 286 | Ga0265339_10426925 | 3300031249 | Bacteria | 617 |
| 287 | Ga0265327_10198905 | 3300031251 | Unclassified | 908 |
| 288 | Ga0265316_10041785 | 3300031344 | Bacteria | 3667 |
| 289 | Ga0265313_10060987 | 3300031595 | Bacteria | 1767 |
| 290 | Ga0265313_10106867 | 3300031595 | Bacteria | 1235 |
| 291 | Ga0265314_10117796 | 3300031711 | Bacteria | 1677 |
| 292 | Ga0307416_101625145 | 3300032002 | Unclassified | 751 |
| 293 | Ga0307411_12363110 | 3300032005 | Bacteria | 500 |
| 294 | Ga0373926_0004429 | 3300035083 | Bacteria | 4605 |
| 295 | Ga0373926_0091816 | 3300035083 | Bacteria | 1129 |
| 296 | Ga0373944_0017007 | 3300035089 | Bacteria | 2058 |
| 297 | Ga0373923_0084952 | 3300035111 | Unclassified | 1377 |
| 298 | Ga0373936_0035789 | 3300035113 | Bacteria | 1977 |
| 299 | Ga0373939_0115671 | 3300035114 | Bacteria | 940 |
| 300 | Ga0373945_0012427 | 3300035116 | Bacteria | 2828 |
| 301 | Ga0373945_0042785 | 3300035116 | Bacteria | 1642 |
| 302 | Ga0373953_0132845 | 3300035117 | Bacteria | 1062 |
| 303 | Ga0373953_0183173 | 3300035117 | Bacteria | 904 |
| 304 | Ga0373954_0162578 | 3300035118 | Bacteria | 1093 |
| 305 | Ga0373956_0052284 | 3300035119 | Bacteria | 1837 |
| 306 | Ga0373957_0051674 | 3300035120 | Bacteria | 1573 |
| 307 | Ga0373943_0005115 | 3300035170 | Bacteria | 5903 |
| 308 | Ga0373943_0049933 | 3300035170 | Bacteria | 2054 |
| 309 | Ga0373943_0981406 | 3300035170 | Unclassified | 506 |
| 310 | Ga0373946_0009805 | 3300035171 | Bacteria | 3536 |
| 311 | Ga0373946_0559545 | 3300035171 | Bacteria | 590 |
| 312 | Ga0373955_0145918 | 3300035172 | Bacteria | 1390 |
| 313 | Ga0373955_0151468 | 3300035172 | Bacteria | 1365 |
| 314 | Ga0373955_0658415 | 3300035172 | Unclassified | 642 |
| 315 | Ga0373961_0092810 | 3300035241 | Bacteria | 967 |
| 316 | Ga0373924_0045822 | 3300035410 | Bacteria | 1799 |
| 317 | Ga0373931_0115224 | 3300035691 | Bacteria | 1529 |
| 318 | Ga0373935_0046400 | 3300035692 | Bacteria | 2744 |
| 319 | Ga0373935_0123744 | 3300035692 | Unclassified | 1730 |
| 320 | Ga0373927_0068544 | 3300035695 | Bacteria | 2295 |
| 321 | Ga0373933_0224692 | 3300035724 | Bacteria | 1205 |
| 322 | Ga0373933_0585996 | 3300035724 | Unclassified | 732 |
| 323 | Ga0373933_0873589 | 3300035724 | Unclassified | 592 |
| 324 | Ga0373947_0002586 | 3300035725 | Bacteria | 10869 |
| 325 | Ga0373947_0005159 | 3300035725 | Bacteria | 7652 |
| 326 | Ga0373937_0000579 | 3300036401 | Bacteria | 32471 |
| 327 | Ga0373937_0025794 | 3300036401 | Bacteria | 5308 |
| 328 | Ga0373925_0001980 | 3300037068 | Bacteria | 16963 |
| 329 | Ga0373925_0018340 | 3300037068 | Bacteria | 5086 |
| 330 | Ga0373925_1681322 | 3300037068 | Unclassified | 518 |
| 331 | Ga0395899_0344343 | 3300037312 | Bacteria | 999 |
| 332 | Ga0395899_0833512 | 3300037312 | Bacteria | 567 |
| 333 | Ga0395900_0869447 | 3300037418 | Bacteria | 826 |
| 334 | Ga0395898_0020895 | 3300037466 | Bacteria | 6644 |
| 335 | Ga0395898_0062701 | 3300037466 | Bacteria | 3610 |
| 336 | Ga0395898_1075668 | 3300037466 | Bacteria | 738 |
| 337 | Ga0395905_0547565 | 3300037471 | Bacteria | 1058 |
| 338 | Ga0395901_0020760 | 3300038443 | Bacteria | 6725 |
| 339 | Ga0395901_0038145 | 3300038443 | Unclassified | 4970 |
| 340 | Ga0395901_0340351 | 3300038443 | Bacteria | 1550 |
| 341 | Ga0436363_0016930 | 3300039450 | Bacteria | 676 |
| 342 | Ga0439439_0082480 | 3300041406 | Bacteria | 871 |
| 343 | Ga0439465_0279926 | 3300041413 | Bacteria | 621 |
| 344 | Ga0451839_0440166 | 3300041496 | Bacteria | 992 |
| 345 | Ga0439431_0135094 | 3300041997 | Bacteria | 694 |
| 346 | Ga0439448_0016721 | 3300042005 | Bacteria | 2234 |
| 347 | Ga0439455_0020147 | 3300042012 | Bacteria | 1579 |
| 348 | Ga0439463_044820 | 3300042016 | Bacteria | 1127 |
| 349 | Ga0450920_090070 | 3300042122 | Unclassified | 632 |
| 350 | Ga0439446_0004813 | 3300042156 | Bacteria | 3441 |
| 351 | Ga0439458_0108004 | 3300042157 | Bacteria | 726 |
| 352 | Ga0439434_0012283 | 3300042435 | Bacteria | 2534 |
| 353 | Ga0439464_0103142 | 3300042439 | Bacteria | 868 |
| 354 | Ga0466969_0001244 | 3300044656 | Bacteria | 13760 |
| 355 | Ga0466969_0047786 | 3300044656 | Bacteria | 2117 |
| 356 | Ga0466969_0349797 | 3300044656 | Bacteria | 669 |
| 357 | Ga0466969_0440568 | 3300044656 | Unclassified | 592 |
| 358 | Ga0466965_0578565 | 3300044683 | Unclassified | 636 |
| 359 | Ga0466966_0012166 | 3300044684 | Bacteria | 5702 |
| 360 | Ga0466966_0111648 | 3300044684 | Bacteria | 1685 |
| 361 | Ga0466966_0122002 | 3300044684 | Bacteria | 1600 |
| 362 | Ga0466966_0287968 | 3300044684 | Bacteria | 987 |
| 363 | Ga0466961_0013577 | 3300044693 | Bacteria | 5217 |
| 364 | Ga0466961_0077570 | 3300044693 | Bacteria | 2104 |
| 365 | Ga0466961_0148879 | 3300044693 | Bacteria | 1462 |
| 366 | Ga0466961_0353278 | 3300044693 | Bacteria | 894 |
| 367 | Ga0466963_0000359 | 3300044694 | Bacteria | 20650 |
| 368 | Ga0466963_0005511 | 3300044694 | Bacteria | 7408 |
| 369 | Ga0466963_0014317 | 3300044694 | Bacteria | 4888 |
| 370 | Ga0466963_0017944 | 3300044694 | Bacteria | 4415 |
| 371 | Ga0466963_0032682 | 3300044694 | Bacteria | 3371 |
| 372 | Ga0466963_0033020 | 3300044694 | Bacteria | 3356 |
| 373 | Ga0466963_0067792 | 3300044694 | Bacteria | 2395 |
| 374 | Ga0466963_0214142 | 3300044694 | Unclassified | 1348 |
| 375 | Ga0466963_0303236 | 3300044694 | Bacteria | 1123 |
| 376 | Ga0466963_0315697 | 3300044694 | Bacteria | 1099 |
| 377 | Ga0466963_0342237 | 3300044694 | Bacteria | 1053 |
| 378 | Ga0466963_0617256 | 3300044694 | Bacteria | 766 |
| 379 | Ga0466964_0007067 | 3300044706 | Bacteria | 4198 |
| 380 | Ga0466964_0007429 | 3300044706 | Bacteria | 4100 |
| 381 | Ga0466964_0034205 | 3300044706 | Bacteria | 2027 |
| 382 | Ga0466964_0046393 | 3300044706 | Bacteria | 1771 |
| 383 | Ga0466964_0091886 | 3300044706 | Bacteria | 1322 |
| 384 | Ga0466964_0577946 | 3300044706 | Unclassified | 613 |
| 385 | Ga0466964_0579149 | 3300044706 | Bacteria | 613 |
| 386 | Ga0466964_0781150 | 3300044706 | Unclassified | 538 |
| 387 | Ga0466971_0009359 | 3300044719 | Bacteria | 4280 |
| 388 | Ga0466971_0020769 | 3300044719 | Bacteria | 2919 |
| 389 | Ga0466971_0020772 | 3300044719 | Bacteria | 2918 |
| 390 | Ga0466971_0020941 | 3300044719 | Bacteria | 2907 |
| 391 | Ga0466971_0102388 | 3300044719 | Bacteria | 1317 |
| 392 | Ga0466968_0001880 | 3300044735 | Bacteria | 7593 |
| 393 | Ga0466968_0029725 | 3300044735 | Bacteria | 2260 |
| 394 | Ga0466968_0042682 | 3300044735 | Bacteria | 1918 |
| 395 | Ga0466968_0050791 | 3300044735 | Bacteria | 1770 |
| 396 | Ga0466970_0005708 | 3300044765 | Bacteria | 6181 |
| 397 | Ga0466970_0020761 | 3300044765 | Bacteria | 3416 |
| 398 | Ga0466970_0604652 | 3300044765 | Unclassified | 636 |
| 399 | Ga0466957_0003878 | 3300044842 | Bacteria | 8262 |
