F478915

General Info

Members Datasets Scaffolds Average Seq Length
747 276 730 263

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10074446|Ga0207647_100744462
Length 302
Sequence VIGRLVIMGSGETAPTMVEVHRATLRAAGEGPSLLLDTPYGFQENADDITAKAVAYFGRNVGRTVAPLRLRHPQLGVDEAYAISLGLLARRVADGERVIGKKIGVTSKAVQDMLGVHQPDFGFLTDRMWIRGDIDVARAGLIQPRAEAEIAFLLREPLQGPGVTAQQVIAATAAIAPCFEIVDSRIADWNIGIVDTVADNASCGVFVLGDTCVSPQGVDLPNLQVTVSKNGRPLSEGLGSAVQGSPAAAVAWLANTLGAYGVALEADDVILSGSLVPLEPAAAGDVFEMTLHGVGGCAARFV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231012 Pseudomonas sp. GM33 Isolate Nodule
4 2511231014 Pseudomonas sp. GM48 Isolate Nodule
5 2511231015 Pseudomonas sp. GM49 Isolate Nodule
6 2511231017 Pseudomonas sp. GM55 Isolate Nodule
7 2511231020 Pseudomonas sp. GM74 Isolate Nodule
8 2511231021 Pseudomonas sp. GM78 Isolate Nodule
9 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
10 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
11 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
12 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
13 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
14 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
15 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
16 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
17 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
88 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
89 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
168 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
265 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
266 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
267 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
268 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
271 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
275 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
276 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 1.2
Rhizoplane 7.23
Rhizosphere 77.91
Stem 0
Stem Tuber 0
Unclassified 11.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1602716 2162886007 Bacteria 20166
2 SwRhRL2b_contig_234738 2162886007 Bacteria 74037
3 SwRhRL2b_contig_3367114 2162886007 Bacteria 9630
4 SwRhRL2b_contig_76937 2162886007 Bacteria 1808
5 JGI24736J21556_1000161 3300001904 Bacteria 11892
6 JGI24736J21556_1013055 3300001904 Bacteria 1342
7 JGI24741J21665_1000082 3300001915 Bacteria 23787
8 JGI24741J21665_1002198 3300001915 Bacteria 5178
9 JGI24752J21851_1000313 3300001976 Bacteria 6784
10 JGI24740J21852_10000126 3300001979 Bacteria 28776
11 JGI24740J21852_10033136 3300001979 Bacteria 1644
12 JGI24739J22299_10004558 3300001989 Bacteria 5299
13 JGI24739J22299_10030824 3300001989 Bacteria 1857
14 JGI24737J22298_10000176 3300001990 Bacteria 20591
15 JGI24737J22298_10023167 3300001990 Bacteria 1970
16 JGI24735J21928_10003750 3300002067 Bacteria 5152
17 JGI24750J21931_1000170 3300002070 Bacteria 10863
18 JGI24748J21848_1000065 3300002074 Bacteria 40176
19 JGI24748J21848_1007295 3300002074 Bacteria 1295
20 JGI24749J21850_1001625 3300002076 Bacteria 3188
21 JGI24034J26672_10000008 3300002239 Bacteria 200986
22 JGI24742J22300_10004545 3300002244 Bacteria 2276
23 Ga0055536_1000120 3300003781 Bacteria 68066
24 Ga0055536_1031927 3300003781 Bacteria 1370
25 Ga0055530_10010579 3300003791 Bacteria 3393
26 Ga0055530_10014624 3300003791 Bacteria 2603
27 Ga0065714_10002650 3300005288 Bacteria 12611
28 Ga0065704_10000342 3300005289 Bacteria 36460
29 Ga0065704_10000463 3300005289 Bacteria 20938
30 Ga0065704_10003385 3300005289 Bacteria 7128
31 Ga0065704_10070166 3300005289 Bacteria 176609
32 Ga0065704_10224241 3300005289 Bacteria 1064
33 Ga0065707_10003099 3300005295 Bacteria 4721
34 Ga0065707_10095962 3300005295 Bacteria 3319
35 Ga0070658_10000244 3300005327 Bacteria 48413
36 Ga0070658_10149743 3300005327 Bacteria 1953
37 Ga0070683_100169475 3300005329 Bacteria 2072
38 Ga0070683_100467629 3300005329 Bacteria 1204
39 Ga0070690_100000006 3300005330 Bacteria 132992
40 Ga0070670_100005200 3300005331 Bacteria 10951
41 Ga0070670_100005269 3300005331 Bacteria 10893
42 Ga0070670_100053091 3300005331 Bacteria 3480
43 Ga0070670_100299913 3300005331 Bacteria 1405
44 Ga0070670_100363421 3300005331 Bacteria 1273
45 Ga0070666_10000004 3300005335 Bacteria 372098
46 Ga0070666_10004316 3300005335 Bacteria 8650
47 Ga0070666_10056125 3300005335 Bacteria 2659
48 Ga0070666_10064196 3300005335 Bacteria 2490
49 Ga0070682_100094383 3300005337 Bacteria 1962
50 Ga0070660_100001742 3300005339 Bacteria 14916
51 Ga0070689_100196365 3300005340 Bacteria 1645
52 Ga0070687_100069539 3300005343 Bacteria 1886
53 Ga0070687_100154840 3300005343 Bacteria 1349
54 Ga0070661_100002644 3300005344 Bacteria 12258
55 Ga0070661_100215689 3300005344 Bacteria 1470
56 Ga0070668_100001230 3300005347 Bacteria 18229
57 Ga0070668_100042133 3300005347 Bacteria 3499
58 Ga0070668_100070225 3300005347 Bacteria 2726
59 Ga0070669_100000199 3300005353 Bacteria 52239
60 Ga0070669_100000215 3300005353 Bacteria 47944
61 Ga0070669_100000674 3300005353 Bacteria 25070
62 Ga0070671_100000634 3300005355 Bacteria 25107
63 Ga0070671_100002071 3300005355 Bacteria 15457
64 Ga0070671_100002761 3300005355 Bacteria 13632
65 Ga0070671_100121853 3300005355 Bacteria 2195
66 Ga0070688_100000836 3300005365 Bacteria 15254
67 Ga0070688_100066117 3300005365 Bacteria 2300
68 Ga0070659_100003240 3300005366 Bacteria 11584
69 Ga0070659_100020786 3300005366 Bacteria 4991
70 Ga0070659_100160386 3300005366 Bacteria 1838
71 Ga0070659_100375517 3300005366 Bacteria 1197
72 Ga0070667_100000347 3300005367 Bacteria 51490
73 Ga0070667_100001345 3300005367 Bacteria 22035
74 Ga0070667_100003356 3300005367 Bacteria 13671
75 Ga0070667_100039034 3300005367 Bacteria 3979
76 Ga0070667_100326908 3300005367 Bacteria 1384
77 Ga0070667_100881708 3300005367 Bacteria 832
78 Ga0070705_100550181 3300005440 Bacteria 885
79 Ga0070663_100008467 3300005455 Bacteria 6327
80 Ga0070663_100029341 3300005455 Bacteria 3758
81 Ga0070663_100073807 3300005455 Bacteria 2489
82 Ga0070663_100156164 3300005455 Bacteria 1753
83 Ga0070663_100202335 3300005455 Bacteria 1550
84 Ga0070681_10316084 3300005458 Bacteria 1471
85 Ga0070685_10000202 3300005466 Bacteria 40025
86 Ga0070685_10045245 3300005466 Bacteria 2523
87 Ga0070684_100074586 3300005535 Bacteria 2990
88 Ga0070684_100109217 3300005535 Bacteria 2479
89 Ga0068853_100008832 3300005539 Bacteria 8106
90 Ga0068853_100038004 3300005539 Bacteria 4099
91 Ga0068853_100081608 3300005539 Bacteria 2831
92 Ga0068853_100244916 3300005539 Bacteria 1644
93 Ga0070686_100000012 3300005544 Bacteria 176038
94 Ga0070686_100329709 3300005544 Bacteria 1141
95 Ga0070665_100000004 3300005548 Bacteria 785500
96 Ga0070665_100000163 3300005548 Bacteria 121320
97 Ga0070665_100007778 3300005548 Bacteria 10889
98 Ga0070665_100024754 3300005548 Bacteria 6048
99 Ga0070665_100054634 3300005548 Bacteria 4005
100 Ga0070665_100145303 3300005548 Bacteria 2375
101 Ga0070665_100204500 3300005548 Bacteria 1975
102 Ga0070665_100251466 3300005548 Bacteria 1768
103 Ga0070665_100348447 3300005548 Bacteria 1486
104 Ga0070665_100362972 3300005548 Bacteria 1454
105 Ga0068855_100011385 3300005563 Bacteria 10741
106 Ga0068855_100016407 3300005563 Bacteria 8904
107 Ga0068855_100052765 3300005563 Bacteria 4786
108 Ga0068855_100348154 3300005563 Bacteria 1632
109 Ga0070664_100004548 3300005564 Bacteria 11126
110 Ga0070664_100356643 3300005564 Bacteria 1331
111 Ga0068857_100005934 3300005577 Bacteria 10429
112 Ga0068857_100049217 3300005577 Bacteria 3739
113 Ga0068857_100147254 3300005577 Bacteria 2131
114 Ga0068857_100269789 3300005577 Bacteria 1564
115 Ga0068857_100493465 3300005577 Bacteria 1148
116 Ga0068854_100001069 3300005578 Bacteria 16476
117 Ga0068854_100003617 3300005578 Bacteria 9672
118 Ga0068854_100012184 3300005578 Bacteria 5627
119 Ga0068854_100041136 3300005578 Bacteria 3264
120 Ga0068854_100130866 3300005578 Bacteria 1916
121 Ga0068856_100011037 3300005614 Bacteria 8775
122 Ga0068856_100015994 3300005614 Bacteria 7252
123 Ga0068856_100063707 3300005614 Bacteria 3642
124 Ga0068856_100177892 3300005614 Bacteria 2140
125 Ga0068856_100390290 3300005614 Bacteria 1412
126 Ga0068852_100000492 3300005616 Bacteria 25824
127 Ga0068852_100036670 3300005616 Bacteria 4106
128 Ga0068852_100078619 3300005616 Bacteria 2919
129 Ga0068859_100009146 3300005617 Bacteria 10005
130 Ga0068859_100011170 3300005617 Bacteria 9029
131 Ga0068859_100097393 3300005617 Bacteria 2995
132 Ga0068859_100250659 3300005617 Bacteria 1861
133 Ga0068859_100430406 3300005617 Bacteria 1416
134 Ga0068864_100002937 3300005618 Bacteria 14096
135 Ga0068864_100005874 3300005618 Bacteria 10057
136 Ga0068864_100052609 3300005618 Bacteria 3510
137 Ga0068864_100333187 3300005618 Bacteria 1428
138 Ga0068861_100000013 3300005719 Bacteria 80820
139 Ga0068861_100006789 3300005719 Bacteria 7818
140 Ga0068861_100226479 3300005719 Bacteria 1583
141 Ga0068851_10013675 3300005834 Bacteria 3842
142 Ga0068851_10028451 3300005834 Bacteria 2761
143 Ga0068851_10032321 3300005834 Bacteria 2604
144 Ga0068851_10157338 3300005834 Bacteria 1246
145 Ga0068863_100000013 3300005841 Bacteria 220357
146 Ga0068863_100000024 3300005841 Bacteria 186277
147 Ga0068863_100000079 3300005841 Bacteria 107383
148 Ga0068863_100038322 3300005841 Bacteria 4561
149 Ga0068858_100000006 3300005842 Bacteria 256011
150 Ga0068858_100003036 3300005842 Bacteria 16821
151 Ga0068858_100004865 3300005842 Bacteria 13174
152 Ga0068858_100011879 3300005842 Bacteria 8206
153 Ga0068858_100066230 3300005842 Bacteria 3343
154 Ga0068858_100097047 3300005842 Bacteria 2747
155 Ga0068858_100112884 3300005842 Bacteria 2538
156 Ga0068858_100138053 3300005842 Bacteria 2288
157 Ga0068858_100788209 3300005842 Bacteria 927
158 Ga0068860_100000009 3300005843 Bacteria 372089
159 Ga0068860_100000098 3300005843 Bacteria 145516
160 Ga0068860_100000474 3300005843 Bacteria 49979
161 Ga0068860_100057541 3300005843 Bacteria 3696
162 Ga0068860_100611340 3300005843 Bacteria 1096
163 Ga0068860_100640469 3300005843 Bacteria 1070
164 Ga0068862_100000023 3300005844 Bacteria 203389
165 Ga0068862_100000029 3300005844 Bacteria 182708
166 Ga0068862_100006576 3300005844 Bacteria 9642
167 Ga0081455_10000277 3300005937 Bacteria 68047
168 Ga0075432_10030469 3300006058 Bacteria 1864
169 Ga0075362_10040882 3300006177 Bacteria 2042
170 Ga0097620_100009146 3300006931 Bacteria 10005
171 Ga0097620_100011170 3300006931 Bacteria 9029
172 Ga0097620_100097392 3300006931 Bacteria 2995
173 Ga0097620_100250650 3300006931 Bacteria 1861
