F478915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 276 | 730 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300025904|Ga0207647_10074446|Ga0207647_100744462 |
| Length | 302 |
| Sequence | VIGRLVIMGSGETAPTMVEVHRATLRAAGEGPSLLLDTPYGFQENADDITAKAVAYFGRNVGRTVAPLRLRHPQLGVDEAYAISLGLLARRVADGERVIGKKIGVTSKAVQDMLGVHQPDFGFLTDRMWIRGDIDVARAGLIQPRAEAEIAFLLREPLQGPGVTAQQVIAATAAIAPCFEIVDSRIADWNIGIVDTVADNASCGVFVLGDTCVSPQGVDLPNLQVTVSKNGRPLSEGLGSAVQGSPAAAVAWLANTLGAYGVALEADDVILSGSLVPLEPAAAGDVFEMTLHGVGGCAARFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 3 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 4 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 5 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 6 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 7 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 8 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 9 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 10 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 11 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 12 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 13 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 14 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 15 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 16 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 17 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 28 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 29 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 88 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 89 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 166 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 167 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 168 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 169 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 170 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 171 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 172 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 274 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 275 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 276 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.72 |
| Metatranscriptomes | 0 |
| Isolates | 2.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 1.2 |
| Rhizoplane | 7.23 |
| Rhizosphere | 77.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1602716 | 2162886007 | Bacteria | 20166 |
| 2 | SwRhRL2b_contig_234738 | 2162886007 | Bacteria | 74037 |
| 3 | SwRhRL2b_contig_3367114 | 2162886007 | Bacteria | 9630 |
| 4 | SwRhRL2b_contig_76937 | 2162886007 | Bacteria | 1808 |
| 5 | JGI24736J21556_1000161 | 3300001904 | Bacteria | 11892 |
| 6 | JGI24736J21556_1013055 | 3300001904 | Bacteria | 1342 |
| 7 | JGI24741J21665_1000082 | 3300001915 | Bacteria | 23787 |
| 8 | JGI24741J21665_1002198 | 3300001915 | Bacteria | 5178 |
| 9 | JGI24752J21851_1000313 | 3300001976 | Bacteria | 6784 |
| 10 | JGI24740J21852_10000126 | 3300001979 | Bacteria | 28776 |
| 11 | JGI24740J21852_10033136 | 3300001979 | Bacteria | 1644 |
| 12 | JGI24739J22299_10004558 | 3300001989 | Bacteria | 5299 |
| 13 | JGI24739J22299_10030824 | 3300001989 | Bacteria | 1857 |
| 14 | JGI24737J22298_10000176 | 3300001990 | Bacteria | 20591 |
| 15 | JGI24737J22298_10023167 | 3300001990 | Bacteria | 1970 |
| 16 | JGI24735J21928_10003750 | 3300002067 | Bacteria | 5152 |
| 17 | JGI24750J21931_1000170 | 3300002070 | Bacteria | 10863 |
| 18 | JGI24748J21848_1000065 | 3300002074 | Bacteria | 40176 |
| 19 | JGI24748J21848_1007295 | 3300002074 | Bacteria | 1295 |
| 20 | JGI24749J21850_1001625 | 3300002076 | Bacteria | 3188 |
| 21 | JGI24034J26672_10000008 | 3300002239 | Bacteria | 200986 |
| 22 | JGI24742J22300_10004545 | 3300002244 | Bacteria | 2276 |
| 23 | Ga0055536_1000120 | 3300003781 | Bacteria | 68066 |
| 24 | Ga0055536_1031927 | 3300003781 | Bacteria | 1370 |
| 25 | Ga0055530_10010579 | 3300003791 | Bacteria | 3393 |
| 26 | Ga0055530_10014624 | 3300003791 | Bacteria | 2603 |
| 27 | Ga0065714_10002650 | 3300005288 | Bacteria | 12611 |
| 28 | Ga0065704_10000342 | 3300005289 | Bacteria | 36460 |
| 29 | Ga0065704_10000463 | 3300005289 | Bacteria | 20938 |
| 30 | Ga0065704_10003385 | 3300005289 | Bacteria | 7128 |
| 31 | Ga0065704_10070166 | 3300005289 | Bacteria | 176609 |
| 32 | Ga0065704_10224241 | 3300005289 | Bacteria | 1064 |
| 33 | Ga0065707_10003099 | 3300005295 | Bacteria | 4721 |
| 34 | Ga0065707_10095962 | 3300005295 | Bacteria | 3319 |
| 35 | Ga0070658_10000244 | 3300005327 | Bacteria | 48413 |
| 36 | Ga0070658_10149743 | 3300005327 | Bacteria | 1953 |
| 37 | Ga0070683_100169475 | 3300005329 | Bacteria | 2072 |
| 38 | Ga0070683_100467629 | 3300005329 | Bacteria | 1204 |
| 39 | Ga0070690_100000006 | 3300005330 | Bacteria | 132992 |
| 40 | Ga0070670_100005200 | 3300005331 | Bacteria | 10951 |
| 41 | Ga0070670_100005269 | 3300005331 | Bacteria | 10893 |
| 42 | Ga0070670_100053091 | 3300005331 | Bacteria | 3480 |
| 43 | Ga0070670_100299913 | 3300005331 | Bacteria | 1405 |
| 44 | Ga0070670_100363421 | 3300005331 | Bacteria | 1273 |
| 45 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 46 | Ga0070666_10004316 | 3300005335 | Bacteria | 8650 |
| 47 | Ga0070666_10056125 | 3300005335 | Bacteria | 2659 |
| 48 | Ga0070666_10064196 | 3300005335 | Bacteria | 2490 |
| 49 | Ga0070682_100094383 | 3300005337 | Bacteria | 1962 |
| 50 | Ga0070660_100001742 | 3300005339 | Bacteria | 14916 |
| 51 | Ga0070689_100196365 | 3300005340 | Bacteria | 1645 |
| 52 | Ga0070687_100069539 | 3300005343 | Bacteria | 1886 |
| 53 | Ga0070687_100154840 | 3300005343 | Bacteria | 1349 |
| 54 | Ga0070661_100002644 | 3300005344 | Bacteria | 12258 |
| 55 | Ga0070661_100215689 | 3300005344 | Bacteria | 1470 |
| 56 | Ga0070668_100001230 | 3300005347 | Bacteria | 18229 |
| 57 | Ga0070668_100042133 | 3300005347 | Bacteria | 3499 |
| 58 | Ga0070668_100070225 | 3300005347 | Bacteria | 2726 |
| 59 | Ga0070669_100000199 | 3300005353 | Bacteria | 52239 |
| 60 | Ga0070669_100000215 | 3300005353 | Bacteria | 47944 |
| 61 | Ga0070669_100000674 | 3300005353 | Bacteria | 25070 |
| 62 | Ga0070671_100000634 | 3300005355 | Bacteria | 25107 |
| 63 | Ga0070671_100002071 | 3300005355 | Bacteria | 15457 |
| 64 | Ga0070671_100002761 | 3300005355 | Bacteria | 13632 |
| 65 | Ga0070671_100121853 | 3300005355 | Bacteria | 2195 |
| 66 | Ga0070688_100000836 | 3300005365 | Bacteria | 15254 |
| 67 | Ga0070688_100066117 | 3300005365 | Bacteria | 2300 |
| 68 | Ga0070659_100003240 | 3300005366 | Bacteria | 11584 |
| 69 | Ga0070659_100020786 | 3300005366 | Bacteria | 4991 |
| 70 | Ga0070659_100160386 | 3300005366 | Bacteria | 1838 |
| 71 | Ga0070659_100375517 | 3300005366 | Bacteria | 1197 |
| 72 | Ga0070667_100000347 | 3300005367 | Bacteria | 51490 |
| 73 | Ga0070667_100001345 | 3300005367 | Bacteria | 22035 |
| 74 | Ga0070667_100003356 | 3300005367 | Bacteria | 13671 |
| 75 | Ga0070667_100039034 | 3300005367 | Bacteria | 3979 |
| 76 | Ga0070667_100326908 | 3300005367 | Bacteria | 1384 |
| 77 | Ga0070667_100881708 | 3300005367 | Bacteria | 832 |
| 78 | Ga0070705_100550181 | 3300005440 | Bacteria | 885 |
| 79 | Ga0070663_100008467 | 3300005455 | Bacteria | 6327 |
| 80 | Ga0070663_100029341 | 3300005455 | Bacteria | 3758 |
| 81 | Ga0070663_100073807 | 3300005455 | Bacteria | 2489 |
| 82 | Ga0070663_100156164 | 3300005455 | Bacteria | 1753 |
| 83 | Ga0070663_100202335 | 3300005455 | Bacteria | 1550 |
| 84 | Ga0070681_10316084 | 3300005458 | Bacteria | 1471 |
| 85 | Ga0070685_10000202 | 3300005466 | Bacteria | 40025 |
| 86 | Ga0070685_10045245 | 3300005466 | Bacteria | 2523 |
| 87 | Ga0070684_100074586 | 3300005535 | Bacteria | 2990 |
| 88 | Ga0070684_100109217 | 3300005535 | Bacteria | 2479 |
| 89 | Ga0068853_100008832 | 3300005539 | Bacteria | 8106 |
| 90 | Ga0068853_100038004 | 3300005539 | Bacteria | 4099 |
| 91 | Ga0068853_100081608 | 3300005539 | Bacteria | 2831 |
| 92 | Ga0068853_100244916 | 3300005539 | Bacteria | 1644 |
| 93 | Ga0070686_100000012 | 3300005544 | Bacteria | 176038 |
| 94 | Ga0070686_100329709 | 3300005544 | Bacteria | 1141 |
| 95 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 96 | Ga0070665_100000163 | 3300005548 | Bacteria | 121320 |
| 97 | Ga0070665_100007778 | 3300005548 | Bacteria | 10889 |
| 98 | Ga0070665_100024754 | 3300005548 | Bacteria | 6048 |
| 99 | Ga0070665_100054634 | 3300005548 | Bacteria | 4005 |
| 100 | Ga0070665_100145303 | 3300005548 | Bacteria | 2375 |
| 101 | Ga0070665_100204500 | 3300005548 | Bacteria | 1975 |
| 102 | Ga0070665_100251466 | 3300005548 | Bacteria | 1768 |
| 103 | Ga0070665_100348447 | 3300005548 | Bacteria | 1486 |
| 104 | Ga0070665_100362972 | 3300005548 | Bacteria | 1454 |
| 105 | Ga0068855_100011385 | 3300005563 | Bacteria | 10741 |
| 106 | Ga0068855_100016407 | 3300005563 | Bacteria | 8904 |
| 107 | Ga0068855_100052765 | 3300005563 | Bacteria | 4786 |
| 108 | Ga0068855_100348154 | 3300005563 | Bacteria | 1632 |
| 109 | Ga0070664_100004548 | 3300005564 | Bacteria | 11126 |
| 110 | Ga0070664_100356643 | 3300005564 | Bacteria | 1331 |
| 111 | Ga0068857_100005934 | 3300005577 | Bacteria | 10429 |
| 112 | Ga0068857_100049217 | 3300005577 | Bacteria | 3739 |
| 113 | Ga0068857_100147254 | 3300005577 | Bacteria | 2131 |
| 114 | Ga0068857_100269789 | 3300005577 | Bacteria | 1564 |
| 115 | Ga0068857_100493465 | 3300005577 | Bacteria | 1148 |
| 116 | Ga0068854_100001069 | 3300005578 | Bacteria | 16476 |
| 117 | Ga0068854_100003617 | 3300005578 | Bacteria | 9672 |
| 118 | Ga0068854_100012184 | 3300005578 | Bacteria | 5627 |
| 119 | Ga0068854_100041136 | 3300005578 | Bacteria | 3264 |
| 120 | Ga0068854_100130866 | 3300005578 | Bacteria | 1916 |
| 121 | Ga0068856_100011037 | 3300005614 | Bacteria | 8775 |
| 122 | Ga0068856_100015994 | 3300005614 | Bacteria | 7252 |
| 123 | Ga0068856_100063707 | 3300005614 | Bacteria | 3642 |
| 124 | Ga0068856_100177892 | 3300005614 | Bacteria | 2140 |
| 125 | Ga0068856_100390290 | 3300005614 | Bacteria | 1412 |
| 126 | Ga0068852_100000492 | 3300005616 | Bacteria | 25824 |
| 127 | Ga0068852_100036670 | 3300005616 | Bacteria | 4106 |
| 128 | Ga0068852_100078619 | 3300005616 | Bacteria | 2919 |
| 129 | Ga0068859_100009146 | 3300005617 | Bacteria | 10005 |
| 130 | Ga0068859_100011170 | 3300005617 | Bacteria | 9029 |
| 131 | Ga0068859_100097393 | 3300005617 | Bacteria | 2995 |
| 132 | Ga0068859_100250659 | 3300005617 | Bacteria | 1861 |
| 133 | Ga0068859_100430406 | 3300005617 | Bacteria | 1416 |
| 134 | Ga0068864_100002937 | 3300005618 | Bacteria | 14096 |
| 135 | Ga0068864_100005874 | 3300005618 | Bacteria | 10057 |
| 136 | Ga0068864_100052609 | 3300005618 | Bacteria | 3510 |
| 137 | Ga0068864_100333187 | 3300005618 | Bacteria | 1428 |
| 138 | Ga0068861_100000013 | 3300005719 | Bacteria | 80820 |
| 139 | Ga0068861_100006789 | 3300005719 | Bacteria | 7818 |
| 140 | Ga0068861_100226479 | 3300005719 | Bacteria | 1583 |
| 141 | Ga0068851_10013675 | 3300005834 | Bacteria | 3842 |
| 142 | Ga0068851_10028451 | 3300005834 | Bacteria | 2761 |
| 143 | Ga0068851_10032321 | 3300005834 | Bacteria | 2604 |
| 144 | Ga0068851_10157338 | 3300005834 | Bacteria | 1246 |
| 145 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 146 | Ga0068863_100000024 | 3300005841 | Bacteria | 186277 |
| 147 | Ga0068863_100000079 | 3300005841 | Bacteria | 107383 |
| 148 | Ga0068863_100038322 | 3300005841 | Bacteria | 4561 |
| 149 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 150 | Ga0068858_100003036 | 3300005842 | Bacteria | 16821 |
| 151 | Ga0068858_100004865 | 3300005842 | Bacteria | 13174 |
| 152 | Ga0068858_100011879 | 3300005842 | Bacteria | 8206 |
| 153 | Ga0068858_100066230 | 3300005842 | Bacteria | 3343 |
| 154 | Ga0068858_100097047 | 3300005842 | Bacteria | 2747 |
| 155 | Ga0068858_100112884 | 3300005842 | Bacteria | 2538 |
| 156 | Ga0068858_100138053 | 3300005842 | Bacteria | 2288 |
| 157 | Ga0068858_100788209 | 3300005842 | Bacteria | 927 |
| 158 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 159 | Ga0068860_100000098 | 3300005843 | Bacteria | 145516 |
| 160 | Ga0068860_100000474 | 3300005843 | Bacteria | 49979 |
| 161 | Ga0068860_100057541 | 3300005843 | Bacteria | 3696 |
| 162 | Ga0068860_100611340 | 3300005843 | Bacteria | 1096 |
| 163 | Ga0068860_100640469 | 3300005843 | Bacteria | 1070 |
| 164 | Ga0068862_100000023 | 3300005844 | Bacteria | 203389 |
| 165 | Ga0068862_100000029 | 3300005844 | Bacteria | 182708 |
| 166 | Ga0068862_100006576 | 3300005844 | Bacteria | 9642 |
| 167 | Ga0081455_10000277 | 3300005937 | Bacteria | 68047 |
| 168 | Ga0075432_10030469 | 3300006058 | Bacteria | 1864 |
| 169 | Ga0075362_10040882 | 3300006177 | Bacteria | 2042 |
| 170 | Ga0097620_100009146 | 3300006931 | Bacteria | 10005 |