| 400 | Ga0466957_0005387 | 3300044842 | Bacteria | 7185 |
| 401 | Ga0466957_0049483 | 3300044842 | Bacteria | 2555 |
| 402 | Ga0466957_0132887 | 3300044842 | Bacteria | 1596 |
| 403 | Ga0466957_0195237 | 3300044842 | Bacteria | 1327 |
| 404 | Ga0466957_0301673 | 3300044842 | Bacteria | 1076 |
| 405 | Ga0466957_0752103 | 3300044842 | Unclassified | 690 |
| 406 | Ga0466957_1159939 | 3300044842 | Bacteria | 558 |
| 407 | Ga0466960_0245799 | 3300044901 | Unclassified | 992 |
| 408 | Ga0466960_0607673 | 3300044901 | Bacteria | 650 |
| 409 | Ga0466959_0009897 | 3300045049 | Bacteria | 6794 |
| 410 | Ga0466959_0010434 | 3300045049 | Bacteria | 6642 |
| 411 | Ga0466959_0133926 | 3300045049 | Bacteria | 1755 |
| 412 | Ga0466959_0141149 | 3300045049 | Bacteria | 1702 |
| 413 | Ga0466959_0167400 | 3300045049 | Bacteria | 1543 |
| 414 | Ga0466959_0351257 | 3300045049 | Bacteria | 1005 |
| 415 | Ga0451576_0381346 | 3300045051 | Bacteria | 1478 |
| 416 | Ga0466958_0004371 | 3300045836 | Bacteria | 7455 |
| 417 | Ga0466958_0005891 | 3300045836 | Bacteria | 6626 |
| 418 | Ga0466958_0012702 | 3300045836 | Bacteria | 4775 |
| 419 | Ga0466958_0013932 | 3300045836 | Bacteria | 4584 |
| 420 | Ga0466958_0019900 | 3300045836 | Bacteria | 3910 |
| 421 | Ga0466958_0039606 | 3300045836 | Bacteria | 2832 |
| 422 | Ga0466958_0072809 | 3300045836 | Bacteria | 2104 |
| 423 | Ga0466958_0459027 | 3300045836 | Bacteria | 825 |
| 424 | Ga0466967_0002334 | 3300045976 | Bacteria | 11735 |
| 425 | Ga0466967_0003292 | 3300045976 | Bacteria | 10484 |
| 426 | Ga0466967_0004796 | 3300045976 | Bacteria | 9214 |
| 427 | Ga0466967_0019266 | 3300045976 | Bacteria | 5482 |
| 428 | Ga0466967_0026453 | 3300045976 | Bacteria | 4807 |
| 429 | Ga0466967_0055615 | 3300045976 | Bacteria | 3486 |
| 430 | Ga0466967_0066437 | 3300045976 | Bacteria | 3213 |
| 431 | Ga0466967_0075094 | 3300045976 | Bacteria | 3037 |
| 432 | Ga0466967_0097428 | 3300045976 | Bacteria | 2684 |
| 433 | Ga0466967_0139593 | 3300045976 | Bacteria | 2256 |
| 434 | Ga0466967_0154491 | 3300045976 | Bacteria | 2148 |
| 435 | Ga0466967_0177231 | 3300045976 | Bacteria | 2008 |
| 436 | Ga0466967_0234686 | 3300045976 | Bacteria | 1747 |
| 437 | Ga0466967_0271120 | 3300045976 | Bacteria | 1626 |
| 438 | Ga0466967_0427769 | 3300045976 | Bacteria | 1291 |
| 439 | Ga0466967_0456816 | 3300045976 | Bacteria | 1249 |
| 440 | Ga0466967_2018740 | 3300045976 | Bacteria | 573 |
| 441 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 442 | Ga0495592_0012241 | 3300046454 | Bacteria | 6511 |
| 443 | Ga0495592_0013715 | 3300046454 | Bacteria | 6165 |
| 444 | Ga0495592_0206906 | 3300046454 | Bacteria | 1320 |
| 445 | Ga0495592_0627108 | 3300046454 | Bacteria | 653 |
| 446 | Ga0495629_0109692 | 3300046459 | Unclassified | 1924 |
| 447 | Ga0495629_0152698 | 3300046459 | Bacteria | 1605 |
| 448 | Ga0495629_0467935 | 3300046459 | Bacteria | 852 |
| 449 | Ga0495629_0503532 | 3300046459 | Bacteria | 816 |
| 450 | Ga0495629_1011970 | 3300046459 | Bacteria | 540 |
| 451 | Ga0495641_0004677 | 3300046461 | Bacteria | 9549 |
| 452 | Ga0495641_0009595 | 3300046461 | Bacteria | 5732 |
| 453 | Ga0495641_0176502 | 3300046461 | Bacteria | 956 |
| 454 | Ga0495641_0200447 | 3300046461 | Unclassified | 894 |
| 455 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 456 | Ga0495651_0051250 | 3300046462 | Bacteria | 3183 |
| 457 | Ga0495651_0153665 | 3300046462 | Unclassified | 1656 |
| 458 | Ga0495651_0243424 | 3300046462 | Bacteria | 1232 |
| 459 | Ga0495651_0374453 | 3300046462 | Bacteria | 935 |
| 460 | Ga0495651_0555149 | 3300046462 | Bacteria | 729 |
| 461 | Ga0495653_0000995 | 3300046463 | Bacteria | 21821 |
| 462 | Ga0495653_0006883 | 3300046463 | Bacteria | 9344 |
| 463 | Ga0495653_0008557 | 3300046463 | Bacteria | 8388 |
| 464 | Ga0495653_0068353 | 3300046463 | Bacteria | 2665 |
| 465 | Ga0495653_0111075 | 3300046463 | Bacteria | 1969 |
| 466 | Ga0495653_0134555 | 3300046463 | Bacteria | 1745 |
| 467 | Ga0495653_0319778 | 3300046463 | Bacteria | 1006 |
| 468 | Ga0495580_0042193 | 3300046472 | Bacteria | 3251 |
| 469 | Ga0495580_0578453 | 3300046472 | Bacteria | 744 |
| 470 | Ga0495582_0048181 | 3300046473 | Bacteria | 2346 |
| 471 | Ga0495582_0100590 | 3300046473 | Bacteria | 1618 |
| 472 | Ga0495582_0286653 | 3300046473 | Bacteria | 946 |
| 473 | Ga0495639_0019971 | 3300046475 | Bacteria | 2925 |
| 474 | Ga0495639_0120956 | 3300046475 | Unclassified | 1249 |
| 475 | Ga0495662_0018930 | 3300046476 | Bacteria | 3333 |
| 476 | Ga0495662_0039966 | 3300046476 | Bacteria | 2265 |
| 477 | Ga0495662_0296824 | 3300046476 | Bacteria | 795 |
| 478 | Ga0495664_0001842 | 3300046477 | Bacteria | 11270 |
| 479 | Ga0495664_0005907 | 3300046477 | Bacteria | 6736 |
| 480 | Ga0495664_0079248 | 3300046477 | Bacteria | 1968 |
| 481 | Ga0495664_0089267 | 3300046477 | Bacteria | 1853 |
| 482 | Ga0495664_0261839 | 3300046477 | Unclassified | 1045 |
| 483 | Ga0495585_0033778 | 3300046492 | Bacteria | 2894 |
| 484 | Ga0495594_0406678 | 3300046499 | Bacteria | 774 |
| 485 | Ga0495607_0011004 | 3300046501 | Bacteria | 6047 |
| 486 | Ga0495608_0000437 | 3300046511 | Bacteria | 29080 |
| 487 | Ga0495608_0062100 | 3300046511 | Bacteria | 2455 |
| 488 | Ga0495608_0074828 | 3300046511 | Bacteria | 2207 |
| 489 | Ga0495608_0511898 | 3300046511 | Bacteria | 726 |
| 490 | Ga0495608_0820850 | 3300046511 | Unclassified | 548 |
| 491 | Ga0495618_0000786 | 3300046514 | Bacteria | 22158 |
| 492 | Ga0495618_0098246 | 3300046514 | Bacteria | 1873 |
| 493 | Ga0495618_0158735 | 3300046514 | Unclassified | 1442 |
| 494 | Ga0495618_0247298 | 3300046514 | Bacteria | 1119 |
| 495 | Ga0495618_0405309 | 3300046514 | Bacteria | 833 |
| 496 | Ga0495618_0623383 | 3300046514 | Bacteria | 640 |
| 497 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 498 | Ga0495628_0007363 | 3300046516 | Bacteria | 9524 |
| 499 | Ga0495628_0121292 | 3300046516 | Bacteria | 2005 |
| 500 | Ga0495628_0223241 | 3300046516 | Bacteria | 1414 |
| 501 | Ga0495630_0009130 | 3300046517 | Bacteria | 7131 |
| 502 | Ga0495630_0020121 | 3300046517 | Bacteria | 4916 |
| 503 | Ga0495630_0089189 | 3300046517 | Bacteria | 2329 |
| 504 | Ga0495630_0131411 | 3300046517 | Bacteria | 1901 |
| 505 | Ga0495644_0006269 | 3300046523 | Bacteria | 4619 |
| 506 | Ga0495644_0351448 | 3300046523 | Unclassified | 580 |
| 507 | Ga0495663_0143639 | 3300046525 | Bacteria | 811 |
| 508 | Ga0495666_0000682 | 3300046526 | Bacteria | 15403 |
| 509 | Ga0495642_0030070 | 3300046528 | Bacteria | 2172 |
| 510 | Ga0495652_0000172 | 3300046529 | Bacteria | 74042 |
| 511 | Ga0495652_0014665 | 3300046529 | Bacteria | 7027 |
| 512 | Ga0495652_0044965 | 3300046529 | Bacteria | 3800 |
| 513 | Ga0495652_0051950 | 3300046529 | Bacteria | 3497 |
| 514 | Ga0495652_0065548 | 3300046529 | Bacteria | 3051 |