174 Ga0097620_100430406 3300006931 Bacteria 1416
175 Ga0105251_10001177 3300009011 Bacteria 22695
176 Ga0105251_10012765 3300009011 Bacteria 4735
177 Ga0105244_10000488 3300009036 Bacteria 35867
178 Ga0105244_10003086 3300009036 Bacteria 12191
179 Ga0105244_10034574 3300009036 Bacteria 2659
180 Ga0105244_10035384 3300009036 Bacteria 2624
181 Ga0105250_10008439 3300009092 Bacteria 4376
182 Ga0105240_10003238 3300009093 Bacteria 25497
183 Ga0105240_10014797 3300009093 Bacteria 10635
184 Ga0105240_10037122 3300009093 Bacteria 6263
185 Ga0105240_10079295 3300009093 Bacteria 4041
186 Ga0105240_10109613 3300009093 Bacteria 3343
187 Ga0105240_10203406 3300009093 Bacteria 2319
188 Ga0105247_10002120 3300009101 Bacteria 13724
189 Ga0105247_10017570 3300009101 Bacteria 4291
190 Ga0105247_10174597 3300009101 Bacteria 1431
191 Ga0105241_10000704 3300009174 Bacteria 25281
192 Ga0105241_10007498 3300009174 Bacteria 8028
193 Ga0105241_10202614 3300009174 Bacteria 1658
194 Ga0105241_10353425 3300009174 Bacteria 1277
195 Ga0105248_10002260 3300009177 Bacteria 21349
196 Ga0105248_10002802 3300009177 Bacteria 19380
197 Ga0105248_10002919 3300009177 Bacteria 18977
198 Ga0105248_10003077 3300009177 Bacteria 18500
199 Ga0105248_10008862 3300009177 Bacteria 11055
200 Ga0105248_10009816 3300009177 Bacteria 10544
201 Ga0105248_10011013 3300009177 Bacteria 9976
202 Ga0105248_10011502 3300009177 Bacteria 9752
203 Ga0105248_10017174 3300009177 Bacteria 7973
204 Ga0105248_10137617 3300009177 Bacteria 2755
205 Ga0105248_10180479 3300009177 Bacteria 2379
206 Ga0105248_10829245 3300009177 Bacteria 1044
207 Ga0105237_10009160 3300009545 Bacteria 10635
208 Ga0105237_10025497 3300009545 Bacteria 6046
209 Ga0105237_10040010 3300009545 Bacteria 4730
210 Ga0105237_10084753 3300009545 Bacteria 3159
211 Ga0105237_10262397 3300009545 Bacteria 1730
212 Ga0105237_10292846 3300009545 Bacteria 1631
213 Ga0105237_10309150 3300009545 Bacteria 1584
214 Ga0105238_10005688 3300009551 Bacteria 12323
215 Ga0105238_10008626 3300009551 Bacteria 10199
216 Ga0105238_10013591 3300009551 Bacteria 8221
217 Ga0105238_10016961 3300009551 Bacteria 7390
218 Ga0105238_10027708 3300009551 Bacteria 5775
219 Ga0105238_10037121 3300009551 Bacteria 4954
220 Ga0105238_10060233 3300009551 Bacteria 3801
221 Ga0105238_10087228 3300009551 Bacteria 3107
222 Ga0105238_10918008 3300009551 Bacteria 894
223 Ga0105249_10000004 3300009553 Bacteria 368014
224 Ga0105249_10000006 3300009553 Bacteria 354449
225 Ga0105249_10056451 3300009553 Bacteria 3595
226 Ga0105249_10168871 3300009553 Bacteria 2120
227 Ga0105148_100179 3300009978 Bacteria 9348
228 Ga0105147_100813 3300009982 Bacteria 2535
229 Ga0105033_102337 3300009986 Bacteria 1568
230 Ga0105239_10010007 3300010375 Bacteria 10635
231 Ga0105239_10015872 3300010375 Bacteria 8336
232 Ga0105239_10056693 3300010375 Bacteria 4298
233 Ga0105239_10291710 3300010375 Bacteria 1837
234 Ga0105239_10417373 3300010375 Bacteria 1520
235 Ga0105239_10461497 3300010375 Bacteria 1442
236 Ga0105246_10089413 3300011119 Bacteria 2216
237 Ga0157373_10004285 3300013100 Bacteria 10736
238 Ga0157373_10012975 3300013100 Bacteria 6117
239 Ga0157371_10000029 3300013102 Bacteria 252131
240 Ga0157371_10039682 3300013102 Bacteria 3366
241 Ga0157370_10004423 3300013104 Bacteria 16103
242 Ga0157370_10785970 3300013104 Bacteria 866
243 Ga0157369_10049270 3300013105 Bacteria 4567
244 Ga0163162_10000633 3300013306 Bacteria 32562
245 Ga0163162_10012162 3300013306 Bacteria 8402
246 Ga0163162_10038483 3300013306 Bacteria 4773
247 Ga0163162_10214455 3300013306 Bacteria 2055
248 Ga0163162_10273266 3300013306 Bacteria 1822
249 Ga0163162_10493256 3300013306 Bacteria 1356
250 Ga0163162_10624754 3300013306 Bacteria 1202
251 Ga0163162_11255983 3300013306 Bacteria 841
252 Ga0157372_10006052 3300013307 Bacteria 12848
253 Ga0157372_10052895 3300013307 Bacteria 4524
254 Ga0157375_10000312 3300013308 Bacteria 43933
255 Ga0163163_10099867 3300014325 Bacteria 2924
256 Ga0163163_10447421 3300014325 Bacteria 1352
257 Ga0157380_10000936 3300014326 Bacteria 18439
258 Ga0157380_10003133 3300014326 Bacteria 11278
259 Ga0157380_10219889 3300014326 Bacteria 1699
260 Ga0157379_10053801 3300014968 Bacteria 3597
261 Ga0157379_10087961 3300014968 Bacteria 2786
262 Ga0182006_1001200 3300015261 Bacteria 16189
263 Ga0163161_10000029 3300017792 Bacteria 193416
264 Ga0163161_10001170 3300017792 Bacteria 19695
265 Ga0163161_10038278 3300017792 Bacteria 3440
266 Ga0209676_1000081 3300025292 Bacteria 285297
267 Ga0209050_1000232 3300025298 Bacteria 121822
268 Ga0209050_1001181 3300025298 Bacteria 30804
269 Ga0209050_1023665 3300025298 Bacteria 2152
270 Ga0209051_1001536 3300025303 Bacteria 19214
271 Ga0207697_10003449 3300025315 Bacteria 7812
272 Ga0207697_10010459 3300025315 Bacteria 3965
273 Ga0207656_10001249 3300025321 Bacteria 8385
274 Ga0207656_10034955 3300025321 Bacteria 2101
275 Ga0207696_1001980 3300025711 Bacteria 10392
276 Ga0207655_1000571 3300025728 Bacteria 45784
277 Ga0207713_1000436 3300025735 Bacteria 43987
278 Ga0207713_1009681 3300025735 Bacteria 5403
279 Ga0207713_1039960 3300025735 Bacteria 1973
280 Ga0207710_10009416 3300025900 Bacteria 4111
281 Ga0207680_10000010 3300025903 Bacteria 414170
282 Ga0207680_10002242 3300025903 Bacteria 9015
283 Ga0207680_10013013 3300025903 Bacteria 4256
284 Ga0207680_10292717 3300025903 Bacteria 1133
285 Ga0207647_10001278 3300025904 Bacteria 19350
286 Ga0207647_10011211 3300025904 Bacteria 6295
287 Ga0207647_10074446 3300025904 Bacteria 2045
288 Ga0207647_10115034 3300025904 Bacteria 1589
289 Ga0207705_10000106 3300025909 Bacteria 95124
290 Ga0207705_10000224 3300025909 Bacteria 56164
291 Ga0207654_10000173 3300025911 Bacteria 40069
292 Ga0207654_10004961 3300025911 Bacteria 6729
293 Ga0207654_10039677 3300025911 Bacteria 2650
294 Ga0207654_10170642 3300025911 Bacteria 1412
295 Ga0207654_10242639 3300025911 Bacteria 1205
296 Ga0207695_10002538 3300025913 Bacteria 26822
297 Ga0207695_10007969 3300025913 Bacteria 13362
298 Ga0207695_10009115 3300025913 Bacteria 12321
299 Ga0207695_10016174 3300025913 Bacteria 8749
300 Ga0207695_10065563 3300025913 Bacteria 3734
301 Ga0207695_10117194 3300025913 Bacteria 2636
302 Ga0207671_10001485 3300025914 Bacteria 27090
303 Ga0207671_10002027 3300025914 Bacteria 22273
304 Ga0207671_10002277 3300025914 Bacteria 20767
305 Ga0207671_10092900 3300025914 Bacteria 2275
306 Ga0207671_10119332 3300025914 Bacteria 2015
307 Ga0207662_10033535 3300025918 Bacteria 2993
308 Ga0207657_10000149 3300025919 Bacteria 71078
309 Ga0207657_10100941 3300025919 Bacteria 2395
310 Ga0207649_10004039 3300025920 Bacteria 7990
311 Ga0207681_10000081 3300025923 Bacteria 85588
312 Ga0207681_10000255 3300025923 Bacteria 40599
313 Ga0207681_10000435 3300025923 Bacteria 29150
314 Ga0207681_10001570 3300025923 Bacteria 14684
315 Ga0207681_10010863 3300025923 Bacteria 5592
316 Ga0207694_10001925 3300025924 Bacteria 17191
317 Ga0207694_10002056 3300025924 Bacteria 16643
318 Ga0207694_10002735 3300025924 Bacteria 14267
319 Ga0207694_10006101 3300025924 Bacteria 9214
320 Ga0207694_10008471 3300025924 Bacteria 7763
321 Ga0207694_10019165 3300025924 Bacteria 5172
322 Ga0207694_10045025 3300025924 Bacteria 3408
323 Ga0207694_10169686 3300025924 Bacteria 1766
324 Ga0207650_10086423 3300025925 Bacteria 2387
325 Ga0207650_10498124 3300025925 Bacteria 1018
326 Ga0207644_10000092 3300025931 Bacteria 64892
327 Ga0207644_10000234 3300025931 Bacteria 38151
328 Ga0207644_10000542 3300025931 Bacteria 24541
329 Ga0207644_10010778 3300025931 Bacteria 6030
330 Ga0207644_10144527 3300025931 Bacteria 1835
331 Ga0207690_10000251 3300025932 Bacteria 39000
332 Ga0207690_10170283 3300025932 Bacteria 1631
333 Ga0207706_10050916 3300025933 Bacteria 3658
334 Ga0207706_10112128 3300025933 Bacteria 2399
335 Ga0207670_10153133 3300025936 Bacteria 1713
336 Ga0207711_10005039 3300025941 Bacteria 11200
337 Ga0207711_10007885 3300025941 Bacteria 8906
338 Ga0207711_10014790 3300025941 Bacteria 6484
339 Ga0207711_10016940 3300025941 Bacteria 6052
340 Ga0207711_10034093 3300025941 Bacteria 4311
341 Ga0207711_10037658 3300025941 Bacteria 4110
342 Ga0207711_10124686 3300025941 Bacteria 2303
343 Ga0207661_10637912 3300025944 Bacteria 979
344 Ga0207679_10180228 3300025945 Bacteria 1747
345 Ga0207667_10000002 3300025949 Bacteria 895662
346 Ga0207667_10002662 3300025949 Bacteria 22070
347 Ga0207667_10014538 3300025949 Bacteria 8967
348 Ga0207667_10136214 3300025949 Bacteria 2529
349 Ga0207667_10141566 3300025949 Bacteria 2476
350 Ga0207667_10484806 3300025949 Bacteria 1255
351 Ga0207667_10554020 3300025949 Bacteria 1163
352 Ga0207712_10000008 3300025961 Bacteria 527957
353 Ga0207712_10000014 3300025961 Bacteria 375393
354 Ga0207712_10029765 3300025961 Bacteria 3666
355 Ga0207712_10086030 3300025961 Bacteria 2302
356 Ga0207712_10104438 3300025961 Bacteria 2112
357 Ga0207668_10000742 3300025972 Bacteria 19912
358 Ga0207668_10004884 3300025972 Bacteria 7890
359 Ga0207668_10037978 3300025972 Bacteria 3228
360 Ga0207668_10130666 3300025972 Bacteria 1917
361 Ga0207640_10000613 3300025981 Bacteria 21033
362 Ga0207640_10024845 3300025981 Bacteria 3620
363 Ga0207640_10031064 3300025981 Bacteria 3296
364 Ga0207640_10035460 3300025981 Bacteria 3123
365 Ga0207640_10059208 3300025981 Bacteria 2527
366 Ga0207640_10072879 3300025981 Bacteria 2318
367 Ga0207640_10136182 3300025981 Bacteria 1783
368 Ga0207640_10376639 3300025981 Bacteria 1149
369 Ga0207658_10000490 3300025986 Bacteria 36308
370 Ga0207658_10002472 3300025986 Bacteria 13493
371 Ga0207658_10005184 3300025986 Bacteria 8972
372 Ga0207658_10005349 3300025986 Bacteria 8825
373 Ga0207658_10008945 3300025986 Bacteria 6793
374 Ga0207703_10000469 3300026035 Bacteria 42199
375 Ga0207703_10002260 3300026035 Bacteria 16831
376 Ga0207703_10004724 3300026035 Bacteria 11114
377 Ga0207703_10037520 3300026035 Bacteria 3861
378 Ga0207703_10148084 3300026035 Bacteria 2044
379 Ga0207703_10214484 3300026035 Bacteria 1718
380 Ga0207703_10458398 3300026035 Bacteria 1192
381 Ga0207639_10001943 3300026041 Bacteria 13872
382 Ga0207639_10004307 3300026041 Bacteria 9588
383 Ga0207639_10011557 3300026041 Bacteria 6135
384 Ga0207639_10013661 3300026041 Bacteria 5691
385 Ga0207639_10014722 3300026041 Bacteria 5509
386 Ga0207639_10173906 3300026041 Bacteria 1826
387 Ga0207678_10000177 3300026067 Bacteria 54271
388 Ga0207678_10000276 3300026067 Bacteria 46568
389 Ga0207678_10004048 3300026067 Bacteria 13182
390 Ga0207678_10005102 3300026067 Bacteria 11776