| 171 | Ga0097620_100011170 | 3300006931 | Bacteria | 9029 |
| 172 | Ga0097620_100097392 | 3300006931 | Bacteria | 2995 |
| 173 | Ga0097620_100250650 | 3300006931 | Bacteria | 1861 |
| 174 | Ga0097620_100430406 | 3300006931 | Bacteria | 1416 |
| 175 | Ga0105251_10001177 | 3300009011 | Bacteria | 22695 |
| 176 | Ga0105251_10012765 | 3300009011 | Bacteria | 4735 |
| 177 | Ga0105244_10000488 | 3300009036 | Bacteria | 35867 |
| 178 | Ga0105244_10003086 | 3300009036 | Bacteria | 12191 |
| 179 | Ga0105244_10034574 | 3300009036 | Bacteria | 2659 |
| 180 | Ga0105244_10035384 | 3300009036 | Bacteria | 2624 |
| 181 | Ga0105250_10008439 | 3300009092 | Bacteria | 4376 |
| 182 | Ga0105240_10003238 | 3300009093 | Bacteria | 25497 |
| 183 | Ga0105240_10014797 | 3300009093 | Bacteria | 10635 |
| 184 | Ga0105240_10037122 | 3300009093 | Bacteria | 6263 |
| 185 | Ga0105240_10079295 | 3300009093 | Bacteria | 4041 |
| 186 | Ga0105240_10109613 | 3300009093 | Bacteria | 3343 |
| 187 | Ga0105240_10203406 | 3300009093 | Bacteria | 2319 |
| 188 | Ga0105247_10002120 | 3300009101 | Bacteria | 13724 |
| 189 | Ga0105247_10017570 | 3300009101 | Bacteria | 4291 |
| 190 | Ga0105247_10174597 | 3300009101 | Bacteria | 1431 |
| 191 | Ga0105241_10000704 | 3300009174 | Bacteria | 25281 |
| 192 | Ga0105241_10007498 | 3300009174 | Bacteria | 8028 |
| 193 | Ga0105241_10202614 | 3300009174 | Bacteria | 1658 |
| 194 | Ga0105241_10353425 | 3300009174 | Bacteria | 1277 |
| 195 | Ga0105248_10002260 | 3300009177 | Bacteria | 21349 |
| 196 | Ga0105248_10002802 | 3300009177 | Bacteria | 19380 |
| 197 | Ga0105248_10002919 | 3300009177 | Bacteria | 18977 |
| 198 | Ga0105248_10003077 | 3300009177 | Bacteria | 18500 |
| 199 | Ga0105248_10008862 | 3300009177 | Bacteria | 11055 |
| 200 | Ga0105248_10009816 | 3300009177 | Bacteria | 10544 |
| 201 | Ga0105248_10011013 | 3300009177 | Bacteria | 9976 |
| 202 | Ga0105248_10011502 | 3300009177 | Bacteria | 9752 |
| 203 | Ga0105248_10017174 | 3300009177 | Bacteria | 7973 |
| 204 | Ga0105248_10137617 | 3300009177 | Bacteria | 2755 |
| 205 | Ga0105248_10180479 | 3300009177 | Bacteria | 2379 |
| 206 | Ga0105248_10829245 | 3300009177 | Bacteria | 1044 |
| 207 | Ga0105237_10009160 | 3300009545 | Bacteria | 10635 |
| 208 | Ga0105237_10025497 | 3300009545 | Bacteria | 6046 |
| 209 | Ga0105237_10040010 | 3300009545 | Bacteria | 4730 |
| 210 | Ga0105237_10084753 | 3300009545 | Bacteria | 3159 |
| 211 | Ga0105237_10262397 | 3300009545 | Bacteria | 1730 |
| 212 | Ga0105237_10292846 | 3300009545 | Bacteria | 1631 |
| 213 | Ga0105237_10309150 | 3300009545 | Bacteria | 1584 |
| 214 | Ga0105238_10005688 | 3300009551 | Bacteria | 12323 |
| 215 | Ga0105238_10008626 | 3300009551 | Bacteria | 10199 |
| 216 | Ga0105238_10013591 | 3300009551 | Bacteria | 8221 |
| 217 | Ga0105238_10016961 | 3300009551 | Bacteria | 7390 |
| 218 | Ga0105238_10027708 | 3300009551 | Bacteria | 5775 |
| 219 | Ga0105238_10037121 | 3300009551 | Bacteria | 4954 |
| 220 | Ga0105238_10060233 | 3300009551 | Bacteria | 3801 |
| 221 | Ga0105238_10087228 | 3300009551 | Bacteria | 3107 |
| 222 | Ga0105238_10918008 | 3300009551 | Bacteria | 894 |
| 223 | Ga0105249_10000004 | 3300009553 | Bacteria | 368014 |
| 224 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 225 | Ga0105249_10056451 | 3300009553 | Bacteria | 3595 |
| 226 | Ga0105249_10168871 | 3300009553 | Bacteria | 2120 |
| 227 | Ga0105148_100179 | 3300009978 | Bacteria | 9348 |
| 228 | Ga0105147_100813 | 3300009982 | Bacteria | 2535 |
| 229 | Ga0105033_102337 | 3300009986 | Bacteria | 1568 |
| 230 | Ga0105239_10010007 | 3300010375 | Bacteria | 10635 |
| 231 | Ga0105239_10015872 | 3300010375 | Bacteria | 8336 |
| 232 | Ga0105239_10056693 | 3300010375 | Bacteria | 4298 |
| 233 | Ga0105239_10291710 | 3300010375 | Bacteria | 1837 |
| 234 | Ga0105239_10417373 | 3300010375 | Bacteria | 1520 |
| 235 | Ga0105239_10461497 | 3300010375 | Bacteria | 1442 |
| 236 | Ga0105246_10089413 | 3300011119 | Bacteria | 2216 |
| 237 | Ga0157373_10004285 | 3300013100 | Bacteria | 10736 |
| 238 | Ga0157373_10012975 | 3300013100 | Bacteria | 6117 |
| 239 | Ga0157371_10000029 | 3300013102 | Bacteria | 252131 |
| 240 | Ga0157371_10039682 | 3300013102 | Bacteria | 3366 |
| 241 | Ga0157370_10004423 | 3300013104 | Bacteria | 16103 |
| 242 | Ga0157370_10785970 | 3300013104 | Bacteria | 866 |
| 243 | Ga0157369_10049270 | 3300013105 | Bacteria | 4567 |
| 244 | Ga0163162_10000633 | 3300013306 | Bacteria | 32562 |
| 245 | Ga0163162_10012162 | 3300013306 | Bacteria | 8402 |
| 246 | Ga0163162_10038483 | 3300013306 | Bacteria | 4773 |
| 247 | Ga0163162_10214455 | 3300013306 | Bacteria | 2055 |
| 248 | Ga0163162_10273266 | 3300013306 | Bacteria | 1822 |
| 249 | Ga0163162_10493256 | 3300013306 | Bacteria | 1356 |
| 250 | Ga0163162_10624754 | 3300013306 | Bacteria | 1202 |
| 251 | Ga0163162_11255983 | 3300013306 | Bacteria | 841 |
| 252 | Ga0157372_10006052 | 3300013307 | Bacteria | 12848 |
| 253 | Ga0157372_10052895 | 3300013307 | Bacteria | 4524 |
| 254 | Ga0157375_10000312 | 3300013308 | Bacteria | 43933 |
| 255 | Ga0163163_10099867 | 3300014325 | Bacteria | 2924 |
| 256 | Ga0163163_10447421 | 3300014325 | Bacteria | 1352 |
| 257 | Ga0157380_10000936 | 3300014326 | Bacteria | 18439 |
| 258 | Ga0157380_10003133 | 3300014326 | Bacteria | 11278 |
| 259 | Ga0157380_10219889 | 3300014326 | Bacteria | 1699 |
| 260 | Ga0157379_10053801 | 3300014968 | Bacteria | 3597 |
| 261 | Ga0157379_10087961 | 3300014968 | Bacteria | 2786 |
| 262 | Ga0182006_1001200 | 3300015261 | Bacteria | 16189 |
| 263 | Ga0163161_10000029 | 3300017792 | Bacteria | 193416 |
| 264 | Ga0163161_10001170 | 3300017792 | Bacteria | 19695 |
| 265 | Ga0163161_10038278 | 3300017792 | Bacteria | 3440 |
| 266 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 267 | Ga0209050_1000232 | 3300025298 | Bacteria | 121822 |
| 268 | Ga0209050_1001181 | 3300025298 | Bacteria | 30804 |
| 269 | Ga0209050_1023665 | 3300025298 | Bacteria | 2152 |
| 270 | Ga0209051_1001536 | 3300025303 | Bacteria | 19214 |
| 271 | Ga0207697_10003449 | 3300025315 | Bacteria | 7812 |
| 272 | Ga0207697_10010459 | 3300025315 | Bacteria | 3965 |
| 273 | Ga0207656_10001249 | 3300025321 | Bacteria | 8385 |
| 274 | Ga0207656_10034955 | 3300025321 | Bacteria | 2101 |
| 275 | Ga0207696_1001980 | 3300025711 | Bacteria | 10392 |
| 276 | Ga0207655_1000571 | 3300025728 | Bacteria | 45784 |
| 277 | Ga0207713_1000436 | 3300025735 | Bacteria | 43987 |
| 278 | Ga0207713_1009681 | 3300025735 | Bacteria | 5403 |
| 279 | Ga0207713_1039960 | 3300025735 | Bacteria | 1973 |
| 280 | Ga0207710_10009416 | 3300025900 | Bacteria | 4111 |
| 281 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 282 | Ga0207680_10002242 | 3300025903 | Bacteria | 9015 |
| 283 | Ga0207680_10013013 | 3300025903 | Bacteria | 4256 |
| 284 | Ga0207680_10292717 | 3300025903 | Bacteria | 1133 |
| 285 | Ga0207647_10001278 | 3300025904 | Bacteria | 19350 |
| 286 | Ga0207647_10011211 | 3300025904 | Bacteria | 6295 |
| 287 | Ga0207647_10074446 | 3300025904 | Bacteria | 2045 |
| 288 | Ga0207647_10115034 | 3300025904 | Bacteria | 1589 |
| 289 | Ga0207705_10000106 | 3300025909 | Bacteria | 95124 |
| 290 | Ga0207705_10000224 | 3300025909 | Bacteria | 56164 |
| 291 | Ga0207654_10000173 | 3300025911 | Bacteria | 40069 |
| 292 | Ga0207654_10004961 | 3300025911 | Bacteria | 6729 |
| 293 | Ga0207654_10039677 | 3300025911 | Bacteria | 2650 |
| 294 | Ga0207654_10170642 | 3300025911 | Bacteria | 1412 |
| 295 | Ga0207654_10242639 | 3300025911 | Bacteria | 1205 |
| 296 | Ga0207695_10002538 | 3300025913 | Bacteria | 26822 |
| 297 | Ga0207695_10007969 | 3300025913 | Bacteria | 13362 |
| 298 | Ga0207695_10009115 | 3300025913 | Bacteria | 12321 |
| 299 | Ga0207695_10016174 | 3300025913 | Bacteria | 8749 |
| 300 | Ga0207695_10065563 | 3300025913 | Bacteria | 3734 |
| 301 | Ga0207695_10117194 | 3300025913 | Bacteria | 2636 |
| 302 | Ga0207671_10001485 | 3300025914 | Bacteria | 27090 |
| 303 | Ga0207671_10002027 | 3300025914 | Bacteria | 22273 |
| 304 | Ga0207671_10002277 | 3300025914 | Bacteria | 20767 |
| 305 | Ga0207671_10092900 | 3300025914 | Bacteria | 2275 |
| 306 | Ga0207671_10119332 | 3300025914 | Bacteria | 2015 |
| 307 | Ga0207662_10033535 | 3300025918 | Bacteria | 2993 |
| 308 | Ga0207657_10000149 | 3300025919 | Bacteria | 71078 |
| 309 | Ga0207657_10100941 | 3300025919 | Bacteria | 2395 |
| 310 | Ga0207649_10004039 | 3300025920 | Bacteria | 7990 |
| 311 | Ga0207681_10000081 | 3300025923 | Bacteria | 85588 |
| 312 | Ga0207681_10000255 | 3300025923 | Bacteria | 40599 |
| 313 | Ga0207681_10000435 | 3300025923 | Bacteria | 29150 |
| 314 | Ga0207681_10001570 | 3300025923 | Bacteria | 14684 |
| 315 | Ga0207681_10010863 | 3300025923 | Bacteria | 5592 |
| 316 | Ga0207694_10001925 | 3300025924 | Bacteria | 17191 |
| 317 | Ga0207694_10002056 | 3300025924 | Bacteria | 16643 |
| 318 | Ga0207694_10002735 | 3300025924 | Bacteria | 14267 |
| 319 | Ga0207694_10006101 | 3300025924 | Bacteria | 9214 |
| 320 | Ga0207694_10008471 | 3300025924 | Bacteria | 7763 |
| 321 | Ga0207694_10019165 | 3300025924 | Bacteria | 5172 |
| 322 | Ga0207694_10045025 | 3300025924 | Bacteria | 3408 |
| 323 | Ga0207694_10169686 | 3300025924 | Bacteria | 1766 |
| 324 | Ga0207650_10086423 | 3300025925 | Bacteria | 2387 |
| 325 | Ga0207650_10498124 | 3300025925 | Bacteria | 1018 |
| 326 | Ga0207644_10000092 | 3300025931 | Bacteria | 64892 |
| 327 | Ga0207644_10000234 | 3300025931 | Bacteria | 38151 |
| 328 | Ga0207644_10000542 | 3300025931 | Bacteria | 24541 |
| 329 | Ga0207644_10010778 | 3300025931 | Bacteria | 6030 |
| 330 | Ga0207644_10144527 | 3300025931 | Bacteria | 1835 |
| 331 | Ga0207690_10000251 | 3300025932 | Bacteria | 39000 |
| 332 | Ga0207690_10170283 | 3300025932 | Bacteria | 1631 |
| 333 | Ga0207706_10050916 | 3300025933 | Bacteria | 3658 |
| 334 | Ga0207706_10112128 | 3300025933 | Bacteria | 2399 |
| 335 | Ga0207670_10153133 | 3300025936 | Bacteria | 1713 |
| 336 | Ga0207711_10005039 | 3300025941 | Bacteria | 11200 |
| 337 | Ga0207711_10007885 | 3300025941 | Bacteria | 8906 |
| 338 | Ga0207711_10014790 | 3300025941 | Bacteria | 6484 |
| 339 | Ga0207711_10016940 | 3300025941 | Bacteria | 6052 |
| 340 | Ga0207711_10034093 | 3300025941 | Bacteria | 4311 |
| 341 | Ga0207711_10037658 | 3300025941 | Bacteria | 4110 |
| 342 | Ga0207711_10124686 | 3300025941 | Bacteria | 2303 |
| 343 | Ga0207661_10637912 | 3300025944 | Bacteria | 979 |
| 344 | Ga0207679_10180228 | 3300025945 | Bacteria | 1747 |
| 345 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 346 | Ga0207667_10002662 | 3300025949 | Bacteria | 22070 |
| 347 | Ga0207667_10014538 | 3300025949 | Bacteria | 8967 |
| 348 | Ga0207667_10136214 | 3300025949 | Bacteria | 2529 |
| 349 | Ga0207667_10141566 | 3300025949 | Bacteria | 2476 |
| 350 | Ga0207667_10484806 | 3300025949 | Bacteria | 1255 |
| 351 | Ga0207667_10554020 | 3300025949 | Bacteria | 1163 |
| 352 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 353 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 354 | Ga0207712_10029765 | 3300025961 | Bacteria | 3666 |
| 355 | Ga0207712_10086030 | 3300025961 | Bacteria | 2302 |
| 356 | Ga0207712_10104438 | 3300025961 | Bacteria | 2112 |
| 357 | Ga0207668_10000742 | 3300025972 | Bacteria | 19912 |
| 358 | Ga0207668_10004884 | 3300025972 | Bacteria | 7890 |
| 359 | Ga0207668_10037978 | 3300025972 | Bacteria | 3228 |
| 360 | Ga0207668_10130666 | 3300025972 | Bacteria | 1917 |
| 361 | Ga0207640_10000613 | 3300025981 | Bacteria | 21033 |
| 362 | Ga0207640_10024845 | 3300025981 | Bacteria | 3620 |
| 363 | Ga0207640_10031064 | 3300025981 | Bacteria | 3296 |
| 364 | Ga0207640_10035460 | 3300025981 | Bacteria | 3123 |
| 365 | Ga0207640_10059208 | 3300025981 | Bacteria | 2527 |
| 366 | Ga0207640_10072879 | 3300025981 | Bacteria | 2318 |
| 367 | Ga0207640_10136182 | 3300025981 | Bacteria | 1783 |
| 368 | Ga0207640_10376639 | 3300025981 | Bacteria | 1149 |
| 369 | Ga0207658_10000490 | 3300025986 | Bacteria | 36308 |
| 370 | Ga0207658_10002472 | 3300025986 | Bacteria | 13493 |
| 371 | Ga0207658_10005184 | 3300025986 | Bacteria | 8972 |
| 372 | Ga0207658_10005349 | 3300025986 | Bacteria | 8825 |
| 373 | Ga0207658_10008945 | 3300025986 | Bacteria | 6793 |
| 374 | Ga0207703_10000469 | 3300026035 | Bacteria | 42199 |
| 375 | Ga0207703_10002260 | 3300026035 | Bacteria | 16831 |
| 376 | Ga0207703_10004724 | 3300026035 | Bacteria | 11114 |
| 377 | Ga0207703_10037520 | 3300026035 | Bacteria | 3861 |
| 378 | Ga0207703_10148084 | 3300026035 | Bacteria | 2044 |
| 379 | Ga0207703_10214484 | 3300026035 | Bacteria | 1718 |
| 380 | Ga0207703_10458398 | 3300026035 | Bacteria | 1192 |
| 381 | Ga0207639_10001943 | 3300026041 | Bacteria | 13872 |
| 382 | Ga0207639_10004307 | 3300026041 | Bacteria | 9588 |
| 383 | Ga0207639_10011557 | 3300026041 | Bacteria | 6135 |