| 515 | Ga0495652_0103980 | 3300046529 | Bacteria | 2298 |
| 516 | Ga0495652_0194303 | 3300046529 | Bacteria | 1546 |
| 517 | Ga0495652_0210067 | 3300046529 | Bacteria | 1470 |
| 518 | Ga0495652_0497630 | 3300046529 | Unclassified | 846 |
| 519 | Ga0495652_0710481 | 3300046529 | Bacteria | 676 |
| 520 | Ga0495665_0009974 | 3300046531 | Bacteria | 5144 |
| 521 | Ga0495665_0101733 | 3300046531 | Bacteria | 1508 |
| 522 | Ga0495640_0007567 | 3300046533 | Bacteria | 8533 |
| 523 | Ga0495640_0034033 | 3300046533 | Bacteria | 3617 |
| 524 | Ga0495640_0187364 | 3300046533 | Unclassified | 1316 |
| 525 | Ga0495640_0239120 | 3300046533 | Bacteria | 1140 |
| 526 | Ga0495586_0004885 | 3300046535 | Bacteria | 7169 |
| 527 | Ga0495586_0043374 | 3300046535 | Bacteria | 2423 |
| 528 | Ga0495586_0129030 | 3300046535 | Bacteria | 1415 |
| 529 | Ga0495586_0294395 | 3300046535 | Bacteria | 930 |
| 530 | Ga0495586_0429947 | 3300046535 | Bacteria | 761 |
| 531 | Ga0495586_0634360 | 3300046535 | Unclassified | 617 |
| 532 | Ga0495587_0000080 | 3300046536 | Bacteria | 75321 |
| 533 | Ga0495587_0070242 | 3300046536 | Bacteria | 2038 |
| 534 | Ga0495587_0099061 | 3300046536 | Bacteria | 1680 |
| 535 | Ga0495587_0198545 | 3300046536 | Unclassified | 1135 |
| 536 | Ga0495609_0041627 | 3300046538 | Bacteria | 2064 |
| 537 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 538 | Ga0495645_0029831 | 3300046543 | Bacteria | 3970 |
| 539 | Ga0495645_0106904 | 3300046543 | Bacteria | 1984 |
| 540 | Ga0495645_0189657 | 3300046543 | Bacteria | 1402 |
| 541 | Ga0495645_0341766 | 3300046543 | Bacteria | 966 |
| 542 | Ga0495645_0354490 | 3300046543 | Bacteria | 944 |
| 543 | Ga0495633_0033411 | 3300046558 | Bacteria | 2481 |
| 544 | Ga0495667_0001471 | 3300046559 | Bacteria | 15507 |
| 545 | Ga0495667_0031538 | 3300046559 | Bacteria | 3557 |
| 546 | Ga0495667_0056344 | 3300046559 | Bacteria | 2585 |
| 547 | Ga0495667_0057165 | 3300046559 | Bacteria | 2565 |
| 548 | Ga0495667_0112312 | 3300046559 | Bacteria | 1761 |
| 549 | Ga0495634_0063769 | 3300046642 | Bacteria | 2444 |
| 550 | Ga0495634_0340148 | 3300046642 | Bacteria | 900 |
| 551 | Ga0495635_0006799 | 3300046663 | Bacteria | 7992 |
| 552 | Ga0495635_0028011 | 3300046663 | Bacteria | 3917 |
| 553 | Ga0495635_0138450 | 3300046663 | Bacteria | 1658 |
| 554 | Ga0495588_0328694 | 3300046674 | Unclassified | 804 |
| 555 | Ga0495657_0007800 | 3300046675 | Bacteria | 8220 |
| 556 | Ga0495657_0054502 | 3300046675 | Bacteria | 2671 |
| 557 | Ga0495657_0307968 | 3300046675 | Bacteria | 943 |
| 558 | Ga0495657_0473848 | 3300046675 | Bacteria | 731 |
| 559 | Ga0495657_0677959 | 3300046675 | Unclassified | 593 |
| 560 | Ga0495657_0768174 | 3300046675 | Unclassified | 552 |
| 561 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 562 | Ga0495599_0004709 | 3300046678 | Bacteria | 8100 |
| 563 | Ga0495599_0070566 | 3300046678 | Bacteria | 2180 |
| 564 | Ga0495599_0080214 | 3300046678 | Bacteria | 2038 |
| 565 | Ga0495599_0181394 | 3300046678 | Unclassified | 1297 |
| 566 | Ga0495623_0000046 | 3300046679 | Bacteria | 74571 |
| 567 | Ga0495623_0095644 | 3300046679 | Bacteria | 1816 |
| 568 | Ga0495646_0000201 | 3300046680 | Bacteria | 29539 |
| 569 | Ga0495646_0019928 | 3300046680 | Bacteria | 4241 |
| 570 | Ga0495646_0067824 | 3300046680 | Bacteria | 2108 |
| 571 | Ga0495646_0449229 | 3300046680 | Bacteria | 666 |
| 572 | Ga0495647_0000668 | 3300046681 | Bacteria | 10201 |
| 573 | Ga0495647_0067539 | 3300046681 | Bacteria | 1424 |
| 574 | Ga0495647_0195603 | 3300046681 | Bacteria | 885 |
| 575 | Ga0495658_0024887 | 3300046683 | Bacteria | 3194 |
| 576 | Ga0495658_0830276 | 3300046683 | Unclassified | 591 |
| 577 | Ga0495613_0009951 | 3300046689 | Bacteria | 7065 |
| 578 | Ga0495613_0112115 | 3300046689 | Bacteria | 1964 |
| 579 | Ga0495613_0311070 | 3300046689 | Bacteria | 1089 |
| 580 | Ga0495613_0366096 | 3300046689 | Bacteria | 988 |
| 581 | Ga0495613_0597926 | 3300046689 | Bacteria | 734 |
| 582 | Ga0495613_0621638 | 3300046689 | Unclassified | 717 |
| 583 | Ga0495624_0007965 | 3300046690 | Bacteria | 7428 |
| 584 | Ga0495624_0075234 | 3300046690 | Bacteria | 2097 |
| 585 | Ga0495624_0174612 | 3300046690 | Bacteria | 1310 |
| 586 | Ga0495670_0010141 | 3300046691 | Bacteria | 4637 |
| 587 | Ga0495589_0030163 | 3300046794 | Bacteria | 2732 |
| 588 | Ga0495600_0089046 | 3300046809 | Unclassified | 2013 |
| 589 | Ga0495600_0136487 | 3300046809 | Bacteria | 1593 |
| 590 | Ga0495600_0185156 | 3300046809 | Bacteria | 1341 |
| 591 | Ga0495600_0279881 | 3300046809 | Bacteria | 1056 |
| 592 | Ga0495581_0006348 | 3300047315 | Bacteria | 6855 |
| 593 | Ga0495581_0009306 | 3300047315 | Bacteria | 5685 |
| 594 | Ga0495581_0866862 | 3300047315 | Unclassified | 516 |
| 595 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 596 | Ga0495604_0117578 | 3300047317 | Bacteria | 1928 |
| 597 | Ga0495674_0005665 | 3300047319 | Bacteria | 11963 |
| 598 | Ga0495674_0023084 | 3300047319 | Bacteria | 5733 |
| 599 | Ga0495674_0078372 | 3300047319 | Bacteria | 2838 |
| 600 | Ga0495674_0096974 | 3300047319 | Bacteria | 2512 |
| 601 | Ga0495674_0227493 | 3300047319 | Bacteria | 1540 |
| 602 | Ga0495674_0323288 | 3300047319 | Bacteria | 1256 |
| 603 | Ga0495674_0635810 | 3300047319 | Bacteria | 842 |
| 604 | Ga0495674_0669783 | 3300047319 | Unclassified | 817 |
| 605 | Ga0495676_0014184 | 3300047321 | Bacteria | 7134 |
| 606 | Ga0495676_0026865 | 3300047321 | Bacteria | 4945 |
| 607 | Ga0495676_0028651 | 3300047321 | Bacteria | 4752 |
| 608 | Ga0495676_0235139 | 3300047321 | Bacteria | 1257 |
| 609 | Ga0495680_0007775 | 3300047322 | Bacteria | 9790 |
| 610 | Ga0495680_0012808 | 3300047322 | Bacteria | 7351 |
| 611 | Ga0495680_0014492 | 3300047322 | Bacteria | 6824 |
| 612 | Ga0495680_0041400 | 3300047322 | Bacteria | 3664 |
| 613 | Ga0495680_0070253 | 3300047322 | Bacteria | 2670 |
| 614 | Ga0495675_0000033 | 3300047444 | Bacteria | 98338 |
| 615 | Ga0495675_0538942 | 3300047444 | Bacteria | 667 |
| 616 | Ga0495675_0551738 | 3300047444 | Bacteria | 657 |
| 617 | Ga0495677_0153285 | 3300047445 | Bacteria | 888 |
| 618 | Ga0495684_0015507 | 3300047471 | Bacteria | 5865 |
| 619 | Ga0495684_0033203 | 3300047471 | Bacteria | 3960 |
| 620 | Ga0495684_0037687 | 3300047471 | Bacteria | 3708 |
| 621 | Ga0495684_0257578 | 3300047471 | Bacteria | 1267 |
| 622 | Ga0495684_0457526 | 3300047471 | Bacteria | 885 |
| 623 | Ga0495593_0003259 | 3300047673 | Bacteria | 9732 |
| 624 | Ga0495593_0140132 | 3300047673 | Bacteria | 1225 |
| 625 | Ga0495602_0000036 | 3300048088 | Bacteria | 133584 |
| 626 | Ga0495602_0022322 | 3300048088 | Bacteria | 6197 |
| 627 | Ga0495602_0026347 | 3300048088 | Bacteria | 5608 |
| 628 | Ga0495602_0343830 | 3300048088 | Unclassified | 1078 |