391 Ga0207678_10316616 3300026067 Bacteria 1342
392 Ga0207702_10000241 3300026078 Bacteria 63829
393 Ga0207702_10001216 3300026078 Bacteria 26119
394 Ga0207702_10003524 3300026078 Bacteria 14263
395 Ga0207702_10015310 3300026078 Bacteria 6357
396 Ga0207702_10188092 3300026078 Bacteria 1906
397 Ga0207702_10321642 3300026078 Bacteria 1473
398 Ga0207702_10414926 3300026078 Bacteria 1301
399 Ga0207641_10000003 3300026088 Bacteria 496984
400 Ga0207641_10000068 3300026088 Bacteria 155114
401 Ga0207641_10000116 3300026088 Bacteria 117850
402 Ga0207641_10003659 3300026088 Bacteria 13549
403 Ga0207641_10296517 3300026088 Bacteria 1526
404 Ga0207676_10000509 3300026095 Bacteria 32700
405 Ga0207676_10000734 3300026095 Bacteria 25702
406 Ga0207676_10103240 3300026095 Bacteria 2368
407 Ga0207676_10115322 3300026095 Bacteria 2255
408 Ga0207674_10001960 3300026116 Bacteria 26068
409 Ga0207674_10010429 3300026116 Bacteria 10526
410 Ga0207674_10156226 3300026116 Bacteria 2236
411 Ga0207674_10266029 3300026116 Bacteria 1662
412 Ga0207674_10441260 3300026116 Bacteria 1258
413 Ga0207675_100000054 3300026118 Bacteria 82248
414 Ga0207675_100046180 3300026118 Bacteria 4068
415 Ga0207698_10000005 3300026142 Bacteria 295687
416 Ga0207698_10000949 3300026142 Bacteria 16841
417 Ga0207698_10048340 3300026142 Bacteria 3229
418 Ga0207698_10142392 3300026142 Bacteria 2068
419 Ga0207698_10637334 3300026142 Bacteria 1054
420 Ga0209371_1000980 3300027312 Bacteria 22005
421 Ga0209974_10087185 3300027876 Bacteria 1079
422 Ga0207428_10039735 3300027907 Bacteria 3821
423 Ga0207428_10047074 3300027907 Bacteria 3465
424 Ga0268266_10000009 3300028379 Bacteria 1097737
425 Ga0268266_10000205 3300028379 Bacteria 103915
426 Ga0268266_10001759 3300028379 Bacteria 24679
427 Ga0268266_10029449 3300028379 Bacteria 4668
428 Ga0268266_10058915 3300028379 Bacteria 3307
429 Ga0268266_10083257 3300028379 Bacteria 2793
430 Ga0268266_10105295 3300028379 Bacteria 2492
431 Ga0268266_10297280 3300028379 Bacteria 1505
432 Ga0268265_10000035 3300028380 Bacteria 207267
433 Ga0268265_10002067 3300028380 Bacteria 15676
434 Ga0268264_10000023 3300028381 Bacteria 471408
435 Ga0268264_10000129 3300028381 Bacteria 182988
436 Ga0268264_10001169 3300028381 Bacteria 25510
437 Ga0268264_10005055 3300028381 Bacteria 11168
438 Ga0268264_10010312 3300028381 Bacteria 7732
439 Ga0268264_10051721 3300028381 Bacteria 3424
440 Ga0268264_10056928 3300028381 Bacteria 3268
441 Ga0268264_10571665 3300028381 Bacteria 1111
442 Ga0307517_10157810 3300028786 Bacteria 1533
443 Ga0268256_1004217 3300030500 Bacteria 6055
444 Ga0307408_100001178 3300031548 Bacteria 19789
445 Ga0307408_100158820 3300031548 Bacteria 1793
446 Ga0307408_100647280 3300031548 Bacteria 944
447 Ga0307405_10033799 3300031731 Bacteria 3037
448 Ga0307405_10060618 3300031731 Bacteria 2388
449 Ga0307405_10129104 3300031731 Bacteria 1743
450 Ga0307405_10227926 3300031731 Bacteria 1371
451 Ga0307405_10238426 3300031731 Bacteria 1345
452 Ga0307413_10087497 3300031824 Bacteria 2018
453 Ga0307410_10074421 3300031852 Bacteria 2365
454 Ga0307406_10006401 3300031901 Bacteria 6496
455 Ga0307406_10058252 3300031901 Bacteria 2482
456 Ga0307406_10065683 3300031901 Bacteria 2358
457 Ga0307406_10243400 3300031901 Bacteria 1350
458 Ga0307412_10090368 3300031911 Bacteria 2140
459 Ga0307412_10141524 3300031911 Bacteria 1762
460 Ga0307412_10177197 3300031911 Bacteria 1599
461 Ga0307412_10213754 3300031911 Bacteria 1473
462 Ga0307409_100025575 3300031995 Bacteria 4143
463 Ga0307409_100098091 3300031995 Bacteria 2422
464 Ga0307416_100013740 3300032002 Bacteria 5514
465 Ga0307416_100176590 3300032002 Bacteria 1996
466 Ga0307416_100235887 3300032002 Bacteria 1768
467 Ga0307414_10029153 3300032004 Bacteria 3588
468 Ga0307414_10147032 3300032004 Bacteria 1853
469 Ga0307414_10320861 3300032004 Bacteria 1318
470 Ga0307414_10465899 3300032004 Bacteria 1111
471 Ga0307411_10010906 3300032005 Bacteria 4872
472 Ga0307411_10118785 3300032005 Bacteria 1908
473 Ga0373936_0000438 3300035113 Bacteria 13923
474 Ga0439431_0000123 3300041997 Bacteria 13511
475 Ga0439443_011710 3300042003 Bacteria 1289
476 Ga0439451_000134 3300042009 Bacteria 13696
477 Ga0450912_000156 3300042116 Bacteria 2654
478 Ga0439434_0017935 3300042435 Bacteria 2119
479 Ga0439435_0011285 3300042436 Bacteria 2141
480 Ga0466968_0000001 3300044735 Bacteria 100282
481 Ga0495617_013157 3300046452 Bacteria 2818
482 Ga0495627_009681 3300046453 Bacteria 3537
483 Ga0495603_0004141 3300046455 Bacteria 8640
484 Ga0495590_0010643 3300046457 Bacteria 3449
485 Ga0495591_000005 3300046458 Bacteria 394092
486 Ga0495591_009522 3300046458 Bacteria 3849
487 Ga0495629_0143136 3300046459 Bacteria 1663
488 Ga0495638_0011478 3300046460 Bacteria 6103
489 Ga0495638_0036433 3300046460 Bacteria 3134
490 Ga0495638_0054061 3300046460 Bacteria 2497
491 Ga0495653_0001061 3300046463 Bacteria 21169
492 Ga0495650_0001536 3300046471 Bacteria 21887
493 Ga0495605_0082171 3300046474 Bacteria 1505
494 Ga0495664_0002014 3300046477 Bacteria 10848
495 Ga0495584_0012791 3300046491 Bacteria 4282
496 Ga0495585_0000577 3300046492 Bacteria 34550
497 Ga0495596_0047251 3300046500 Bacteria 1689
498 Ga0495607_0006485 3300046501 Bacteria 8228
499 Ga0495607_0052435 3300046501 Bacteria 2363
500 Ga0495583_0002568 3300046506 Bacteria 15282
501 Ga0495606_0000525 3300046507 Bacteria 61969
502 Ga0495606_0091208 3300046507 Bacteria 1874
503 Ga0495616_0002361 3300046513 Bacteria 12573
504 Ga0495616_0022986 3300046513 Bacteria 3360
505 Ga0495628_0032197 3300046516 Bacteria 4234
506 Ga0495630_0001092 3300046517 Bacteria 18641
507 Ga0495631_0000063 3300046518 Bacteria 66560
508 Ga0495632_0000058 3300046519 Bacteria 122648
509 Ga0495632_0019335 3300046519 Bacteria 3713
510 Ga0495632_0032441 3300046519 Bacteria 2691
511 Ga0495637_0000315 3300046520 Bacteria 37537
512 Ga0495643_0000044 3300046522 Bacteria 226211
513 Ga0495643_0000880 3300046522 Bacteria 31960
514 Ga0495644_0001098 3300046523 Bacteria 11173
515 Ga0495648_0000241 3300046524 Bacteria 61991
516 Ga0495648_0002312 3300046524 Bacteria 17749
517 Ga0495663_0000394 3300046525 Bacteria 16143
518 Ga0495642_0000003 3300046528 Bacteria 185425
519 Ga0495652_0121122 3300046529 Bacteria 2086
520 Ga0495654_0015638 3300046530 Bacteria 4027
521 Ga0495654_0030628 3300046530 Bacteria 2736
522 Ga0495665_0000088 3300046531 Bacteria 41277
523 Ga0495586_0111876 3300046535 Bacteria 1520
524 Ga0495609_0000490 3300046538 Bacteria 31718
525 Ga0495597_0000216 3300046542 Bacteria 52708
526 Ga0495597_0008172 3300046542 Bacteria 5262
527 Ga0495645_0001816 3300046543 Bacteria 14507
528 Ga0495622_0003159 3300046557 Bacteria 7798
529 Ga0495633_0074262 3300046558 Bacteria 1584
530 Ga0495656_0000104 3300046615 Bacteria 35209
531 Ga0495635_0007133 3300046663 Bacteria 7812
532 Ga0495659_0000116 3300046664 Bacteria 35444
533 Ga0495661_0033597 3300046665 Bacteria 3234
534 Ga0495599_0001037 3300046678 Bacteria 15615
535 Ga0495623_0003834 3300046679 Bacteria 9910
536 Ga0495623_0007903 3300046679 Bacteria 6917
537 Ga0495646_0042176 3300046680 Bacteria 2801
538 Ga0495669_0000263 3300046684 Bacteria 30264
539 Ga0495671_0001868 3300046692 Bacteria 13535
540 Ga0495671_0016585 3300046692 Bacteria 3930
541 Ga0495649_0052751 3300046694 Bacteria 2203
542 Ga0495649_0092547 3300046694 Bacteria 1610
543 Ga0495589_0000549 3300046794 Bacteria 25906
544 Ga0495660_0000517 3300046810 Bacteria 31676
545 Ga0495660_0143329 3300046810 Bacteria 1186
546 Ga0495581_0046960 3300047315 Bacteria 2496
547 Ga0495636_0005002 3300047318 Bacteria 5200
548 Ga0495674_0004761 3300047319 Bacteria 13047
549 Ga0495674_0026330 3300047319 Bacteria 5321
550 Ga0495672_0000006 3300047320 Bacteria 589807
551 Ga0495672_0002680 3300047320 Bacteria 16016
552 Ga0495672_0207645 3300047320 Bacteria 975
553 Ga0495680_0001743 3300047322 Bacteria 23092
554 Ga0495683_0003035 3300047323 Bacteria 9872
555 Ga0495675_0068666 3300047444 Bacteria 2239
556 Ga0495675_0097903 3300047444 Bacteria 1838
557 Ga0495677_0000047 3300047445 Bacteria 72197
558 Ga0495685_013131 3300047447 Bacteria 2809
559 Ga0495673_0000178 3300047469 Bacteria 102182
560 Ga0495681_0000026 3300047470 Bacteria 144911
561 Ga0495681_0025699 3300047470 Bacteria 3077
562 Ga0495686_0087546 3300047472 Bacteria 1894
563 Ga0495593_0000023 3300047673 Bacteria 66020
564 Ga0495602_0000395 3300048088 Bacteria 40667
565 Ga0495602_0006180 3300048088 Bacteria 12560
566 Ga0495626_0000132 3300048091 Bacteria 94157
567 Ga0495626_0000522 3300048091 Bacteria 38417
568 Ga0495626_0001091 3300048091 Bacteria 22989
569 Ga0496100_0000468 3300048903 Bacteria 19363
570 Ga0496100_0104443 3300048903 Bacteria 1957
571 Ga0496101_0000286 3300048904 Bacteria 35339
572 Ga0496101_0006180 3300048904 Bacteria 7697
573 Ga0496101_0063056 3300048904 Bacteria 2696
574 Ga0496101_0089742 3300048904 Bacteria 2285
575 Ga0496101_0192409 3300048904 Bacteria 1575
576 Ga0496101_0245428 3300048904 Bacteria 1394
577 Ga0496102_0000149 3300048905 Bacteria 95638
578 Ga0496102_0000178 3300048905 Bacteria 86174
579 Ga0496102_0000603 3300048905 Bacteria 37505
580 Ga0496102_0014478 3300048905 Bacteria 6852
581 Ga0496102_0031407 3300048905 Bacteria 4764
582 Ga0496102_0066791 3300048905 Bacteria 3297
583 Ga0496102_0440626 3300048905 Bacteria 1222
584 Ga0496102_0621632 3300048905 Bacteria 1003
585 Ga0496103_0000049 3300048906 Bacteria 154466
586 Ga0496103_0000119 3300048906 Bacteria 86194
587 Ga0496103_0001250 3300048906 Bacteria 17360
588 Ga0496103_0003454 3300048906 Bacteria 9661
589 Ga0496103_0025754 3300048906 Bacteria 3557
590 Ga0496103_0246627 3300048906 Bacteria 1149
591 Ga0496103_0257765 3300048906 Bacteria 1122
592 Ga0496104_0002042 3300048907 Bacteria 17531
593 Ga0496104_0012927 3300048907 Bacteria 7517
594 Ga0496104_0047274 3300048907 Bacteria 4056
595 Ga0496104_0113755 3300048907 Bacteria 2595
596 Ga0496105_0000384 3300048908 Bacteria 29011
597 Ga0496105_0004516 3300048908 Bacteria 10477
598 Ga0496105_0004706 3300048908 Bacteria 10292
599 Ga0496106_0007807 3300048909 Bacteria 7915
600 Ga0496106_0034381 3300048909 Bacteria 3784
601 Ga0496106_0070595 3300048909 Bacteria 2668
602 Ga0496107_0000555 3300048910 Bacteria 20889
603 Ga0496107_0080429 3300048910 Bacteria 2376
604 Ga0496107_0377322 3300048910 Bacteria 1055
605 Ga0496108_0006786 3300048911 Bacteria 9270
606 Ga0496109_0038989 3300048912 Bacteria 4299
607 Ga0496109_0168773 3300048912 Bacteria 2052
608 Ga0496110_0014851 3300048913 Bacteria 6471
609 Ga0496110_0044082 3300048913 Bacteria 3895
610 Ga0496110_0058882 3300048913 Bacteria 3384