| 384 | Ga0207639_10013661 | 3300026041 | Bacteria | 5691 |
| 385 | Ga0207639_10014722 | 3300026041 | Bacteria | 5509 |
| 386 | Ga0207639_10173906 | 3300026041 | Bacteria | 1826 |
| 387 | Ga0207678_10000177 | 3300026067 | Bacteria | 54271 |
| 388 | Ga0207678_10000276 | 3300026067 | Bacteria | 46568 |
| 389 | Ga0207678_10004048 | 3300026067 | Bacteria | 13182 |
| 390 | Ga0207678_10005102 | 3300026067 | Bacteria | 11776 |
| 391 | Ga0207678_10316616 | 3300026067 | Bacteria | 1342 |
| 392 | Ga0207702_10000241 | 3300026078 | Bacteria | 63829 |
| 393 | Ga0207702_10001216 | 3300026078 | Bacteria | 26119 |
| 394 | Ga0207702_10003524 | 3300026078 | Bacteria | 14263 |
| 395 | Ga0207702_10015310 | 3300026078 | Bacteria | 6357 |
| 396 | Ga0207702_10188092 | 3300026078 | Bacteria | 1906 |
| 397 | Ga0207702_10321642 | 3300026078 | Bacteria | 1473 |
| 398 | Ga0207702_10414926 | 3300026078 | Bacteria | 1301 |
| 399 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 400 | Ga0207641_10000068 | 3300026088 | Bacteria | 155114 |
| 401 | Ga0207641_10000116 | 3300026088 | Bacteria | 117850 |
| 402 | Ga0207641_10003659 | 3300026088 | Bacteria | 13549 |
| 403 | Ga0207641_10296517 | 3300026088 | Bacteria | 1526 |
| 404 | Ga0207676_10000509 | 3300026095 | Bacteria | 32700 |
| 405 | Ga0207676_10000734 | 3300026095 | Bacteria | 25702 |
| 406 | Ga0207676_10103240 | 3300026095 | Bacteria | 2368 |
| 407 | Ga0207676_10115322 | 3300026095 | Bacteria | 2255 |
| 408 | Ga0207674_10001960 | 3300026116 | Bacteria | 26068 |
| 409 | Ga0207674_10010429 | 3300026116 | Bacteria | 10526 |
| 410 | Ga0207674_10156226 | 3300026116 | Bacteria | 2236 |
| 411 | Ga0207674_10266029 | 3300026116 | Bacteria | 1662 |
| 412 | Ga0207674_10441260 | 3300026116 | Bacteria | 1258 |
| 413 | Ga0207675_100000054 | 3300026118 | Bacteria | 82248 |
| 414 | Ga0207675_100046180 | 3300026118 | Bacteria | 4068 |
| 415 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 416 | Ga0207698_10000949 | 3300026142 | Bacteria | 16841 |
| 417 | Ga0207698_10048340 | 3300026142 | Bacteria | 3229 |
| 418 | Ga0207698_10142392 | 3300026142 | Bacteria | 2068 |
| 419 | Ga0207698_10637334 | 3300026142 | Bacteria | 1054 |
| 420 | Ga0209371_1000980 | 3300027312 | Bacteria | 22005 |
| 421 | Ga0209974_10087185 | 3300027876 | Bacteria | 1079 |
| 422 | Ga0207428_10039735 | 3300027907 | Bacteria | 3821 |
| 423 | Ga0207428_10047074 | 3300027907 | Bacteria | 3465 |
| 424 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 425 | Ga0268266_10000205 | 3300028379 | Bacteria | 103915 |
| 426 | Ga0268266_10001759 | 3300028379 | Bacteria | 24679 |
| 427 | Ga0268266_10029449 | 3300028379 | Bacteria | 4668 |
| 428 | Ga0268266_10058915 | 3300028379 | Bacteria | 3307 |
| 429 | Ga0268266_10083257 | 3300028379 | Bacteria | 2793 |
| 430 | Ga0268266_10105295 | 3300028379 | Bacteria | 2492 |
| 431 | Ga0268266_10297280 | 3300028379 | Bacteria | 1505 |
| 432 | Ga0268265_10000035 | 3300028380 | Bacteria | 207267 |
| 433 | Ga0268265_10002067 | 3300028380 | Bacteria | 15676 |
| 434 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 435 | Ga0268264_10000129 | 3300028381 | Bacteria | 182988 |
| 436 | Ga0268264_10001169 | 3300028381 | Bacteria | 25510 |
| 437 | Ga0268264_10005055 | 3300028381 | Bacteria | 11168 |
| 438 | Ga0268264_10010312 | 3300028381 | Bacteria | 7732 |
| 439 | Ga0268264_10051721 | 3300028381 | Bacteria | 3424 |
| 440 | Ga0268264_10056928 | 3300028381 | Bacteria | 3268 |
| 441 | Ga0268264_10571665 | 3300028381 | Bacteria | 1111 |
| 442 | Ga0307517_10157810 | 3300028786 | Bacteria | 1533 |
| 443 | Ga0268256_1004217 | 3300030500 | Bacteria | 6055 |
| 444 | Ga0307408_100001178 | 3300031548 | Bacteria | 19789 |
| 445 | Ga0307408_100158820 | 3300031548 | Bacteria | 1793 |
| 446 | Ga0307408_100647280 | 3300031548 | Bacteria | 944 |
| 447 | Ga0307405_10033799 | 3300031731 | Bacteria | 3037 |
| 448 | Ga0307405_10060618 | 3300031731 | Bacteria | 2388 |
| 449 | Ga0307405_10129104 | 3300031731 | Bacteria | 1743 |
| 450 | Ga0307405_10227926 | 3300031731 | Bacteria | 1371 |
| 451 | Ga0307405_10238426 | 3300031731 | Bacteria | 1345 |
| 452 | Ga0307413_10087497 | 3300031824 | Bacteria | 2018 |
| 453 | Ga0307410_10074421 | 3300031852 | Bacteria | 2365 |
| 454 | Ga0307406_10006401 | 3300031901 | Bacteria | 6496 |
| 455 | Ga0307406_10058252 | 3300031901 | Bacteria | 2482 |
| 456 | Ga0307406_10065683 | 3300031901 | Bacteria | 2358 |
| 457 | Ga0307406_10243400 | 3300031901 | Bacteria | 1350 |
| 458 | Ga0307412_10090368 | 3300031911 | Bacteria | 2140 |
| 459 | Ga0307412_10141524 | 3300031911 | Bacteria | 1762 |
| 460 | Ga0307412_10177197 | 3300031911 | Bacteria | 1599 |
| 461 | Ga0307412_10213754 | 3300031911 | Bacteria | 1473 |
| 462 | Ga0307409_100025575 | 3300031995 | Bacteria | 4143 |
| 463 | Ga0307409_100098091 | 3300031995 | Bacteria | 2422 |
| 464 | Ga0307416_100013740 | 3300032002 | Bacteria | 5514 |
| 465 | Ga0307416_100176590 | 3300032002 | Bacteria | 1996 |
| 466 | Ga0307416_100235887 | 3300032002 | Bacteria | 1768 |
| 467 | Ga0307414_10029153 | 3300032004 | Bacteria | 3588 |
| 468 | Ga0307414_10147032 | 3300032004 | Bacteria | 1853 |
| 469 | Ga0307414_10320861 | 3300032004 | Bacteria | 1318 |
| 470 | Ga0307414_10465899 | 3300032004 | Bacteria | 1111 |
| 471 | Ga0307411_10010906 | 3300032005 | Bacteria | 4872 |
| 472 | Ga0307411_10118785 | 3300032005 | Bacteria | 1908 |
| 473 | Ga0373936_0000438 | 3300035113 | Bacteria | 13923 |
| 474 | Ga0439431_0000123 | 3300041997 | Bacteria | 13511 |
| 475 | Ga0439443_011710 | 3300042003 | Bacteria | 1289 |
| 476 | Ga0439451_000134 | 3300042009 | Bacteria | 13696 |
| 477 | Ga0450912_000156 | 3300042116 | Bacteria | 2654 |
| 478 | Ga0439434_0017935 | 3300042435 | Bacteria | 2119 |
| 479 | Ga0439435_0011285 | 3300042436 | Bacteria | 2141 |
| 480 | Ga0466968_0000001 | 3300044735 | Bacteria | 100282 |
| 481 | Ga0495617_013157 | 3300046452 | Bacteria | 2818 |
| 482 | Ga0495627_009681 | 3300046453 | Bacteria | 3537 |
| 483 | Ga0495603_0004141 | 3300046455 | Bacteria | 8640 |
| 484 | Ga0495590_0010643 | 3300046457 | Bacteria | 3449 |
| 485 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 486 | Ga0495591_009522 | 3300046458 | Bacteria | 3849 |
| 487 | Ga0495629_0143136 | 3300046459 | Bacteria | 1663 |
| 488 | Ga0495638_0011478 | 3300046460 | Bacteria | 6103 |
| 489 | Ga0495638_0036433 | 3300046460 | Bacteria | 3134 |
| 490 | Ga0495638_0054061 | 3300046460 | Bacteria | 2497 |
| 491 | Ga0495653_0001061 | 3300046463 | Bacteria | 21169 |
| 492 | Ga0495650_0001536 | 3300046471 | Bacteria | 21887 |
| 493 | Ga0495605_0082171 | 3300046474 | Bacteria | 1505 |
| 494 | Ga0495664_0002014 | 3300046477 | Bacteria | 10848 |
| 495 | Ga0495584_0012791 | 3300046491 | Bacteria | 4282 |
| 496 | Ga0495585_0000577 | 3300046492 | Bacteria | 34550 |
| 497 | Ga0495596_0047251 | 3300046500 | Bacteria | 1689 |
| 498 | Ga0495607_0006485 | 3300046501 | Bacteria | 8228 |
| 499 | Ga0495607_0052435 | 3300046501 | Bacteria | 2363 |
| 500 | Ga0495583_0002568 | 3300046506 | Bacteria | 15282 |
| 501 | Ga0495606_0000525 | 3300046507 | Bacteria | 61969 |
| 502 | Ga0495606_0091208 | 3300046507 | Bacteria | 1874 |
| 503 | Ga0495616_0002361 | 3300046513 | Bacteria | 12573 |
| 504 | Ga0495616_0022986 | 3300046513 | Bacteria | 3360 |
| 505 | Ga0495628_0032197 | 3300046516 | Bacteria | 4234 |
| 506 | Ga0495630_0001092 | 3300046517 | Bacteria | 18641 |
| 507 | Ga0495631_0000063 | 3300046518 | Bacteria | 66560 |
| 508 | Ga0495632_0000058 | 3300046519 | Bacteria | 122648 |
| 509 | Ga0495632_0019335 | 3300046519 | Bacteria | 3713 |
| 510 | Ga0495632_0032441 | 3300046519 | Bacteria | 2691 |
| 511 | Ga0495637_0000315 | 3300046520 | Bacteria | 37537 |
| 512 | Ga0495643_0000044 | 3300046522 | Bacteria | 226211 |
| 513 | Ga0495643_0000880 | 3300046522 | Bacteria | 31960 |
| 514 | Ga0495644_0001098 | 3300046523 | Bacteria | 11173 |
| 515 | Ga0495648_0000241 | 3300046524 | Bacteria | 61991 |
| 516 | Ga0495648_0002312 | 3300046524 | Bacteria | 17749 |
| 517 | Ga0495663_0000394 | 3300046525 | Bacteria | 16143 |
| 518 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 519 | Ga0495652_0121122 | 3300046529 | Bacteria | 2086 |
| 520 | Ga0495654_0015638 | 3300046530 | Bacteria | 4027 |
| 521 | Ga0495654_0030628 | 3300046530 | Bacteria | 2736 |
| 522 | Ga0495665_0000088 | 3300046531 | Bacteria | 41277 |
| 523 | Ga0495586_0111876 | 3300046535 | Bacteria | 1520 |
| 524 | Ga0495609_0000490 | 3300046538 | Bacteria | 31718 |
| 525 | Ga0495597_0000216 | 3300046542 | Bacteria | 52708 |
| 526 | Ga0495597_0008172 | 3300046542 | Bacteria | 5262 |
| 527 | Ga0495645_0001816 | 3300046543 | Bacteria | 14507 |
| 528 | Ga0495622_0003159 | 3300046557 | Bacteria | 7798 |
| 529 | Ga0495633_0074262 | 3300046558 | Bacteria | 1584 |
| 530 | Ga0495656_0000104 | 3300046615 | Bacteria | 35209 |
| 531 | Ga0495635_0007133 | 3300046663 | Bacteria | 7812 |
| 532 | Ga0495659_0000116 | 3300046664 | Bacteria | 35444 |
| 533 | Ga0495661_0033597 | 3300046665 | Bacteria | 3234 |
| 534 | Ga0495599_0001037 | 3300046678 | Bacteria | 15615 |
| 535 | Ga0495623_0003834 | 3300046679 | Bacteria | 9910 |
| 536 | Ga0495623_0007903 | 3300046679 | Bacteria | 6917 |
| 537 | Ga0495646_0042176 | 3300046680 | Bacteria | 2801 |
| 538 | Ga0495669_0000263 | 3300046684 | Bacteria | 30264 |
| 539 | Ga0495671_0001868 | 3300046692 | Bacteria | 13535 |
| 540 | Ga0495671_0016585 | 3300046692 | Bacteria | 3930 |
| 541 | Ga0495649_0052751 | 3300046694 | Bacteria | 2203 |
| 542 | Ga0495649_0092547 | 3300046694 | Bacteria | 1610 |
| 543 | Ga0495589_0000549 | 3300046794 | Bacteria | 25906 |
| 544 | Ga0495660_0000517 | 3300046810 | Bacteria | 31676 |
| 545 | Ga0495660_0143329 | 3300046810 | Bacteria | 1186 |
| 546 | Ga0495581_0046960 | 3300047315 | Bacteria | 2496 |
| 547 | Ga0495636_0005002 | 3300047318 | Bacteria | 5200 |
| 548 | Ga0495674_0004761 | 3300047319 | Bacteria | 13047 |
| 549 | Ga0495674_0026330 | 3300047319 | Bacteria | 5321 |
| 550 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 551 | Ga0495672_0002680 | 3300047320 | Bacteria | 16016 |
| 552 | Ga0495672_0207645 | 3300047320 | Bacteria | 975 |
| 553 | Ga0495680_0001743 | 3300047322 | Bacteria | 23092 |
| 554 | Ga0495683_0003035 | 3300047323 | Bacteria | 9872 |
| 555 | Ga0495675_0068666 | 3300047444 | Bacteria | 2239 |
| 556 | Ga0495675_0097903 | 3300047444 | Bacteria | 1838 |
| 557 | Ga0495677_0000047 | 3300047445 | Bacteria | 72197 |
| 558 | Ga0495685_013131 | 3300047447 | Bacteria | 2809 |
| 559 | Ga0495673_0000178 | 3300047469 | Bacteria | 102182 |
| 560 | Ga0495681_0000026 | 3300047470 | Bacteria | 144911 |
| 561 | Ga0495681_0025699 | 3300047470 | Bacteria | 3077 |
| 562 | Ga0495686_0087546 | 3300047472 | Bacteria | 1894 |
| 563 | Ga0495593_0000023 | 3300047673 | Bacteria | 66020 |
| 564 | Ga0495602_0000395 | 3300048088 | Bacteria | 40667 |
| 565 | Ga0495602_0006180 | 3300048088 | Bacteria | 12560 |
| 566 | Ga0495626_0000132 | 3300048091 | Bacteria | 94157 |
| 567 | Ga0495626_0000522 | 3300048091 | Bacteria | 38417 |
| 568 | Ga0495626_0001091 | 3300048091 | Bacteria | 22989 |
| 569 | Ga0496100_0000468 | 3300048903 | Bacteria | 19363 |
| 570 | Ga0496100_0104443 | 3300048903 | Bacteria | 1957 |
| 571 | Ga0496101_0000286 | 3300048904 | Bacteria | 35339 |
| 572 | Ga0496101_0006180 | 3300048904 | Bacteria | 7697 |
| 573 | Ga0496101_0063056 | 3300048904 | Bacteria | 2696 |
| 574 | Ga0496101_0089742 | 3300048904 | Bacteria | 2285 |
| 575 | Ga0496101_0192409 | 3300048904 | Bacteria | 1575 |
| 576 | Ga0496101_0245428 | 3300048904 | Bacteria | 1394 |
| 577 | Ga0496102_0000149 | 3300048905 | Bacteria | 95638 |
| 578 | Ga0496102_0000178 | 3300048905 | Bacteria | 86174 |
| 579 | Ga0496102_0000603 | 3300048905 | Bacteria | 37505 |
| 580 | Ga0496102_0014478 | 3300048905 | Bacteria | 6852 |
| 581 | Ga0496102_0031407 | 3300048905 | Bacteria | 4764 |
| 582 | Ga0496102_0066791 | 3300048905 | Bacteria | 3297 |
| 583 | Ga0496102_0440626 | 3300048905 | Bacteria | 1222 |
| 584 | Ga0496102_0621632 | 3300048905 | Bacteria | 1003 |
| 585 | Ga0496103_0000049 | 3300048906 | Bacteria | 154466 |
| 586 | Ga0496103_0000119 | 3300048906 | Bacteria | 86194 |
| 587 | Ga0496103_0001250 | 3300048906 | Bacteria | 17360 |
| 588 | Ga0496103_0003454 | 3300048906 | Bacteria | 9661 |
| 589 | Ga0496103_0025754 | 3300048906 | Bacteria | 3557 |
| 590 | Ga0496103_0246627 | 3300048906 | Bacteria | 1149 |
| 591 | Ga0496103_0257765 | 3300048906 | Bacteria | 1122 |
| 592 | Ga0496104_0002042 | 3300048907 | Bacteria | 17531 |
| 593 | Ga0496104_0012927 | 3300048907 | Bacteria | 7517 |
| 594 | Ga0496104_0047274 | 3300048907 | Bacteria | 4056 |
| 595 | Ga0496104_0113755 | 3300048907 | Bacteria | 2595 |
| 596 | Ga0496105_0000384 | 3300048908 | Bacteria | 29011 |