| 629 | Ga0495614_0001811 | 3300048089 | Bacteria | 9359 |
| 630 | Ga0496100_0088679 | 3300048903 | Bacteria | 2106 |
| 631 | Ga0496100_0292303 | 3300048903 | Bacteria | 1218 |
| 632 | Ga0496100_0903955 | 3300048903 | Bacteria | 693 |
| 633 | Ga0496101_0065758 | 3300048904 | Bacteria | 2643 |
| 634 | Ga0496101_0153901 | 3300048904 | Bacteria | 1760 |
| 635 | Ga0496101_0253893 | 3300048904 | Bacteria | 1370 |
| 636 | Ga0496101_0820002 | 3300048904 | Bacteria | 733 |
| 637 | Ga0496102_0334445 | 3300048905 | Bacteria | 1426 |
| 638 | Ga0496102_0381466 | 3300048905 | Bacteria | 1326 |
| 639 | Ga0496102_1136646 | 3300048905 | Unclassified | 701 |
| 640 | Ga0496103_0007321 | 3300048906 | Bacteria | 6579 |
| 641 | Ga0496103_0107074 | 3300048906 | Bacteria | 1773 |
| 642 | Ga0496104_0002459 | 3300048907 | Bacteria | 15959 |
| 643 | Ga0496104_0038723 | 3300048907 | Bacteria | 4462 |
| 644 | Ga0496105_0005380 | 3300048908 | Bacteria | 9709 |
| 645 | Ga0496105_0078790 | 3300048908 | Bacteria | 2720 |
| 646 | Ga0496105_0163413 | 3300048908 | Bacteria | 1827 |
| 647 | Ga0496105_0238105 | 3300048908 | Bacteria | 1478 |
| 648 | Ga0496105_0270451 | 3300048908 | Unclassified | 1372 |
| 649 | Ga0496105_0499510 | 3300048908 | Bacteria | 955 |
| 650 | Ga0496105_1150323 | 3300048908 | Unclassified | 574 |
| 651 | Ga0496106_0029265 | 3300048909 | Bacteria | 4104 |
| 652 | Ga0496106_0343206 | 3300048909 | Unclassified | 1199 |
| 653 | Ga0496107_0059817 | 3300048910 | Bacteria | 2757 |
| 654 | Ga0496107_0181644 | 3300048910 | Bacteria | 1562 |
| 655 | Ga0496107_0429462 | 3300048910 | Bacteria | 982 |
| 656 | Ga0496108_0011321 | 3300048911 | Bacteria | 7247 |
| 657 | Ga0496108_0022566 | 3300048911 | Bacteria | 5175 |
| 658 | Ga0496108_0036273 | 3300048911 | Bacteria | 4102 |
| 659 | Ga0496108_0270293 | 3300048911 | Bacteria | 1479 |
| 660 | Ga0496108_0283872 | 3300048911 | Bacteria | 1441 |
| 661 | Ga0496109_0000864 | 3300048912 | Bacteria | 25268 |
| 662 | Ga0496109_0128049 | 3300048912 | Bacteria | 2368 |
| 663 | Ga0496109_0219481 | 3300048912 | Bacteria | 1788 |
| 664 | Ga0496109_0232753 | 3300048912 | Bacteria | 1733 |
| 665 | Ga0496109_0262324 | 3300048912 | Bacteria | 1627 |
| 666 | Ga0496109_0559059 | 3300048912 | Unclassified | 1079 |
| 667 | Ga0496110_0003635 | 3300048913 | Bacteria | 11860 |
| 668 | Ga0496110_0135026 | 3300048913 | Bacteria | 2229 |
| 669 | Ga0496110_0735226 | 3300048913 | Bacteria | 889 |
| 670 | Ga0496111_0068966 | 3300048914 | Bacteria | 2571 |
| 671 | Ga0496111_0174994 | 3300048914 | Bacteria | 1595 |
| 672 | Ga0496111_0370086 | 3300048914 | Bacteria | 1060 |
| 673 | Ga0496112_0092696 | 3300048915 | Bacteria | 2991 |
| 674 | Ga0496112_0173081 | 3300048915 | Bacteria | 2124 |
| 675 | Ga0496112_0243244 | 3300048915 | Bacteria | 1751 |
| 676 | Ga0496112_0267026 | 3300048915 | Bacteria | 1660 |
| 677 | Ga0496112_0800605 | 3300048915 | Bacteria | 867 |
| 678 | Ga0496113_0122855 | 3300048916 | Bacteria | 2032 |
| 679 | Ga0496113_0230648 | 3300048916 | Bacteria | 1476 |
| 680 | Ga0496113_0640562 | 3300048916 | Bacteria | 850 |
| 681 | Ga0496113_0667953 | 3300048916 | Bacteria | 830 |
| 682 | Ga0496113_0716911 | 3300048916 | Bacteria | 798 |
| 683 | Ga0496113_0874120 | 3300048916 | Bacteria | 712 |
| 684 | Ga0496113_1026282 | 3300048916 | Unclassified | 649 |
| 685 | Ga0496114_0016999 | 3300048917 | Bacteria | 5865 |
| 686 | Ga0496114_0238005 | 3300048917 | Bacteria | 1600 |
| 687 | Ga0496114_0371741 | 3300048917 | Bacteria | 1265 |
| 688 | Ga0496114_0404005 | 3300048917 | Unclassified | 1210 |
| 689 | Ga0496114_0552794 | 3300048917 | Bacteria | 1017 |
| 690 | Ga0496114_1191683 | 3300048917 | Bacteria | 648 |
| 691 | Ga0496115_0014772 | 3300048918 | Bacteria | 5920 |
| 692 | Ga0496115_0088669 | 3300048918 | Bacteria | 2526 |
| 693 | Ga0496115_0170184 | 3300048918 | Bacteria | 1802 |
| 694 | Ga0496115_0251317 | 3300048918 | Bacteria | 1455 |
| 695 | Ga0501042_0011632 | 3300049578 | Bacteria | 5946 |
| 696 | Ga0501067_0103132 | 3300049583 | Bacteria | 1585 |
| 697 | Ga0501067_0560657 | 3300049583 | Bacteria | 640 |
| 698 | Ga0501069_0013960 | 3300049585 | Bacteria | 4290 |
| 699 | Ga0501069_0609462 | 3300049585 | Unclassified | 655 |
| 700 | nmdc:mga05p37_411626_c1 | 3300050507 | Bacteria | 1576 |
| 701 | nmdc:mga05p37_680402_c1 | 3300050507 | Bacteria | 1147 |
| 702 | nmdc:mga09592_598732_c1 | 3300050508 | Bacteria | 944 |
| 703 | nmdc:mga06r32_342371_c1 | 3300050510 | Bacteria | 1480 |
| 704 | nmdc:mga08y16_1108108_c1 | 3300050511 | Bacteria | 766 |
| 705 | nmdc:mga08y16_51598_c1 | 3300050511 | Bacteria | 4304 |
| 706 | nmdc:mga08y16_56415_c1 | 3300050511 | Bacteria | 4105 |
| 707 | nmdc:mga08y16_748829_c1 | 3300050511 | Bacteria | 973 |
| 708 | nmdc:mga0n895_2410_c1 | 3300050512 | Bacteria | 14579 |
| 709 | nmdc:mga0n895_26335_c1 | 3300050512 | Bacteria | 5506 |
| 710 | nmdc:mga0n895_43298_c1 | 3300050512 | Bacteria | 4387 |
| 711 | nmdc:mga0rr50_122793_c1 | 3300050513 | Bacteria | 2069 |
| 712 | nmdc:mga0rr50_154395_c1 | 3300050513 | Bacteria | 1858 |
| 713 | nmdc:mga0rr50_524949_c1 | 3300050513 | Bacteria | 1007 |
| 714 | nmdc:mga08x19_75405_c1 | 3300050514 | Bacteria | 2205 |
| 715 | nmdc:mga08x19_819098_c1 | 3300050514 | Bacteria | 661 |
| 716 | nmdc:mga0a205_54089_c1 | 3300050515 | Bacteria | 3875 |
| 717 | Ga0495601_0004650 | 3300053077 | Bacteria | 7949 |
| 718 | Ga0495601_0009365 | 3300053077 | Bacteria | 5791 |
| 719 | Ga0495601_0014175 | 3300053077 | Bacteria | 4803 |
| 720 | Ga0495601_0014269 | 3300053077 | Bacteria | 4786 |
| 721 | Ga0495601_0179941 | 3300053077 | Bacteria | 1382 |
| 722 | Ga0495601_0349655 | 3300053077 | Bacteria | 961 |
| 723 | Ga0495601_0353988 | 3300053077 | Bacteria | 954 |
| 724 | Ga0495601_0505460 | 3300053077 | Bacteria | 779 |
| 725 | Ga0495612_0001139 | 3300053078 | Bacteria | 10902 |
| 726 | Ga0495612_0019362 | 3300053078 | Bacteria | 2726 |
| 727 | Ga0495612_0127362 | 3300053078 | Bacteria | 1098 |
| 728 | Ga0495612_0130999 | 3300053078 | Unclassified | 1083 |
| 729 | Ga0495612_0164177 | 3300053078 | Unclassified | 970 |
| 730 | Ga0495612_0248292 | 3300053078 | Bacteria | 791 |
| 731 | Ga0495612_0327204 | 3300053078 | Unclassified | 690 |
| 732 | Ga0495655_0021624 | 3300053083 | Bacteria | 1459 |
| 733 | Ga0495595_0001664 | 3300053084 | Bacteria | 8695 |
| 734 | Ga0495595_0043588 | 3300053084 | Bacteria | 2058 |
| 735 | Ga0495595_0052773 | 3300053084 | Bacteria | 1887 |
| 736 | Ga0495619_0000235 | 3300053085 | Bacteria | 40323 |
| 737 | Ga0495619_0001661 | 3300053085 | Bacteria | 14689 |
| 738 | Ga0495619_0001883 | 3300053085 | Bacteria | 13971 |
| 739 | Ga0495619_0011097 | 3300053085 | Bacteria | 5665 |
| 740 | Ga0495619_0364877 | 3300053085 | Bacteria | 998 |
| 741 | Ga0495619_0373565 | 3300053085 | Bacteria | 985 |