611 Ga0496110_0200022 3300048913 Bacteria 1815
612 Ga0496112_0126968 3300048915 Bacteria 2521
613 Ga0496112_0141116 3300048915 Bacteria 2378
614 Ga0496113_0000915 3300048916 Bacteria 15596
615 Ga0496113_0001856 3300048916 Bacteria 12033
616 Ga0496113_0002781 3300048916 Bacteria 10290
617 Ga0496113_0057702 3300048916 Bacteria 2918
618 Ga0496113_0191952 3300048916 Bacteria 1621
619 Ga0496114_0006234 3300048917 Bacteria 9386
620 Ga0496114_0053749 3300048917 Bacteria 3357
621 Ga0496115_0000740 3300048918 Bacteria 24162
622 Ga0496115_0352547 3300048918 Bacteria 1200
623 Ga0496116_0000078 3300048919 Bacteria 227712
624 Ga0496116_0005447 3300048919 Bacteria 11787
625 Ga0496116_0027139 3300048919 Bacteria 4173
626 Ga0496116_0032455 3300048919 Bacteria 3721
627 Ga0496116_0057344 3300048919 Bacteria 2547
628 Ga0496116_0142241 3300048919 Bacteria 1347
629 Ga0496117_0000123 3300048920 Bacteria 169805
630 Ga0496117_0000318 3300048920 Bacteria 84351
631 Ga0496117_0011188 3300048920 Bacteria 8058
632 Ga0496117_0016985 3300048920 Bacteria 6097
633 Ga0496117_0021007 3300048920 Bacteria 5304
634 Ga0496117_0083145 3300048920 Bacteria 2094
635 Ga0496118_0000186 3300048921 Bacteria 108940
636 Ga0496118_0004578 3300048921 Bacteria 16276
637 Ga0496118_0009472 3300048921 Bacteria 9830
638 Ga0496118_0013949 3300048921 Bacteria 7557
639 Ga0496118_0075970 3300048921 Bacteria 2392
640 Ga0496118_0090878 3300048921 Bacteria 2102
641 Ga0496119_0000090 3300048922 Bacteria 134340
642 Ga0496119_0005614 3300048922 Bacteria 11930
643 Ga0496119_0080647 3300048922 Bacteria 1876
644 Ga0496119_0089794 3300048922 Bacteria 1749
645 Ga0496120_0000690 3300048923 Bacteria 49503
646 Ga0496120_0081402 3300048923 Bacteria 1752
647 Ga0496121_0000058 3300048924 Bacteria 281335
648 Ga0496121_0000170 3300048924 Bacteria 144547
649 Ga0496121_0001102 3300048924 Bacteria 47573
650 Ga0496121_0001167 3300048924 Bacteria 46089
651 Ga0496121_0008424 3300048924 Bacteria 12133
652 Ga0496121_0021736 3300048924 Bacteria 6269
653 Ga0496121_0022199 3300048924 Bacteria 6173
654 Ga0496121_0207385 3300048924 Bacteria 1391
655 Ga0496121_0275411 3300048924 Bacteria 1154
656 Ga0496122_0000552 3300048925 Bacteria 77275
657 Ga0496122_0000662 3300048925 Bacteria 69323
658 Ga0496122_0000710 3300048925 Bacteria 65728
659 Ga0496122_0003669 3300048925 Bacteria 19924
660 Ga0496122_0004341 3300048925 Bacteria 17725
661 Ga0496122_0019002 3300048925 Bacteria 6304
662 Ga0496122_0026032 3300048925 Bacteria 5061
663 Ga0496122_0074283 3300048925 Bacteria 2406
664 Ga0496122_0176940 3300048925 Bacteria 1278
665 Ga0496123_0000104 3300048926 Bacteria 168230
666 Ga0496123_0000478 3300048926 Bacteria 69650
667 Ga0496123_0001031 3300048926 Bacteria 42310
668 Ga0496123_0001607 3300048926 Bacteria 30631
669 Ga0496123_0002034 3300048926 Bacteria 26132
670 Ga0496123_0002385 3300048926 Bacteria 23545
671 Ga0496123_0006685 3300048926 Bacteria 11111
672 Ga0496123_0012881 3300048926 Bacteria 7080
673 Ga0496123_0021639 3300048926 Bacteria 4991
674 Ga0496123_0060689 3300048926 Bacteria 2436
675 Ga0496123_0123807 3300048926 Bacteria 1448
676 Ga0496124_0000224 3300048927 Bacteria 110603
677 Ga0496124_0000324 3300048927 Bacteria 88327
678 Ga0496124_0000569 3300048927 Bacteria 62485
679 Ga0496124_0002768 3300048927 Bacteria 22293
680 Ga0496124_0003427 3300048927 Bacteria 19435
681 Ga0496124_0011124 3300048927 Bacteria 9029
682 Ga0496124_0021301 3300048927 Bacteria 5974
683 Ga0496124_0062282 3300048927 Bacteria 3122
684 Ga0496124_0111667 3300048927 Bacteria 2199
685 Ga0496125_0001890 3300048928 Bacteria 28768
686 Ga0496125_0002211 3300048928 Bacteria 25955
687 Ga0496125_0005275 3300048928 Bacteria 14467
688 Ga0496125_0008036 3300048928 Bacteria 11136
689 Ga0496125_0008335 3300048928 Bacteria 10874
690 Ga0496125_0026107 3300048928 Bacteria 5334
691 Ga0496125_0120535 3300048928 Bacteria 1872
692 Ga0496125_0120715 3300048928 Bacteria 1871
693 Ga0496125_0170879 3300048928 Bacteria 1461
694 Ga0496125_0252529 3300048928 Bacteria 1111
695 Ga0496126_0000045 3300048929 Bacteria 331225
696 Ga0496126_0000058 3300048929 Bacteria 272530
697 Ga0496126_0001180 3300048929 Bacteria 42930
698 Ga0496126_0002582 3300048929 Bacteria 24157
699 Ga0496126_0003207 3300048929 Bacteria 20981
700 Ga0496126_0019383 3300048929 Bacteria 6701
701 Ga0496126_0023137 3300048929 Bacteria 6023
702 Ga0496126_0033848 3300048929 Bacteria 4806
703 Ga0496126_0091991 3300048929 Bacteria 2666
704 Ga0496126_0179666 3300048929 Bacteria 1798
705 Ga0495678_007230 3300049459 Bacteria 5785
706 Ga0495678_030282 3300049459 Bacteria 2265
707 Ga0495682_0000926 3300049460 Bacteria 17782
708 Ga0501198_001048 3300049649 Bacteria 3522
709 Ga0501223_000006 3300049663 Bacteria 133378
710 Ga0501223_000024 3300049663 Bacteria 59339
711 Ga0501223_000047 3300049663 Bacteria 41715
712 Ga0501224_000001 3300049664 Bacteria 308131
713 Ga0501224_000017 3300049664 Bacteria 81060
714 Ga0501233_000034 3300049668 Bacteria 17934
715 Ga0501233_001364 3300049668 Bacteria 4176
716 Ga0501235_000125 3300049669 Bacteria 12715
717 Ga0501235_006498 3300049669 Bacteria 2545
718 Ga0501235_018040 3300049669 Bacteria 1562
719 Ga0501225_0000007 3300049705 Bacteria 107771
720 Ga0501225_0000095 3300049705 Bacteria 28347
721 Ga0501225_0002153 3300049705 Bacteria 6103
722 Ga0501225_0002556 3300049705 Bacteria 5609
723 Ga0501234_001781 3300049707 Bacteria 3396
724 Ga0501234_002623 3300049707 Bacteria 2835
725 Ga0501226_000029 3300049853 Bacteria 82723
726 Ga0501226_000040 3300049853 Bacteria 60590
727 nmdc:mga08x19_67195_c1 3300050514 Bacteria 2331
728 Ga0500573_0000027 3300053140 Bacteria 143529
729 Ga0500588_0007022 3300053146 Bacteria 2580
730 Ga0500565_003122 3300053734 Bacteria 1295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046458 Ga0495591_009522 Ga0495591_009522_16_702 227
2 3300047320 Ga0495672_0207645 Ga0495672_0207645_83_769 227
3 3300046678 Ga0495599_0001037 Ga0495599_0001037_11206_12030 235
4 3300046679 Ga0495623_0003834 Ga0495623_0003834_3516_4340 235
5 3300047444 Ga0495675_0068666 Ga0495675_0068666_1131_1955 235
6 3300048088 Ga0495602_0006180 Ga0495602_0006180_8014_8838 235
7 3300047318 Ga0495636_0005002 Ga0495636_0005002_4466_5182 237
8 3300025961 Ga0207712_10029765 Ga0207712_100297653 245
9 3300048929 Ga0496126_0023137 Ga0496126_0023137_315_1073 252
10 3300025914 Ga0207671_10092900 Ga0207671_100929002 254
11 iso_pu_bacteria 2895880812 2895885780 254
12 3300001976 JGI24752J21851_1000313 JGI24752J21851_10003134 255
13 3300002070 JGI24750J21931_1000170 JGI24750J21931_10001704 255
14 3300002074 JGI24748J21848_1000065 JGI24748J21848_10000655 255
15 3300002076 JGI24749J21850_1001625 JGI24749J21850_10016253 255
16 3300002239 JGI24034J26672_10000008 JGI24034J26672_10000008166 255
17 3300002244 JGI24742J22300_10004545 JGI24742J22300_100045454 255
18 3300005330 Ga0070690_100000006 Ga0070690_10000000657 255
19 3300005331 Ga0070670_100005200 Ga0070670_1000052006 255
20 3300005335 Ga0070666_10000004 Ga0070666_10000004124 255
21 3300005340 Ga0070689_100196365 Ga0070689_1001963651 255
22 3300005343 Ga0070687_100154840 Ga0070687_1001548401 255
23 3300005353 Ga0070669_100000215 Ga0070669_10000021534 255
24 3300005365 Ga0070688_100000836 Ga0070688_1000008363 255
25 3300005367 Ga0070667_100881708 Ga0070667_1008817081 255
26 3300005466 Ga0070685_10000202 Ga0070685_1000020216 255
27 3300005544 Ga0070686_100000012 Ga0070686_10000001222 255
28 3300005548 Ga0070665_100000004 Ga0070665_100000004500 255
29 3300005617 Ga0068859_100011170 Ga0068859_1000111707 255
30 3300005618 Ga0068864_100052609 Ga0068864_1000526094 255
31 3300005719 Ga0068861_100006789 Ga0068861_1000067897 255
32 3300005841 Ga0068863_100000013 Ga0068863_10000001347 255
33 3300005842 Ga0068858_100004865 Ga0068858_10000486512 255
34 3300005843 Ga0068860_100000009 Ga0068860_100000009124 255
35 3300005844 Ga0068862_100000029 Ga0068862_100000029135 255
36 3300006931 Ga0097620_100011170 Ga0097620_1000111707 255
37 3300009177 Ga0105248_10009816 Ga0105248_100098164 255
38 3300009553 Ga0105249_10000006 Ga0105249_10000006241 255
39 3300014326 Ga0157380_10003133 Ga0157380_100031335 255
40 3300017792 Ga0163161_10000029 Ga0163161_1000002963 255
41 3300025903 Ga0207680_10000010 Ga0207680_10000010283 255
42 3300025918 Ga0207662_10033535 Ga0207662_100335353 255
43 3300025923 Ga0207681_10000435 Ga0207681_1000043522 255
44 3300025931 Ga0207644_10000092 Ga0207644_1000009212 255
45 3300025936 Ga0207670_10153133 Ga0207670_101531331 255
46 3300025941 Ga0207711_10037658 Ga0207711_100376585 255
47 3300025961 Ga0207712_10000014 Ga0207712_10000014124 255
48 3300025972 Ga0207668_10130666 Ga0207668_101306663 255
49 3300025986 Ga0207658_10005184 Ga0207658_100051846 255
50 3300026035 Ga0207703_10004724 Ga0207703_100047247 255
51 3300026088 Ga0207641_10000116 Ga0207641_1000011648 255
52 3300026095 Ga0207676_10103240 Ga0207676_101032404 255
53 3300026118 Ga0207675_100046180 Ga0207675_1000461804 255
54 3300028379 Ga0268266_10000009 Ga0268266_10000009300 255
55 3300028380 Ga0268265_10002067 Ga0268265_100020679 255
56 3300028381 Ga0268264_10000023 Ga0268264_10000023241 255
57 3300048905 Ga0496102_0031407 Ga0496102_0031407_1321_2100 255
58 3300048906 Ga0496103_0003454 Ga0496103_0003454_1274_2053 255
59 3300048907 Ga0496104_0047274 Ga0496104_0047274_2336_3115 255
60 3300048909 Ga0496106_0070595 Ga0496106_0070595_1531_2310 255
61 3300048910 Ga0496107_0080429 Ga0496107_0080429_331_1110 255
62 3300048920 Ga0496117_0016985 Ga0496117_0016985_1327_2106 255
63 3300048924 Ga0496121_0275411 Ga0496121_0275411_225_1004 255
64 iso_pu_bacteria 2511231007 2511271864 255
65 iso_pu_bacteria 2511231012 2511300022 255
66 iso_pu_bacteria 2511231014 2511314512 255
67 iso_pu_bacteria 2511231015 2511322090 255
68 iso_pu_bacteria 2511231017 2511331904 255
69 iso_pu_bacteria 2511231020 2511347858 255
70 iso_pu_bacteria 2511231021 2511354151 255
71 iso_pu_bacteria 2513237165 2514044323 255
72 iso_pu_bacteria 2562617112 2563057941 255
73 iso_pu_bacteria 2711768613 2713473356 255
74 2162886007 SwRhRL2b_contig_3367114 SwRhRL2b_0645.00008410 256
75 3300005289 Ga0065704_10000463 Ga0065704_1000046313 256
76 3300005347 Ga0070668_100070225 Ga0070668_1000702252 256
77 3300005548 Ga0070665_100145303 Ga0070665_1001453032 256
78 3300009978 Ga0105148_100179 Ga0105148_1001798 256
79 3300009982 Ga0105147_100813 Ga0105147_1008133 256
80 3300009986 Ga0105033_102337 Ga0105033_1023371 256
81 3300025923 Ga0207681_10010863 Ga0207681_100108636 256
82 3300025972 Ga0207668_10037978 Ga0207668_100379784 256