| 597 | Ga0496105_0004516 | 3300048908 | Bacteria | 10477 |
| 598 | Ga0496105_0004706 | 3300048908 | Bacteria | 10292 |
| 599 | Ga0496106_0007807 | 3300048909 | Bacteria | 7915 |
| 600 | Ga0496106_0034381 | 3300048909 | Bacteria | 3784 |
| 601 | Ga0496106_0070595 | 3300048909 | Bacteria | 2668 |
| 602 | Ga0496107_0000555 | 3300048910 | Bacteria | 20889 |
| 603 | Ga0496107_0080429 | 3300048910 | Bacteria | 2376 |
| 604 | Ga0496107_0377322 | 3300048910 | Bacteria | 1055 |
| 605 | Ga0496108_0006786 | 3300048911 | Bacteria | 9270 |
| 606 | Ga0496109_0038989 | 3300048912 | Bacteria | 4299 |
| 607 | Ga0496109_0168773 | 3300048912 | Bacteria | 2052 |
| 608 | Ga0496110_0014851 | 3300048913 | Bacteria | 6471 |
| 609 | Ga0496110_0044082 | 3300048913 | Bacteria | 3895 |
| 610 | Ga0496110_0058882 | 3300048913 | Bacteria | 3384 |
| 611 | Ga0496110_0200022 | 3300048913 | Bacteria | 1815 |
| 612 | Ga0496112_0126968 | 3300048915 | Bacteria | 2521 |
| 613 | Ga0496112_0141116 | 3300048915 | Bacteria | 2378 |
| 614 | Ga0496113_0000915 | 3300048916 | Bacteria | 15596 |
| 615 | Ga0496113_0001856 | 3300048916 | Bacteria | 12033 |
| 616 | Ga0496113_0002781 | 3300048916 | Bacteria | 10290 |
| 617 | Ga0496113_0057702 | 3300048916 | Bacteria | 2918 |
| 618 | Ga0496113_0191952 | 3300048916 | Bacteria | 1621 |
| 619 | Ga0496114_0006234 | 3300048917 | Bacteria | 9386 |
| 620 | Ga0496114_0053749 | 3300048917 | Bacteria | 3357 |
| 621 | Ga0496115_0000740 | 3300048918 | Bacteria | 24162 |
| 622 | Ga0496115_0352547 | 3300048918 | Bacteria | 1200 |
| 623 | Ga0496116_0000078 | 3300048919 | Bacteria | 227712 |
| 624 | Ga0496116_0005447 | 3300048919 | Bacteria | 11787 |
| 625 | Ga0496116_0027139 | 3300048919 | Bacteria | 4173 |
| 626 | Ga0496116_0032455 | 3300048919 | Bacteria | 3721 |
| 627 | Ga0496116_0057344 | 3300048919 | Bacteria | 2547 |
| 628 | Ga0496116_0142241 | 3300048919 | Bacteria | 1347 |
| 629 | Ga0496117_0000123 | 3300048920 | Bacteria | 169805 |
| 630 | Ga0496117_0000318 | 3300048920 | Bacteria | 84351 |
| 631 | Ga0496117_0011188 | 3300048920 | Bacteria | 8058 |
| 632 | Ga0496117_0016985 | 3300048920 | Bacteria | 6097 |
| 633 | Ga0496117_0021007 | 3300048920 | Bacteria | 5304 |
| 634 | Ga0496117_0083145 | 3300048920 | Bacteria | 2094 |
| 635 | Ga0496118_0000186 | 3300048921 | Bacteria | 108940 |
| 636 | Ga0496118_0004578 | 3300048921 | Bacteria | 16276 |
| 637 | Ga0496118_0009472 | 3300048921 | Bacteria | 9830 |
| 638 | Ga0496118_0013949 | 3300048921 | Bacteria | 7557 |
| 639 | Ga0496118_0075970 | 3300048921 | Bacteria | 2392 |
| 640 | Ga0496118_0090878 | 3300048921 | Bacteria | 2102 |
| 641 | Ga0496119_0000090 | 3300048922 | Bacteria | 134340 |
| 642 | Ga0496119_0005614 | 3300048922 | Bacteria | 11930 |
| 643 | Ga0496119_0080647 | 3300048922 | Bacteria | 1876 |
| 644 | Ga0496119_0089794 | 3300048922 | Bacteria | 1749 |
| 645 | Ga0496120_0000690 | 3300048923 | Bacteria | 49503 |
| 646 | Ga0496120_0081402 | 3300048923 | Bacteria | 1752 |
| 647 | Ga0496121_0000058 | 3300048924 | Bacteria | 281335 |
| 648 | Ga0496121_0000170 | 3300048924 | Bacteria | 144547 |
| 649 | Ga0496121_0001102 | 3300048924 | Bacteria | 47573 |
| 650 | Ga0496121_0001167 | 3300048924 | Bacteria | 46089 |
| 651 | Ga0496121_0008424 | 3300048924 | Bacteria | 12133 |
| 652 | Ga0496121_0021736 | 3300048924 | Bacteria | 6269 |
| 653 | Ga0496121_0022199 | 3300048924 | Bacteria | 6173 |
| 654 | Ga0496121_0207385 | 3300048924 | Bacteria | 1391 |
| 655 | Ga0496121_0275411 | 3300048924 | Bacteria | 1154 |
| 656 | Ga0496122_0000552 | 3300048925 | Bacteria | 77275 |
| 657 | Ga0496122_0000662 | 3300048925 | Bacteria | 69323 |
| 658 | Ga0496122_0000710 | 3300048925 | Bacteria | 65728 |
| 659 | Ga0496122_0003669 | 3300048925 | Bacteria | 19924 |
| 660 | Ga0496122_0004341 | 3300048925 | Bacteria | 17725 |
| 661 | Ga0496122_0019002 | 3300048925 | Bacteria | 6304 |
| 662 | Ga0496122_0026032 | 3300048925 | Bacteria | 5061 |
| 663 | Ga0496122_0074283 | 3300048925 | Bacteria | 2406 |
| 664 | Ga0496122_0176940 | 3300048925 | Bacteria | 1278 |
| 665 | Ga0496123_0000104 | 3300048926 | Bacteria | 168230 |
| 666 | Ga0496123_0000478 | 3300048926 | Bacteria | 69650 |
| 667 | Ga0496123_0001031 | 3300048926 | Bacteria | 42310 |
| 668 | Ga0496123_0001607 | 3300048926 | Bacteria | 30631 |
| 669 | Ga0496123_0002034 | 3300048926 | Bacteria | 26132 |
| 670 | Ga0496123_0002385 | 3300048926 | Bacteria | 23545 |
| 671 | Ga0496123_0006685 | 3300048926 | Bacteria | 11111 |
| 672 | Ga0496123_0012881 | 3300048926 | Bacteria | 7080 |
| 673 | Ga0496123_0021639 | 3300048926 | Bacteria | 4991 |
| 674 | Ga0496123_0060689 | 3300048926 | Bacteria | 2436 |
| 675 | Ga0496123_0123807 | 3300048926 | Bacteria | 1448 |
| 676 | Ga0496124_0000224 | 3300048927 | Bacteria | 110603 |
| 677 | Ga0496124_0000324 | 3300048927 | Bacteria | 88327 |
| 678 | Ga0496124_0000569 | 3300048927 | Bacteria | 62485 |
| 679 | Ga0496124_0002768 | 3300048927 | Bacteria | 22293 |
| 680 | Ga0496124_0003427 | 3300048927 | Bacteria | 19435 |
| 681 | Ga0496124_0011124 | 3300048927 | Bacteria | 9029 |
| 682 | Ga0496124_0021301 | 3300048927 | Bacteria | 5974 |
| 683 | Ga0496124_0062282 | 3300048927 | Bacteria | 3122 |
| 684 | Ga0496124_0111667 | 3300048927 | Bacteria | 2199 |
| 685 | Ga0496125_0001890 | 3300048928 | Bacteria | 28768 |
| 686 | Ga0496125_0002211 | 3300048928 | Bacteria | 25955 |
| 687 | Ga0496125_0005275 | 3300048928 | Bacteria | 14467 |
| 688 | Ga0496125_0008036 | 3300048928 | Bacteria | 11136 |
| 689 | Ga0496125_0008335 | 3300048928 | Bacteria | 10874 |
| 690 | Ga0496125_0026107 | 3300048928 | Bacteria | 5334 |
| 691 | Ga0496125_0120535 | 3300048928 | Bacteria | 1872 |
| 692 | Ga0496125_0120715 | 3300048928 | Bacteria | 1871 |
| 693 | Ga0496125_0170879 | 3300048928 | Bacteria | 1461 |
| 694 | Ga0496125_0252529 | 3300048928 | Bacteria | 1111 |
| 695 | Ga0496126_0000045 | 3300048929 | Bacteria | 331225 |
| 696 | Ga0496126_0000058 | 3300048929 | Bacteria | 272530 |
| 697 | Ga0496126_0001180 | 3300048929 | Bacteria | 42930 |
| 698 | Ga0496126_0002582 | 3300048929 | Bacteria | 24157 |
| 699 | Ga0496126_0003207 | 3300048929 | Bacteria | 20981 |
| 700 | Ga0496126_0019383 | 3300048929 | Bacteria | 6701 |
| 701 | Ga0496126_0023137 | 3300048929 | Bacteria | 6023 |
| 702 | Ga0496126_0033848 | 3300048929 | Bacteria | 4806 |
| 703 | Ga0496126_0091991 | 3300048929 | Bacteria | 2666 |
| 704 | Ga0496126_0179666 | 3300048929 | Bacteria | 1798 |
| 705 | Ga0495678_007230 | 3300049459 | Bacteria | 5785 |
| 706 | Ga0495678_030282 | 3300049459 | Bacteria | 2265 |
| 707 | Ga0495682_0000926 | 3300049460 | Bacteria | 17782 |
| 708 | Ga0501198_001048 | 3300049649 | Bacteria | 3522 |
| 709 | Ga0501223_000006 | 3300049663 | Bacteria | 133378 |
| 710 | Ga0501223_000024 | 3300049663 | Bacteria | 59339 |
| 711 | Ga0501223_000047 | 3300049663 | Bacteria | 41715 |
| 712 | Ga0501224_000001 | 3300049664 | Bacteria | 308131 |
| 713 | Ga0501224_000017 | 3300049664 | Bacteria | 81060 |
| 714 | Ga0501233_000034 | 3300049668 | Bacteria | 17934 |
| 715 | Ga0501233_001364 | 3300049668 | Bacteria | 4176 |
| 716 | Ga0501235_000125 | 3300049669 | Bacteria | 12715 |
| 717 | Ga0501235_006498 | 3300049669 | Bacteria | 2545 |
| 718 | Ga0501235_018040 | 3300049669 | Bacteria | 1562 |
| 719 | Ga0501225_0000007 | 3300049705 | Bacteria | 107771 |
| 720 | Ga0501225_0000095 | 3300049705 | Bacteria | 28347 |
| 721 | Ga0501225_0002153 | 3300049705 | Bacteria | 6103 |
| 722 | Ga0501225_0002556 | 3300049705 | Bacteria | 5609 |
| 723 | Ga0501234_001781 | 3300049707 | Bacteria | 3396 |
| 724 | Ga0501234_002623 | 3300049707 | Bacteria | 2835 |
| 725 | Ga0501226_000029 | 3300049853 | Bacteria | 82723 |
| 726 | Ga0501226_000040 | 3300049853 | Bacteria | 60590 |
| 727 | nmdc:mga08x19_67195_c1 | 3300050514 | Bacteria | 2331 |
| 728 | Ga0500573_0000027 | 3300053140 | Bacteria | 143529 |
| 729 | Ga0500588_0007022 | 3300053146 | Bacteria | 2580 |
| 730 | Ga0500565_003122 | 3300053734 | Bacteria | 1295 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046458 | Ga0495591_009522 | Ga0495591_009522_16_702 | 227 |
| 2 | 3300047320 | Ga0495672_0207645 | Ga0495672_0207645_83_769 | 227 |
| 3 | 3300046678 | Ga0495599_0001037 | Ga0495599_0001037_11206_12030 | 235 |
| 4 | 3300046679 | Ga0495623_0003834 | Ga0495623_0003834_3516_4340 | 235 |
| 5 | 3300047444 | Ga0495675_0068666 | Ga0495675_0068666_1131_1955 | 235 |
| 6 | 3300048088 | Ga0495602_0006180 | Ga0495602_0006180_8014_8838 | 235 |
| 7 | 3300047318 | Ga0495636_0005002 | Ga0495636_0005002_4466_5182 | 237 |
| 8 | 3300025961 | Ga0207712_10029765 | Ga0207712_100297653 | 245 |
| 9 | 3300048929 | Ga0496126_0023137 | Ga0496126_0023137_315_1073 | 252 |
| 10 | 3300025914 | Ga0207671_10092900 | Ga0207671_100929002 | 254 |
| 11 | iso_pu_bacteria | 2895880812 | 2895885780 | 254 |
| 12 | 3300001976 | JGI24752J21851_1000313 | JGI24752J21851_10003134 | 255 |
| 13 | 3300002070 | JGI24750J21931_1000170 | JGI24750J21931_10001704 | 255 |
| 14 | 3300002074 | JGI24748J21848_1000065 | JGI24748J21848_10000655 | 255 |
| 15 | 3300002076 | JGI24749J21850_1001625 | JGI24749J21850_10016253 | 255 |
| 16 | 3300002239 | JGI24034J26672_10000008 | JGI24034J26672_10000008166 | 255 |
| 17 | 3300002244 | JGI24742J22300_10004545 | JGI24742J22300_100045454 | 255 |
| 18 | 3300005330 | Ga0070690_100000006 | Ga0070690_10000000657 | 255 |
| 19 | 3300005331 | Ga0070670_100005200 | Ga0070670_1000052006 | 255 |
| 20 | 3300005335 | Ga0070666_10000004 | Ga0070666_10000004124 | 255 |
| 21 | 3300005340 | Ga0070689_100196365 | Ga0070689_1001963651 | 255 |
| 22 | 3300005343 | Ga0070687_100154840 | Ga0070687_1001548401 | 255 |
| 23 | 3300005353 | Ga0070669_100000215 | Ga0070669_10000021534 | 255 |
| 24 | 3300005365 | Ga0070688_100000836 | Ga0070688_1000008363 | 255 |
| 25 | 3300005367 | Ga0070667_100881708 | Ga0070667_1008817081 | 255 |
| 26 | 3300005466 | Ga0070685_10000202 | Ga0070685_1000020216 | 255 |
| 27 | 3300005544 | Ga0070686_100000012 | Ga0070686_10000001222 | 255 |
| 28 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004500 | 255 |
| 29 | 3300005617 | Ga0068859_100011170 | Ga0068859_1000111707 | 255 |
| 30 | 3300005618 | Ga0068864_100052609 | Ga0068864_1000526094 | 255 |
| 31 | 3300005719 | Ga0068861_100006789 | Ga0068861_1000067897 | 255 |
| 32 | 3300005841 | Ga0068863_100000013 | Ga0068863_10000001347 | 255 |
| 33 | 3300005842 | Ga0068858_100004865 | Ga0068858_10000486512 | 255 |
| 34 | 3300005843 | Ga0068860_100000009 | Ga0068860_100000009124 | 255 |
| 35 | 3300005844 | Ga0068862_100000029 | Ga0068862_100000029135 | 255 |
| 36 | 3300006931 | Ga0097620_100011170 | Ga0097620_1000111707 | 255 |
| 37 | 3300009177 | Ga0105248_10009816 | Ga0105248_100098164 | 255 |
| 38 | 3300009553 | Ga0105249_10000006 | Ga0105249_10000006241 | 255 |
| 39 | 3300014326 | Ga0157380_10003133 | Ga0157380_100031335 | 255 |
| 40 | 3300017792 | Ga0163161_10000029 | Ga0163161_1000002963 | 255 |
| 41 | 3300025903 | Ga0207680_10000010 | Ga0207680_10000010283 | 255 |
| 42 | 3300025918 | Ga0207662_10033535 | Ga0207662_100335353 | 255 |
| 43 | 3300025923 | Ga0207681_10000435 | Ga0207681_1000043522 | 255 |
| 44 | 3300025931 | Ga0207644_10000092 | Ga0207644_1000009212 | 255 |
| 45 | 3300025936 | Ga0207670_10153133 | Ga0207670_101531331 | 255 |
| 46 | 3300025941 | Ga0207711_10037658 | Ga0207711_100376585 | 255 |
| 47 | 3300025961 | Ga0207712_10000014 | Ga0207712_10000014124 | 255 |
| 48 | 3300025972 | Ga0207668_10130666 | Ga0207668_101306663 | 255 |
| 49 | 3300025986 | Ga0207658_10005184 | Ga0207658_100051846 | 255 |
| 50 | 3300026035 | Ga0207703_10004724 | Ga0207703_100047247 | 255 |
| 51 | 3300026088 | Ga0207641_10000116 | Ga0207641_1000011648 | 255 |
| 52 | 3300026095 | Ga0207676_10103240 | Ga0207676_101032404 | 255 |
| 53 | 3300026118 | Ga0207675_100046180 | Ga0207675_1000461804 | 255 |
| 54 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009300 | 255 |
| 55 | 3300028380 | Ga0268265_10002067 | Ga0268265_100020679 | 255 |
| 56 | 3300028381 | Ga0268264_10000023 | Ga0268264_10000023241 | 255 |
| 57 | 3300048905 | Ga0496102_0031407 | Ga0496102_0031407_1321_2100 | 255 |
| 58 | 3300048906 | Ga0496103_0003454 | Ga0496103_0003454_1274_2053 | 255 |
| 59 | 3300048907 | Ga0496104_0047274 | Ga0496104_0047274_2336_3115 | 255 |
| 60 | 3300048909 | Ga0496106_0070595 | Ga0496106_0070595_1531_2310 | 255 |
| 61 | 3300048910 | Ga0496107_0080429 | Ga0496107_0080429_331_1110 | 255 |
| 62 | 3300048920 | Ga0496117_0016985 | Ga0496117_0016985_1327_2106 | 255 |
| 63 | 3300048924 | Ga0496121_0275411 | Ga0496121_0275411_225_1004 | 255 |
| 64 | iso_pu_bacteria | 2511231007 | 2511271864 | 255 |
| 65 | iso_pu_bacteria | 2511231012 | 2511300022 | 255 |
| 66 | iso_pu_bacteria | 2511231014 | 2511314512 | 255 |
| 67 | iso_pu_bacteria | 2511231015 | 2511322090 | 255 |