| 742 | Ga0495619_0748107 | 3300053085 | Bacteria | 663 |
| 743 | Ga0500566_0080811 | 3300053094 | Bacteria | 1809 |
| 744 | Ga0466962_0003280 | 3300061719 | Bacteria | 7687 |
| 745 | Ga0466962_0005523 | 3300061719 | Bacteria | 6073 |
| 746 | Ga0466962_0020037 | 3300061719 | Bacteria | 3215 |
| 747 | Ga0466962_0032436 | 3300061719 | Bacteria | 2501 |
| 748 | Ga0466962_0048333 | 3300061719 | Bacteria | 2033 |
| 749 | Ga0070709_10049523 | |||
| 750 | rootH2_10121284 | |||
| 751 | rootH1_10247950 | |||
| 752 | Ga0070658_10156803 | |||
| 753 | Ga0070683_100768477 | |||
| 754 | Ga0070680_100222339 | |||
| 755 | Ga0070680_100636560 | |||
| 756 | Ga0070680_100771367 | |||
| 757 | Ga0068868_100733843 | |||
| 758 | Ga0070660_100501791 | |||
| 759 | Ga0070660_101083770 | |||
| 760 | Ga0070689_100392689 | |||
| 761 | Ga0070691_10135712 | |||
| 762 | Ga0070661_100338969 | |||
| 763 | Ga0070661_100581771 | |||
| 764 | Ga0070692_10277561 | |||
| 765 | Ga0070668_100016897 | |||
| 766 | Ga0070671_100098536 | |||
| 767 | Ga0070659_100143603 | |||
| 768 | Ga0070659_100932591 | |||
| 769 | Ga0070659_101264253 | |||
| 770 | Ga0070709_10438988 | |||
| 771 | Ga0070714_100027979 | |||
| 772 | Ga0070714_100144214 | |||
| 773 | Ga0070714_100151916 | |||
| 774 | Ga0070714_100172913 | |||
| 775 | Ga0070714_100198653 | |||
| 776 | Ga0070714_100275815 | |||
| 777 | Ga0070714_100363651 | |||
| 778 | Ga0070714_100423545 | |||
| 779 | Ga0070714_100568239 | |||
| 780 | Ga0070714_100900104 | |||
| 781 | Ga0070714_101466297 | |||
| 782 | Ga0070713_100090964 | |||
| 783 | Ga0070713_100128337 | |||
| 784 | Ga0070713_100210407 | |||
| 785 | Ga0070710_10002886 | |||
| 786 | Ga0070710_10007484 | |||
| 787 | Ga0070711_100012826 | |||
| 788 | Ga0070711_100258721 | |||
| 789 | Ga0070711_101132192 | |||
| 790 | Ga0070694_100043570 | |||
| 791 | Ga0070694_100087909 | |||
| 792 | Ga0070694_100552678 | |||
| 793 | Ga0070708_100035442 | |||
| 794 | Ga0070708_100329749 | |||
| 795 | Ga0070662_100009058 | |||
| 796 | Ga0070662_100129743 | |||
| 797 | Ga0070681_10020159 | |||
| 798 | Ga0070681_10020314 | |||
| 799 | Ga0070681_10075699 | |||
| 800 | Ga0070681_10484645 | |||
| 801 | Ga0070707_100000130 | |||
| 802 | Ga0070707_100083902 | |||
| 803 | Ga0070698_100079829 | |||
| 804 | Ga0070699_100805646 | |||
| 805 | Ga0070679_100126972 | |||
| 806 | Ga0070679_100128599 | |||
| 807 | Ga0070679_100185302 | |||
| 808 | Ga0070679_101970639 | |||
| 809 | Ga0070684_100180941 | |||
| 810 | Ga0070684_100404522 | |||
| 811 | Ga0070684_100539869 | |||
| 812 | Ga0070684_101181626 | |||
| 813 | Ga0070684_102204675 | |||
| 814 | Ga0070697_100853464 | |||
| 815 | Ga0070686_100556504 | |||
| 816 | Ga0070695_100000284 | |||
| 817 | Ga0070695_100084197 | |||
| 818 | Ga0070695_100639675 | |||
| 819 | Ga0070696_100682591 | |||
| 820 | Ga0070696_101370815 | |||
| 821 | Ga0070696_101741134 | |||
| 822 | Ga0070693_100468645 | |||
| 823 | Ga0070693_100489649 | |||
| 824 | Ga0068855_100015091 | |||
| 825 | Ga0068855_100054162 | |||
| 826 | Ga0068855_100113063 | |||
| 827 | Ga0068855_100396535 | |||
| 828 | Ga0068855_100839797 | |||
| 829 | Ga0070664_100141634 | |||
| 830 | Ga0070664_102236380 | |||
| 831 | Ga0068857_100544618 | |||
| 832 | Ga0068854_101326353 | |||
| 833 | Ga0068854_101478116 | |||
| 834 | Ga0068856_100255928 | |||
| 835 | Ga0068856_100314196 | |||
| 836 | Ga0068856_101088811 | |||
| 837 | Ga0070702_100358314 | |||
| 838 | Ga0068852_100079839 | |||
| 839 | Ga0068852_101307297 | |||
| 840 | Ga0068852_101345545 | |||
| 841 | Ga0068864_101632480 | |||
| 842 | Ga0068861_100026596 | |||
| 843 | Ga0068861_100196332 | |||
| 844 | Ga0081455_10005176 | |||
| 845 | Ga0081455_10807258 | |||
| 846 | Ga0081540_1001617 | |||
| 847 | Ga0070717_10010121 | |||
| 848 | Ga0070717_10072379 | |||
| 849 | Ga0070717_10093402 | |||
| 850 | Ga0070717_10137344 | |||
| 851 | Ga0070717_10149401 | |||
| 852 | Ga0070717_10638495 | |||
| 853 | Ga0075432_10027384 | |||
| 854 | Ga0070715_10001530 | |||
| 855 | Ga0070716_100016698 | |||
| 856 | Ga0070716_100139485 | |||
| 857 | Ga0070716_100516790 | |||
| 858 | Ga0070712_100058471 | |||
| 859 | Ga0070712_101420431 | |||
| 860 | Ga0075428_100681297 | |||
| 861 | Ga0075428_100842678 | |||
| 862 | Ga0075431_100381015 | |||
| 863 | Ga0075433_10155955 | |||
| 864 | Ga0075433_10646711 | |||
| 865 | Ga0075434_100061498 | |||
| 866 | Ga0075434_100062752 | |||
| 867 | Ga0075434_100322812 | |||
| 868 | Ga0068865_100164541 | |||
| 869 | Ga0075436_100172592 | |||
| 870 | Ga0075436_100877252 | |||
| 871 | Ga0075436_100941138 | |||
| 872 | Ga0075435_100060201 | |||
| 873 | Ga0075435_100170108 | |||
| 874 | Ga0075435_100225387 | |||
| 875 | Ga0075435_100586995 | |||
| 876 | Ga0105240_10015883 | |||
| 877 | Ga0105240_10030635 | |||
| 878 | Ga0105240_10192696 | |||
| 879 | Ga0105240_10470317 | |||
| 880 | Ga0111539_10132270 | |||
| 881 | Ga0111539_10264642 | |||
| 882 | Ga0111539_12796702 | |||
| 883 | Ga0105245_10005406 | |||
| 884 | Ga0105245_10015395 | |||
| 885 | Ga0105245_10110030 | |||
| 886 | Ga0105245_10371898 | |||
| 887 | Ga0105245_10705055 | |||
| 888 | Ga0105247_10574314 | |||
| 889 | Ga0114129_10380712 | |||
| 890 | Ga0114129_10741727 | |||
| 891 | Ga0114129_12449435 | |||
| 892 | Ga0105243_10109815 | |||
| 893 | Ga0105243_10140014 | |||
| 894 | Ga0105248_10765253 | |||
| 895 | Ga0105248_11382237 | |||
| 896 | Ga0105237_10014676 | |||
| 897 | Ga0105237_11181752 | |||
| 898 | Ga0105238_10538009 | |||
| 899 | Ga0105249_10090542 | |||
| 900 | Ga0105239_10008805 | |||
| 901 | Ga0105239_10027083 | |||
| 902 | Ga0105239_10217516 | |||
| 903 | Ga0105239_12311908 | |||
| 904 | Ga0105246_10113443 | |||
| 905 | Ga0105246_11963656 | |||
| 906 | Ga0157371_10140362 | |||
| 907 | Ga0157371_11433661 | |||
| 908 | Ga0157370_10002093 | |||
| 909 | Ga0157370_10269534 | |||
| 910 | Ga0157369_10342212 | |||
| 911 | Ga0157369_11129158 | |||
| 912 | Ga0157374_10144865 | |||
| 913 | Ga0157374_10536571 | |||
| 914 | Ga0163162_10406399 | |||
| 915 | Ga0163162_10572683 | |||
| 916 | Ga0163162_11691240 | |||
| 917 | Ga0157372_10081916 | |||
| 918 | Ga0157372_10193822 | |||
| 919 | Ga0157372_10941133 | |||
| 920 | Ga0157372_11607066 | |||
| 921 | Ga0157372_12718446 | |||
| 922 | Ga0182008_10109342 | |||
| 923 | Ga0182008_10535837 | |||
| 924 | Ga0182008_10644535 | |||
| 925 | Ga0157376_10017738 | |||
| 926 | Ga0197907_11184908 | |||
| 927 | Ga0206356_10932773 | |||
| 928 | Ga0206356_11009747 | |||
| 929 | Ga0206356_11299398 | |||
| 930 | Ga0206354_11445060 | |||
| 931 | Ga0206353_11308727 | |||
| 932 | Ga0206353_11874886 | |||
| 933 | Ga0224712_10412117 | |||
| 934 | Ga0207692_10003151 | |||
| 935 | Ga0207692_10208640 | |||
| 936 | Ga0207710_10438973 | |||
| 937 | Ga0207685_10002273 | |||
| 938 | Ga0207699_10306504 | |||