83 3300028379 Ga0268266_10029449 Ga0268266_100294492 256
84 3300048911 Ga0496108_0006786 Ga0496108_0006786_1397_2176 256
85 3300048919 Ga0496116_0057344 Ga0496116_0057344_32_811 256
86 3300048924 Ga0496121_0001102 Ga0496121_0001102_25786_26565 256
87 3300048925 Ga0496122_0176940 Ga0496122_0176940_386_1165 256
88 3300048928 Ga0496125_0170879 Ga0496125_0170879_425_1204 256
89 3300048929 Ga0496126_0003207 Ga0496126_0003207_19011_19790 256
90 3300049663 Ga0501223_000006 Ga0501223_000006_129677_130456 256
91 3300049669 Ga0501235_006498 Ga0501235_006498_722_1501 256
92 3300049705 Ga0501225_0002153 Ga0501225_0002153_3483_4262 256
93 3300049705 Ga0501225_0002556 Ga0501225_0002556_1908_2687 256
94 2162886007 SwRhRL2b_contig_234738 SwRhRL2b_0427.00002420 257
95 3300005289 Ga0065704_10070166 Ga0065704_1007016685 257
96 3300009011 Ga0105251_10012765 Ga0105251_100127655 257
97 3300009036 Ga0105244_10000488 Ga0105244_1000048826 257
98 3300013308 Ga0157375_10000312 Ga0157375_100003128 257
99 3300025735 Ga0207713_1039960 Ga0207713_10399603 257
100 3300042009 Ga0439451_000134 Ga0439451_000134_1569_2345 257
101 3300049649 Ga0501198_001048 Ga0501198_001048_2725_3510 257
102 3300049669 Ga0501235_018040 Ga0501235_018040_400_1185 257
103 3300005577 Ga0068857_100005934 Ga0068857_10000593410 258
104 3300026116 Ga0207674_10010429 Ga0207674_1001042910 258
105 3300027876 Ga0209974_10087185 Ga0209974_100871852 258
106 3300044735 Ga0466968_0000001 Ga0466968_0000001_4349_5125 258
107 3300046522 Ga0495643_0000044 Ga0495643_0000044_132158_132937 258
108 3300046542 Ga0495597_0000216 Ga0495597_0000216_31376_32155 258
109 3300046694 Ga0495649_0052751 Ga0495649_0052751_1041_1820 258
110 3300046810 Ga0495660_0143329 Ga0495660_0143329_364_1143 258
111 3300048904 Ga0496101_0089742 Ga0496101_0089742_969_1763 258
112 3300048905 Ga0496102_0000178 Ga0496102_0000178_37578_38372 258
113 3300048906 Ga0496103_0000119 Ga0496103_0000119_68262_69056 258
114 3300048907 Ga0496104_0012927 Ga0496104_0012927_784_1578 258
115 3300048908 Ga0496105_0004516 Ga0496105_0004516_7343_8137 258
116 3300048913 Ga0496110_0058882 Ga0496110_0058882_1682_2476 258
117 3300048916 Ga0496113_0191952 Ga0496113_0191952_295_1089 258
118 3300048917 Ga0496114_0006234 Ga0496114_0006234_7752_8546 258
119 3300048918 Ga0496115_0000740 Ga0496115_0000740_6104_6898 258
120 3300048919 Ga0496116_0005447 Ga0496116_0005447_6680_7474 258
121 3300048920 Ga0496117_0000318 Ga0496117_0000318_66299_67093 258
122 3300048921 Ga0496118_0000186 Ga0496118_0000186_37589_38383 258
123 3300048922 Ga0496119_0005614 Ga0496119_0005614_10031_10825 258
124 3300048924 Ga0496121_0001167 Ga0496121_0001167_758_1552 258
125 3300048925 Ga0496122_0019002 Ga0496122_0019002_659_1453 258
126 3300048926 Ga0496123_0060689 Ga0496123_0060689_70_864 258
127 3300048927 Ga0496124_0000324 Ga0496124_0000324_17250_18044 258
128 3300048928 Ga0496125_0001890 Ga0496125_0001890_17270_18064 258
129 3300048929 Ga0496126_0001180 Ga0496126_0001180_17251_18045 258
130 iso_pu_bacteria 2643221563 2643833263 258
131 iso_pu_bacteria 2643221608 2644054190 258
132 3300003781 Ga0055536_1031927 Ga0055536_10319272 259
133 3300003791 Ga0055530_10010579 Ga0055530_100105792 259
134 3300005288 Ga0065714_10002650 Ga0065714_1000265012 259
135 3300006058 Ga0075432_10030469 Ga0075432_100304692 259
136 3300006177 Ga0075362_10040882 Ga0075362_100408822 259
137 3300009036 Ga0105244_10003086 Ga0105244_100030869 259
138 3300009036 Ga0105244_10034574 Ga0105244_100345741 259
139 3300009036 Ga0105244_10035384 Ga0105244_100353842 259
140 3300009545 Ga0105237_10040010 Ga0105237_100400104 259
141 3300013100 Ga0157373_10004285 Ga0157373_1000428511 259
142 3300013102 Ga0157371_10039682 Ga0157371_100396825 259
143 3300013104 Ga0157370_10004423 Ga0157370_1000442312 259
144 3300013306 Ga0163162_11255983 Ga0163162_112559831 259
145 3300015261 Ga0182006_1001200 Ga0182006_100120012 259
146 3300017792 Ga0163161_10038278 Ga0163161_100382782 259
147 3300025298 Ga0209050_1001181 Ga0209050_100118128 259
148 3300025303 Ga0209051_1001536 Ga0209051_10015365 259
149 3300025728 Ga0207655_1000571 Ga0207655_100057141 259
150 3300027312 Ga0209371_1000980 Ga0209371_10009807 259
151 3300027907 Ga0207428_10039735 Ga0207428_100397352 259
152 3300027907 Ga0207428_10047074 Ga0207428_100470745 259
153 3300028786 Ga0307517_10157810 Ga0307517_101578102 259
154 3300030500 Ga0268256_1004217 Ga0268256_10042177 259
155 3300032004 Ga0307414_10465899 Ga0307414_104658992 259
156 3300041997 Ga0439431_0000123 Ga0439431_0000123_1468_2247 259
157 3300042003 Ga0439443_011710 Ga0439443_011710_461_1240 259
158 3300042116 Ga0450912_000156 Ga0450912_000156_605_1384 259
159 3300042435 Ga0439434_0017935 Ga0439434_0017935_271_1050 259
160 3300042436 Ga0439435_0011285 Ga0439435_0011285_1322_2101 259
161 3300046452 Ga0495617_013157 Ga0495617_013157_1374_2156 259
162 3300046453 Ga0495627_009681 Ga0495627_009681_983_1765 259
163 3300046455 Ga0495603_0004141 Ga0495603_0004141_7807_8589 259
164 3300046457 Ga0495590_0010643 Ga0495590_0010643_1045_1827 259
165 3300046458 Ga0495591_000005 Ga0495591_000005_63438_64226 259
166 3300046459 Ga0495629_0143136 Ga0495629_0143136_814_1599 259
167 3300046460 Ga0495638_0011478 Ga0495638_0011478_1529_2311 259
168 3300046460 Ga0495638_0036433 Ga0495638_0036433_1728_2516 259
169 3300046460 Ga0495638_0054061 Ga0495638_0054061_586_1368 259
170 3300046463 Ga0495653_0001061 Ga0495653_0001061_14355_15140 259
171 3300046471 Ga0495650_0001536 Ga0495650_0001536_16585_17367 259
172 3300046474 Ga0495605_0082171 Ga0495605_0082171_566_1348 259
173 3300046477 Ga0495664_0002014 Ga0495664_0002014_1140_1925 259
174 3300046491 Ga0495584_0012791 Ga0495584_0012791_2150_2932 259
175 3300046492 Ga0495585_0000577 Ga0495585_0000577_12340_13122 259
176 3300046500 Ga0495596_0047251 Ga0495596_0047251_459_1241 259
177 3300046501 Ga0495607_0006485 Ga0495607_0006485_5367_6149 259
178 3300046501 Ga0495607_0052435 Ga0495607_0052435_61_843 259
179 3300046506 Ga0495583_0002568 Ga0495583_0002568_9614_10396 259
180 3300046507 Ga0495606_0000525 Ga0495606_0000525_4638_5426 259
181 3300046507 Ga0495606_0091208 Ga0495606_0091208_448_1230 259
182 3300046513 Ga0495616_0002361 Ga0495616_0002361_1170_1952 259
183 3300046513 Ga0495616_0022986 Ga0495616_0022986_831_1625 259
184 3300046516 Ga0495628_0032197 Ga0495628_0032197_2422_3207 259
185 3300046517 Ga0495630_0001092 Ga0495630_0001092_4654_5439 259
186 3300046518 Ga0495631_0000063 Ga0495631_0000063_14888_15682 259
187 3300046519 Ga0495632_0000058 Ga0495632_0000058_44904_45686 259
188 3300046519 Ga0495632_0019335 Ga0495632_0019335_95_883 259
189 3300046519 Ga0495632_0032441 Ga0495632_0032441_890_1678 259
190 3300046520 Ga0495637_0000315 Ga0495637_0000315_21725_22507 259
191 3300046522 Ga0495643_0000880 Ga0495643_0000880_9729_10511 259
192 3300046523 Ga0495644_0001098 Ga0495644_0001098_5902_6684 259
193 3300046524 Ga0495648_0000241 Ga0495648_0000241_4636_5424 259
194 3300046524 Ga0495648_0002312 Ga0495648_0002312_11325_12107 259
195 3300046525 Ga0495663_0000394 Ga0495663_0000394_7376_8170 259
196 3300046528 Ga0495642_0000003 Ga0495642_0000003_40311_41093 259
197 3300046529 Ga0495652_0121122 Ga0495652_0121122_12_797 259
198 3300046530 Ga0495654_0015638 Ga0495654_0015638_1785_2567 259
199 3300046530 Ga0495654_0030628 Ga0495654_0030628_1465_2253 259
200 3300046531 Ga0495665_0000088 Ga0495665_0000088_11117_11902 259
201 3300046535 Ga0495586_0111876 Ga0495586_0111876_37_822 259
202 3300046538 Ga0495609_0000490 Ga0495609_0000490_21322_22104 259
203 3300046542 Ga0495597_0008172 Ga0495597_0008172_2889_3671 259
204 3300046543 Ga0495645_0001816 Ga0495645_0001816_111_896 259
205 3300046557 Ga0495622_0003159 Ga0495622_0003159_2489_3271 259
206 3300046558 Ga0495633_0074262 Ga0495633_0074262_425_1219 259
207 3300046615 Ga0495656_0000104 Ga0495656_0000104_12999_13781 259
208 3300046663 Ga0495635_0007133 Ga0495635_0007133_4259_5044 259
209 3300046664 Ga0495659_0000116 Ga0495659_0000116_22415_23197 259
210 3300046665 Ga0495661_0033597 Ga0495661_0033597_1177_1959 259
211 3300046679 Ga0495623_0007903 Ga0495623_0007903_263_1048 259
212 3300046680 Ga0495646_0042176 Ga0495646_0042176_1769_2554 259
213 3300046684 Ga0495669_0000263 Ga0495669_0000263_9353_10135 259
214 3300046692 Ga0495671_0001868 Ga0495671_0001868_8937_9719 259
215 3300046692 Ga0495671_0016585 Ga0495671_0016585_2659_3447 259
216 3300046694 Ga0495649_0092547 Ga0495649_0092547_545_1327 259
217 3300046794 Ga0495589_0000549 Ga0495589_0000549_21520_22302 259
218 3300046810 Ga0495660_0000517 Ga0495660_0000517_21322_22104 259
219 3300047315 Ga0495581_0046960 Ga0495581_0046960_1041_1826 259
220 3300047319 Ga0495674_0004761 Ga0495674_0004761_9277_10062 259
221 3300047319 Ga0495674_0026330 Ga0495674_0026330_2206_3030 259
222 3300047320 Ga0495672_0000006 Ga0495672_0000006_479236_480030 259
223 3300047320 Ga0495672_0002680 Ga0495672_0002680_5620_6402 259
224 3300047322 Ga0495680_0001743 Ga0495680_0001743_7631_8416 259
225 3300047323 Ga0495683_0003035 Ga0495683_0003035_8567_9349 259
226 3300047444 Ga0495675_0097903 Ga0495675_0097903_234_1019 259
227 3300047445 Ga0495677_0000047 Ga0495677_0000047_20432_21214 259
228 3300047447 Ga0495685_013131 Ga0495685_013131_1996_2778 259
229 3300047469 Ga0495673_0000178 Ga0495673_0000178_44913_45701 259
230 3300047470 Ga0495681_0000026 Ga0495681_0000026_86893_87681 259
231 3300047470 Ga0495681_0025699 Ga0495681_0025699_251_1045 259
232 3300047673 Ga0495593_0000023 Ga0495593_0000023_35775_36560 259
233 3300048088 Ga0495602_0000395 Ga0495602_0000395_38759_39544 259
234 3300048091 Ga0495626_0000132 Ga0495626_0000132_36797_37585 259
235 3300048091 Ga0495626_0000522 Ga0495626_0000522_28100_28882 259
236 3300048091 Ga0495626_0001091 Ga0495626_0001091_12247_13047 259
237 3300048903 Ga0496100_0000468 Ga0496100_0000468_12163_12948 259
238 3300048904 Ga0496101_0000286 Ga0496101_0000286_23233_24018 259
239 3300048904 Ga0496101_0006180 Ga0496101_0006180_5000_5800 259
240 3300048905 Ga0496102_0000603 Ga0496102_0000603_28710_29495 259
241 3300048906 Ga0496103_0001250 Ga0496103_0001250_12807_13592 259
242 3300048907 Ga0496104_0113755 Ga0496104_0113755_457_1242 259
243 3300048908 Ga0496105_0004706 Ga0496105_0004706_1830_2615 259
244 3300048909 Ga0496106_0007807 Ga0496106_0007807_5607_6392 259
245 3300048912 Ga0496109_0038989 Ga0496109_0038989_2595_3395 259
246 3300048916 Ga0496113_0000915 Ga0496113_0000915_4873_5673 259
247 3300048919 Ga0496116_0032455 Ga0496116_0032455_1329_2111 259
248 3300048921 Ga0496118_0090878 Ga0496118_0090878_271_1056 259