| 68 | iso_pu_bacteria | 2511231017 | 2511331904 | 255 |
| 69 | iso_pu_bacteria | 2511231020 | 2511347858 | 255 |
| 70 | iso_pu_bacteria | 2511231021 | 2511354151 | 255 |
| 71 | iso_pu_bacteria | 2513237165 | 2514044323 | 255 |
| 72 | iso_pu_bacteria | 2562617112 | 2563057941 | 255 |
| 73 | iso_pu_bacteria | 2711768613 | 2713473356 | 255 |
| 74 | 2162886007 | SwRhRL2b_contig_3367114 | SwRhRL2b_0645.00008410 | 256 |
| 75 | 3300005289 | Ga0065704_10000463 | Ga0065704_1000046313 | 256 |
| 76 | 3300005347 | Ga0070668_100070225 | Ga0070668_1000702252 | 256 |
| 77 | 3300005548 | Ga0070665_100145303 | Ga0070665_1001453032 | 256 |
| 78 | 3300009978 | Ga0105148_100179 | Ga0105148_1001798 | 256 |
| 79 | 3300009982 | Ga0105147_100813 | Ga0105147_1008133 | 256 |
| 80 | 3300009986 | Ga0105033_102337 | Ga0105033_1023371 | 256 |
| 81 | 3300025923 | Ga0207681_10010863 | Ga0207681_100108636 | 256 |
| 82 | 3300025972 | Ga0207668_10037978 | Ga0207668_100379784 | 256 |
| 83 | 3300028379 | Ga0268266_10029449 | Ga0268266_100294492 | 256 |
| 84 | 3300048911 | Ga0496108_0006786 | Ga0496108_0006786_1397_2176 | 256 |
| 85 | 3300048919 | Ga0496116_0057344 | Ga0496116_0057344_32_811 | 256 |
| 86 | 3300048924 | Ga0496121_0001102 | Ga0496121_0001102_25786_26565 | 256 |
| 87 | 3300048925 | Ga0496122_0176940 | Ga0496122_0176940_386_1165 | 256 |
| 88 | 3300048928 | Ga0496125_0170879 | Ga0496125_0170879_425_1204 | 256 |
| 89 | 3300048929 | Ga0496126_0003207 | Ga0496126_0003207_19011_19790 | 256 |
| 90 | 3300049663 | Ga0501223_000006 | Ga0501223_000006_129677_130456 | 256 |
| 91 | 3300049669 | Ga0501235_006498 | Ga0501235_006498_722_1501 | 256 |
| 92 | 3300049705 | Ga0501225_0002153 | Ga0501225_0002153_3483_4262 | 256 |
| 93 | 3300049705 | Ga0501225_0002556 | Ga0501225_0002556_1908_2687 | 256 |
| 94 | 2162886007 | SwRhRL2b_contig_234738 | SwRhRL2b_0427.00002420 | 257 |
| 95 | 3300005289 | Ga0065704_10070166 | Ga0065704_1007016685 | 257 |
| 96 | 3300009011 | Ga0105251_10012765 | Ga0105251_100127655 | 257 |
| 97 | 3300009036 | Ga0105244_10000488 | Ga0105244_1000048826 | 257 |
| 98 | 3300013308 | Ga0157375_10000312 | Ga0157375_100003128 | 257 |
| 99 | 3300025735 | Ga0207713_1039960 | Ga0207713_10399603 | 257 |
| 100 | 3300042009 | Ga0439451_000134 | Ga0439451_000134_1569_2345 | 257 |
| 101 | 3300049649 | Ga0501198_001048 | Ga0501198_001048_2725_3510 | 257 |
| 102 | 3300049669 | Ga0501235_018040 | Ga0501235_018040_400_1185 | 257 |
| 103 | 3300005577 | Ga0068857_100005934 | Ga0068857_10000593410 | 258 |
| 104 | 3300026116 | Ga0207674_10010429 | Ga0207674_1001042910 | 258 |
| 105 | 3300027876 | Ga0209974_10087185 | Ga0209974_100871852 | 258 |
| 106 | 3300044735 | Ga0466968_0000001 | Ga0466968_0000001_4349_5125 | 258 |
| 107 | 3300046522 | Ga0495643_0000044 | Ga0495643_0000044_132158_132937 | 258 |
| 108 | 3300046542 | Ga0495597_0000216 | Ga0495597_0000216_31376_32155 | 258 |
| 109 | 3300046694 | Ga0495649_0052751 | Ga0495649_0052751_1041_1820 | 258 |
| 110 | 3300046810 | Ga0495660_0143329 | Ga0495660_0143329_364_1143 | 258 |
| 111 | 3300048904 | Ga0496101_0089742 | Ga0496101_0089742_969_1763 | 258 |
| 112 | 3300048905 | Ga0496102_0000178 | Ga0496102_0000178_37578_38372 | 258 |
| 113 | 3300048906 | Ga0496103_0000119 | Ga0496103_0000119_68262_69056 | 258 |
| 114 | 3300048907 | Ga0496104_0012927 | Ga0496104_0012927_784_1578 | 258 |
| 115 | 3300048908 | Ga0496105_0004516 | Ga0496105_0004516_7343_8137 | 258 |
| 116 | 3300048913 | Ga0496110_0058882 | Ga0496110_0058882_1682_2476 | 258 |
| 117 | 3300048916 | Ga0496113_0191952 | Ga0496113_0191952_295_1089 | 258 |
| 118 | 3300048917 | Ga0496114_0006234 | Ga0496114_0006234_7752_8546 | 258 |
| 119 | 3300048918 | Ga0496115_0000740 | Ga0496115_0000740_6104_6898 | 258 |
| 120 | 3300048919 | Ga0496116_0005447 | Ga0496116_0005447_6680_7474 | 258 |
| 121 | 3300048920 | Ga0496117_0000318 | Ga0496117_0000318_66299_67093 | 258 |
| 122 | 3300048921 | Ga0496118_0000186 | Ga0496118_0000186_37589_38383 | 258 |
| 123 | 3300048922 | Ga0496119_0005614 | Ga0496119_0005614_10031_10825 | 258 |
| 124 | 3300048924 | Ga0496121_0001167 | Ga0496121_0001167_758_1552 | 258 |
| 125 | 3300048925 | Ga0496122_0019002 | Ga0496122_0019002_659_1453 | 258 |
| 126 | 3300048926 | Ga0496123_0060689 | Ga0496123_0060689_70_864 | 258 |
| 127 | 3300048927 | Ga0496124_0000324 | Ga0496124_0000324_17250_18044 | 258 |
| 128 | 3300048928 | Ga0496125_0001890 | Ga0496125_0001890_17270_18064 | 258 |
| 129 | 3300048929 | Ga0496126_0001180 | Ga0496126_0001180_17251_18045 | 258 |
| 130 | iso_pu_bacteria | 2643221563 | 2643833263 | 258 |
| 131 | iso_pu_bacteria | 2643221608 | 2644054190 | 258 |
| 132 | 3300003781 | Ga0055536_1031927 | Ga0055536_10319272 | 259 |
| 133 | 3300003791 | Ga0055530_10010579 | Ga0055530_100105792 | 259 |
| 134 | 3300005288 | Ga0065714_10002650 | Ga0065714_1000265012 | 259 |
| 135 | 3300006058 | Ga0075432_10030469 | Ga0075432_100304692 | 259 |
| 136 | 3300006177 | Ga0075362_10040882 | Ga0075362_100408822 | 259 |
| 137 | 3300009036 | Ga0105244_10003086 | Ga0105244_100030869 | 259 |
| 138 | 3300009036 | Ga0105244_10034574 | Ga0105244_100345741 | 259 |
| 139 | 3300009036 | Ga0105244_10035384 | Ga0105244_100353842 | 259 |
| 140 | 3300009545 | Ga0105237_10040010 | Ga0105237_100400104 | 259 |
| 141 | 3300013100 | Ga0157373_10004285 | Ga0157373_1000428511 | 259 |
| 142 | 3300013102 | Ga0157371_10039682 | Ga0157371_100396825 | 259 |
| 143 | 3300013104 | Ga0157370_10004423 | Ga0157370_1000442312 | 259 |
| 144 | 3300013306 | Ga0163162_11255983 | Ga0163162_112559831 | 259 |
| 145 | 3300015261 | Ga0182006_1001200 | Ga0182006_100120012 | 259 |
| 146 | 3300017792 | Ga0163161_10038278 | Ga0163161_100382782 | 259 |
| 147 | 3300025298 | Ga0209050_1001181 | Ga0209050_100118128 | 259 |
| 148 | 3300025303 | Ga0209051_1001536 | Ga0209051_10015365 | 259 |
| 149 | 3300025728 | Ga0207655_1000571 | Ga0207655_100057141 | 259 |
| 150 | 3300027312 | Ga0209371_1000980 | Ga0209371_10009807 | 259 |
| 151 | 3300027907 | Ga0207428_10039735 | Ga0207428_100397352 | 259 |
| 152 | 3300027907 | Ga0207428_10047074 | Ga0207428_100470745 | 259 |
| 153 | 3300028786 | Ga0307517_10157810 | Ga0307517_101578102 | 259 |
| 154 | 3300030500 | Ga0268256_1004217 | Ga0268256_10042177 | 259 |
| 155 | 3300032004 | Ga0307414_10465899 | Ga0307414_104658992 | 259 |
| 156 | 3300041997 | Ga0439431_0000123 | Ga0439431_0000123_1468_2247 | 259 |
| 157 | 3300042003 | Ga0439443_011710 | Ga0439443_011710_461_1240 | 259 |
| 158 | 3300042116 | Ga0450912_000156 | Ga0450912_000156_605_1384 | 259 |
| 159 | 3300042435 | Ga0439434_0017935 | Ga0439434_0017935_271_1050 | 259 |
| 160 | 3300042436 | Ga0439435_0011285 | Ga0439435_0011285_1322_2101 | 259 |
| 161 | 3300046452 | Ga0495617_013157 | Ga0495617_013157_1374_2156 | 259 |
| 162 | 3300046453 | Ga0495627_009681 | Ga0495627_009681_983_1765 | 259 |
| 163 | 3300046455 | Ga0495603_0004141 | Ga0495603_0004141_7807_8589 | 259 |
| 164 | 3300046457 | Ga0495590_0010643 | Ga0495590_0010643_1045_1827 | 259 |
| 165 | 3300046458 | Ga0495591_000005 | Ga0495591_000005_63438_64226 | 259 |
| 166 | 3300046459 | Ga0495629_0143136 | Ga0495629_0143136_814_1599 | 259 |
| 167 | 3300046460 | Ga0495638_0011478 | Ga0495638_0011478_1529_2311 | 259 |
| 168 | 3300046460 | Ga0495638_0036433 | Ga0495638_0036433_1728_2516 | 259 |
| 169 | 3300046460 | Ga0495638_0054061 | Ga0495638_0054061_586_1368 | 259 |
| 170 | 3300046463 | Ga0495653_0001061 | Ga0495653_0001061_14355_15140 | 259 |
| 171 | 3300046471 | Ga0495650_0001536 | Ga0495650_0001536_16585_17367 | 259 |
| 172 | 3300046474 | Ga0495605_0082171 | Ga0495605_0082171_566_1348 | 259 |
| 173 | 3300046477 | Ga0495664_0002014 | Ga0495664_0002014_1140_1925 | 259 |
| 174 | 3300046491 | Ga0495584_0012791 | Ga0495584_0012791_2150_2932 | 259 |
| 175 | 3300046492 | Ga0495585_0000577 | Ga0495585_0000577_12340_13122 | 259 |
| 176 | 3300046500 | Ga0495596_0047251 | Ga0495596_0047251_459_1241 | 259 |
| 177 | 3300046501 | Ga0495607_0006485 | Ga0495607_0006485_5367_6149 | 259 |
| 178 | 3300046501 | Ga0495607_0052435 | Ga0495607_0052435_61_843 | 259 |
| 179 | 3300046506 | Ga0495583_0002568 | Ga0495583_0002568_9614_10396 | 259 |
| 180 | 3300046507 | Ga0495606_0000525 | Ga0495606_0000525_4638_5426 | 259 |
| 181 | 3300046507 | Ga0495606_0091208 | Ga0495606_0091208_448_1230 | 259 |
| 182 | 3300046513 | Ga0495616_0002361 | Ga0495616_0002361_1170_1952 | 259 |
| 183 | 3300046513 | Ga0495616_0022986 | Ga0495616_0022986_831_1625 | 259 |
| 184 | 3300046516 | Ga0495628_0032197 | Ga0495628_0032197_2422_3207 | 259 |
| 185 | 3300046517 | Ga0495630_0001092 | Ga0495630_0001092_4654_5439 | 259 |
| 186 | 3300046518 | Ga0495631_0000063 | Ga0495631_0000063_14888_15682 | 259 |
| 187 | 3300046519 | Ga0495632_0000058 | Ga0495632_0000058_44904_45686 | 259 |
| 188 | 3300046519 | Ga0495632_0019335 | Ga0495632_0019335_95_883 | 259 |
| 189 | 3300046519 | Ga0495632_0032441 | Ga0495632_0032441_890_1678 | 259 |
| 190 | 3300046520 | Ga0495637_0000315 | Ga0495637_0000315_21725_22507 | 259 |
| 191 | 3300046522 | Ga0495643_0000880 | Ga0495643_0000880_9729_10511 | 259 |
| 192 | 3300046523 | Ga0495644_0001098 | Ga0495644_0001098_5902_6684 | 259 |
| 193 | 3300046524 | Ga0495648_0000241 | Ga0495648_0000241_4636_5424 | 259 |
| 194 | 3300046524 | Ga0495648_0002312 | Ga0495648_0002312_11325_12107 | 259 |
| 195 | 3300046525 | Ga0495663_0000394 | Ga0495663_0000394_7376_8170 | 259 |
| 196 | 3300046528 | Ga0495642_0000003 | Ga0495642_0000003_40311_41093 | 259 |
| 197 | 3300046529 | Ga0495652_0121122 | Ga0495652_0121122_12_797 | 259 |
| 198 | 3300046530 | Ga0495654_0015638 | Ga0495654_0015638_1785_2567 | 259 |
| 199 | 3300046530 | Ga0495654_0030628 | Ga0495654_0030628_1465_2253 | 259 |
| 200 | 3300046531 | Ga0495665_0000088 | Ga0495665_0000088_11117_11902 | 259 |
| 201 | 3300046535 | Ga0495586_0111876 | Ga0495586_0111876_37_822 | 259 |
| 202 | 3300046538 | Ga0495609_0000490 | Ga0495609_0000490_21322_22104 | 259 |
| 203 | 3300046542 | Ga0495597_0008172 | Ga0495597_0008172_2889_3671 | 259 |
| 204 | 3300046543 | Ga0495645_0001816 | Ga0495645_0001816_111_896 | 259 |
| 205 | 3300046557 | Ga0495622_0003159 | Ga0495622_0003159_2489_3271 | 259 |
| 206 | 3300046558 | Ga0495633_0074262 | Ga0495633_0074262_425_1219 | 259 |
| 207 | 3300046615 | Ga0495656_0000104 | Ga0495656_0000104_12999_13781 | 259 |
| 208 | 3300046663 | Ga0495635_0007133 | Ga0495635_0007133_4259_5044 | 259 |
| 209 | 3300046664 | Ga0495659_0000116 | Ga0495659_0000116_22415_23197 | 259 |
| 210 | 3300046665 | Ga0495661_0033597 | Ga0495661_0033597_1177_1959 | 259 |
| 211 | 3300046679 | Ga0495623_0007903 | Ga0495623_0007903_263_1048 | 259 |
| 212 | 3300046680 | Ga0495646_0042176 | Ga0495646_0042176_1769_2554 | 259 |
| 213 | 3300046684 | Ga0495669_0000263 | Ga0495669_0000263_9353_10135 | 259 |
| 214 | 3300046692 | Ga0495671_0001868 | Ga0495671_0001868_8937_9719 | 259 |
| 215 | 3300046692 | Ga0495671_0016585 | Ga0495671_0016585_2659_3447 | 259 |
| 216 | 3300046694 | Ga0495649_0092547 | Ga0495649_0092547_545_1327 | 259 |
| 217 | 3300046794 | Ga0495589_0000549 | Ga0495589_0000549_21520_22302 | 259 |
| 218 | 3300046810 | Ga0495660_0000517 | Ga0495660_0000517_21322_22104 | 259 |
| 219 | 3300047315 | Ga0495581_0046960 | Ga0495581_0046960_1041_1826 | 259 |
| 220 | 3300047319 | Ga0495674_0004761 | Ga0495674_0004761_9277_10062 | 259 |
| 221 | 3300047319 | Ga0495674_0026330 | Ga0495674_0026330_2206_3030 | 259 |
| 222 | 3300047320 | Ga0495672_0000006 | Ga0495672_0000006_479236_480030 | 259 |
| 223 | 3300047320 | Ga0495672_0002680 | Ga0495672_0002680_5620_6402 | 259 |
| 224 | 3300047322 | Ga0495680_0001743 | Ga0495680_0001743_7631_8416 | 259 |
| 225 | 3300047323 | Ga0495683_0003035 | Ga0495683_0003035_8567_9349 | 259 |
| 226 | 3300047444 | Ga0495675_0097903 | Ga0495675_0097903_234_1019 | 259 |
| 227 | 3300047445 | Ga0495677_0000047 | Ga0495677_0000047_20432_21214 | 259 |
| 228 | 3300047447 | Ga0495685_013131 | Ga0495685_013131_1996_2778 | 259 |
| 229 | 3300047469 | Ga0495673_0000178 | Ga0495673_0000178_44913_45701 | 259 |
| 230 | 3300047470 | Ga0495681_0000026 | Ga0495681_0000026_86893_87681 | 259 |
| 231 | 3300047470 | Ga0495681_0025699 | Ga0495681_0025699_251_1045 | 259 |
| 232 | 3300047673 | Ga0495593_0000023 | Ga0495593_0000023_35775_36560 | 259 |
| 233 | 3300048088 | Ga0495602_0000395 | Ga0495602_0000395_38759_39544 | 259 |
| 234 | 3300048091 | Ga0495626_0000132 | Ga0495626_0000132_36797_37585 | 259 |
| 235 | 3300048091 | Ga0495626_0000522 | Ga0495626_0000522_28100_28882 | 259 |
| 236 | 3300048091 | Ga0495626_0001091 | Ga0495626_0001091_12247_13047 | 259 |
| 237 | 3300048903 | Ga0496100_0000468 | Ga0496100_0000468_12163_12948 | 259 |
| 238 | 3300048904 | Ga0496101_0000286 | Ga0496101_0000286_23233_24018 | 259 |
| 239 | 3300048904 | Ga0496101_0006180 | Ga0496101_0006180_5000_5800 | 259 |