| 939 | Ga0207699_10338325 | |||
| 940 | Ga0207699_10612841 | |||
| 941 | Ga0207705_10028003 | |||
| 942 | Ga0207705_10391360 | |||
| 943 | Ga0207707_10063452 | |||
| 944 | Ga0207707_10090509 | |||
| 945 | Ga0207707_10312288 | |||
| 946 | Ga0207707_10358120 | |||
| 947 | Ga0207707_10937042 | |||
| 948 | Ga0207695_10248026 | |||
| 949 | Ga0207671_10638810 | |||
| 950 | Ga0207693_10003532 | |||
| 951 | Ga0207663_10097779 | |||
| 952 | Ga0207663_10110138 | |||
| 953 | Ga0207660_10131028 | |||
| 954 | Ga0207660_10683651 | |||
| 955 | Ga0207657_10003627 | |||
| 956 | Ga0207657_10009590 | |||
| 957 | Ga0207652_10012030 | |||
| 958 | Ga0207652_10060751 | |||
| 959 | Ga0207652_11816655 | |||
| 960 | Ga0207646_10001067 | |||
| 961 | Ga0207646_10002873 | |||
| 962 | Ga0207694_10424645 | |||
| 963 | Ga0207687_10004725 | |||
| 964 | Ga0207687_10107716 | |||
| 965 | Ga0207687_10264907 | |||
| 966 | Ga0207687_10563603 | |||
| 967 | Ga0207687_10573892 | |||
| 968 | Ga0207700_10010748 | |||
| 969 | Ga0207700_10119575 | |||
| 970 | Ga0207700_10166095 | |||
| 971 | Ga0207700_10286693 | |||
| 972 | Ga0207700_10587736 | |||
| 973 | Ga0207700_10893626 | |||
| 974 | Ga0207700_11889828 | |||
| 975 | Ga0207664_10032304 | |||
| 976 | Ga0207664_10052892 | |||
| 977 | Ga0207664_10078207 | |||
| 978 | Ga0207664_10106560 | |||
| 979 | Ga0207664_10289946 | |||
| 980 | Ga0207664_10337070 | |||
| 981 | Ga0207664_10555508 | |||
| 982 | Ga0207664_10580982 | |||
| 983 | Ga0207664_11366636 | |||
| 984 | Ga0207644_10011885 | |||
| 985 | Ga0207706_10003709 | |||
| 986 | Ga0207706_10092431 | |||
| 987 | Ga0207670_10315436 | |||
| 988 | Ga0207704_10517881 | |||
| 989 | Ga0207665_10004921 | |||
| 990 | Ga0207665_10539283 | |||
| 991 | Ga0207711_10686617 | |||
| 992 | Ga0207711_10966540 | |||
| 993 | Ga0207711_11113722 | |||
| 994 | Ga0207661_10618723 | |||
| 995 | Ga0207661_11861371 | |||
| 996 | Ga0207679_10913752 | |||
| 997 | Ga0207667_10069710 | |||
| 998 | Ga0207667_10135113 | |||
| 999 | Ga0207667_10759852 | |||
| 1000 | Ga0207667_10807887 | |||
| 1001 | Ga0207667_10907760 | |||
| 1002 | Ga0207712_10014725 | |||
| 1003 | Ga0207712_11125039 | |||
| 1004 | Ga0207668_10011739 | |||
| 1005 | Ga0207668_10114793 | |||
| 1006 | Ga0207677_10014913 | |||
| 1007 | Ga0207677_10749934 | |||
| 1008 | Ga0207702_10675111 | |||
| 1009 | Ga0207702_11407724 | |||
| 1010 | Ga0207674_10744294 | |||
| 1011 | Ga0207674_10760651 | |||
| 1012 | Ga0207675_100002375 | |||
| 1013 | Ga0207675_100212144 | |||
| 1014 | Ga0207675_100265298 | |||
| 1015 | Ga0207698_10633311 | |||
| 1016 | Ga0207698_11016816 | |||
| 1017 | Ga0207698_11570611 | |||
| 1018 | Ga0209998_10024157 | |||
| 1019 | Ga0207428_11165914 | |||
| 1020 | Ga0265319_1019399 | |||
| 1021 | Ga0265334_10004153 | |||
| 1022 | Ga0265334_10033646 | |||
| 1023 | Ga0265318_10002949 | |||
| 1024 | Ga0265318_10003267 | |||
| 1025 | Ga0265336_10002289 | |||
| 1026 | Ga0265338_10025290 | |||
| 1027 | Ga0265338_10037762 | |||
| 1028 | Ga0265338_10065777 | |||
| 1029 | Ga0265338_10098994 | |||
| 1030 | Ga0265338_10205016 | |||
| 1031 | Ga0265324_10058440 | |||
| 1032 | Ga0265320_10041011 | |||
| 1033 | Ga0265320_10083421 | |||
| 1034 | Ga0265339_10426925 | |||
| 1035 | Ga0265327_10198905 | |||
| 1036 | Ga0265316_10041785 | |||
| 1037 | Ga0265313_10060987 | |||
| 1038 | Ga0265313_10106867 | |||
| 1039 | Ga0265314_10117796 | |||
| 1040 | Ga0307416_101625145 | |||
| 1041 | Ga0307411_12363110 | |||
| 1042 | Ga0373926_0004429 | |||
| 1043 | Ga0373926_0091816 | |||
| 1044 | Ga0373944_0017007 | |||
| 1045 | Ga0373923_0084952 | |||
| 1046 | Ga0373936_0035789 | |||
| 1047 | Ga0373939_0115671 | |||
| 1048 | Ga0373945_0012427 | |||
| 1049 | Ga0373945_0042785 | |||
| 1050 | Ga0373953_0132845 | |||
| 1051 | Ga0373953_0183173 | |||
| 1052 | Ga0373954_0162578 | |||
| 1053 | Ga0373956_0052284 | |||
| 1054 | Ga0373957_0051674 | |||
| 1055 | Ga0373943_0005115 | |||
| 1056 | Ga0373943_0049933 | |||
| 1057 | Ga0373943_0981406 | |||
| 1058 | Ga0373946_0009805 | |||
| 1059 | Ga0373946_0559545 | |||
| 1060 | Ga0373955_0145918 | |||
| 1061 | Ga0373955_0151468 | |||
| 1062 | Ga0373955_0658415 | |||
| 1063 | Ga0373961_0092810 | |||
| 1064 | Ga0373924_0045822 | |||
| 1065 | Ga0373931_0115224 | |||
| 1066 | Ga0373935_0046400 | |||
| 1067 | Ga0373935_0123744 | |||
| 1068 | Ga0373927_0068544 | |||
| 1069 | Ga0373933_0224692 | |||
| 1070 | Ga0373933_0585996 | |||
| 1071 | Ga0373933_0873589 | |||
| 1072 | Ga0373947_0002586 | |||
| 1073 | Ga0373947_0005159 | |||
| 1074 | Ga0373937_0000579 | |||
| 1075 | Ga0373937_0025794 | |||
| 1076 | Ga0373925_0001980 | |||
| 1077 | Ga0373925_0018340 | |||
| 1078 | Ga0373925_1681322 | |||
| 1079 | Ga0395899_0344343 | |||
| 1080 | Ga0395899_0833512 | |||
| 1081 | Ga0395900_0869447 | |||
| 1082 | Ga0395898_0020895 | |||
| 1083 | Ga0395898_0062701 | |||
| 1084 | Ga0395898_1075668 | |||
| 1085 | Ga0395905_0547565 | |||
| 1086 | Ga0395901_0020760 | |||
| 1087 | Ga0395901_0038145 | |||
| 1088 | Ga0395901_0340351 | |||
| 1089 | Ga0436363_0016930 | |||
| 1090 | Ga0439439_0082480 | |||
| 1091 | Ga0439465_0279926 | |||
| 1092 | Ga0451839_0440166 | |||
| 1093 | Ga0439431_0135094 | |||
| 1094 | Ga0439448_0016721 | |||
| 1095 | Ga0439455_0020147 | |||
| 1096 | Ga0439463_044820 | |||
| 1097 | Ga0450920_090070 | |||
| 1098 | Ga0439446_0004813 | |||
| 1099 | Ga0439458_0108004 | |||
| 1100 | Ga0439434_0012283 | |||
| 1101 | Ga0439464_0103142 | |||
| 1102 | Ga0466969_0001244 | |||
| 1103 | Ga0466969_0047786 | |||
| 1104 | Ga0466969_0349797 | |||
| 1105 | Ga0466969_0440568 | |||
| 1106 | Ga0466965_0578565 | |||
| 1107 | Ga0466966_0012166 | |||
| 1108 | Ga0466966_0111648 | |||
| 1109 | Ga0466966_0122002 | |||
| 1110 | Ga0466966_0287968 | |||
| 1111 | Ga0466961_0013577 | |||
| 1112 | Ga0466961_0077570 | |||
| 1113 | Ga0466961_0148879 | |||
| 1114 | Ga0466961_0353278 | |||
| 1115 | Ga0466963_0000359 | |||
| 1116 | Ga0466963_0005511 | |||
| 1117 | Ga0466963_0014317 | |||
| 1118 | Ga0466963_0017944 | |||
| 1119 | Ga0466963_0032682 | |||
| 1120 | Ga0466963_0033020 | |||
| 1121 | Ga0466963_0067792 | |||
| 1122 | Ga0466963_0214142 | |||
| 1123 | Ga0466963_0303236 | |||
| 1124 | Ga0466963_0315697 | |||
| 1125 | Ga0466963_0342237 | |||
| 1126 | Ga0466963_0617256 | |||
| 1127 | Ga0466964_0007067 | |||
| 1128 | Ga0466964_0007429 | |||
| 1129 | Ga0466964_0034205 | |||
| 1130 | Ga0466964_0046393 | |||
| 1131 | Ga0466964_0091886 | |||
| 1132 | Ga0466964_0577946 | |||
| 1133 | Ga0466964_0579149 | |||
| 1134 | Ga0466964_0781150 | |||
| 1135 | Ga0466971_0009359 | |||
| 1136 | Ga0466971_0020769 | |||
| 1137 | Ga0466971_0020772 | |||
| 1138 | Ga0466971_0020941 | |||
| 1139 | Ga0466971_0102388 | |||
| 1140 | Ga0466968_0001880 | |||
| 1141 | Ga0466968_0029725 | |||
| 1142 | Ga0466968_0042682 | |||
| 1143 | Ga0466968_0050791 | |||
| 1144 | Ga0466970_0005708 | |||
| 1145 | Ga0466970_0020761 | |||
| 1146 | Ga0466970_0604652 | |||
| 1147 | Ga0466957_0003878 | |||
| 1148 | Ga0466957_0005387 | |||
| 1149 | Ga0466957_0049483 | |||
| 1150 | Ga0466957_0132887 | |||
| 1151 | Ga0466957_0195237 | |||
| 1152 | Ga0466957_0301673 | |||
| 1153 | Ga0466957_0752103 | |||
| 1154 | Ga0466957_1159939 | |||
| 1155 | Ga0466960_0245799 | |||
| 1156 | Ga0466960_0607673 | |||
| 1157 | Ga0466959_0009897 | |||
| 1158 | Ga0466959_0010434 | |||
| 1159 | Ga0466959_0133926 | |||
| 1160 | Ga0466959_0141149 | |||
| 1161 | Ga0466959_0167400 | |||
| 1162 | Ga0466959_0351257 | |||
| 1163 | Ga0451576_0381346 | |||
| 1164 | Ga0466958_0004371 | |||
| 1165 | Ga0466958_0005891 | |||
| 1166 | Ga0466958_0012702 | |||
| 1167 | Ga0466958_0013932 | |||
| 1168 | Ga0466958_0019900 | |||
| 1169 | Ga0466958_0039606 | |||
| 1170 | Ga0466958_0072809 | |||
| 1171 | Ga0466958_0459027 | |||
| 1172 | Ga0466967_0002334 | |||
| 1173 | Ga0466967_0003292 | |||
| 1174 | Ga0466967_0004796 | |||
| 1175 | Ga0466967_0019266 | |||
| 1176 | Ga0466967_0026453 | |||
| 1177 | Ga0466967_0055615 | |||
| 1178 | Ga0466967_0066437 | |||
| 1179 | Ga0466967_0075094 | |||
| 1180 | Ga0466967_0097428 | |||
| 1181 | Ga0466967_0139593 | |||
| 1182 | Ga0466967_0154491 | |||
| 1183 | Ga0466967_0177231 | |||
| 1184 | Ga0466967_0234686 | |||
| 1185 | Ga0466967_0271120 | |||
| 1186 | Ga0466967_0427769 | |||
| 1187 | Ga0466967_0456816 | |||
| 1188 | Ga0466967_2018740 | |||
| 1189 | Ga0495592_0000048 | |||
| 1190 | Ga0495592_0012241 | |||
| 1191 | Ga0495592_0013715 | |||
| 1192 | Ga0495592_0206906 | |||
| 1193 | Ga0495592_0627108 | |||
| 1194 | Ga0495629_0109692 | |||
| 1195 | Ga0495629_0152698 | |||
| 1196 | Ga0495629_0467935 | |||
| 1197 | Ga0495629_0503532 | |||
| 1198 | Ga0495629_1011970 | |||
| 1199 | Ga0495641_0004677 | |||
| 1200 | Ga0495641_0009595 | |||
| 1201 | Ga0495641_0176502 | |||
| 1202 | Ga0495641_0200447 | |||
| 1203 | Ga0495651_0000049 | |||
| 1204 | Ga0495651_0051250 | |||
| 1205 | Ga0495651_0153665 | |||
| 1206 | Ga0495651_0243424 | |||
| 1207 | Ga0495651_0374453 | |||
| 1208 | Ga0495651_0555149 | |||
| 1209 | Ga0495653_0000995 | |||
| 1210 | Ga0495653_0006883 | |||
| 1211 | Ga0495653_0008557 | |||
| 1212 | Ga0495653_0068353 | |||
| 1213 | Ga0495653_0111075 | |||
| 1214 | Ga0495653_0134555 | |||
| 1215 | Ga0495653_0319778 | |||
| 1216 | Ga0495580_0042193 | |||
| 1217 | Ga0495580_0578453 | |||
| 1218 | Ga0495582_0048181 | |||
| 1219 | Ga0495582_0100590 | |||
| 1220 | Ga0495582_0286653 | |||
| 1221 | Ga0495639_0019971 | |||
| 1222 | Ga0495639_0120956 | |||
| 1223 | Ga0495662_0018930 | |||
| 1224 | Ga0495662_0039966 | |||
| 1225 | Ga0495662_0296824 | |||
| 1226 | Ga0495664_0001842 | |||
| 1227 | Ga0495664_0005907 | |||
| 1228 | Ga0495664_0079248 | |||
| 1229 | Ga0495664_0089267 | |||
| 1230 | Ga0495664_0261839 | |||
| 1231 | Ga0495585_0033778 | |||
| 1232 | Ga0495594_0406678 | |||
| 1233 | Ga0495607_0011004 | |||
| 1234 | Ga0495608_0000437 | |||
| 1235 | Ga0495608_0062100 | |||
| 1236 | Ga0495608_0074828 | |||
| 1237 | Ga0495608_0511898 | |||
| 1238 | Ga0495608_0820850 | |||
| 1239 | Ga0495618_0000786 | |||
| 1240 | Ga0495618_0098246 | |||
| 1241 | Ga0495618_0158735 | |||
| 1242 | Ga0495618_0247298 | |||
| 1243 | Ga0495618_0405309 | |||
| 1244 | Ga0495618_0623383 | |||
| 1245 | Ga0495628_0000026 | |||
| 1246 | Ga0495628_0007363 | |||
| 1247 | Ga0495628_0121292 | |||
| 1248 | Ga0495628_0223241 | |||
| 1249 | Ga0495630_0009130 | |||
| 1250 | Ga0495630_0020121 | |||
| 1251 | Ga0495630_0089189 | |||
| 1252 | Ga0495630_0131411 | |||
| 1253 | Ga0495644_0006269 | |||
| 1254 | Ga0495644_0351448 | |||
| 1255 | Ga0495663_0143639 | |||
| 1256 | Ga0495666_0000682 | |||
| 1257 | Ga0495642_0030070 | |||
| 1258 | Ga0495652_0000172 | |||
| 1259 | Ga0495652_0014665 | |||
| 1260 | Ga0495652_0044965 | |||
| 1261 | Ga0495652_0051950 | |||
| 1262 | Ga0495652_0065548 | |||
| 1263 | Ga0495652_0103980 | |||
| 1264 | Ga0495652_0194303 | |||
| 1265 | Ga0495652_0210067 | |||
| 1266 | Ga0495652_0497630 | |||
| 1267 | Ga0495652_0710481 | |||
| 1268 | Ga0495665_0009974 | |||
| 1269 | Ga0495665_0101733 | |||
| 1270 | Ga0495640_0007567 | |||
| 1271 | Ga0495640_0034033 | |||
| 1272 | Ga0495640_0187364 | |||
| 1273 | Ga0495640_0239120 | |||
| 1274 | Ga0495586_0004885 | |||
| 1275 | Ga0495586_0043374 | |||
| 1276 | Ga0495586_0129030 | |||
| 1277 | Ga0495586_0294395 | |||
| 1278 | Ga0495586_0429947 | |||
| 1279 | Ga0495586_0634360 | |||
| 1280 | Ga0495587_0000080 | |||
| 1281 | Ga0495587_0070242 | |||
| 1282 | Ga0495587_0099061 | |||
| 1283 | Ga0495587_0198545 | |||
| 1284 | Ga0495609_0041627 | |||
| 1285 | Ga0495645_0000016 | |||
| 1286 | Ga0495645_0029831 | |||
| 1287 | Ga0495645_0106904 | |||
| 1288 | Ga0495645_0189657 | |||
| 1289 | Ga0495645_0341766 | |||
| 1290 | Ga0495645_0354490 | |||
| 1291 | Ga0495633_0033411 | |||
| 1292 | Ga0495667_0001471 | |||
| 1293 | Ga0495667_0031538 | |||
| 1294 | Ga0495667_0056344 | |||
| 1295 | Ga0495667_0057165 | |||
| 1296 | Ga0495667_0112312 | |||
| 1297 | Ga0495634_0063769 | |||
| 1298 | Ga0495634_0340148 | |||
| 1299 | Ga0495635_0006799 | |||
| 1300 | Ga0495635_0028011 | |||
| 1301 | Ga0495635_0138450 | |||
| 1302 | Ga0495588_0328694 | |||
| 1303 | Ga0495657_0007800 | |||
| 1304 | Ga0495657_0054502 | |||
| 1305 | Ga0495657_0307968 | |||
| 1306 | Ga0495657_0473848 | |||
| 1307 | Ga0495657_0677959 | |||
| 1308 | Ga0495657_0768174 | |||
| 1309 | Ga0495599_0000016 | |||
| 1310 | Ga0495599_0004709 | |||
| 1311 | Ga0495599_0070566 | |||
| 1312 | Ga0495599_0080214 | |||
| 1313 | Ga0495599_0181394 | |||
| 1314 | Ga0495623_0000046 | |||
| 1315 | Ga0495623_0095644 | |||
| 1316 | Ga0495646_0000201 | |||
| 1317 | Ga0495646_0019928 | |||
| 1318 | Ga0495646_0067824 | |||
| 1319 | Ga0495646_0449229 | |||
| 1320 | Ga0495647_0000668 | |||
| 1321 | Ga0495647_0067539 | |||
| 1322 | Ga0495647_0195603 | |||
| 1323 | Ga0495658_0024887 | |||
| 1324 | Ga0495658_0830276 | |||
| 1325 | Ga0495613_0009951 | |||
| 1326 | Ga0495613_0112115 | |||
| 1327 | Ga0495613_0311070 | |||
| 1328 | Ga0495613_0366096 | |||
| 1329 | Ga0495613_0597926 | |||
| 1330 | Ga0495613_0621638 | |||
| 1331 | Ga0495624_0007965 | |||
| 1332 | Ga0495624_0075234 | |||
| 1333 | Ga0495624_0174612 | |||
| 1334 | Ga0495670_0010141 | |||
| 1335 | Ga0495589_0030163 | |||
| 1336 | Ga0495600_0089046 | |||
| 1337 | Ga0495600_0136487 | |||
| 1338 | Ga0495600_0185156 | |||
| 1339 | Ga0495600_0279881 | |||
| 1340 | Ga0495581_0006348 | |||
| 1341 | Ga0495581_0009306 | |||
| 1342 | Ga0495581_0866862 | |||
| 1343 | Ga0495604_0000004 | |||
| 1344 | Ga0495604_0117578 | |||
| 1345 | Ga0495674_0005665 | |||
| 1346 | Ga0495674_0023084 | |||
| 1347 | Ga0495674_0078372 | |||
| 1348 | Ga0495674_0096974 | |||