249 3300048924 Ga0496121_0008424 Ga0496121_0008424_4506_5288 259
250 3300048925 Ga0496122_0000552 Ga0496122_0000552_22551_23351 259
251 3300048925 Ga0496122_0000662 Ga0496122_0000662_48507_49301 259
252 3300048925 Ga0496122_0000710 Ga0496122_0000710_55233_56030 259
253 3300048925 Ga0496122_0074283 Ga0496122_0074283_220_1002 259
254 3300048926 Ga0496123_0000104 Ga0496123_0000104_112194_112991 259
255 3300048926 Ga0496123_0000478 Ga0496123_0000478_48506_49300 259
256 3300048926 Ga0496123_0001031 Ga0496123_0001031_22558_23358 259
257 3300048926 Ga0496123_0012881 Ga0496123_0012881_3801_4583 259
258 3300048926 Ga0496123_0123807 Ga0496123_0123807_197_982 259
259 3300048927 Ga0496124_0000224 Ga0496124_0000224_4703_5485 259
260 3300048927 Ga0496124_0000569 Ga0496124_0000569_11245_12039 259
261 3300048928 Ga0496125_0002211 Ga0496125_0002211_22617_23417 259
262 3300048928 Ga0496125_0005275 Ga0496125_0005275_3335_4132 259
263 3300048928 Ga0496125_0026107 Ga0496125_0026107_2278_3063 259
264 3300048929 Ga0496126_0019383 Ga0496126_0019383_5536_6321 259
265 3300049459 Ga0495678_007230 Ga0495678_007230_4632_5420 259
266 3300049459 Ga0495678_030282 Ga0495678_030282_1403_2185 259
267 3300049460 Ga0495682_0000926 Ga0495682_0000926_9803_10585 259
268 3300050514 nmdc:mga08x19_67195_c1 nmdc:mga08x19_67195_c1_1030_1812 259
269 3300053734 Ga0500565_003122 Ga0500565_003122_21_815 259
270 iso_pu_bacteria 2791355137 2792837778 259
271 iso_pu_bacteria 2904615490 2904624919 259
272 iso_pu_bacteria 2987605356 2987608645 259
273 iso_pu_bacteria 8055266321 8055273453 259
274 2162886007 SwRhRL2b_contig_76937 SwRhRL2b_0437.00007960 260
275 3300001904 JGI24736J21556_1000161 JGI24736J21556_100016111 260
276 3300001904 JGI24736J21556_1013055 JGI24736J21556_10130552 260
277 3300001915 JGI24741J21665_1002198 JGI24741J21665_10021986 260
278 3300001979 JGI24740J21852_10033136 JGI24740J21852_100331361 260
279 3300001989 JGI24739J22299_10004558 JGI24739J22299_100045586 260
280 3300001989 JGI24739J22299_10030824 JGI24739J22299_100308243 260
281 3300001990 JGI24737J22298_10023167 JGI24737J22298_100231672 260
282 3300002067 JGI24735J21928_10003750 JGI24735J21928_100037507 260
283 3300002074 JGI24748J21848_1007295 JGI24748J21848_10072952 260
284 3300005289 Ga0065704_10003385 Ga0065704_100033854 260
285 3300005327 Ga0070658_10149743 Ga0070658_101497432 260
286 3300005329 Ga0070683_100169475 Ga0070683_1001694753 260
287 3300005331 Ga0070670_100005269 Ga0070670_1000052698 260
288 3300005331 Ga0070670_100053091 Ga0070670_1000530911 260
289 3300005331 Ga0070670_100363421 Ga0070670_1003634212 260
290 3300005337 Ga0070682_100094383 Ga0070682_1000943832 260
291 3300005347 Ga0070668_100042133 Ga0070668_1000421333 260
292 3300005353 Ga0070669_100000199 Ga0070669_10000019947 260
293 3300005355 Ga0070671_100002761 Ga0070671_10000276113 260
294 3300005355 Ga0070671_100121853 Ga0070671_1001218531 260
295 3300005365 Ga0070688_100066117 Ga0070688_1000661173 260
296 3300005366 Ga0070659_100020786 Ga0070659_1000207863 260
297 3300005366 Ga0070659_100160386 Ga0070659_1001603862 260
298 3300005367 Ga0070667_100003356 Ga0070667_1000033569 260
299 3300005367 Ga0070667_100039034 Ga0070667_1000390342 260
300 3300005455 Ga0070663_100029341 Ga0070663_1000293413 260
301 3300005455 Ga0070663_100156164 Ga0070663_1001561642 260
302 3300005455 Ga0070663_100202335 Ga0070663_1002023352 260
303 3300005466 Ga0070685_10045245 Ga0070685_100452452 260
304 3300005535 Ga0070684_100074586 Ga0070684_1000745863 260
305 3300005539 Ga0068853_100008832 Ga0068853_1000088324 260
306 3300005539 Ga0068853_100038004 Ga0068853_1000380042 260
307 3300005548 Ga0070665_100000163 Ga0070665_10000016342 260
308 3300005548 Ga0070665_100251466 Ga0070665_1002514662 260
309 3300005548 Ga0070665_100362972 Ga0070665_1003629723 260
310 3300005563 Ga0068855_100348154 Ga0068855_1003481542 260
311 3300005577 Ga0068857_100049217 Ga0068857_1000492174 260
312 3300005577 Ga0068857_100269789 Ga0068857_1002697893 260
313 3300005577 Ga0068857_100493465 Ga0068857_1004934651 260
314 3300005578 Ga0068854_100012184 Ga0068854_1000121844 260
315 3300005578 Ga0068854_100041136 Ga0068854_1000411363 260
316 3300005616 Ga0068852_100036670 Ga0068852_1000366702 260
317 3300005617 Ga0068859_100009146 Ga0068859_10000914610 260
318 3300005618 Ga0068864_100005874 Ga0068864_1000058746 260
319 3300005719 Ga0068861_100000013 Ga0068861_10000001349 260
320 3300005834 Ga0068851_10028451 Ga0068851_100284512 260
321 3300005834 Ga0068851_10032321 Ga0068851_100323212 260
322 3300005841 Ga0068863_100000079 Ga0068863_1000000797 260
323 3300005841 Ga0068863_100038322 Ga0068863_1000383223 260
324 3300005842 Ga0068858_100000006 Ga0068858_1000000065 260
325 3300005842 Ga0068858_100112884 Ga0068858_1001128843 260
326 3300005843 Ga0068860_100611340 Ga0068860_1006113401 260
327 3300005844 Ga0068862_100006576 Ga0068862_1000065763 260
328 3300005937 Ga0081455_10000277 Ga0081455_1000027725 260
329 3300006931 Ga0097620_100009146 Ga0097620_1000091464 260
330 3300009011 Ga0105251_10001177 Ga0105251_100011771 260
331 3300009093 Ga0105240_10014797 Ga0105240_1001479710 260
332 3300009101 Ga0105247_10017570 Ga0105247_100175703 260
333 3300009177 Ga0105248_10002260 Ga0105248_100022606 260
334 3300009177 Ga0105248_10002802 Ga0105248_1000280219 260
335 3300009177 Ga0105248_10002919 Ga0105248_100029196 260
336 3300009177 Ga0105248_10003077 Ga0105248_1000307715 260
337 3300009177 Ga0105248_10008862 Ga0105248_100088629 260
338 3300009177 Ga0105248_10017174 Ga0105248_100171748 260
339 3300009177 Ga0105248_10137617 Ga0105248_101376173 260
340 3300009545 Ga0105237_10009160 Ga0105237_1000916010 260
341 3300009545 Ga0105237_10262397 Ga0105237_102623972 260
342 3300009545 Ga0105237_10309150 Ga0105237_103091502 260
343 3300009551 Ga0105238_10016961 Ga0105238_100169614 260
344 3300009551 Ga0105238_10027708 Ga0105238_100277084 260
345 3300009551 Ga0105238_10918008 Ga0105238_109180081 260
346 3300010375 Ga0105239_10010007 Ga0105239_1001000710 260
347 3300013104 Ga0157370_10785970 Ga0157370_107859701 260
348 3300013306 Ga0163162_10273266 Ga0163162_102732662 260
349 3300013306 Ga0163162_10493256 Ga0163162_104932562 260
350 3300014325 Ga0163163_10099867 Ga0163163_100998673 260
351 3300014325 Ga0163163_10447421 Ga0163163_104474212 260
352 3300014326 Ga0157380_10000936 Ga0157380_1000093616 260
353 3300014968 Ga0157379_10053801 Ga0157379_100538013 260
354 3300014968 Ga0157379_10087961 Ga0157379_100879613 260
355 3300017792 Ga0163161_10001170 Ga0163161_1000117011 260
356 3300025321 Ga0207656_10034955 Ga0207656_100349552 260
357 3300025735 Ga0207713_1000436 Ga0207713_10004369 260
358 3300025904 Ga0207647_10074446 Ga0207647_100744462 260
359 3300025911 Ga0207654_10004961 Ga0207654_100049617 260
360 3300025913 Ga0207695_10009115 Ga0207695_1000911510 260
361 3300025913 Ga0207695_10016174 Ga0207695_100161746 260
362 3300025914 Ga0207671_10001485 Ga0207671_100014853 260
363 3300025914 Ga0207671_10002277 Ga0207671_1000227713 260
364 3300025919 Ga0207657_10100941 Ga0207657_101009413 260
365 3300025923 Ga0207681_10001570 Ga0207681_1000157013 260
366 3300025924 Ga0207694_10002056 Ga0207694_1000205610 260
367 3300025924 Ga0207694_10019165 Ga0207694_100191654 260
368 3300025924 Ga0207694_10045025 Ga0207694_100450254 260
369 3300025925 Ga0207650_10086423 Ga0207650_100864232 260
370 3300025925 Ga0207650_10498124 Ga0207650_104981241 260
371 3300025931 Ga0207644_10000234 Ga0207644_100002343 260
372 3300025931 Ga0207644_10144527 Ga0207644_101445272 260
373 3300025932 Ga0207690_10170283 Ga0207690_101702833 260
374 3300025933 Ga0207706_10112128 Ga0207706_101121282 260
375 3300025941 Ga0207711_10005039 Ga0207711_100050398 260
376 3300025941 Ga0207711_10007885 Ga0207711_100078854 260
377 3300025941 Ga0207711_10016940 Ga0207711_100169405 260
378 3300025941 Ga0207711_10034093 Ga0207711_100340935 260
379 3300025941 Ga0207711_10124686 Ga0207711_101246862 260
380 3300025944 Ga0207661_10637912 Ga0207661_106379121 260
381 3300025949 Ga0207667_10002662 Ga0207667_1000266216 260
382 3300025949 Ga0207667_10136214 Ga0207667_101362143 260
383 3300025961 Ga0207712_10104438 Ga0207712_101044382 260
384 3300025972 Ga0207668_10004884 Ga0207668_100048847 260
385 3300025981 Ga0207640_10031064 Ga0207640_100310644 260
386 3300025981 Ga0207640_10059208 Ga0207640_100592083 260
387 3300025981 Ga0207640_10136182 Ga0207640_101361822 260
388 3300025986 Ga0207658_10005349 Ga0207658_100053496 260
389 3300025986 Ga0207658_10008945 Ga0207658_100089452 260
390 3300026035 Ga0207703_10000469 Ga0207703_100004697 260
391 3300026035 Ga0207703_10458398 Ga0207703_104583982 260
392 3300026041 Ga0207639_10001943 Ga0207639_100019432 260
393 3300026041 Ga0207639_10013661 Ga0207639_100136613 260
394 3300026041 Ga0207639_10014722 Ga0207639_100147224 260
395 3300026041 Ga0207639_10173906 Ga0207639_101739061 260
396 3300026067 Ga0207678_10000276 Ga0207678_1000027643 260
397 3300026067 Ga0207678_10005102 Ga0207678_100051024 260
398 3300026078 Ga0207702_10001216 Ga0207702_100012166 260
399 3300026078 Ga0207702_10003524 Ga0207702_100035248 260
400 3300026088 Ga0207641_10000003 Ga0207641_10000003439 260
401 3300026088 Ga0207641_10003659 Ga0207641_1000365910 260
402 3300026088 Ga0207641_10296517 Ga0207641_102965171 260
403 3300026095 Ga0207676_10000734 Ga0207676_100007345 260
404 3300026095 Ga0207676_10115322 Ga0207676_101153223 260
405 3300026116 Ga0207674_10266029 Ga0207674_102660293 260
406 3300026118 Ga0207675_100000054 Ga0207675_10000005448 260
407 3300026142 Ga0207698_10142392 Ga0207698_101423922 260
408 3300026142 Ga0207698_10637334 Ga0207698_106373342 260
409 3300028379 Ga0268266_10000205 Ga0268266_1000020530 260
410 3300028379 Ga0268266_10297280 Ga0268266_102972803 260
411 3300028381 Ga0268264_10005055 Ga0268264_100050558 260
412 3300028381 Ga0268264_10571665 Ga0268264_105716651 260
413 3300031548 Ga0307408_100001178 Ga0307408_10000117814 260
414 3300031548 Ga0307408_100647280 Ga0307408_1006472802 260
415 3300031731 Ga0307405_10129104 Ga0307405_101291043 260
416 3300031731 Ga0307405_10227926 Ga0307405_102279261 260
417 3300031731 Ga0307405_10238426 Ga0307405_102384262 260
418 3300031824 Ga0307413_10087497 Ga0307413_100874972 260
419 3300031852 Ga0307410_10074421 Ga0307410_100744212 260
420 3300031901 Ga0307406_10006401 Ga0307406_100064012 260
421 3300031901 Ga0307406_10243400 Ga0307406_102434002 260
422 3300031911 Ga0307412_10141524 Ga0307412_101415242 260
423 3300031911 Ga0307412_10177197 Ga0307412_101771972 260
424 3300031911 Ga0307412_10213754 Ga0307412_102137542 260