| 240 | 3300048905 | Ga0496102_0000603 | Ga0496102_0000603_28710_29495 | 259 |
| 241 | 3300048906 | Ga0496103_0001250 | Ga0496103_0001250_12807_13592 | 259 |
| 242 | 3300048907 | Ga0496104_0113755 | Ga0496104_0113755_457_1242 | 259 |
| 243 | 3300048908 | Ga0496105_0004706 | Ga0496105_0004706_1830_2615 | 259 |
| 244 | 3300048909 | Ga0496106_0007807 | Ga0496106_0007807_5607_6392 | 259 |
| 245 | 3300048912 | Ga0496109_0038989 | Ga0496109_0038989_2595_3395 | 259 |
| 246 | 3300048916 | Ga0496113_0000915 | Ga0496113_0000915_4873_5673 | 259 |
| 247 | 3300048919 | Ga0496116_0032455 | Ga0496116_0032455_1329_2111 | 259 |
| 248 | 3300048921 | Ga0496118_0090878 | Ga0496118_0090878_271_1056 | 259 |
| 249 | 3300048924 | Ga0496121_0008424 | Ga0496121_0008424_4506_5288 | 259 |
| 250 | 3300048925 | Ga0496122_0000552 | Ga0496122_0000552_22551_23351 | 259 |
| 251 | 3300048925 | Ga0496122_0000662 | Ga0496122_0000662_48507_49301 | 259 |
| 252 | 3300048925 | Ga0496122_0000710 | Ga0496122_0000710_55233_56030 | 259 |
| 253 | 3300048925 | Ga0496122_0074283 | Ga0496122_0074283_220_1002 | 259 |
| 254 | 3300048926 | Ga0496123_0000104 | Ga0496123_0000104_112194_112991 | 259 |
| 255 | 3300048926 | Ga0496123_0000478 | Ga0496123_0000478_48506_49300 | 259 |
| 256 | 3300048926 | Ga0496123_0001031 | Ga0496123_0001031_22558_23358 | 259 |
| 257 | 3300048926 | Ga0496123_0012881 | Ga0496123_0012881_3801_4583 | 259 |
| 258 | 3300048926 | Ga0496123_0123807 | Ga0496123_0123807_197_982 | 259 |
| 259 | 3300048927 | Ga0496124_0000224 | Ga0496124_0000224_4703_5485 | 259 |
| 260 | 3300048927 | Ga0496124_0000569 | Ga0496124_0000569_11245_12039 | 259 |
| 261 | 3300048928 | Ga0496125_0002211 | Ga0496125_0002211_22617_23417 | 259 |
| 262 | 3300048928 | Ga0496125_0005275 | Ga0496125_0005275_3335_4132 | 259 |
| 263 | 3300048928 | Ga0496125_0026107 | Ga0496125_0026107_2278_3063 | 259 |
| 264 | 3300048929 | Ga0496126_0019383 | Ga0496126_0019383_5536_6321 | 259 |
| 265 | 3300049459 | Ga0495678_007230 | Ga0495678_007230_4632_5420 | 259 |
| 266 | 3300049459 | Ga0495678_030282 | Ga0495678_030282_1403_2185 | 259 |
| 267 | 3300049460 | Ga0495682_0000926 | Ga0495682_0000926_9803_10585 | 259 |
| 268 | 3300050514 | nmdc:mga08x19_67195_c1 | nmdc:mga08x19_67195_c1_1030_1812 | 259 |
| 269 | 3300053734 | Ga0500565_003122 | Ga0500565_003122_21_815 | 259 |
| 270 | iso_pu_bacteria | 2791355137 | 2792837778 | 259 |
| 271 | iso_pu_bacteria | 2904615490 | 2904624919 | 259 |
| 272 | iso_pu_bacteria | 2987605356 | 2987608645 | 259 |
| 273 | iso_pu_bacteria | 8055266321 | 8055273453 | 259 |
| 274 | 2162886007 | SwRhRL2b_contig_76937 | SwRhRL2b_0437.00007960 | 260 |
| 275 | 3300001904 | JGI24736J21556_1000161 | JGI24736J21556_100016111 | 260 |
| 276 | 3300001904 | JGI24736J21556_1013055 | JGI24736J21556_10130552 | 260 |
| 277 | 3300001915 | JGI24741J21665_1002198 | JGI24741J21665_10021986 | 260 |
| 278 | 3300001979 | JGI24740J21852_10033136 | JGI24740J21852_100331361 | 260 |
| 279 | 3300001989 | JGI24739J22299_10004558 | JGI24739J22299_100045586 | 260 |
| 280 | 3300001989 | JGI24739J22299_10030824 | JGI24739J22299_100308243 | 260 |
| 281 | 3300001990 | JGI24737J22298_10023167 | JGI24737J22298_100231672 | 260 |
| 282 | 3300002067 | JGI24735J21928_10003750 | JGI24735J21928_100037507 | 260 |
| 283 | 3300002074 | JGI24748J21848_1007295 | JGI24748J21848_10072952 | 260 |
| 284 | 3300005289 | Ga0065704_10003385 | Ga0065704_100033854 | 260 |
| 285 | 3300005327 | Ga0070658_10149743 | Ga0070658_101497432 | 260 |
| 286 | 3300005329 | Ga0070683_100169475 | Ga0070683_1001694753 | 260 |
| 287 | 3300005331 | Ga0070670_100005269 | Ga0070670_1000052698 | 260 |
| 288 | 3300005331 | Ga0070670_100053091 | Ga0070670_1000530911 | 260 |
| 289 | 3300005331 | Ga0070670_100363421 | Ga0070670_1003634212 | 260 |
| 290 | 3300005337 | Ga0070682_100094383 | Ga0070682_1000943832 | 260 |
| 291 | 3300005347 | Ga0070668_100042133 | Ga0070668_1000421333 | 260 |
| 292 | 3300005353 | Ga0070669_100000199 | Ga0070669_10000019947 | 260 |
| 293 | 3300005355 | Ga0070671_100002761 | Ga0070671_10000276113 | 260 |
| 294 | 3300005355 | Ga0070671_100121853 | Ga0070671_1001218531 | 260 |
| 295 | 3300005365 | Ga0070688_100066117 | Ga0070688_1000661173 | 260 |
| 296 | 3300005366 | Ga0070659_100020786 | Ga0070659_1000207863 | 260 |
| 297 | 3300005366 | Ga0070659_100160386 | Ga0070659_1001603862 | 260 |
| 298 | 3300005367 | Ga0070667_100003356 | Ga0070667_1000033569 | 260 |
| 299 | 3300005367 | Ga0070667_100039034 | Ga0070667_1000390342 | 260 |
| 300 | 3300005455 | Ga0070663_100029341 | Ga0070663_1000293413 | 260 |
| 301 | 3300005455 | Ga0070663_100156164 | Ga0070663_1001561642 | 260 |
| 302 | 3300005455 | Ga0070663_100202335 | Ga0070663_1002023352 | 260 |
| 303 | 3300005466 | Ga0070685_10045245 | Ga0070685_100452452 | 260 |
| 304 | 3300005535 | Ga0070684_100074586 | Ga0070684_1000745863 | 260 |
| 305 | 3300005539 | Ga0068853_100008832 | Ga0068853_1000088324 | 260 |
| 306 | 3300005539 | Ga0068853_100038004 | Ga0068853_1000380042 | 260 |
| 307 | 3300005548 | Ga0070665_100000163 | Ga0070665_10000016342 | 260 |
| 308 | 3300005548 | Ga0070665_100251466 | Ga0070665_1002514662 | 260 |
| 309 | 3300005548 | Ga0070665_100362972 | Ga0070665_1003629723 | 260 |
| 310 | 3300005563 | Ga0068855_100348154 | Ga0068855_1003481542 | 260 |
| 311 | 3300005577 | Ga0068857_100049217 | Ga0068857_1000492174 | 260 |
| 312 | 3300005577 | Ga0068857_100269789 | Ga0068857_1002697893 | 260 |
| 313 | 3300005577 | Ga0068857_100493465 | Ga0068857_1004934651 | 260 |
| 314 | 3300005578 | Ga0068854_100012184 | Ga0068854_1000121844 | 260 |
| 315 | 3300005578 | Ga0068854_100041136 | Ga0068854_1000411363 | 260 |
| 316 | 3300005616 | Ga0068852_100036670 | Ga0068852_1000366702 | 260 |
| 317 | 3300005617 | Ga0068859_100009146 | Ga0068859_10000914610 | 260 |
| 318 | 3300005618 | Ga0068864_100005874 | Ga0068864_1000058746 | 260 |
| 319 | 3300005719 | Ga0068861_100000013 | Ga0068861_10000001349 | 260 |
| 320 | 3300005834 | Ga0068851_10028451 | Ga0068851_100284512 | 260 |
| 321 | 3300005834 | Ga0068851_10032321 | Ga0068851_100323212 | 260 |
| 322 | 3300005841 | Ga0068863_100000079 | Ga0068863_1000000797 | 260 |
| 323 | 3300005841 | Ga0068863_100038322 | Ga0068863_1000383223 | 260 |
| 324 | 3300005842 | Ga0068858_100000006 | Ga0068858_1000000065 | 260 |
| 325 | 3300005842 | Ga0068858_100112884 | Ga0068858_1001128843 | 260 |
| 326 | 3300005843 | Ga0068860_100611340 | Ga0068860_1006113401 | 260 |
| 327 | 3300005844 | Ga0068862_100006576 | Ga0068862_1000065763 | 260 |
| 328 | 3300005937 | Ga0081455_10000277 | Ga0081455_1000027725 | 260 |
| 329 | 3300006931 | Ga0097620_100009146 | Ga0097620_1000091464 | 260 |
| 330 | 3300009011 | Ga0105251_10001177 | Ga0105251_100011771 | 260 |
| 331 | 3300009093 | Ga0105240_10014797 | Ga0105240_1001479710 | 260 |
| 332 | 3300009101 | Ga0105247_10017570 | Ga0105247_100175703 | 260 |
| 333 | 3300009177 | Ga0105248_10002260 | Ga0105248_100022606 | 260 |
| 334 | 3300009177 | Ga0105248_10002802 | Ga0105248_1000280219 | 260 |
| 335 | 3300009177 | Ga0105248_10002919 | Ga0105248_100029196 | 260 |
| 336 | 3300009177 | Ga0105248_10003077 | Ga0105248_1000307715 | 260 |
| 337 | 3300009177 | Ga0105248_10008862 | Ga0105248_100088629 | 260 |
| 338 | 3300009177 | Ga0105248_10017174 | Ga0105248_100171748 | 260 |
| 339 | 3300009177 | Ga0105248_10137617 | Ga0105248_101376173 | 260 |
| 340 | 3300009545 | Ga0105237_10009160 | Ga0105237_1000916010 | 260 |
| 341 | 3300009545 | Ga0105237_10262397 | Ga0105237_102623972 | 260 |
| 342 | 3300009545 | Ga0105237_10309150 | Ga0105237_103091502 | 260 |
| 343 | 3300009551 | Ga0105238_10016961 | Ga0105238_100169614 | 260 |
| 344 | 3300009551 | Ga0105238_10027708 | Ga0105238_100277084 | 260 |
| 345 | 3300009551 | Ga0105238_10918008 | Ga0105238_109180081 | 260 |
| 346 | 3300010375 | Ga0105239_10010007 | Ga0105239_1001000710 | 260 |
| 347 | 3300013104 | Ga0157370_10785970 | Ga0157370_107859701 | 260 |
| 348 | 3300013306 | Ga0163162_10273266 | Ga0163162_102732662 | 260 |
| 349 | 3300013306 | Ga0163162_10493256 | Ga0163162_104932562 | 260 |
| 350 | 3300014325 | Ga0163163_10099867 | Ga0163163_100998673 | 260 |
| 351 | 3300014325 | Ga0163163_10447421 | Ga0163163_104474212 | 260 |
| 352 | 3300014326 | Ga0157380_10000936 | Ga0157380_1000093616 | 260 |
| 353 | 3300014968 | Ga0157379_10053801 | Ga0157379_100538013 | 260 |
| 354 | 3300014968 | Ga0157379_10087961 | Ga0157379_100879613 | 260 |
| 355 | 3300017792 | Ga0163161_10001170 | Ga0163161_1000117011 | 260 |
| 356 | 3300025321 | Ga0207656_10034955 | Ga0207656_100349552 | 260 |
| 357 | 3300025735 | Ga0207713_1000436 | Ga0207713_10004369 | 260 |
| 358 | 3300025904 | Ga0207647_10074446 | Ga0207647_100744462 | 260 |
| 359 | 3300025911 | Ga0207654_10004961 | Ga0207654_100049617 | 260 |
| 360 | 3300025913 | Ga0207695_10009115 | Ga0207695_1000911510 | 260 |
| 361 | 3300025913 | Ga0207695_10016174 | Ga0207695_100161746 | 260 |
| 362 | 3300025914 | Ga0207671_10001485 | Ga0207671_100014853 | 260 |
| 363 | 3300025914 | Ga0207671_10002277 | Ga0207671_1000227713 | 260 |
| 364 | 3300025919 | Ga0207657_10100941 | Ga0207657_101009413 | 260 |
| 365 | 3300025923 | Ga0207681_10001570 | Ga0207681_1000157013 | 260 |
| 366 | 3300025924 | Ga0207694_10002056 | Ga0207694_1000205610 | 260 |
| 367 | 3300025924 | Ga0207694_10019165 | Ga0207694_100191654 | 260 |
| 368 | 3300025924 | Ga0207694_10045025 | Ga0207694_100450254 | 260 |
| 369 | 3300025925 | Ga0207650_10086423 | Ga0207650_100864232 | 260 |
| 370 | 3300025925 | Ga0207650_10498124 | Ga0207650_104981241 | 260 |
| 371 | 3300025931 | Ga0207644_10000234 | Ga0207644_100002343 | 260 |
| 372 | 3300025931 | Ga0207644_10144527 | Ga0207644_101445272 | 260 |
| 373 | 3300025932 | Ga0207690_10170283 | Ga0207690_101702833 | 260 |
| 374 | 3300025933 | Ga0207706_10112128 | Ga0207706_101121282 | 260 |
| 375 | 3300025941 | Ga0207711_10005039 | Ga0207711_100050398 | 260 |
| 376 | 3300025941 | Ga0207711_10007885 | Ga0207711_100078854 | 260 |
| 377 | 3300025941 | Ga0207711_10016940 | Ga0207711_100169405 | 260 |
| 378 | 3300025941 | Ga0207711_10034093 | Ga0207711_100340935 | 260 |
| 379 | 3300025941 | Ga0207711_10124686 | Ga0207711_101246862 | 260 |
| 380 | 3300025944 | Ga0207661_10637912 | Ga0207661_106379121 | 260 |
| 381 | 3300025949 | Ga0207667_10002662 | Ga0207667_1000266216 | 260 |
| 382 | 3300025949 | Ga0207667_10136214 | Ga0207667_101362143 | 260 |
| 383 | 3300025961 | Ga0207712_10104438 | Ga0207712_101044382 | 260 |
| 384 | 3300025972 | Ga0207668_10004884 | Ga0207668_100048847 | 260 |
| 385 | 3300025981 | Ga0207640_10031064 | Ga0207640_100310644 | 260 |
| 386 | 3300025981 | Ga0207640_10059208 | Ga0207640_100592083 | 260 |
| 387 | 3300025981 | Ga0207640_10136182 | Ga0207640_101361822 | 260 |
| 388 | 3300025986 | Ga0207658_10005349 | Ga0207658_100053496 | 260 |
| 389 | 3300025986 | Ga0207658_10008945 | Ga0207658_100089452 | 260 |
| 390 | 3300026035 | Ga0207703_10000469 | Ga0207703_100004697 | 260 |
| 391 | 3300026035 | Ga0207703_10458398 | Ga0207703_104583982 | 260 |
| 392 | 3300026041 | Ga0207639_10001943 | Ga0207639_100019432 | 260 |
| 393 | 3300026041 | Ga0207639_10013661 | Ga0207639_100136613 | 260 |
| 394 | 3300026041 | Ga0207639_10014722 | Ga0207639_100147224 | 260 |
| 395 | 3300026041 | Ga0207639_10173906 | Ga0207639_101739061 | 260 |
| 396 | 3300026067 | Ga0207678_10000276 | Ga0207678_1000027643 | 260 |
| 397 | 3300026067 | Ga0207678_10005102 | Ga0207678_100051024 | 260 |
| 398 | 3300026078 | Ga0207702_10001216 | Ga0207702_100012166 | 260 |
| 399 | 3300026078 | Ga0207702_10003524 | Ga0207702_100035248 | 260 |
| 400 | 3300026088 | Ga0207641_10000003 | Ga0207641_10000003439 | 260 |
| 401 | 3300026088 | Ga0207641_10003659 | Ga0207641_1000365910 | 260 |
| 402 | 3300026088 | Ga0207641_10296517 | Ga0207641_102965171 | 260 |
| 403 | 3300026095 | Ga0207676_10000734 | Ga0207676_100007345 | 260 |
| 404 | 3300026095 | Ga0207676_10115322 | Ga0207676_101153223 | 260 |
| 405 | 3300026116 | Ga0207674_10266029 | Ga0207674_102660293 | 260 |
| 406 | 3300026118 | Ga0207675_100000054 | Ga0207675_10000005448 | 260 |
| 407 | 3300026142 | Ga0207698_10142392 | Ga0207698_101423922 | 260 |
| 408 | 3300026142 | Ga0207698_10637334 | Ga0207698_106373342 | 260 |
| 409 | 3300028379 | Ga0268266_10000205 | Ga0268266_1000020530 | 260 |
| 410 | 3300028379 | Ga0268266_10297280 | Ga0268266_102972803 | 260 |
| 411 | 3300028381 | Ga0268264_10005055 | Ga0268264_100050558 | 260 |
| 412 | 3300028381 | Ga0268264_10571665 | Ga0268264_105716651 | 260 |
| 413 | 3300031548 | Ga0307408_100001178 | Ga0307408_10000117814 | 260 |
| 414 | 3300031548 | Ga0307408_100647280 | Ga0307408_1006472802 | 260 |
| 415 | 3300031731 | Ga0307405_10129104 | Ga0307405_101291043 | 260 |
| 416 | 3300031731 | Ga0307405_10227926 | Ga0307405_102279261 | 260 |