| 1349 | Ga0495674_0227493 | |||
| 1350 | Ga0495674_0323288 | |||
| 1351 | Ga0495674_0635810 | |||
| 1352 | Ga0495674_0669783 | |||
| 1353 | Ga0495676_0014184 | |||
| 1354 | Ga0495676_0026865 | |||
| 1355 | Ga0495676_0028651 | |||
| 1356 | Ga0495676_0235139 | |||
| 1357 | Ga0495680_0007775 | |||
| 1358 | Ga0495680_0012808 | |||
| 1359 | Ga0495680_0014492 | |||
| 1360 | Ga0495680_0041400 | |||
| 1361 | Ga0495680_0070253 | |||
| 1362 | Ga0495675_0000033 | |||
| 1363 | Ga0495675_0538942 | |||
| 1364 | Ga0495675_0551738 | |||
| 1365 | Ga0495677_0153285 | |||
| 1366 | Ga0495684_0015507 | |||
| 1367 | Ga0495684_0033203 | |||
| 1368 | Ga0495684_0037687 | |||
| 1369 | Ga0495684_0257578 | |||
| 1370 | Ga0495684_0457526 | |||
| 1371 | Ga0495593_0003259 | |||
| 1372 | Ga0495593_0140132 | |||
| 1373 | Ga0495602_0000036 | |||
| 1374 | Ga0495602_0022322 | |||
| 1375 | Ga0495602_0026347 | |||
| 1376 | Ga0495602_0343830 | |||
| 1377 | Ga0495614_0001811 | |||
| 1378 | Ga0496100_0088679 | |||
| 1379 | Ga0496100_0292303 | |||
| 1380 | Ga0496100_0903955 | |||
| 1381 | Ga0496101_0065758 | |||
| 1382 | Ga0496101_0153901 | |||
| 1383 | Ga0496101_0253893 | |||
| 1384 | Ga0496101_0820002 | |||
| 1385 | Ga0496102_0334445 | |||
| 1386 | Ga0496102_0381466 | |||
| 1387 | Ga0496102_1136646 | |||
| 1388 | Ga0496103_0007321 | |||
| 1389 | Ga0496103_0107074 | |||
| 1390 | Ga0496104_0002459 | |||
| 1391 | Ga0496104_0038723 | |||
| 1392 | Ga0496105_0005380 | |||
| 1393 | Ga0496105_0078790 | |||
| 1394 | Ga0496105_0163413 | |||
| 1395 | Ga0496105_0238105 | |||
| 1396 | Ga0496105_0270451 | |||
| 1397 | Ga0496105_0499510 | |||
| 1398 | Ga0496105_1150323 | |||
| 1399 | Ga0496106_0029265 | |||
| 1400 | Ga0496106_0343206 | |||
| 1401 | Ga0496107_0059817 | |||
| 1402 | Ga0496107_0181644 | |||
| 1403 | Ga0496107_0429462 | |||
| 1404 | Ga0496108_0011321 | |||
| 1405 | Ga0496108_0022566 | |||
| 1406 | Ga0496108_0036273 | |||
| 1407 | Ga0496108_0270293 | |||
| 1408 | Ga0496108_0283872 | |||
| 1409 | Ga0496109_0000864 | |||
| 1410 | Ga0496109_0128049 | |||
| 1411 | Ga0496109_0219481 | |||
| 1412 | Ga0496109_0232753 | |||
| 1413 | Ga0496109_0262324 | |||
| 1414 | Ga0496109_0559059 | |||
| 1415 | Ga0496110_0003635 | |||
| 1416 | Ga0496110_0135026 | |||
| 1417 | Ga0496110_0735226 | |||
| 1418 | Ga0496111_0068966 | |||
| 1419 | Ga0496111_0174994 | |||
| 1420 | Ga0496111_0370086 | |||
| 1421 | Ga0496112_0092696 | |||
| 1422 | Ga0496112_0173081 | |||
| 1423 | Ga0496112_0243244 | |||
| 1424 | Ga0496112_0267026 | |||
| 1425 | Ga0496112_0800605 | |||
| 1426 | Ga0496113_0122855 | |||
| 1427 | Ga0496113_0230648 | |||
| 1428 | Ga0496113_0640562 | |||
| 1429 | Ga0496113_0667953 | |||
| 1430 | Ga0496113_0716911 | |||
| 1431 | Ga0496113_0874120 | |||
| 1432 | Ga0496113_1026282 | |||
| 1433 | Ga0496114_0016999 | |||
| 1434 | Ga0496114_0238005 | |||
| 1435 | Ga0496114_0371741 | |||
| 1436 | Ga0496114_0404005 | |||
| 1437 | Ga0496114_0552794 | |||
| 1438 | Ga0496114_1191683 | |||
| 1439 | Ga0496115_0014772 | |||
| 1440 | Ga0496115_0088669 | |||
| 1441 | Ga0496115_0170184 | |||
| 1442 | Ga0496115_0251317 | |||
| 1443 | Ga0501042_0011632 | |||
| 1444 | Ga0501067_0103132 | |||
| 1445 | Ga0501067_0560657 | |||
| 1446 | Ga0501069_0013960 | |||
| 1447 | Ga0501069_0609462 | |||
| 1448 | nmdc:mga05p37_411626_c1 | |||
| 1449 | nmdc:mga05p37_680402_c1 | |||
| 1450 | nmdc:mga09592_598732_c1 | |||
| 1451 | nmdc:mga06r32_342371_c1 | |||
| 1452 | nmdc:mga08y16_1108108_c1 | |||
| 1453 | nmdc:mga08y16_51598_c1 | |||
| 1454 | nmdc:mga08y16_56415_c1 | |||
| 1455 | nmdc:mga08y16_748829_c1 | |||
| 1456 | nmdc:mga0n895_2410_c1 | |||
| 1457 | nmdc:mga0n895_26335_c1 | |||
| 1458 | nmdc:mga0n895_43298_c1 | |||
| 1459 | nmdc:mga0rr50_122793_c1 | |||
| 1460 | nmdc:mga0rr50_154395_c1 | |||
| 1461 | nmdc:mga0rr50_524949_c1 | |||
| 1462 | nmdc:mga08x19_75405_c1 | |||
| 1463 | nmdc:mga08x19_819098_c1 | |||
| 1464 | nmdc:mga0a205_54089_c1 | |||
| 1465 | Ga0495601_0004650 | |||
| 1466 | Ga0495601_0009365 | |||
| 1467 | Ga0495601_0014175 | |||
| 1468 | Ga0495601_0014269 | |||
| 1469 | Ga0495601_0179941 | |||
| 1470 | Ga0495601_0349655 | |||
| 1471 | Ga0495601_0353988 | |||
| 1472 | Ga0495601_0505460 | |||
| 1473 | Ga0495612_0001139 | |||
| 1474 | Ga0495612_0019362 | |||
| 1475 | Ga0495612_0127362 | |||
| 1476 | Ga0495612_0130999 | |||
| 1477 | Ga0495612_0164177 | |||
| 1478 | Ga0495612_0248292 | |||
| 1479 | Ga0495612_0327204 | |||
| 1480 | Ga0495655_0021624 | |||
| 1481 | Ga0495595_0001664 | |||
| 1482 | Ga0495595_0043588 | |||
| 1483 | Ga0495595_0052773 | |||
| 1484 | Ga0495619_0000235 | |||
| 1485 | Ga0495619_0001661 | |||
| 1486 | Ga0495619_0001883 | |||
| 1487 | Ga0495619_0011097 | |||
| 1488 | Ga0495619_0364877 | |||
| 1489 | Ga0495619_0373565 | |||
| 1490 | Ga0495619_0748107 | |||
| 1491 | Ga0500566_0080811 | |||
| 1492 | Ga0466962_0003280 | |||
| 1493 | Ga0466962_0005523 | |||
| 1494 | Ga0466962_0020037 | |||
| 1495 | Ga0466962_0032436 | |||
| 1496 | Ga0466962_0048333 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3eet-assembly2.cif.gz_B-3 | crystal structure of putative gntr-family transcriptional regulator | 0.9283 | 15 | 66 |
| 2wv0-assembly3.cif.gz_E | crystal structure of the gntr-hutc family member yvoa from bacillus subtilis | 0.9198 | 6 | 79 |
| 5xgf-assembly1.cif.gz_A | the fatty acid-responsive fadr repressor of vibrio alginolyticus | 0.9198 | 18 | 78 |
| 2wv0-assembly6.cif.gz_J-3 | crystal structure of the gntr-hutc family member yvoa from bacillus subtilis | 0.9195 | 5 | 79 |
| 3edp-assembly1.cif.gz_A | the crystal structure of the protein lin2111 (functionally unknown) from listeria innocua clip11262 | 0.9186 | 12 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1P1_1_44_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9793 | 35 | 77 | 1.10.10.10 |
| af_P31475_2_79_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9742 | 15 | 79 | 1.10.10.10 |
| af_P45544_5_80_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9717 | 15 | 79 | 1.10.10.10 |
| af_P9WMG7_15_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9663 | 15 | 79 | 1.10.10.10 |
| af_O86331_14_86_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9623 | 5 | 78 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y4W3H2-F1-model_v4 | HTH gntR-type domain-containing protein | 0.9766 | 5 | 78 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A511N5D0-F1-model_v4 | GntR family transcriptional regulator | 0.9745 | 5 | 79 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A7X7ERJ2-F1-model_v4 | GntR family transcriptional regulator | 0.971 | 5 | 82 |
GO:0003677
GO:0003700 |
| AF-A0A0N0NCK1-F1-model_v4 | Transcriptional regulator, GntR family | 0.9698 | 4 | 78 |
GO:0003677
GO:0003700 |
| AF-A0A5C4ZUM1-F1-model_v4 | deleted | 0.9691 | 5 | 78 |
|