425 3300031995 Ga0307409_100025575 Ga0307409_1000255753 260
426 3300031995 Ga0307409_100098091 Ga0307409_1000980913 260
427 3300032002 Ga0307416_100013740 Ga0307416_1000137406 260
428 3300032002 Ga0307416_100235887 Ga0307416_1002358872 260
429 3300032004 Ga0307414_10029153 Ga0307414_100291533 260
430 3300032004 Ga0307414_10147032 Ga0307414_101470322 260
431 3300032004 Ga0307414_10320861 Ga0307414_103208612 260
432 3300032005 Ga0307411_10010906 Ga0307411_100109066 260
433 3300032005 Ga0307411_10118785 Ga0307411_101187852 260
434 3300035113 Ga0373936_0000438 Ga0373936_0000438_11429_12235 260
435 3300047472 Ga0495686_0087546 Ga0495686_0087546_775_1560 260
436 3300048904 Ga0496101_0192409 Ga0496101_0192409_203_997 260
437 3300048905 Ga0496102_0014478 Ga0496102_0014478_2430_3224 260
438 3300048905 Ga0496102_0066791 Ga0496102_0066791_435_1232 260
439 3300048905 Ga0496102_0621632 Ga0496102_0621632_103_897 260
440 3300048906 Ga0496103_0025754 Ga0496103_0025754_2210_3004 260
441 3300048906 Ga0496103_0246627 Ga0496103_0246627_94_888 260
442 3300048912 Ga0496109_0168773 Ga0496109_0168773_1242_2036 260
443 3300048913 Ga0496110_0014851 Ga0496110_0014851_1705_2499 260
444 3300048913 Ga0496110_0044082 Ga0496110_0044082_528_1322 260
445 3300048913 Ga0496110_0200022 Ga0496110_0200022_395_1177 260
446 3300048916 Ga0496113_0057702 Ga0496113_0057702_1779_2573 260
447 3300048917 Ga0496114_0053749 Ga0496114_0053749_1509_2291 260
448 3300048918 Ga0496115_0352547 Ga0496115_0352547_55_837 260
449 3300048919 Ga0496116_0000078 Ga0496116_0000078_128460_129254 260
450 3300048919 Ga0496116_0027139 Ga0496116_0027139_2855_3652 260
451 3300048919 Ga0496116_0142241 Ga0496116_0142241_201_995 260
452 3300048920 Ga0496117_0011188 Ga0496117_0011188_2249_3046 260
453 3300048920 Ga0496117_0021007 Ga0496117_0021007_464_1258 260
454 3300048920 Ga0496117_0083145 Ga0496117_0083145_656_1450 260
455 3300048921 Ga0496118_0004578 Ga0496118_0004578_6320_7117 260
456 3300048921 Ga0496118_0009472 Ga0496118_0009472_531_1325 260
457 3300048921 Ga0496118_0075970 Ga0496118_0075970_1478_2272 260
458 3300048922 Ga0496119_0080647 Ga0496119_0080647_446_1243 260
459 3300048922 Ga0496119_0089794 Ga0496119_0089794_813_1607 260
460 3300048924 Ga0496121_0000058 Ga0496121_0000058_238602_239399 260
461 3300048924 Ga0496121_0000170 Ga0496121_0000170_5324_6118 260
462 3300048924 Ga0496121_0021736 Ga0496121_0021736_5304_6098 260
463 3300048924 Ga0496121_0022199 Ga0496121_0022199_10_804 260
464 3300048924 Ga0496121_0207385 Ga0496121_0207385_333_1127 260
465 3300048925 Ga0496122_0003669 Ga0496122_0003669_8868_9662 260
466 3300048925 Ga0496122_0026032 Ga0496122_0026032_3783_4577 260
467 3300048926 Ga0496123_0001607 Ga0496123_0001607_22010_22804 260
468 3300048926 Ga0496123_0002385 Ga0496123_0002385_9879_10673 260
469 3300048926 Ga0496123_0021639 Ga0496123_0021639_821_1615 260
470 3300048927 Ga0496124_0002768 Ga0496124_0002768_5557_6351 260
471 3300048927 Ga0496124_0011124 Ga0496124_0011124_6820_7614 260
472 3300048927 Ga0496124_0062282 Ga0496124_0062282_1778_2572 260
473 3300048927 Ga0496124_0111667 Ga0496124_0111667_645_1439 260
474 3300048928 Ga0496125_0008335 Ga0496125_0008335_959_1753 260
475 3300048928 Ga0496125_0120535 Ga0496125_0120535_800_1594 260
476 3300048928 Ga0496125_0120715 Ga0496125_0120715_581_1375 260
477 3300048928 Ga0496125_0252529 Ga0496125_0252529_39_833 260
478 3300048929 Ga0496126_0000058 Ga0496126_0000058_186198_186992 260
479 3300048929 Ga0496126_0002582 Ga0496126_0002582_6897_7679 260
480 3300048929 Ga0496126_0033848 Ga0496126_0033848_3555_4349 260
481 3300049663 Ga0501223_000024 Ga0501223_000024_29352_30155 260
482 3300049663 Ga0501223_000047 Ga0501223_000047_12987_13769 260
483 3300049664 Ga0501224_000001 Ga0501224_000001_52505_53308 260
484 3300049664 Ga0501224_000017 Ga0501224_000017_58250_59032 260
485 3300049668 Ga0501233_000034 Ga0501233_000034_4166_4948 260
486 3300049668 Ga0501233_001364 Ga0501233_001364_379_1182 260
487 3300049669 Ga0501235_000125 Ga0501235_000125_3067_3849 260
488 3300049705 Ga0501225_0000007 Ga0501225_0000007_58256_59038 260
489 3300049705 Ga0501225_0000095 Ga0501225_0000095_6534_7337 260
490 3300049707 Ga0501234_001781 Ga0501234_001781_1135_1917 260
491 3300049707 Ga0501234_002623 Ga0501234_002623_1247_2050 260
492 3300049853 Ga0501226_000029 Ga0501226_000029_52469_53272 260
493 3300049853 Ga0501226_000040 Ga0501226_000040_37827_38609 260
494 3300005335 Ga0070666_10064196 Ga0070666_100641962 261
495 3300005344 Ga0070661_100215689 Ga0070661_1002156891 261
496 3300005366 Ga0070659_100375517 Ga0070659_1003755172 261
497 3300005367 Ga0070667_100001345 Ga0070667_1000013458 261
498 3300005455 Ga0070663_100008467 Ga0070663_1000084675 261
499 3300005458 Ga0070681_10316084 Ga0070681_103160842 261
500 3300005539 Ga0068853_100081608 Ga0068853_1000816082 261
501 3300005548 Ga0070665_100024754 Ga0070665_1000247544 261
502 3300005548 Ga0070665_100348447 Ga0070665_1003484472 261
503 3300005563 Ga0068855_100011385 Ga0068855_1000113856 261
504 3300005563 Ga0068855_100016407 Ga0068855_1000164075 261
505 3300005564 Ga0070664_100356643 Ga0070664_1003566432 261
506 3300005614 Ga0068856_100011037 Ga0068856_1000110373 261
507 3300005614 Ga0068856_100177892 Ga0068856_1001778921 261
508 3300005614 Ga0068856_100390290 Ga0068856_1003902902 261
509 3300005616 Ga0068852_100078619 Ga0068852_1000786193 261
510 3300005834 Ga0068851_10157338 Ga0068851_101573382 261
511 3300005841 Ga0068863_100000024 Ga0068863_10000002479 261
512 3300005842 Ga0068858_100097047 Ga0068858_1000970472 261
513 3300005843 Ga0068860_100000098 Ga0068860_10000009899 261
514 3300009093 Ga0105240_10037122 Ga0105240_100371222 261
515 3300009093 Ga0105240_10079295 Ga0105240_100792952 261
516 3300009093 Ga0105240_10109613 Ga0105240_101096134 261
517 3300009093 Ga0105240_10203406 Ga0105240_102034064 261
518 3300009174 Ga0105241_10007498 Ga0105241_100074984 261
519 3300009174 Ga0105241_10202614 Ga0105241_102026142 261
520 3300009174 Ga0105241_10353425 Ga0105241_103534252 261
521 3300009177 Ga0105248_10180479 Ga0105248_101804793 261
522 3300009545 Ga0105237_10025497 Ga0105237_100254975 261
523 3300009545 Ga0105237_10084753 Ga0105237_100847533 261
524 3300009545 Ga0105237_10292846 Ga0105237_102928462 261
525 3300009551 Ga0105238_10005688 Ga0105238_100056888 261
526 3300009551 Ga0105238_10008626 Ga0105238_100086267 261
527 3300009551 Ga0105238_10060233 Ga0105238_100602331 261
528 3300009551 Ga0105238_10087228 Ga0105238_100872282 261
529 3300010375 Ga0105239_10015872 Ga0105239_100158725 261
530 3300010375 Ga0105239_10056693 Ga0105239_100566933 261
531 3300010375 Ga0105239_10417373 Ga0105239_104173732 261
532 3300010375 Ga0105239_10461497 Ga0105239_104614971 261
533 3300011119 Ga0105246_10089413 Ga0105246_100894133 261
534 3300013306 Ga0163162_10214455 Ga0163162_102144552 261
535 3300013307 Ga0157372_10052895 Ga0157372_100528953 261
536 3300025903 Ga0207680_10002242 Ga0207680_100022428 261
537 3300025904 Ga0207647_10115034 Ga0207647_101150342 261
538 3300025911 Ga0207654_10039677 Ga0207654_100396772 261
539 3300025911 Ga0207654_10170642 Ga0207654_101706421 261
540 3300025911 Ga0207654_10242639 Ga0207654_102426391 261
541 3300025913 Ga0207695_10065563 Ga0207695_100655633 261
542 3300025913 Ga0207695_10117194 Ga0207695_101171942 261
543 3300025914 Ga0207671_10119332 Ga0207671_101193322 261
544 3300025924 Ga0207694_10001925 Ga0207694_100019258 261
545 3300025924 Ga0207694_10006101 Ga0207694_100061013 261
546 3300025924 Ga0207694_10008471 Ga0207694_100084714 261
547 3300025933 Ga0207706_10050916 Ga0207706_100509163 261
548 3300025949 Ga0207667_10014538 Ga0207667_100145387 261
549 3300025949 Ga0207667_10141566 Ga0207667_101415661 261
550 3300025949 Ga0207667_10554020 Ga0207667_105540202 261
551 3300025981 Ga0207640_10072879 Ga0207640_100728793 261
552 3300025986 Ga0207658_10002472 Ga0207658_100024724 261
553 3300026041 Ga0207639_10011557 Ga0207639_100115574 261
554 3300026067 Ga0207678_10004048 Ga0207678_100040484 261
555 3300026067 Ga0207678_10316616 Ga0207678_103166162 261
556 3300026078 Ga0207702_10188092 Ga0207702_101880922 261
557 3300026078 Ga0207702_10321642 Ga0207702_103216422 261
558 3300026078 Ga0207702_10414926 Ga0207702_104149262 261
559 3300026088 Ga0207641_10000068 Ga0207641_1000006897 261
560 3300026116 Ga0207674_10441260 Ga0207674_104412602 261
561 3300026142 Ga0207698_10048340 Ga0207698_100483402 261
562 3300028379 Ga0268266_10058915 Ga0268266_100589152 261
563 3300028381 Ga0268264_10000129 Ga0268264_10000129115 261
564 3300048923 Ga0496120_0081402 Ga0496120_0081402_449_1252 261
565 3300048926 Ga0496123_0006685 Ga0496123_0006685_7143_7946 261
566 3300048927 Ga0496124_0021301 Ga0496124_0021301_1018_1821 261
567 3300053140 Ga0500573_0000027 Ga0500573_0000027_84156_84953 261
568 3300053146 Ga0500588_0007022 Ga0500588_0007022_1731_2558 261
569 3300001915 JGI24741J21665_1000082 JGI24741J21665_100008220 262
570 3300001979 JGI24740J21852_10000126 JGI24740J21852_1000012620 262
571 3300001990 JGI24737J22298_10000176 JGI24737J22298_1000017614 262
572 3300003781 Ga0055536_1000120 Ga0055536_100012063 262
573 3300003791 Ga0055530_10014624 Ga0055530_100146241 262
574 3300005289 Ga0065704_10224241 Ga0065704_102242412 262
575 3300005295 Ga0065707_10003099 Ga0065707_100030993 262
576 3300005295 Ga0065707_10095962 Ga0065707_100959623 262
577 3300005329 Ga0070683_100467629 Ga0070683_1004676292 262
578 3300005339 Ga0070660_100001742 Ga0070660_10000174214 262
579 3300005343 Ga0070687_100069539 Ga0070687_1000695392 262
580 3300005344 Ga0070661_100002644 Ga0070661_1000026444 262
581 3300005366 Ga0070659_100003240 Ga0070659_1000032402 262
582 3300005455 Ga0070663_100073807 Ga0070663_1000738072 262
583 3300005535 Ga0070684_100109217 Ga0070684_1001092173 262
584 3300005548 Ga0070665_100204500 Ga0070665_1002045003 262
585 3300005564 Ga0070664_100004548 Ga0070664_1000045484 262
586 3300005614 Ga0068856_100015994 Ga0068856_1000159947 262
587 3300005617 Ga0068859_100097393 Ga0068859_1000973933 262
588 3300005617 Ga0068859_100250659 Ga0068859_1002506591 262
589 3300005618 Ga0068864_100002937 Ga0068864_1000029372 262
590 3300005719 Ga0068861_100226479 Ga0068861_1002264792 262
591 3300005834 Ga0068851_10013675 Ga0068851_100136754 262
592 3300005842 Ga0068858_100003036 Ga0068858_1000030364 262
593 3300005842 Ga0068858_100138053 Ga0068858_1001380532 262
594 3300005842 Ga0068858_100788209 Ga0068858_1007882092 262
595 3300005843 Ga0068860_100000474 Ga0068860_10000047431 262
596 3300005844 Ga0068862_100000023 Ga0068862_100000023191 262