| 417 | 3300031731 | Ga0307405_10238426 | Ga0307405_102384262 | 260 |
| 418 | 3300031824 | Ga0307413_10087497 | Ga0307413_100874972 | 260 |
| 419 | 3300031852 | Ga0307410_10074421 | Ga0307410_100744212 | 260 |
| 420 | 3300031901 | Ga0307406_10006401 | Ga0307406_100064012 | 260 |
| 421 | 3300031901 | Ga0307406_10243400 | Ga0307406_102434002 | 260 |
| 422 | 3300031911 | Ga0307412_10141524 | Ga0307412_101415242 | 260 |
| 423 | 3300031911 | Ga0307412_10177197 | Ga0307412_101771972 | 260 |
| 424 | 3300031911 | Ga0307412_10213754 | Ga0307412_102137542 | 260 |
| 425 | 3300031995 | Ga0307409_100025575 | Ga0307409_1000255753 | 260 |
| 426 | 3300031995 | Ga0307409_100098091 | Ga0307409_1000980913 | 260 |
| 427 | 3300032002 | Ga0307416_100013740 | Ga0307416_1000137406 | 260 |
| 428 | 3300032002 | Ga0307416_100235887 | Ga0307416_1002358872 | 260 |
| 429 | 3300032004 | Ga0307414_10029153 | Ga0307414_100291533 | 260 |
| 430 | 3300032004 | Ga0307414_10147032 | Ga0307414_101470322 | 260 |
| 431 | 3300032004 | Ga0307414_10320861 | Ga0307414_103208612 | 260 |
| 432 | 3300032005 | Ga0307411_10010906 | Ga0307411_100109066 | 260 |
| 433 | 3300032005 | Ga0307411_10118785 | Ga0307411_101187852 | 260 |
| 434 | 3300035113 | Ga0373936_0000438 | Ga0373936_0000438_11429_12235 | 260 |
| 435 | 3300047472 | Ga0495686_0087546 | Ga0495686_0087546_775_1560 | 260 |
| 436 | 3300048904 | Ga0496101_0192409 | Ga0496101_0192409_203_997 | 260 |
| 437 | 3300048905 | Ga0496102_0014478 | Ga0496102_0014478_2430_3224 | 260 |
| 438 | 3300048905 | Ga0496102_0066791 | Ga0496102_0066791_435_1232 | 260 |
| 439 | 3300048905 | Ga0496102_0621632 | Ga0496102_0621632_103_897 | 260 |
| 440 | 3300048906 | Ga0496103_0025754 | Ga0496103_0025754_2210_3004 | 260 |
| 441 | 3300048906 | Ga0496103_0246627 | Ga0496103_0246627_94_888 | 260 |
| 442 | 3300048912 | Ga0496109_0168773 | Ga0496109_0168773_1242_2036 | 260 |
| 443 | 3300048913 | Ga0496110_0014851 | Ga0496110_0014851_1705_2499 | 260 |
| 444 | 3300048913 | Ga0496110_0044082 | Ga0496110_0044082_528_1322 | 260 |
| 445 | 3300048913 | Ga0496110_0200022 | Ga0496110_0200022_395_1177 | 260 |
| 446 | 3300048916 | Ga0496113_0057702 | Ga0496113_0057702_1779_2573 | 260 |
| 447 | 3300048917 | Ga0496114_0053749 | Ga0496114_0053749_1509_2291 | 260 |
| 448 | 3300048918 | Ga0496115_0352547 | Ga0496115_0352547_55_837 | 260 |
| 449 | 3300048919 | Ga0496116_0000078 | Ga0496116_0000078_128460_129254 | 260 |
| 450 | 3300048919 | Ga0496116_0027139 | Ga0496116_0027139_2855_3652 | 260 |
| 451 | 3300048919 | Ga0496116_0142241 | Ga0496116_0142241_201_995 | 260 |
| 452 | 3300048920 | Ga0496117_0011188 | Ga0496117_0011188_2249_3046 | 260 |
| 453 | 3300048920 | Ga0496117_0021007 | Ga0496117_0021007_464_1258 | 260 |
| 454 | 3300048920 | Ga0496117_0083145 | Ga0496117_0083145_656_1450 | 260 |
| 455 | 3300048921 | Ga0496118_0004578 | Ga0496118_0004578_6320_7117 | 260 |
| 456 | 3300048921 | Ga0496118_0009472 | Ga0496118_0009472_531_1325 | 260 |
| 457 | 3300048921 | Ga0496118_0075970 | Ga0496118_0075970_1478_2272 | 260 |
| 458 | 3300048922 | Ga0496119_0080647 | Ga0496119_0080647_446_1243 | 260 |
| 459 | 3300048922 | Ga0496119_0089794 | Ga0496119_0089794_813_1607 | 260 |
| 460 | 3300048924 | Ga0496121_0000058 | Ga0496121_0000058_238602_239399 | 260 |
| 461 | 3300048924 | Ga0496121_0000170 | Ga0496121_0000170_5324_6118 | 260 |
| 462 | 3300048924 | Ga0496121_0021736 | Ga0496121_0021736_5304_6098 | 260 |
| 463 | 3300048924 | Ga0496121_0022199 | Ga0496121_0022199_10_804 | 260 |
| 464 | 3300048924 | Ga0496121_0207385 | Ga0496121_0207385_333_1127 | 260 |
| 465 | 3300048925 | Ga0496122_0003669 | Ga0496122_0003669_8868_9662 | 260 |
| 466 | 3300048925 | Ga0496122_0026032 | Ga0496122_0026032_3783_4577 | 260 |
| 467 | 3300048926 | Ga0496123_0001607 | Ga0496123_0001607_22010_22804 | 260 |
| 468 | 3300048926 | Ga0496123_0002385 | Ga0496123_0002385_9879_10673 | 260 |
| 469 | 3300048926 | Ga0496123_0021639 | Ga0496123_0021639_821_1615 | 260 |
| 470 | 3300048927 | Ga0496124_0002768 | Ga0496124_0002768_5557_6351 | 260 |
| 471 | 3300048927 | Ga0496124_0011124 | Ga0496124_0011124_6820_7614 | 260 |
| 472 | 3300048927 | Ga0496124_0062282 | Ga0496124_0062282_1778_2572 | 260 |
| 473 | 3300048927 | Ga0496124_0111667 | Ga0496124_0111667_645_1439 | 260 |
| 474 | 3300048928 | Ga0496125_0008335 | Ga0496125_0008335_959_1753 | 260 |
| 475 | 3300048928 | Ga0496125_0120535 | Ga0496125_0120535_800_1594 | 260 |
| 476 | 3300048928 | Ga0496125_0120715 | Ga0496125_0120715_581_1375 | 260 |
| 477 | 3300048928 | Ga0496125_0252529 | Ga0496125_0252529_39_833 | 260 |
| 478 | 3300048929 | Ga0496126_0000058 | Ga0496126_0000058_186198_186992 | 260 |
| 479 | 3300048929 | Ga0496126_0002582 | Ga0496126_0002582_6897_7679 | 260 |
| 480 | 3300048929 | Ga0496126_0033848 | Ga0496126_0033848_3555_4349 | 260 |
| 481 | 3300049663 | Ga0501223_000024 | Ga0501223_000024_29352_30155 | 260 |
| 482 | 3300049663 | Ga0501223_000047 | Ga0501223_000047_12987_13769 | 260 |
| 483 | 3300049664 | Ga0501224_000001 | Ga0501224_000001_52505_53308 | 260 |
| 484 | 3300049664 | Ga0501224_000017 | Ga0501224_000017_58250_59032 | 260 |
| 485 | 3300049668 | Ga0501233_000034 | Ga0501233_000034_4166_4948 | 260 |
| 486 | 3300049668 | Ga0501233_001364 | Ga0501233_001364_379_1182 | 260 |
| 487 | 3300049669 | Ga0501235_000125 | Ga0501235_000125_3067_3849 | 260 |
| 488 | 3300049705 | Ga0501225_0000007 | Ga0501225_0000007_58256_59038 | 260 |
| 489 | 3300049705 | Ga0501225_0000095 | Ga0501225_0000095_6534_7337 | 260 |
| 490 | 3300049707 | Ga0501234_001781 | Ga0501234_001781_1135_1917 | 260 |
| 491 | 3300049707 | Ga0501234_002623 | Ga0501234_002623_1247_2050 | 260 |
| 492 | 3300049853 | Ga0501226_000029 | Ga0501226_000029_52469_53272 | 260 |
| 493 | 3300049853 | Ga0501226_000040 | Ga0501226_000040_37827_38609 | 260 |
| 494 | 3300005335 | Ga0070666_10064196 | Ga0070666_100641962 | 261 |
| 495 | 3300005344 | Ga0070661_100215689 | Ga0070661_1002156891 | 261 |
| 496 | 3300005366 | Ga0070659_100375517 | Ga0070659_1003755172 | 261 |
| 497 | 3300005367 | Ga0070667_100001345 | Ga0070667_1000013458 | 261 |
| 498 | 3300005455 | Ga0070663_100008467 | Ga0070663_1000084675 | 261 |
| 499 | 3300005458 | Ga0070681_10316084 | Ga0070681_103160842 | 261 |
| 500 | 3300005539 | Ga0068853_100081608 | Ga0068853_1000816082 | 261 |
| 501 | 3300005548 | Ga0070665_100024754 | Ga0070665_1000247544 | 261 |
| 502 | 3300005548 | Ga0070665_100348447 | Ga0070665_1003484472 | 261 |
| 503 | 3300005563 | Ga0068855_100011385 | Ga0068855_1000113856 | 261 |
| 504 | 3300005563 | Ga0068855_100016407 | Ga0068855_1000164075 | 261 |
| 505 | 3300005564 | Ga0070664_100356643 | Ga0070664_1003566432 | 261 |
| 506 | 3300005614 | Ga0068856_100011037 | Ga0068856_1000110373 | 261 |
| 507 | 3300005614 | Ga0068856_100177892 | Ga0068856_1001778921 | 261 |
| 508 | 3300005614 | Ga0068856_100390290 | Ga0068856_1003902902 | 261 |
| 509 | 3300005616 | Ga0068852_100078619 | Ga0068852_1000786193 | 261 |
| 510 | 3300005834 | Ga0068851_10157338 | Ga0068851_101573382 | 261 |
| 511 | 3300005841 | Ga0068863_100000024 | Ga0068863_10000002479 | 261 |
| 512 | 3300005842 | Ga0068858_100097047 | Ga0068858_1000970472 | 261 |
| 513 | 3300005843 | Ga0068860_100000098 | Ga0068860_10000009899 | 261 |
| 514 | 3300009093 | Ga0105240_10037122 | Ga0105240_100371222 | 261 |
| 515 | 3300009093 | Ga0105240_10079295 | Ga0105240_100792952 | 261 |
| 516 | 3300009093 | Ga0105240_10109613 | Ga0105240_101096134 | 261 |
| 517 | 3300009093 | Ga0105240_10203406 | Ga0105240_102034064 | 261 |
| 518 | 3300009174 | Ga0105241_10007498 | Ga0105241_100074984 | 261 |
| 519 | 3300009174 | Ga0105241_10202614 | Ga0105241_102026142 | 261 |
| 520 | 3300009174 | Ga0105241_10353425 | Ga0105241_103534252 | 261 |
| 521 | 3300009177 | Ga0105248_10180479 | Ga0105248_101804793 | 261 |
| 522 | 3300009545 | Ga0105237_10025497 | Ga0105237_100254975 | 261 |
| 523 | 3300009545 | Ga0105237_10084753 | Ga0105237_100847533 | 261 |
| 524 | 3300009545 | Ga0105237_10292846 | Ga0105237_102928462 | 261 |
| 525 | 3300009551 | Ga0105238_10005688 | Ga0105238_100056888 | 261 |
| 526 | 3300009551 | Ga0105238_10008626 | Ga0105238_100086267 | 261 |
| 527 | 3300009551 | Ga0105238_10060233 | Ga0105238_100602331 | 261 |
| 528 | 3300009551 | Ga0105238_10087228 | Ga0105238_100872282 | 261 |
| 529 | 3300010375 | Ga0105239_10015872 | Ga0105239_100158725 | 261 |
| 530 | 3300010375 | Ga0105239_10056693 | Ga0105239_100566933 | 261 |
| 531 | 3300010375 | Ga0105239_10417373 | Ga0105239_104173732 | 261 |
| 532 | 3300010375 | Ga0105239_10461497 | Ga0105239_104614971 | 261 |
| 533 | 3300011119 | Ga0105246_10089413 | Ga0105246_100894133 | 261 |
| 534 | 3300013306 | Ga0163162_10214455 | Ga0163162_102144552 | 261 |
| 535 | 3300013307 | Ga0157372_10052895 | Ga0157372_100528953 | 261 |
| 536 | 3300025903 | Ga0207680_10002242 | Ga0207680_100022428 | 261 |
| 537 | 3300025904 | Ga0207647_10115034 | Ga0207647_101150342 | 261 |
| 538 | 3300025911 | Ga0207654_10039677 | Ga0207654_100396772 | 261 |
| 539 | 3300025911 | Ga0207654_10170642 | Ga0207654_101706421 | 261 |
| 540 | 3300025911 | Ga0207654_10242639 | Ga0207654_102426391 | 261 |
| 541 | 3300025913 | Ga0207695_10065563 | Ga0207695_100655633 | 261 |
| 542 | 3300025913 | Ga0207695_10117194 | Ga0207695_101171942 | 261 |
| 543 | 3300025914 | Ga0207671_10119332 | Ga0207671_101193322 | 261 |
| 544 | 3300025924 | Ga0207694_10001925 | Ga0207694_100019258 | 261 |
| 545 | 3300025924 | Ga0207694_10006101 | Ga0207694_100061013 | 261 |
| 546 | 3300025924 | Ga0207694_10008471 | Ga0207694_100084714 | 261 |
| 547 | 3300025933 | Ga0207706_10050916 | Ga0207706_100509163 | 261 |
| 548 | 3300025949 | Ga0207667_10014538 | Ga0207667_100145387 | 261 |
| 549 | 3300025949 | Ga0207667_10141566 | Ga0207667_101415661 | 261 |
| 550 | 3300025949 | Ga0207667_10554020 | Ga0207667_105540202 | 261 |
| 551 | 3300025981 | Ga0207640_10072879 | Ga0207640_100728793 | 261 |
| 552 | 3300025986 | Ga0207658_10002472 | Ga0207658_100024724 | 261 |
| 553 | 3300026041 | Ga0207639_10011557 | Ga0207639_100115574 | 261 |
| 554 | 3300026067 | Ga0207678_10004048 | Ga0207678_100040484 | 261 |
| 555 | 3300026067 | Ga0207678_10316616 | Ga0207678_103166162 | 261 |
| 556 | 3300026078 | Ga0207702_10188092 | Ga0207702_101880922 | 261 |
| 557 | 3300026078 | Ga0207702_10321642 | Ga0207702_103216422 | 261 |
| 558 | 3300026078 | Ga0207702_10414926 | Ga0207702_104149262 | 261 |
| 559 | 3300026088 | Ga0207641_10000068 | Ga0207641_1000006897 | 261 |
| 560 | 3300026116 | Ga0207674_10441260 | Ga0207674_104412602 | 261 |
| 561 | 3300026142 | Ga0207698_10048340 | Ga0207698_100483402 | 261 |
| 562 | 3300028379 | Ga0268266_10058915 | Ga0268266_100589152 | 261 |
| 563 | 3300028381 | Ga0268264_10000129 | Ga0268264_10000129115 | 261 |
| 564 | 3300048923 | Ga0496120_0081402 | Ga0496120_0081402_449_1252 | 261 |
| 565 | 3300048926 | Ga0496123_0006685 | Ga0496123_0006685_7143_7946 | 261 |
| 566 | 3300048927 | Ga0496124_0021301 | Ga0496124_0021301_1018_1821 | 261 |
| 567 | 3300053140 | Ga0500573_0000027 | Ga0500573_0000027_84156_84953 | 261 |
| 568 | 3300053146 | Ga0500588_0007022 | Ga0500588_0007022_1731_2558 | 261 |
| 569 | 3300001915 | JGI24741J21665_1000082 | JGI24741J21665_100008220 | 262 |
| 570 | 3300001979 | JGI24740J21852_10000126 | JGI24740J21852_1000012620 | 262 |
| 571 | 3300001990 | JGI24737J22298_10000176 | JGI24737J22298_1000017614 | 262 |
| 572 | 3300003781 | Ga0055536_1000120 | Ga0055536_100012063 | 262 |
| 573 | 3300003791 | Ga0055530_10014624 | Ga0055530_100146241 | 262 |
| 574 | 3300005289 | Ga0065704_10224241 | Ga0065704_102242412 | 262 |
| 575 | 3300005295 | Ga0065707_10003099 | Ga0065707_100030993 | 262 |
| 576 | 3300005295 | Ga0065707_10095962 | Ga0065707_100959623 | 262 |
| 577 | 3300005329 | Ga0070683_100467629 | Ga0070683_1004676292 | 262 |
| 578 | 3300005339 | Ga0070660_100001742 | Ga0070660_10000174214 | 262 |
| 579 | 3300005343 | Ga0070687_100069539 | Ga0070687_1000695392 | 262 |
| 580 | 3300005344 | Ga0070661_100002644 | Ga0070661_1000026444 | 262 |
| 581 | 3300005366 | Ga0070659_100003240 | Ga0070659_1000032402 | 262 |
| 582 | 3300005455 | Ga0070663_100073807 | Ga0070663_1000738072 | 262 |
| 583 | 3300005535 | Ga0070684_100109217 | Ga0070684_1001092173 | 262 |
| 584 | 3300005548 | Ga0070665_100204500 | Ga0070665_1002045003 | 262 |
| 585 | 3300005564 | Ga0070664_100004548 | Ga0070664_1000045484 | 262 |
| 586 | 3300005614 | Ga0068856_100015994 | Ga0068856_1000159947 | 262 |
| 587 | 3300005617 | Ga0068859_100097393 | Ga0068859_1000973933 | 262 |
| 588 | 3300005617 | Ga0068859_100250659 | Ga0068859_1002506591 | 262 |
| 589 | 3300005618 | Ga0068864_100002937 | Ga0068864_1000029372 | 262 |
| 590 | 3300005719 | Ga0068861_100226479 | Ga0068861_1002264792 | 262 |
| 591 | 3300005834 | Ga0068851_10013675 | Ga0068851_100136754 | 262 |