597 3300006931 Ga0097620_100097392 Ga0097620_1000973923 262
598 3300006931 Ga0097620_100250650 Ga0097620_1002506501 262
599 3300009101 Ga0105247_10002120 Ga0105247_100021202 262
600 3300009174 Ga0105241_10000704 Ga0105241_1000070416 262
601 3300009177 Ga0105248_10011502 Ga0105248_100115028 262
602 3300009551 Ga0105238_10013591 Ga0105238_100135914 262
603 3300009553 Ga0105249_10000004 Ga0105249_10000004180 262
604 3300009553 Ga0105249_10056451 Ga0105249_100564513 262
605 3300013100 Ga0157373_10012975 Ga0157373_100129753 262
606 3300013102 Ga0157371_10000029 Ga0157371_10000029135 262
607 3300013105 Ga0157369_10049270 Ga0157369_100492703 262
608 3300013306 Ga0163162_10000633 Ga0163162_1000063323 262
609 3300013306 Ga0163162_10038483 Ga0163162_100384835 262
610 3300013307 Ga0157372_10006052 Ga0157372_1000605212 262
611 3300014326 Ga0157380_10219889 Ga0157380_102198892 262
612 3300025292 Ga0209676_1000081 Ga0209676_100008181 262
613 3300025298 Ga0209050_1000232 Ga0209050_100023285 262
614 3300025298 Ga0209050_1023665 Ga0209050_10236652 262
615 3300025315 Ga0207697_10003449 Ga0207697_100034494 262
616 3300025321 Ga0207656_10001249 Ga0207656_100012494 262
617 3300025900 Ga0207710_10009416 Ga0207710_100094164 262
618 3300025904 Ga0207647_10001278 Ga0207647_100012782 262
619 3300025909 Ga0207705_10000106 Ga0207705_100001065 262
620 3300025911 Ga0207654_10000173 Ga0207654_1000017318 262
621 3300025913 Ga0207695_10002538 Ga0207695_1000253818 262
622 3300025914 Ga0207671_10002027 Ga0207671_1000202714 262
623 3300025919 Ga0207657_10000149 Ga0207657_1000014921 262
624 3300025920 Ga0207649_10004039 Ga0207649_100040393 262
625 3300025924 Ga0207694_10002735 Ga0207694_100027358 262
626 3300025932 Ga0207690_10000251 Ga0207690_1000025120 262
627 3300025941 Ga0207711_10014790 Ga0207711_100147905 262
628 3300025945 Ga0207679_10180228 Ga0207679_101802283 262
629 3300025949 Ga0207667_10000002 Ga0207667_10000002782 262
630 3300025961 Ga0207712_10000008 Ga0207712_10000008311 262
631 3300025961 Ga0207712_10086030 Ga0207712_100860302 262
632 3300025981 Ga0207640_10000613 Ga0207640_100006138 262
633 3300026035 Ga0207703_10002260 Ga0207703_100022604 262
634 3300026035 Ga0207703_10214484 Ga0207703_102144842 262
635 3300026041 Ga0207639_10004307 Ga0207639_100043076 262
636 3300026067 Ga0207678_10000177 Ga0207678_1000017723 262
637 3300026078 Ga0207702_10000241 Ga0207702_1000024134 262
638 3300026095 Ga0207676_10000509 Ga0207676_1000050916 262
639 3300026116 Ga0207674_10001960 Ga0207674_100019609 262
640 3300026142 Ga0207698_10000949 Ga0207698_1000094910 262
641 3300028379 Ga0268266_10105295 Ga0268266_101052952 262
642 3300028380 Ga0268265_10000035 Ga0268265_10000035185 262
643 3300028381 Ga0268264_10001169 Ga0268264_1000116926 262
644 3300031901 Ga0307406_10058252 Ga0307406_100582522 262
645 3300048906 Ga0496103_0257765 Ga0496103_0257765_222_1010 262
646 3300048929 Ga0496126_0091991 Ga0496126_0091991_659_1447 262
647 3300005327 Ga0070658_10000244 Ga0070658_1000024419 264
648 3300005440 Ga0070705_100550181 Ga0070705_1005501811 264
649 3300005539 Ga0068853_100244916 Ga0068853_1002449162 264
650 3300005544 Ga0070686_100329709 Ga0070686_1003297092 264
651 3300005563 Ga0068855_100052765 Ga0068855_1000527655 264
652 3300005577 Ga0068857_100147254 Ga0068857_1001472542 264
653 3300005578 Ga0068854_100001069 Ga0068854_10000106916 264
654 3300005578 Ga0068854_100003617 Ga0068854_1000036173 264
655 3300005578 Ga0068854_100130866 Ga0068854_1001308662 264
656 3300005614 Ga0068856_100063707 Ga0068856_1000637075 264
657 3300005616 Ga0068852_100000492 Ga0068852_1000004927 264
658 3300005618 Ga0068864_100333187 Ga0068864_1003331872 264
659 3300009093 Ga0105240_10003238 Ga0105240_1000323819 264
660 3300009551 Ga0105238_10037121 Ga0105238_100371212 264
661 3300010375 Ga0105239_10291710 Ga0105239_102917102 264
662 3300013306 Ga0163162_10624754 Ga0163162_106247542 264
663 3300025904 Ga0207647_10011211 Ga0207647_100112114 264
664 3300025909 Ga0207705_10000224 Ga0207705_1000022436 264
665 3300025913 Ga0207695_10007969 Ga0207695_100079697 264
666 3300025924 Ga0207694_10169686 Ga0207694_101696862 264
667 3300025949 Ga0207667_10484806 Ga0207667_104848062 264
668 3300025981 Ga0207640_10024845 Ga0207640_100248455 264
669 3300025981 Ga0207640_10035460 Ga0207640_100354603 264
670 3300025981 Ga0207640_10376639 Ga0207640_103766392 264
671 3300026078 Ga0207702_10015310 Ga0207702_100153105 264
672 3300026116 Ga0207674_10156226 Ga0207674_101562262 264
673 3300026142 Ga0207698_10000005 Ga0207698_1000000590 264
674 3300028381 Ga0268264_10056928 Ga0268264_100569282 264
675 3300031548 Ga0307408_100158820 Ga0307408_1001588203 264
676 3300031731 Ga0307405_10033799 Ga0307405_100337994 264
677 3300031731 Ga0307405_10060618 Ga0307405_100606181 264
678 3300031901 Ga0307406_10065683 Ga0307406_100656832 264
679 3300031911 Ga0307412_10090368 Ga0307412_100903682 264
680 3300032002 Ga0307416_100176590 Ga0307416_1001765902 264
681 3300048904 Ga0496101_0245428 Ga0496101_0245428_242_1045 264
682 3300048909 Ga0496106_0034381 Ga0496106_0034381_2672_3475 264
683 3300048910 Ga0496107_0000555 Ga0496107_0000555_733_1536 264
684 3300048915 Ga0496112_0141116 Ga0496112_0141116_1219_2022 264
685 3300048916 Ga0496113_0002781 Ga0496113_0002781_1315_2118 264
686 3300048929 Ga0496126_0179666 Ga0496126_0179666_445_1239 264
687 2162886007 SwRhRL2b_contig_1602716 SwRhRL2b_0414.00006070 265
688 3300005289 Ga0065704_10000342 Ga0065704_1000034226 265
689 3300005331 Ga0070670_100299913 Ga0070670_1002999132 265
690 3300005335 Ga0070666_10004316 Ga0070666_100043162 265
691 3300005335 Ga0070666_10056125 Ga0070666_100561253 265
692 3300005347 Ga0070668_100001230 Ga0070668_10000123010 265
693 3300005353 Ga0070669_100000674 Ga0070669_10000067414 265
694 3300005355 Ga0070671_100000634 Ga0070671_10000063416 265
695 3300005355 Ga0070671_100002071 Ga0070671_10000207112 265
696 3300005367 Ga0070667_100000347 Ga0070667_1000003473 265
697 3300005367 Ga0070667_100326908 Ga0070667_1003269082 265
698 3300005548 Ga0070665_100007778 Ga0070665_10000777811 265
699 3300005548 Ga0070665_100054634 Ga0070665_1000546342 265
700 3300005617 Ga0068859_100430406 Ga0068859_1004304061 265
701 3300005842 Ga0068858_100011879 Ga0068858_1000118792 265
702 3300005842 Ga0068858_100066230 Ga0068858_1000662304 265
703 3300005843 Ga0068860_100057541 Ga0068860_1000575414 265
704 3300005843 Ga0068860_100640469 Ga0068860_1006404692 265
705 3300006931 Ga0097620_100430406 Ga0097620_1004304061 265
706 3300009092 Ga0105250_10008439 Ga0105250_100084392 265
707 3300009101 Ga0105247_10174597 Ga0105247_101745972 265
708 3300009177 Ga0105248_10011013 Ga0105248_100110138 265
709 3300009177 Ga0105248_10829245 Ga0105248_108292451 265
710 3300009553 Ga0105249_10168871 Ga0105249_101688713 265
711 3300013306 Ga0163162_10012162 Ga0163162_100121626 265
712 3300025315 Ga0207697_10010459 Ga0207697_100104594 265
713 3300025711 Ga0207696_1001980 Ga0207696_10019807 265
714 3300025735 Ga0207713_1009681 Ga0207713_10096815 265
715 3300025903 Ga0207680_10013013 Ga0207680_100130133 265
716 3300025903 Ga0207680_10292717 Ga0207680_102927171 265
717 3300025923 Ga0207681_10000081 Ga0207681_1000008130 265
718 3300025923 Ga0207681_10000255 Ga0207681_100002557 265
719 3300025931 Ga0207644_10000542 Ga0207644_1000054215 265
720 3300025931 Ga0207644_10010778 Ga0207644_100107782 265
721 3300025972 Ga0207668_10000742 Ga0207668_1000074210 265
722 3300025986 Ga0207658_10000490 Ga0207658_1000049033 265
723 3300026035 Ga0207703_10037520 Ga0207703_100375204 265
724 3300026035 Ga0207703_10148084 Ga0207703_101480843 265
725 3300028379 Ga0268266_10001759 Ga0268266_1000175915 265
726 3300028379 Ga0268266_10083257 Ga0268266_100832572 265
727 3300028381 Ga0268264_10010312 Ga0268264_100103129 265
728 3300028381 Ga0268264_10051721 Ga0268264_100517213 265
729 3300048903 Ga0496100_0104443 Ga0496100_0104443_238_1053 265
730 3300048904 Ga0496101_0063056 Ga0496101_0063056_267_1082 265
731 3300048905 Ga0496102_0000149 Ga0496102_0000149_70623_71438 265
732 3300048905 Ga0496102_0440626 Ga0496102_0440626_202_1020 265
733 3300048906 Ga0496103_0000049 Ga0496103_0000049_131381_132196 265
734 3300048907 Ga0496104_0002042 Ga0496104_0002042_1943_2740 265
735 3300048908 Ga0496105_0000384 Ga0496105_0000384_25395_26192 265
736 3300048910 Ga0496107_0377322 Ga0496107_0377322_65_883 265
737 3300048915 Ga0496112_0126968 Ga0496112_0126968_387_1202 265
738 3300048916 Ga0496113_0001856 Ga0496113_0001856_9765_10562 265
739 3300048920 Ga0496117_0000123 Ga0496117_0000123_127836_128651 265
740 3300048921 Ga0496118_0013949 Ga0496118_0013949_6651_7448 265
741 3300048922 Ga0496119_0000090 Ga0496119_0000090_1943_2740 265
742 3300048923 Ga0496120_0000690 Ga0496120_0000690_2293_3090 265
743 3300048925 Ga0496122_0004341 Ga0496122_0004341_15305_16120 265
744 3300048926 Ga0496123_0002034 Ga0496123_0002034_15305_16120 265
745 3300048927 Ga0496124_0003427 Ga0496124_0003427_6608_7405 265
746 3300048928 Ga0496125_0008036 Ga0496125_0008036_1624_2421 265
747 3300048929 Ga0496126_0000045 Ga0496126_0000045_198856_199653 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

104

302

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eb5-assembly1.cif.gz_E-2 crystal structure of hpcg complexed with oxalate 0.9477 5 265
2eb5-assembly1.cif.gz_A crystal structure of hpcg complexed with oxalate 0.9461 5 265
5d2i-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate 0.9459 4 265
2eb4-assembly1.cif.gz_D-2 crystal structure of apo-hpcg 0.944 5 265
2eb4-assembly1.cif.gz_A-2 crystal structure of apo-hpcg 0.9437 5 265
ID Description Score Start End Superfamily
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9649 5 264 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9468 5 264 3.90.850.10
2wqtB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9465 1 264 3.90.850.10
2eb4C00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9395 5 265 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9368 5 265 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2G2JPF4-F1-model_v4 deleted 0.9829 122 265
AF-A0A7R9AH48-F1-model_v4 Pyruvate carboxyltransferase domain-containing protein 0.9807 7 250 GO:0005737
GO:0008684
GO:0008701
GO:0008774
GO:0009056
GO:0051287
AF-A0A830G881-F1-model_v4 2-keto-4-pentenoate hydratase 0.9761 5 264 GO:0005737
GO:0008684
AF-A0A2G2JPF4-F1-model_v4 deleted 0.976 122 265
AF-A0A5D3I3R9-F1-model_v4 deleted 0.9752 106 265

Feature Viewer

pLDDT pTM Quality
92.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map