| 592 | 3300005842 | Ga0068858_100003036 | Ga0068858_1000030364 | 262 |
| 593 | 3300005842 | Ga0068858_100138053 | Ga0068858_1001380532 | 262 |
| 594 | 3300005842 | Ga0068858_100788209 | Ga0068858_1007882092 | 262 |
| 595 | 3300005843 | Ga0068860_100000474 | Ga0068860_10000047431 | 262 |
| 596 | 3300005844 | Ga0068862_100000023 | Ga0068862_100000023191 | 262 |
| 597 | 3300006931 | Ga0097620_100097392 | Ga0097620_1000973923 | 262 |
| 598 | 3300006931 | Ga0097620_100250650 | Ga0097620_1002506501 | 262 |
| 599 | 3300009101 | Ga0105247_10002120 | Ga0105247_100021202 | 262 |
| 600 | 3300009174 | Ga0105241_10000704 | Ga0105241_1000070416 | 262 |
| 601 | 3300009177 | Ga0105248_10011502 | Ga0105248_100115028 | 262 |
| 602 | 3300009551 | Ga0105238_10013591 | Ga0105238_100135914 | 262 |
| 603 | 3300009553 | Ga0105249_10000004 | Ga0105249_10000004180 | 262 |
| 604 | 3300009553 | Ga0105249_10056451 | Ga0105249_100564513 | 262 |
| 605 | 3300013100 | Ga0157373_10012975 | Ga0157373_100129753 | 262 |
| 606 | 3300013102 | Ga0157371_10000029 | Ga0157371_10000029135 | 262 |
| 607 | 3300013105 | Ga0157369_10049270 | Ga0157369_100492703 | 262 |
| 608 | 3300013306 | Ga0163162_10000633 | Ga0163162_1000063323 | 262 |
| 609 | 3300013306 | Ga0163162_10038483 | Ga0163162_100384835 | 262 |
| 610 | 3300013307 | Ga0157372_10006052 | Ga0157372_1000605212 | 262 |
| 611 | 3300014326 | Ga0157380_10219889 | Ga0157380_102198892 | 262 |
| 612 | 3300025292 | Ga0209676_1000081 | Ga0209676_100008181 | 262 |
| 613 | 3300025298 | Ga0209050_1000232 | Ga0209050_100023285 | 262 |
| 614 | 3300025298 | Ga0209050_1023665 | Ga0209050_10236652 | 262 |
| 615 | 3300025315 | Ga0207697_10003449 | Ga0207697_100034494 | 262 |
| 616 | 3300025321 | Ga0207656_10001249 | Ga0207656_100012494 | 262 |
| 617 | 3300025900 | Ga0207710_10009416 | Ga0207710_100094164 | 262 |
| 618 | 3300025904 | Ga0207647_10001278 | Ga0207647_100012782 | 262 |
| 619 | 3300025909 | Ga0207705_10000106 | Ga0207705_100001065 | 262 |
| 620 | 3300025911 | Ga0207654_10000173 | Ga0207654_1000017318 | 262 |
| 621 | 3300025913 | Ga0207695_10002538 | Ga0207695_1000253818 | 262 |
| 622 | 3300025914 | Ga0207671_10002027 | Ga0207671_1000202714 | 262 |
| 623 | 3300025919 | Ga0207657_10000149 | Ga0207657_1000014921 | 262 |
| 624 | 3300025920 | Ga0207649_10004039 | Ga0207649_100040393 | 262 |
| 625 | 3300025924 | Ga0207694_10002735 | Ga0207694_100027358 | 262 |
| 626 | 3300025932 | Ga0207690_10000251 | Ga0207690_1000025120 | 262 |
| 627 | 3300025941 | Ga0207711_10014790 | Ga0207711_100147905 | 262 |
| 628 | 3300025945 | Ga0207679_10180228 | Ga0207679_101802283 | 262 |
| 629 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002782 | 262 |
| 630 | 3300025961 | Ga0207712_10000008 | Ga0207712_10000008311 | 262 |
| 631 | 3300025961 | Ga0207712_10086030 | Ga0207712_100860302 | 262 |
| 632 | 3300025981 | Ga0207640_10000613 | Ga0207640_100006138 | 262 |
| 633 | 3300026035 | Ga0207703_10002260 | Ga0207703_100022604 | 262 |
| 634 | 3300026035 | Ga0207703_10214484 | Ga0207703_102144842 | 262 |
| 635 | 3300026041 | Ga0207639_10004307 | Ga0207639_100043076 | 262 |
| 636 | 3300026067 | Ga0207678_10000177 | Ga0207678_1000017723 | 262 |
| 637 | 3300026078 | Ga0207702_10000241 | Ga0207702_1000024134 | 262 |
| 638 | 3300026095 | Ga0207676_10000509 | Ga0207676_1000050916 | 262 |
| 639 | 3300026116 | Ga0207674_10001960 | Ga0207674_100019609 | 262 |
| 640 | 3300026142 | Ga0207698_10000949 | Ga0207698_1000094910 | 262 |
| 641 | 3300028379 | Ga0268266_10105295 | Ga0268266_101052952 | 262 |
| 642 | 3300028380 | Ga0268265_10000035 | Ga0268265_10000035185 | 262 |
| 643 | 3300028381 | Ga0268264_10001169 | Ga0268264_1000116926 | 262 |
| 644 | 3300031901 | Ga0307406_10058252 | Ga0307406_100582522 | 262 |
| 645 | 3300048906 | Ga0496103_0257765 | Ga0496103_0257765_222_1010 | 262 |
| 646 | 3300048929 | Ga0496126_0091991 | Ga0496126_0091991_659_1447 | 262 |
| 647 | 3300005327 | Ga0070658_10000244 | Ga0070658_1000024419 | 264 |
| 648 | 3300005440 | Ga0070705_100550181 | Ga0070705_1005501811 | 264 |
| 649 | 3300005539 | Ga0068853_100244916 | Ga0068853_1002449162 | 264 |
| 650 | 3300005544 | Ga0070686_100329709 | Ga0070686_1003297092 | 264 |
| 651 | 3300005563 | Ga0068855_100052765 | Ga0068855_1000527655 | 264 |
| 652 | 3300005577 | Ga0068857_100147254 | Ga0068857_1001472542 | 264 |
| 653 | 3300005578 | Ga0068854_100001069 | Ga0068854_10000106916 | 264 |
| 654 | 3300005578 | Ga0068854_100003617 | Ga0068854_1000036173 | 264 |
| 655 | 3300005578 | Ga0068854_100130866 | Ga0068854_1001308662 | 264 |
| 656 | 3300005614 | Ga0068856_100063707 | Ga0068856_1000637075 | 264 |
| 657 | 3300005616 | Ga0068852_100000492 | Ga0068852_1000004927 | 264 |
| 658 | 3300005618 | Ga0068864_100333187 | Ga0068864_1003331872 | 264 |
| 659 | 3300009093 | Ga0105240_10003238 | Ga0105240_1000323819 | 264 |
| 660 | 3300009551 | Ga0105238_10037121 | Ga0105238_100371212 | 264 |
| 661 | 3300010375 | Ga0105239_10291710 | Ga0105239_102917102 | 264 |
| 662 | 3300013306 | Ga0163162_10624754 | Ga0163162_106247542 | 264 |
| 663 | 3300025904 | Ga0207647_10011211 | Ga0207647_100112114 | 264 |
| 664 | 3300025909 | Ga0207705_10000224 | Ga0207705_1000022436 | 264 |
| 665 | 3300025913 | Ga0207695_10007969 | Ga0207695_100079697 | 264 |
| 666 | 3300025924 | Ga0207694_10169686 | Ga0207694_101696862 | 264 |
| 667 | 3300025949 | Ga0207667_10484806 | Ga0207667_104848062 | 264 |
| 668 | 3300025981 | Ga0207640_10024845 | Ga0207640_100248455 | 264 |
| 669 | 3300025981 | Ga0207640_10035460 | Ga0207640_100354603 | 264 |
| 670 | 3300025981 | Ga0207640_10376639 | Ga0207640_103766392 | 264 |
| 671 | 3300026078 | Ga0207702_10015310 | Ga0207702_100153105 | 264 |
| 672 | 3300026116 | Ga0207674_10156226 | Ga0207674_101562262 | 264 |
| 673 | 3300026142 | Ga0207698_10000005 | Ga0207698_1000000590 | 264 |
| 674 | 3300028381 | Ga0268264_10056928 | Ga0268264_100569282 | 264 |
| 675 | 3300031548 | Ga0307408_100158820 | Ga0307408_1001588203 | 264 |
| 676 | 3300031731 | Ga0307405_10033799 | Ga0307405_100337994 | 264 |
| 677 | 3300031731 | Ga0307405_10060618 | Ga0307405_100606181 | 264 |
| 678 | 3300031901 | Ga0307406_10065683 | Ga0307406_100656832 | 264 |
| 679 | 3300031911 | Ga0307412_10090368 | Ga0307412_100903682 | 264 |
| 680 | 3300032002 | Ga0307416_100176590 | Ga0307416_1001765902 | 264 |
| 681 | 3300048904 | Ga0496101_0245428 | Ga0496101_0245428_242_1045 | 264 |
| 682 | 3300048909 | Ga0496106_0034381 | Ga0496106_0034381_2672_3475 | 264 |
| 683 | 3300048910 | Ga0496107_0000555 | Ga0496107_0000555_733_1536 | 264 |
| 684 | 3300048915 | Ga0496112_0141116 | Ga0496112_0141116_1219_2022 | 264 |
| 685 | 3300048916 | Ga0496113_0002781 | Ga0496113_0002781_1315_2118 | 264 |
| 686 | 3300048929 | Ga0496126_0179666 | Ga0496126_0179666_445_1239 | 264 |
| 687 | 2162886007 | SwRhRL2b_contig_1602716 | SwRhRL2b_0414.00006070 | 265 |
| 688 | 3300005289 | Ga0065704_10000342 | Ga0065704_1000034226 | 265 |
| 689 | 3300005331 | Ga0070670_100299913 | Ga0070670_1002999132 | 265 |
| 690 | 3300005335 | Ga0070666_10004316 | Ga0070666_100043162 | 265 |
| 691 | 3300005335 | Ga0070666_10056125 | Ga0070666_100561253 | 265 |
| 692 | 3300005347 | Ga0070668_100001230 | Ga0070668_10000123010 | 265 |
| 693 | 3300005353 | Ga0070669_100000674 | Ga0070669_10000067414 | 265 |
| 694 | 3300005355 | Ga0070671_100000634 | Ga0070671_10000063416 | 265 |
| 695 | 3300005355 | Ga0070671_100002071 | Ga0070671_10000207112 | 265 |
| 696 | 3300005367 | Ga0070667_100000347 | Ga0070667_1000003473 | 265 |
| 697 | 3300005367 | Ga0070667_100326908 | Ga0070667_1003269082 | 265 |
| 698 | 3300005548 | Ga0070665_100007778 | Ga0070665_10000777811 | 265 |
| 699 | 3300005548 | Ga0070665_100054634 | Ga0070665_1000546342 | 265 |
| 700 | 3300005617 | Ga0068859_100430406 | Ga0068859_1004304061 | 265 |
| 701 | 3300005842 | Ga0068858_100011879 | Ga0068858_1000118792 | 265 |
| 702 | 3300005842 | Ga0068858_100066230 | Ga0068858_1000662304 | 265 |
| 703 | 3300005843 | Ga0068860_100057541 | Ga0068860_1000575414 | 265 |
| 704 | 3300005843 | Ga0068860_100640469 | Ga0068860_1006404692 | 265 |
| 705 | 3300006931 | Ga0097620_100430406 | Ga0097620_1004304061 | 265 |
| 706 | 3300009092 | Ga0105250_10008439 | Ga0105250_100084392 | 265 |
| 707 | 3300009101 | Ga0105247_10174597 | Ga0105247_101745972 | 265 |
| 708 | 3300009177 | Ga0105248_10011013 | Ga0105248_100110138 | 265 |
| 709 | 3300009177 | Ga0105248_10829245 | Ga0105248_108292451 | 265 |
| 710 | 3300009553 | Ga0105249_10168871 | Ga0105249_101688713 | 265 |
| 711 | 3300013306 | Ga0163162_10012162 | Ga0163162_100121626 | 265 |
| 712 | 3300025315 | Ga0207697_10010459 | Ga0207697_100104594 | 265 |
| 713 | 3300025711 | Ga0207696_1001980 | Ga0207696_10019807 | 265 |
| 714 | 3300025735 | Ga0207713_1009681 | Ga0207713_10096815 | 265 |
| 715 | 3300025903 | Ga0207680_10013013 | Ga0207680_100130133 | 265 |
| 716 | 3300025903 | Ga0207680_10292717 | Ga0207680_102927171 | 265 |
| 717 | 3300025923 | Ga0207681_10000081 | Ga0207681_1000008130 | 265 |
| 718 | 3300025923 | Ga0207681_10000255 | Ga0207681_100002557 | 265 |
| 719 | 3300025931 | Ga0207644_10000542 | Ga0207644_1000054215 | 265 |
| 720 | 3300025931 | Ga0207644_10010778 | Ga0207644_100107782 | 265 |
| 721 | 3300025972 | Ga0207668_10000742 | Ga0207668_1000074210 | 265 |
| 722 | 3300025986 | Ga0207658_10000490 | Ga0207658_1000049033 | 265 |
| 723 | 3300026035 | Ga0207703_10037520 | Ga0207703_100375204 | 265 |
| 724 | 3300026035 | Ga0207703_10148084 | Ga0207703_101480843 | 265 |
| 725 | 3300028379 | Ga0268266_10001759 | Ga0268266_1000175915 | 265 |
| 726 | 3300028379 | Ga0268266_10083257 | Ga0268266_100832572 | 265 |
| 727 | 3300028381 | Ga0268264_10010312 | Ga0268264_100103129 | 265 |
| 728 | 3300028381 | Ga0268264_10051721 | Ga0268264_100517213 | 265 |
| 729 | 3300048903 | Ga0496100_0104443 | Ga0496100_0104443_238_1053 | 265 |
| 730 | 3300048904 | Ga0496101_0063056 | Ga0496101_0063056_267_1082 | 265 |
| 731 | 3300048905 | Ga0496102_0000149 | Ga0496102_0000149_70623_71438 | 265 |
| 732 | 3300048905 | Ga0496102_0440626 | Ga0496102_0440626_202_1020 | 265 |
| 733 | 3300048906 | Ga0496103_0000049 | Ga0496103_0000049_131381_132196 | 265 |
| 734 | 3300048907 | Ga0496104_0002042 | Ga0496104_0002042_1943_2740 | 265 |
| 735 | 3300048908 | Ga0496105_0000384 | Ga0496105_0000384_25395_26192 | 265 |
| 736 | 3300048910 | Ga0496107_0377322 | Ga0496107_0377322_65_883 | 265 |
| 737 | 3300048915 | Ga0496112_0126968 | Ga0496112_0126968_387_1202 | 265 |
| 738 | 3300048916 | Ga0496113_0001856 | Ga0496113_0001856_9765_10562 | 265 |
| 739 | 3300048920 | Ga0496117_0000123 | Ga0496117_0000123_127836_128651 | 265 |
| 740 | 3300048921 | Ga0496118_0013949 | Ga0496118_0013949_6651_7448 | 265 |
| 741 | 3300048922 | Ga0496119_0000090 | Ga0496119_0000090_1943_2740 | 265 |
| 742 | 3300048923 | Ga0496120_0000690 | Ga0496120_0000690_2293_3090 | 265 |
| 743 | 3300048925 | Ga0496122_0004341 | Ga0496122_0004341_15305_16120 | 265 |
| 744 | 3300048926 | Ga0496123_0002034 | Ga0496123_0002034_15305_16120 | 265 |
| 745 | 3300048927 | Ga0496124_0003427 | Ga0496124_0003427_6608_7405 | 265 |
| 746 | 3300048928 | Ga0496125_0008036 | Ga0496125_0008036_1624_2421 | 265 |
| 747 | 3300048929 | Ga0496126_0000045 | Ga0496126_0000045_198856_199653 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2eb5-assembly1.cif.gz_E-2 | crystal structure of hpcg complexed with oxalate | 0.9477 | 5 | 265 |
| 2eb5-assembly1.cif.gz_A | crystal structure of hpcg complexed with oxalate | 0.9461 | 5 | 265 |
| 5d2i-assembly2.cif.gz_B | 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate | 0.9459 | 4 | 265 |
| 2eb4-assembly1.cif.gz_D-2 | crystal structure of apo-hpcg | 0.944 | 5 | 265 |
| 2eb4-assembly1.cif.gz_A-2 | crystal structure of apo-hpcg | 0.9437 | 5 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XHH5_1_260_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9649 | 5 | 264 | 3.90.850.10 |
| af_I6XHH5_1_260_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9468 | 5 | 264 | 3.90.850.10 |
| 2wqtB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9465 | 1 | 264 | 3.90.850.10 |
| 2eb4C00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9395 | 5 | 265 | 3.90.850.10 |
| 5d2kB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9368 | 5 | 265 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G2JPF4-F1-model_v4 | deleted | 0.9829 | 122 | 265 |
|
| AF-A0A7R9AH48-F1-model_v4 | Pyruvate carboxyltransferase domain-containing protein | 0.9807 | 7 | 250 |
GO:0005737
GO:0008684 GO:0008701 GO:0008774 GO:0009056 GO:0051287 |
| AF-A0A830G881-F1-model_v4 | 2-keto-4-pentenoate hydratase | 0.9761 | 5 | 264 |
GO:0005737
GO:0008684 |
| AF-A0A2G2JPF4-F1-model_v4 | deleted | 0.976 | 122 | 265 |
|
| AF-A0A5D3I3R9-F1-model_v4 | deleted | 0.9752 | 106 | 265 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar