F478907

General Info

Members Datasets Scaffolds Average Seq Length
747 392 711 326

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100061684|Ga0070700_1000616842
Length 345
Sequence MKQAFFAVFNDPKETPIMKRRFLGWLAACAVAALATGVAAPALAQTKLKFAHVYETSEPYHKWALWAAGEIKQRTQGRYEMDVFPASQLGKETDINQGLTLGTVDVIYTGQAFAARTHPPLAIGGAPFMFRDFDHWQKYSSSPLLQELMDGYFKKGGNKPLAVTYYGVRHTTANKPINVPDDMKGLKLRVPDAPLYVMYPKVVGANATPIAFAEVYLALQSKTVDAQENPLPTIEAKKFYEVQSHINLTGHITEMLLTIVSGQTWNKLSDADKKTFEAVFKEAGAKCTDDIAAAEIKLVDEFATKYKKTVVKSDRAAFAAAFQKFHLGPDATWDKATYDRLQAIK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
6 2643221683 Variovorax sp. Root473 Isolate Unclassified
7 2643221717 Acidovorax sp. Root267 Isolate Unclassified
8 2738543013 Variovorax sp. BT01 Isolate Unclassified
9 2842677519 Variovorax sp. R-72495 Isolate Unclassified
10 2842733646 Variovorax sp. R-72446 Isolate Unclassified
11 2842747753 Variovorax sp. R-72060 Isolate Unclassified
12 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
13 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
14 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
15 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
16 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
17 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
18 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
19 2904456579 Variovorax sp. 2002 Isolate Unclassified
20 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
21 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
22 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
23 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
24 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
25 2929520902 Variovorax beijingensis 502 Isolate Unclassified
26 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
27 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
28 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
29 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
30 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
31 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
32 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
33 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
34 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
35 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
36 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
41 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
150 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
172 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
240 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
241 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
242 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
257 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
258 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
285 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
286 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
287 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
288 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
295 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
296 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
297 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
298 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
299 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
332 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
333 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
376 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
380 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
381 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
382 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
389 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
390 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
391 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
392 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.32
Nodule 1.74
Rhizoplane 2.95
Rhizosphere 75.1
Stem 0
Stem Tuber 0
Unclassified 5.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000028 3300002704 Bacteria 120158
2 JGI25156J39149_1000013 3300002705 Bacteria 189553
3 JGI25154J39366_1000032 3300002738 Bacteria 189265
4 JGI25157J39369_1000017 3300002741 Bacteria 189553
5 JGI25150J39212_1008334 3300002774 Bacteria 2032
6 JGI25159J45721_1004214 3300002987 Bacteria 4848
7 JGI25159J45721_1006741 3300002987 Bacteria 3385
8 JGI25151J46595_10002986 3300003187 Bacteria 9645
9 JGI25151J46595_10008595 3300003187 Bacteria 4895
10 JGI25151J46595_10012976 3300003187 Bacteria 3764
11 JGI25151J46595_10026532 3300003187 Bacteria 2336
12 JGI25160J50197_1000106 3300003354 Bacteria 80449
13 JGI25161J50226_1000041 3300003374 Bacteria 124485
14 Ga0055526_1006939 3300003771 Bacteria 6021
15 Ga0055526_1006976 3300003771 Bacteria 5993
16 Ga0055537_1000029 3300003773 Bacteria 101797
17 Ga0055537_1000229 3300003773 Bacteria 41052
18 Ga0055537_1008434 3300003773 Bacteria 2379
19 Ga0055524_1000040 3300003775 Bacteria 157409
20 Ga0055536_1003958 3300003781 Bacteria 7764
21 Ga0055536_1005991 3300003781 Bacteria 5784
22 Ga0055534_1000081 3300003784 Bacteria 75591
23 Ga0055534_1001320 3300003784 Bacteria 9970
24 Ga0055528_1000107 3300003790 Bacteria 67056
25 Ga0055528_1003803 3300003790 Bacteria 7436
26 Ga0055530_10000493 3300003791 Bacteria 34162
27 Ga0055540_1000030 3300003792 Bacteria 177871
28 Ga0055540_1001837 3300003792 Bacteria 11979
29 Ga0055540_1002684 3300003792 Bacteria 9173
30 Ga0055531_10009620 3300003794 Bacteria 4920
31 Ga0055543_1001200 3300004625 Bacteria 10901
32 Ga0065165_1017710 3300005262 Bacteria 2612
33 Ga0065714_10109949 3300005288 Bacteria 1492
34 Ga0065704_10083585 3300005289 Bacteria 3445
35 Ga0065712_10014625 3300005290 Bacteria 2000
36 Ga0065715_10012822 3300005293 Bacteria 3362
37 Ga0065715_10021301 3300005293 Bacteria 1978
38 Ga0065707_10086478 3300005295 Bacteria 5441
39 Ga0065707_10113710 3300005295 Bacteria 2305
40 Ga0070658_10179870 3300005327 Bacteria 1779
41 Ga0070676_10049045 3300005328 Bacteria 2470
42 Ga0070676_10062704 3300005328 Bacteria 2212
43 Ga0070676_10141185 3300005328 Bacteria 1533
44 Ga0070676_10149960 3300005328 Bacteria 1492
45 Ga0070690_100017765 3300005330 Bacteria 4285
46 Ga0070690_100059812 3300005330 Bacteria 2450
47 Ga0070690_100069129 3300005330 Bacteria 2291
48 Ga0070690_100192824 3300005330 Bacteria 1414
49 Ga0070670_100049162 3300005331 Bacteria 3626
50 Ga0070670_100073813 3300005331 Bacteria 2930
51 Ga0070670_100155929 3300005331 Bacteria 1977
52 Ga0070677_10012753 3300005333 Bacteria 2923
53 Ga0070677_10029393 3300005333 Bacteria 2083
54 Ga0070677_10031593 3300005333 Bacteria 2025
55 Ga0068869_100011970 3300005334 Bacteria 5709
56 Ga0068869_100081511 3300005334 Bacteria 2416
57 Ga0068869_100100809 3300005334 Bacteria 2184
58 Ga0070666_10007413 3300005335 Bacteria 6762
59 Ga0070666_10047403 3300005335 Bacteria 2884
60 Ga0070666_10215970 3300005335 Bacteria 1352
61 Ga0070680_100112248 3300005336 Bacteria 2270
62 Ga0068868_100001955 3300005338 Bacteria 14135
63 Ga0068868_100022609 3300005338 Bacteria 4749
64 Ga0068868_100253216 3300005338 Bacteria 1482
65 Ga0068868_100341558 3300005338 Bacteria 1280
66 Ga0070660_100104911 3300005339 Bacteria 2242
67 Ga0070689_100051287 3300005340 Bacteria 3189
68 Ga0070689_100223463 3300005340 Bacteria 1545
69 Ga0070687_100041294 3300005343 Bacteria 2330
70 Ga0070687_100105808 3300005343 Bacteria 1584
71 Ga0070661_100160399 3300005344 Bacteria 1703
72 Ga0070668_100003555 3300005347 Bacteria 11496
73 Ga0070668_100020892 3300005347 Bacteria 4945
74 Ga0070668_100123058 3300005347 Bacteria 2075
75 Ga0070669_100017475 3300005353 Bacteria 5115
76 Ga0070669_100019673 3300005353 Bacteria 4823
77 Ga0070669_100080235 3300005353 Bacteria 2428
78 Ga0070669_100229947 3300005353 Bacteria 1469
79 Ga0070675_100005320 3300005354 Bacteria 9835
80 Ga0070675_100026424 3300005354 Bacteria 4659
81 Ga0070675_100061363 3300005354 Bacteria 3104
82 Ga0070675_100079423 3300005354 Bacteria 2733
83 Ga0070675_100161306 3300005354 Bacteria 1928
84 Ga0070675_100229391 3300005354 Bacteria 1619
85 Ga0070675_100316084 3300005354 Bacteria 1379
86 Ga0070671_100006632 3300005355 Bacteria 9251
87 Ga0070671_100043326 3300005355 Bacteria 3740
88 Ga0070671_100069616 3300005355 Bacteria 2935
89 Ga0070671_100081519 3300005355 Bacteria 2705
90 Ga0070674_100018239 3300005356 Bacteria 4433
91 Ga0070674_100029397 3300005356 Bacteria 3619
92 Ga0070674_100070201 3300005356 Bacteria 2474
93 Ga0070674_100140602 3300005356 Bacteria 1811
94 Ga0070674_100216580 3300005356 Bacteria 1487
95 Ga0070674_100308897 3300005356 Bacteria 1263
96 Ga0070673_100029782 3300005364 Bacteria 4075
97 Ga0070673_100067350 3300005364 Bacteria 2863
98 Ga0070673_100107639 3300005364 Bacteria 2306
99 Ga0070688_100043204 3300005365 Bacteria 2775
100 Ga0070659_100135367 3300005366 Bacteria 2003
101 Ga0070667_100018788 3300005367 Bacteria 5732
102 Ga0070667_100036122 3300005367 Bacteria 4142
103 Ga0070667_100038123 3300005367 Bacteria 4029
104 Ga0070667_100201894 3300005367 Bacteria 1764
105 Ga0070667_100262937 3300005367 Bacteria 1545
106 Ga0070701_10009247 3300005438 Bacteria 4309
107 Ga0070701_10125573 3300005438 Bacteria 1452
108 Ga0070700_100061684 3300005441 Bacteria 2366
109 Ga0070663_100325826 3300005455 Bacteria 1236
110 Ga0070678_100053734 3300005456 Bacteria 2931
111 Ga0070678_100058482 3300005456 Bacteria 2829
112 Ga0070678_100075327 3300005456 Bacteria 2538
113 Ga0070678_100081587 3300005456 Bacteria 2452
114 Ga0070678_100105411 3300005456 Bacteria 2194
115 Ga0070678_100206128 3300005456 Bacteria 1626
116 Ga0070662_100012157 3300005457 Bacteria 5700
117 Ga0070662_100023662 3300005457 Bacteria 4222
118 Ga0070662_100047737 3300005457 Bacteria 3081
119 Ga0070662_100091956 3300005457 Bacteria 2279
120 Ga0070681_10014937 3300005458 Bacteria 7721
121 Ga0070681_10130574 3300005458 Bacteria 2444
122 Ga0068867_100002211 3300005459 Bacteria 13654
123 Ga0068867_100033665 3300005459 Bacteria 3712
124 Ga0068867_100036909 3300005459 Bacteria 3550
125 Ga0068867_100047053 3300005459 Bacteria 3170
126 Ga0070679_100010948 3300005530 Bacteria 8620
127 Ga0070679_100021873 3300005530 Bacteria 6246
128 Ga0070679_100212154 3300005530 Bacteria 1900
129 Ga0070684_100019585 3300005535 Bacteria 5600
130 Ga0070697_100165757 3300005536 Bacteria 1868
131 Ga0068853_100046393 3300005539 Bacteria 3725
132 Ga0068853_100241264 3300005539 Bacteria 1656
133 Ga0070672_100060460 3300005543 Bacteria 2983
134 Ga0070672_100061360 3300005543 Bacteria 2963
135 Ga0070672_100153963 3300005543 Bacteria 1903
136 Ga0070672_100343199 3300005543 Bacteria 1272
137 Ga0070686_100028269 3300005544 Bacteria 3399
138 Ga0070686_100087148 3300005544 Bacteria 2081
139 Ga0070686_100175520 3300005544 Bacteria 1519
140 Ga0070696_100004763 3300005546 Bacteria 9063
141 Ga0070693_100045512 3300005547 Bacteria 2488
142 Ga0070665_100013700 3300005548 Bacteria 8159
143 Ga0070665_100041030 3300005548 Bacteria 4651
144 Ga0070665_100111220 3300005548 Bacteria 2742
145 Ga0070665_100195858 3300005548 Bacteria 2021
146 Ga0070665_100220512 3300005548 Bacteria 1897
147 Ga0070665_100583693 3300005548 Bacteria 1130
148 Ga0070704_100281280 3300005549 Bacteria 1378
149 Ga0068855_100039058 3300005563 Bacteria 5636
150 Ga0070664_100325584 3300005564 Bacteria 1393
151 Ga0068857_100177520 3300005577 Bacteria 1938
152 Ga0068854_100147454 3300005578 Bacteria 1811
153 Ga0068856_100083350 3300005614 Bacteria 3174
154 Ga0070702_100063806 3300005615 Bacteria 2152
155 Ga0068852_100244512 3300005616 Bacteria 1716
156 Ga0068852_100248037 3300005616 Bacteria 1705
157 Ga0068859_100004027 3300005617 Bacteria 14982
158 Ga0068859_100068114 3300005617 Bacteria 3594
159 Ga0068859_100381668 3300005617 Bacteria 1504
160 Ga0068859_100558755 3300005617 Bacteria 1239
161 Ga0068864_100083775 3300005618 Bacteria 2800
162 Ga0068864_100126759 3300005618 Bacteria 2288
163 Ga0068866_10008823 3300005718 Bacteria 4262
164 Ga0068861_100002079 3300005719 Bacteria 12984
165 Ga0068861_100011946 3300005719 Bacteria 6048
166 Ga0068851_10036813 3300005834 Bacteria 2451
167 Ga0068851_10048399 3300005834 Bacteria 2154
168 Ga0068851_10122175 3300005834 Bacteria 1400
169 Ga0068870_10048317 3300005840 Bacteria 2240
170 Ga0068863_100004155 3300005841 Bacteria 14296
171 Ga0068863_100062379 3300005841 Bacteria 3525
172 Ga0068863_100071438 3300005841 Bacteria 3283
173 Ga0068863_100167627 3300005841 Bacteria 2106
174 Ga0068863_100333192 3300005841 Bacteria 1475
175 Ga0068858_100002678 3300005842 Bacteria 17932
176 Ga0068858_100117342 3300005842 Bacteria 2487
177 Ga0068858_100219961 3300005842 Bacteria 1798
178 Ga0068858_100429739 3300005842 Bacteria 1271
179 Ga0068860_100003245 3300005843 Bacteria 16767
180 Ga0068860_100005443 3300005843 Bacteria 12906
181 Ga0068860_100033915 3300005843 Bacteria 4897
182 Ga0068860_100100078 3300005843 Bacteria 2765
183 Ga0068862_100020138 3300005844 Bacteria 5572
184 Ga0068862_100027364 3300005844 Bacteria 4800
185 Ga0068862_100224900 3300005844 Bacteria 1700
186 Ga0081540_1015210 3300005983 Bacteria 4881
187 Ga0070717_10399214 3300006028 Bacteria 1235
188 Ga0075365_10070319 3300006038 Bacteria 2354
189 Ga0075365_10143044 3300006038 Bacteria 1661
190 Ga0075363_100010846 3300006048 Bacteria 4346
191 Ga0075364_10079127 3300006051 Bacteria 2172
192 Ga0070716_100009470 3300006173 Bacteria 4858
193 Ga0075362_10007059 3300006177 Bacteria 4224
194 Ga0075362_10030954 3300006177 Bacteria 2313
195 Ga0075369_10042662 3300006186 Bacteria 1945
196 Ga0075366_10001983 3300006195 Bacteria 10365
197 Ga0075366_10012005 3300006195 Bacteria 4905
198 Ga0097621_100001880 3300006237 Bacteria 14378
199 Ga0097621_100061406 3300006237 Bacteria 3082
200 Ga0097621_100117798 3300006237 Bacteria 2251
201 Ga0075370_10021532 3300006353 Bacteria 3532
202 Ga0068871_100002226 3300006358 Bacteria 13179
203 Ga0068871_100040497 3300006358 Bacteria 3732
204 Ga0075428_100000130 3300006844 Bacteria 65814
205 Ga0075430_100009841 3300006846 Bacteria 8087
206 Ga0075433_10067380 3300006852 Bacteria 3142
207 Ga0075429_100000541 3300006880 Bacteria 28764
208 Ga0075429_100003178 3300006880 Bacteria 13964
209 Ga0068865_100037005 3300006881 Bacteria 3293
210 Ga0068865_100152279 3300006881 Bacteria 1756
211 Ga0068865_100217357 3300006881 Bacteria 1492
212 Ga0075436_100097370 3300006914 Bacteria 2047
213 Ga0075436_100102475 3300006914 Bacteria 1994
214 Ga0097620_100004027 3300006931 Bacteria 14982
215 Ga0097620_100068114 3300006931 Bacteria 3594
216 Ga0097620_100381709 3300006931 Bacteria 1504
217 Ga0097620_100558827 3300006931 Bacteria 1239
218 Ga0099826_10000087 3300006948 Bacteria 46364
219 Ga0099826_10073699 3300006948 Bacteria 2156
220 Ga0075435_100002374 3300007076 Bacteria 12484
221 Ga0075435_100118338 3300007076 Bacteria 2208
222 Ga0099794_10097702 3300007265 Bacteria 1463
223 Ga0111539_10000801 3300009094 Bacteria 40972
224 Ga0111539_10016103 3300009094 Bacteria 9277
225 Ga0111539_10017872 3300009094 Bacteria 8782
226 Ga0111539_10023989 3300009094 Bacteria 7493
227 Ga0105245_10075153 3300009098 Bacteria 3076
228 Ga0105245_10083242 3300009098 Bacteria 2928
229 Ga0114129_10000604 3300009147 Bacteria 44388
230 Ga0105243_10002623 3300009148 Bacteria 14958
231 Ga0105243_10068322 3300009148 Bacteria 2864
232 Ga0105243_10080527 3300009148 Bacteria 2657
233 Ga0105243_10222758 3300009148 Bacteria 1668
234 Ga0105241_10351492 3300009174 Bacteria 1280
235 Ga0105242_10002310 3300009176 Bacteria 15045
236 Ga0105242_10021682 3300009176 Bacteria 5046
237 Ga0105242_10064669 3300009176 Bacteria 3016
238 Ga0105248_10051302 3300009177 Bacteria 4629
239 Ga0105248_10128074 3300009177 Bacteria 2864
240 Ga0105237_10060033 3300009545 Bacteria 3804
241 Ga0105238_10293509 3300009551 Bacteria 1608
242 Ga0105249_10017865 3300009553 Bacteria 6302
243 Ga0105249_10139785 3300009553 Bacteria 2321
244 Ga0105249_10166771 3300009553 Bacteria 2132
245 Ga0105249_10248077 3300009553 Bacteria 1764
246 Ga0099796_10066554 3300010159 Bacteria 1291
247 Ga0105239_10066299 3300010375 Bacteria 3966
248 Ga0105246_10158720 3300011119 Bacteria 1721
249 Ga0157327_1000947 3300012512 Bacteria 1713
250 Ga0157326_1000451 3300012513 Bacteria 4870
251 Ga0157370_10003845 3300013104 Bacteria 17512
252 Ga0157369_10166440 3300013105 Bacteria 2325
253 Ga0157374_10037741 3300013296 Bacteria 4437
254 Ga0157374_10100494 3300013296 Bacteria 2773
255 Ga0157378_10022765 3300013297 Bacteria 5514
256 Ga0157378_10076992 3300013297 Bacteria 3006
257 Ga0163162_10005074 3300013306 Bacteria 12688
258 Ga0163162_10106194 3300013306 Bacteria 2903
259 Ga0163162_10222435 3300013306 Bacteria 2017
260 Ga0163162_10538660 3300013306 Bacteria 1296
261 Ga0157375_10024303 3300013308 Bacteria 5605
262 Ga0157375_10125411 3300013308 Bacteria 2682
263 Ga0163163_10016809 3300014325 Bacteria 6810
264 Ga0163163_10078290 3300014325 Bacteria 3302
265 Ga0157380_10019496 3300014326 Bacteria 5055
266 Ga0157380_10019525 3300014326 Bacteria 5051
267 Ga0157380_10067279 3300014326 Bacteria 2884
268 Ga0157377_10012265 3300014745 Bacteria 4304
269 Ga0157377_10080764 3300014745 Bacteria 1900
270 Ga0157377_10090220 3300014745 Bacteria 1808
271 Ga0157379_10052219 3300014968 Bacteria 3651
272 Ga0157379_10076187 3300014968 Bacteria 3004
273 Ga0157376_10103751 3300014969 Bacteria 2490
274 Ga0157376_10163317 3300014969 Bacteria 2021
275 Ga0182005_1028784 3300015265 Bacteria 1515
276 Ga0182005_1036246 3300015265 Bacteria 1341
277 Ga0163161_10000329 3300017792 Bacteria 40476
278 Ga0163161_10013701 3300017792 Bacteria 5646
279 Ga0163161_10053805 3300017792 Bacteria 2920
280 Ga0163161_10098799 3300017792 Bacteria 2170
281 Ga0163161_10129110 3300017792 Bacteria 1905
282 Ga0163161_10212954 3300017792 Bacteria 1493
283 Ga0213876_10027453 3300021384 Bacteria 3003
284 Ga0209435_100003 3300025206 Bacteria 669534
285 Ga0209436_105046 3300025208 Bacteria 3126
286 Ga0207425_1007648 3300025245 Bacteria 2831
287 Ga0209646_1000008 3300025246 Bacteria 669534
288 Ga0209026_1000007 3300025250 Bacteria 669534
289 Ga0209759_1000026 3300025256 Bacteria 311743
290 Ga0209129_1007409 3300025258 Bacteria 3276
291 Ga0209129_1020623 3300025258 Bacteria 1223
292 Ga0209565_1000026 3300025263 Bacteria 365910
293 Ga0209565_1000150 3300025263 Bacteria 94073
294 Ga0209565_1001312 3300025263 Bacteria 11421
295 Ga0207666_1001766 3300025271 Bacteria 2567
296 Ga0207666_1005525 3300025271 Bacteria 1617
297 Ga0209673_1000009 3300025273 Bacteria 620735
298 Ga0209673_1000012 3300025273 Bacteria 579480
299 Ga0209673_1000114 3300025273 Bacteria 178557
300 Ga0209673_1008634 3300025273 Bacteria 4514
301 Ga0209130_1000099 3300025284 Bacteria 141717
302 Ga0209130_1000123 3300025284 Bacteria 125840
303 Ga0209130_1006153 3300025284 Bacteria 3960
304 Ga0209675_1000062 3300025291 Bacteria 178557
305 Ga0209675_1000155 3300025291 Bacteria 89020
306 Ga0209675_1004791 3300025291 Bacteria 5878
307 Ga0209675_1005864 3300025291 Bacteria 5045
308 Ga0209676_1000051 3300025292 Bacteria 389016
309 Ga0209676_1000325 3300025292 Bacteria 91840
310 Ga0209676_1008862 3300025292 Bacteria 4423
311 Ga0209676_1009460 3300025292 Bacteria 4200
312 Ga0209676_1026578 3300025292 Bacteria 1836
313 Ga0209025_1000521 3300025294 Bacteria 73251
314 Ga0209025_1004061 3300025294 Bacteria 13090
315 Ga0209025_1007738 3300025294 Bacteria 7920
316 Ga0209025_1009286 3300025294 Bacteria 6885
317 Ga0209564_1000211 3300025295 Bacteria 133277
318 Ga0209564_1000228 3300025295 Bacteria 125206
319 Ga0209564_1004815 3300025295 Bacteria 8037
320 Ga0209758_1054147 3300025297 Bacteria 1372
321 Ga0209050_1000044 3300025298 Bacteria 391114
322 Ga0209050_1003950 3300025298 Bacteria 10477
323 Ga0209050_1010312 3300025298 Bacteria 4620
324 Ga0209256_1000003 3300025299 Bacteria 1661127
325 Ga0207426_1000062 3300025302 Bacteria 362040
326 Ga0207426_1003919 3300025302 Bacteria 7633
327 Ga0209051_1000031 3300025303 Bacteria 391114
328 Ga0209051_1000208 3300025303 Bacteria 102967
329 Ga0209051_1000760 3300025303 Bacteria 34370
330 Ga0209051_1042140 3300025303 Bacteria 1616
331 Ga0209257_1000058 3300025304 Bacteria 381686
332 Ga0209257_1008393 3300025304 Bacteria 5887
333 Ga0209257_1014090 3300025304 Bacteria 3474
334 Ga0207697_10009556 3300025315 Bacteria 4185
335 Ga0207697_10032926 3300025315 Bacteria 2122
336 Ga0207697_10065936 3300025315 Bacteria 1512
337 Ga0207682_10001921 3300025893 Bacteria 9445
338 Ga0207682_10009146 3300025893 Bacteria 3914
339 Ga0207682_10038424 3300025893 Bacteria 1942
340 Ga0207682_10057923 3300025893 Bacteria 1616
341 Ga0207642_10015639 3300025899 Bacteria 2834
342 Ga0207688_10004631 3300025901 Bacteria 7495
343 Ga0207688_10033243 3300025901 Bacteria 2852
344 Ga0207699_10067868 3300025906 Bacteria 2170
345 Ga0207645_10003092 3300025907 Bacteria 12763
346 Ga0207645_10007091 3300025907 Bacteria 7965
347 Ga0207645_10027206 3300025907 Bacteria 3694
348 Ga0207645_10115523 3300025907 Bacteria 1740
349 Ga0207643_10003923 3300025908 Bacteria 8004
350 Ga0207643_10054228 3300025908 Bacteria 2278
351 Ga0207707_10044809 3300025912 Bacteria 3855
352 Ga0207707_10104139 3300025912 Bacteria 2480
353 Ga0207671_10162669 3300025914 Bacteria 1729
354 Ga0207660_10007738 3300025917 Bacteria 6956
355 Ga0207660_10131999 3300025917 Bacteria 1902
356 Ga0207662_10003730 3300025918 Bacteria 7899
357 Ga0207662_10076536 3300025918 Bacteria 2034
358 Ga0207657_10049797 3300025919 Bacteria 3648
359 Ga0207652_10005260 3300025921 Bacteria 10509
360 Ga0207652_10282909 3300025921 Bacteria 1496
361 Ga0207681_10007401 3300025923 Bacteria 6721
362 Ga0207681_10018416 3300025923 Bacteria 4400
363 Ga0207681_10074401 3300025923 Bacteria 2379
364 Ga0207681_10081248 3300025923 Bacteria 2288
365 Ga0207681_10124240 3300025923 Bacteria 1897
366 Ga0207681_10215106 3300025923 Bacteria 1484
367 Ga0207694_10076303 3300025924 Bacteria 2625
368 Ga0207650_10023527 3300025925 Bacteria 4369
369 Ga0207650_10069686 3300025925 Bacteria 2642
370 Ga0207659_10007169 3300025926 Bacteria 6843
371 Ga0207659_10020490 3300025926 Bacteria 4372
372 Ga0207659_10058986 3300025926 Bacteria 2757
373 Ga0207659_10059908 3300025926 Bacteria 2738
374 Ga0207659_10138499 3300025926 Bacteria 1887
375 Ga0207659_10356728 3300025926 Bacteria 1214
376 Ga0207659_10492099 3300025926 Bacteria 1037
377 Ga0207687_10049293 3300025927 Bacteria 2928
378 Ga0207687_10322388 3300025927 Bacteria 1251
379 Ga0207644_10000068 3300025931 Bacteria 76090
380 Ga0207644_10015661 3300025931 Bacteria 5094
381 Ga0207644_10051778 3300025931 Bacteria 2948
382 Ga0207690_10095883 3300025932 Bacteria 2108
383 Ga0207706_10052263 3300025933 Bacteria 3607
384 Ga0207706_10152950 3300025933 Bacteria 2029
385 Ga0207686_10028134 3300025934 Bacteria 3301
386 Ga0207686_10031426 3300025934 Bacteria 3152
387 Ga0207709_10002195 3300025935 Bacteria 12448
388 Ga0207709_10021397 3300025935 Bacteria 3661
389 Ga0207709_10186987 3300025935 Bacteria 1468
390 Ga0207709_10338157 3300025935 Bacteria 1132
391 Ga0207670_10099193 3300025936 Bacteria 2077
392 Ga0207669_10017506 3300025937 Bacteria 3679
393 Ga0207669_10026733 3300025937 Bacteria 3145
394 Ga0207669_10067712 3300025937 Bacteria 2226
395 Ga0207704_10002833 3300025938 Bacteria 7826
396 Ga0207704_10058905 3300025938 Bacteria 2368
397 Ga0207704_10186226 3300025938 Bacteria 1505
398 Ga0207665_10019966 3300025939 Bacteria 4403
399 Ga0207665_10062982 3300025939 Bacteria 2518
400 Ga0207691_10017865 3300025940 Bacteria 6721
401 Ga0207691_10038713 3300025940 Bacteria 4412
402 Ga0207691_10076011 3300025940 Bacteria 3027
403 Ga0207691_10096530 3300025940 Bacteria 2642
404 Ga0207691_10135806 3300025940 Bacteria 2169
405 Ga0207691_10140623 3300025940 Bacteria 2127
406 Ga0207691_10168616 3300025940 Bacteria 1918
407 Ga0207711_10019765 3300025941 Bacteria 5612
408 Ga0207711_10054755 3300025941 Bacteria 3424
409 Ga0207689_10001957 3300025942 Bacteria 19463
410 Ga0207689_10003617 3300025942 Bacteria 14127
411 Ga0207689_10028597 3300025942 Bacteria 4661
412 Ga0207689_10057292 3300025942 Bacteria 3206
413 Ga0207689_10093231 3300025942 Bacteria 2474
414 Ga0207651_10183129 3300025960 Bacteria 1664
415 Ga0207651_10425300 3300025960 Bacteria 1135
416 Ga0207712_10085529 3300025961 Bacteria 2308
417 Ga0207712_10291971 3300025961 Bacteria 1335
418 Ga0207668_10050743 3300025972 Bacteria 2861
419 Ga0207668_10159663 3300025972 Bacteria 1755
420 Ga0207640_10167449 3300025981 Bacteria 1633
421 Ga0207640_10314162 3300025981 Bacteria 1245
422 Ga0207640_10359120 3300025981 Bacteria 1173
423 Ga0207658_10040984 3300025986 Bacteria 3350
424 Ga0207677_10003663 3300026023 Bacteria 8158
425 Ga0207677_10010533 3300026023 Bacteria 5237
426 Ga0207703_10007902 3300026035 Bacteria 8412
427 Ga0207703_10021291 3300026035 Bacteria 5076
428 Ga0207703_10340960 3300026035 Bacteria 1377
429 Ga0207639_10169145 3300026041 Bacteria 1849
430 Ga0207708_10003042 3300026075 Bacteria 12362
431 Ga0207708_10174301 3300026075 Bacteria 1705
432 Ga0207702_10121901 3300026078 Bacteria 2335
433 Ga0207641_10005089 3300026088 Bacteria 11267
434 Ga0207641_10012091 3300026088 Bacteria 7079
435 Ga0207641_10021771 3300026088 Bacteria 5269
436 Ga0207641_10045647 3300026088 Bacteria 3690
437 Ga0207641_10097342 3300026088 Bacteria 2586
438 Ga0207641_10202929 3300026088 Bacteria 1829
439 Ga0207648_10003800 3300026089 Bacteria 15788
440 Ga0207648_10005299 3300026089 Bacteria 13011
441 Ga0207648_10031498 3300026089 Bacteria 4689
442 Ga0207648_10120272 3300026089 Bacteria 2309
443 Ga0207648_10135611 3300026089 Bacteria 2168
444 Ga0207648_10230632 3300026089 Bacteria 1647
445 Ga0207648_10256610 3300026089 Bacteria 1559
446 Ga0207676_10005921 3300026095 Bacteria 8637
447 Ga0207676_10037212 3300026095 Bacteria 3707
448 Ga0207676_10067533 3300026095 Bacteria 2856
449 Ga0207674_10188848 3300026116 Bacteria 2010
450 Ga0207675_100002241 3300026118 Bacteria 19232
451 Ga0207675_100003993 3300026118 Bacteria 14308
452 Ga0207675_100004245 3300026118 Bacteria 13857
453 Ga0207675_100004891 3300026118 Bacteria 12915
454 Ga0207675_100313582 3300026118 Bacteria 1530
455 Ga0207683_10006887 3300026121 Bacteria 9732
456 Ga0207683_10009318 3300026121 Bacteria 8364
457 Ga0207683_10037761 3300026121 Bacteria 4207
458 Ga0207683_10051292 3300026121 Bacteria 3615
459 Ga0207683_10066018 3300026121 Bacteria 3190
460 Ga0207683_10082714 3300026121 Bacteria 2852
461 Ga0207683_10135215 3300026121 Bacteria 2219
462 Ga0207683_10145642 3300026121 Bacteria 2136
463 Ga0207683_10177550 3300026121 Bacteria 1930
464 Ga0207698_10136339 3300026142 Bacteria 2106
465 Ga0209282_1000307 3300027666 Bacteria 24300
466 Ga0209813_10018671 3300027866 Bacteria 1919
467 Ga0207428_10001393 3300027907 Bacteria 25520
468 Ga0207428_10214401 3300027907 Bacteria 1445
469 Ga0207428_10297530 3300027907 Bacteria 1195
470 Ga0268266_10028790 3300028379 Bacteria 4722
471 Ga0268266_10078383 3300028379 Bacteria 2875
472 Ga0268266_10084949 3300028379 Bacteria 2765
473 Ga0268266_10173298 3300028379 Bacteria 1959
474 Ga0268266_10260665 3300028379 Bacteria 1606
475 Ga0268265_10050607 3300028380 Bacteria 3131
476 Ga0268265_10093826 3300028380 Bacteria 2405
477 Ga0268265_10311769 3300028380 Bacteria 1421
478 Ga0268265_10315396 3300028380 Bacteria 1413
479 Ga0268264_10004057 3300028381 Bacteria 12533
480 Ga0268264_10011781 3300028381 Bacteria 7210
481 Ga0268264_10015030 3300028381 Bacteria 6351
482 Ga0307515_10000064 3300028794 Bacteria 245452
483 Ga0307515_10131206 3300028794 Bacteria 2758
484 Ga0314311_1070027 3300030733 Bacteria 2682
485 Ga0316178_1126380 3300030735 Bacteria 3798
486 Ga0316183_1110495 3300030742 Bacteria 3751
487 Ga0307513_10000090 3300031456 Bacteria 129750
488 Ga0307513_10152164 3300031456 Bacteria 2220
489 Ga0307513_10282106 3300031456 Bacteria 1438
490 Ga0307408_100005621 3300031548 Bacteria 8383
491 Ga0307514_10011166 3300031649 Bacteria 7476
492 Ga0316576_10022958 3300031727 Bacteria 4340
493 Ga0307516_10003513 3300031730 Bacteria 20060
494 Ga0307516_10289807 3300031730 Bacteria 1316
495 Ga0307405_10005918 3300031731 Bacteria 5963
496 Ga0307405_10037668 3300031731 Bacteria 2908
497 Ga0307405_10156098 3300031731 Bacteria 1611
498 Ga0307405_10172422 3300031731 Bacteria 1544
499 Ga0307405_10312652 3300031731 Bacteria 1196
500 Ga0307406_10006495 3300031901 Bacteria 6459
501 Ga0307406_10018017 3300031901 Bacteria 4119
502 Ga0307406_10056965 3300031901 Bacteria 2505
503 Ga0307406_10237084 3300031901 Bacteria 1366
504 Ga0307407_10039408 3300031903 Bacteria 2627
505 Ga0307407_10044743 3300031903 Bacteria 2497
506 Ga0307407_10125171 3300031903 Bacteria 1636
507 Ga0307412_10002222 3300031911 Bacteria 10777
508 Ga0307412_10046332 3300031911 Bacteria 2848
509 Ga0307412_10071053 3300031911 Bacteria 2375
510 Ga0307412_10139943 3300031911 Bacteria 1771
511 Ga0307412_10206202 3300031911 Bacteria 1496
512 Ga0307409_100000592 3300031995 Bacteria 15808
513 Ga0307416_100006736 3300032002 Bacteria 7222
514 Ga0307416_100030125 3300032002 Bacteria 4068
515 Ga0307416_100214103 3300032002 Bacteria 1841
516 Ga0307416_100377465 3300032002 Bacteria 1446
517 Ga0307414_10011967 3300032004 Bacteria 5115
518 Ga0307414_10146811 3300032004 Bacteria 1854
519 Ga0307415_100002275 3300032126 Bacteria 9522
520 Ga0373948_0008637 3300034817 Bacteria 1739
521 Ga0373958_0011585 3300034819 Bacteria 1493
522 Ga0373938_0002172 3300034957 Bacteria 3150
523 Ga0373926_0056296 3300035083 Bacteria 1427
524 Ga0373934_0003128 3300035086 Bacteria 6033
525 Ga0373940_0002793 3300035088 Bacteria 3463
526 Ga0373949_0005821 3300035090 Bacteria 2740
527 Ga0373932_0000899 3300035112 Bacteria 8694
528 Ga0373936_0042274 3300035113 Bacteria 1829
529 Ga0373939_0031116 3300035114 Bacteria 1540
530 Ga0373941_0001232 3300035115 Bacteria 5370
531 Ga0373954_0001879 3300035118 Bacteria 8667
532 Ga0373954_0010855 3300035118 Bacteria 4027
533 Ga0373954_0075111 3300035118 Bacteria 1609
534 Ga0373956_0004750 3300035119 Bacteria 5436
535 Ga0373943_0021729 3300035170 Bacteria 2966
536 Ga0373955_0014117 3300035172 Bacteria 3878
537 Ga0373942_0004480 3300035207 Bacteria 3239
538 Ga0373924_0072241 3300035410 Bacteria 1457
539 Ga0373931_0000240 3300035691 Bacteria 23366
540 Ga0373931_0045475 3300035691 Bacteria 2318
541 Ga0373935_0005687 3300035692 Bacteria 7359
542 Ga0373935_0214442 3300035692 Bacteria 1335
543 Ga0373927_0015781 3300035695 Bacteria 4984
544 Ga0373927_0094091 3300035695 Bacteria 1947
545 Ga0373937_0051422 3300036401 Bacteria 3776
546 Ga0373937_0055969 3300036401 Bacteria 3621
547 Ga0373937_0218702 3300036401 Bacteria 1793
548 Ga0373937_0328257 3300036401 Bacteria 1448
549 Ga0373925_0005088 3300037068 Bacteria 9841
550 Ga0373925_0006421 3300037068 Bacteria 8653
551 Ga0373925_0077080 3300037068 Bacteria 2529
552 Ga0373925_0232377 3300037068 Bacteria 1475
553 Ga0395899_0003326 3300037312 Bacteria 12743
554 Ga0395900_0145283 3300037418 Bacteria 2425
555 Ga0395900_0409358 3300037418 Bacteria 1319
556 Ga0395898_0007717 3300037466 Bacteria 11423
557 Ga0395905_0000027 3300037471 Bacteria 297239
558 Ga0395905_0000492 3300037471 Bacteria 54399
559 Ga0395905_0005285 3300037471 Bacteria 13205
560 Ga0395905_0024428 3300037471 Bacteria 5704
561 Ga0395901_0060974 3300038443 Bacteria 3925
562 Ga0395901_0325747 3300038443 Bacteria 1589
563 Ga0436365_0797101 3300039437 Bacteria 4419
564 Ga0439436_0032296 3300041404 Bacteria 1518
565 Ga0439436_0040343 3300041404 Bacteria 1338
566 Ga0439447_031399 3300041407 Bacteria 1333
567 Ga0439466_0008218 3300041411 Bacteria 3935
568 Ga0451845_0923310 3300041501 Bacteria 1065
569 Ga0451853_2803178 3300041512 Bacteria 1073
570 Ga0451853_2861878 3300041512 Bacteria 1975
571 Ga0439445_0001503 3300042004 Bacteria 5070
572 Ga0439445_0017625 3300042004 Bacteria 1766
573 Ga0439432_000751 3300042006 Bacteria 12131
574 Ga0439432_028932 3300042006 Bacteria 1803
575 Ga0439449_0002753 3300042007 Bacteria 6842
576 Ga0439450_002769 3300042008 Bacteria 2807
577 Ga0439452_020482 3300042010 Bacteria 1734
578 Ga0439462_0013144 3300042015 Bacteria 2121
579 Ga0450911_000714 3300042115 Bacteria 9675
580 Ga0450906_009514 3300042145 Bacteria 1851
581 Ga0439446_0025803 3300042156 Bacteria 1681
582 Ga0450908_023022 3300042184 Bacteria 1091
583 Ga0439434_0000521 3300042435 Bacteria 10979
584 Ga0439434_0032229 3300042435 Bacteria 1594
585 Ga0439464_0009427 3300042439 Bacteria 2570
586 Ga0450918_007268 3300042531 Bacteria 1964
587 Ga0451577_0034708 3300042876 Bacteria 4545
588 Ga0451577_0077656 3300042876 Bacteria 2961
589 Ga0466960_0034266 3300044901 Bacteria 2365
590 Ga0451576_0045169 3300045051 Bacteria 4641
591 Ga0451576_0046886 3300045051 Bacteria 4548
592 Ga0451576_0126883 3300045051 Bacteria 2658
593 Ga0495592_0018276 3300046454 Bacteria 5328
594 Ga0495592_0038629 3300046454 Bacteria 3590
595 Ga0495592_0241699 3300046454 Bacteria 1198
596 Ga0495651_0004864 3300046462 Bacteria 10278
597 Ga0495653_0016586 3300046463 Bacteria 5995
598 Ga0495580_0030828 3300046472 Bacteria 3879
599 Ga0495639_0001883 3300046475 Bacteria 9302
600 Ga0495662_0032003 3300046476 Bacteria 2540
601 Ga0495664_0028228 3300046477 Bacteria 3277
602 Ga0495608_0017319 3300046511 Bacteria 4984
603 Ga0495608_0052053 3300046511 Bacteria 2711
604 Ga0495628_0000826 3300046516 Bacteria 28697
605 Ga0495663_0023705 3300046525 Bacteria 1780
606 Ga0495642_0088778 3300046528 Bacteria 1307
607 Ga0495652_0005167 3300046529 Bacteria 12342
608 Ga0495652_0029175 3300046529 Bacteria 4847
609 Ga0495654_0003475 3300046530 Bacteria 9623
610 Ga0495665_0001363 3300046531 Bacteria 13069
611 Ga0495640_0009540 3300046533 Bacteria 7549
612 Ga0495586_0012113 3300046535 Bacteria 4578
613 Ga0495587_0014208 3300046536 Bacteria 4997
614 Ga0495598_0020186 3300046537 Bacteria 1756
615 Ga0495621_0010048 3300046539 Bacteria 2888
616 Ga0495645_0000419 3300046543 Bacteria 29318
617 Ga0495645_0139853 3300046543 Bacteria 1690
618 Ga0495633_0184763 3300046558 Bacteria 959
619 Ga0495667_0022002 3300046559 Bacteria 4298
620 Ga0495667_0214338 3300046559 Bacteria 1230
621 Ga0495656_0002368 3300046615 Bacteria 6248
622 Ga0495634_0007734 3300046642 Bacteria 8039
623 Ga0495657_0012040 3300046675 Bacteria 6435
624 Ga0495657_0206380 3300046675 Bacteria 1196
625 Ga0495599_0000476 3300046678 Bacteria 22901
626 Ga0495599_0006605 3300046678 Bacteria 6997
627 Ga0495647_0018668 3300046681 Bacteria 2472
628 Ga0495658_0063549 3300046683 Bacteria 2124
629 Ga0495669_0032817 3300046684 Bacteria 2283
630 Ga0495669_0104579 3300046684 Bacteria 1317
631 Ga0495613_0078278 3300046689 Bacteria 2405
632 Ga0495581_0155442 3300047315 Bacteria 1337
633 Ga0495604_0019442 3300047317 Bacteria 5436
634 Ga0495636_0003473 3300047318 Bacteria 6118
635 Ga0495674_0009625 3300047319 Bacteria 9181
636 Ga0495680_0008579 3300047322 Bacteria 9278
637 Ga0495675_0001332 3300047444 Bacteria 14955
638 Ga0495681_0101270 3300047470 Bacteria 1259
639 Ga0495684_0008994 3300047471 Bacteria 7710
640 Ga0496100_0190733 3300048903 Bacteria 1488
641 Ga0496101_0004340 3300048904 Bacteria 8899
642 Ga0496101_0251577 3300048904 Bacteria 1377
643 Ga0496102_0043995 3300048905 Bacteria 4050
644 Ga0496103_0042834 3300048906 Bacteria 2786
645 Ga0496103_0065059 3300048906 Bacteria 2274
646 Ga0496103_0228185 3300048906 Bacteria 1198
647 Ga0496104_0075420 3300048907 Bacteria 3211
648 Ga0496104_0135850 3300048907 Bacteria 2363
649 Ga0496104_0358800 3300048907 Bacteria 1370
650 Ga0496105_0013954 3300048908 Bacteria 6387
651 Ga0496106_0113688 3300048909 Bacteria 2110
652 Ga0496108_0188870 3300048911 Bacteria 1785
653 Ga0496109_0033593 3300048912 Bacteria 4615
654 Ga0496109_0192357 3300048912 Bacteria 1917
655 Ga0496110_0070534 3300048913 Bacteria 3096
656 Ga0496110_0178144 3300048913 Bacteria 1930
657 Ga0496110_0241034 3300048913 Bacteria 1645
658 Ga0496111_0112321 3300048914 Bacteria 2007
659 Ga0496111_0134709 3300048914 Bacteria 1829
660 Ga0496112_0104512 3300048915 Bacteria 2802
661 Ga0496113_0373480 3300048916 Bacteria 1144
662 Ga0496121_0004542 3300048924 Bacteria 18558
663 Ga0496122_0000184 3300048925 Bacteria 144437
664 Ga0496123_0000181 3300048926 Bacteria 127092
665 Ga0496124_0033333 3300048927 Bacteria 4530
666 Ga0496125_0007111 3300048928 Bacteria 11945
667 Ga0496125_0007919 3300048928 Bacteria 11218
668 Ga0496125_0033645 3300048928 Bacteria 4532
669 Ga0501262_000209 3300049759 Bacteria 7284
670 nmdc:mga03683_26926_c1 3300050489 Bacteria 2273
671 nmdc:mga03683_7048_c1 3300050489 Bacteria 3880
672 nmdc:mga03n38_58743_c1 3300050490 Bacteria 1744
673 nmdc:mga0yw44_135850_c1 3300050492 Bacteria 1595
674 nmdc:mga0yw44_66710_c1 3300050492 Bacteria 2221
675 nmdc:mga0k408_29966_c1 3300050493 Bacteria 3101
676 nmdc:mga0k408_34317_c1 3300050493 Bacteria 2904
677 nmdc:mga0k408_70727_c1 3300050493 Bacteria 2036
678 nmdc:mga06z11_5003_c1 3300050494 Bacteria 5269
679 nmdc:mga07m45_36834_c1 3300050496 Bacteria 2726
680 nmdc:mga07m45_43661_c1 3300050496 Bacteria 2514
681 nmdc:mga07m45_60069_c2 3300050496 Bacteria 1837
682 nmdc:mga07m45_67103_c1 3300050496 Bacteria 1083
683 nmdc:mga05p37_2731_c1 3300050507 Bacteria 20509
684 nmdc:mga09592_1651_c1 3300050508 Bacteria 17950
685 nmdc:mga09592_34056_c1 3300050508 Bacteria 4257
686 nmdc:mga09592_7768_c1 3300050508 Bacteria 8715
687 nmdc:mga0qj67_8225_c2 3300050509 Bacteria 6603
688 nmdc:mga08y16_2538_c1 3300050511 Bacteria 18780
689 nmdc:mga08y16_260843_c1 3300050511 Bacteria 1790
690 nmdc:mga08y16_328861_c1 3300050511 Bacteria 1573
691 nmdc:mga08y16_49249_c1 3300050511 Bacteria 4410
692 nmdc:mga0rr50_4644_c1 3300050513 Bacteria 8094
693 nmdc:mga0rr50_95867_c1 3300050513 Bacteria 2320
694 nmdc:mga08x19_4918_c1 3300050514 Bacteria 7889
695 nmdc:mga0a205_26501_c1 3300050515 Bacteria 5529
696 nmdc:mga0sz30_23984_c1 3300050516 Bacteria 2487
697 Ga0495601_0009086 3300053077 Bacteria 5869
698 Ga0495601_0017699 3300053077 Bacteria 4329
699 Ga0495601_0107988 3300053077 Bacteria 1800
700 Ga0495595_0005077 3300053084 Bacteria 5318
701 Ga0495619_0022417 3300053085 Bacteria 4041
702 Ga0500644_0001138 3300053088 Bacteria 7751
703 Ga0500651_0005197 3300053093 Bacteria 7409
704 Ga0500556_0114877 3300053104 Bacteria 1047
705 Ga0500593_002149 3300053117 Bacteria 7169
706 Ga0500594_0009084 3300053118 Bacteria 2281
707 Ga0500573_0063734 3300053140 Bacteria 2109
708 Ga0500616_0034346 3300053153 Bacteria 2762
709 Ga0500634_0036397 3300053161 Bacteria 2679
710 Ga0500645_000061 3300053730 Bacteria 85703
711 Ga0500661_000809 3300055283 Bacteria 5830

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0088778 Ga0495642_0088778_25_870 280
2 3300046558 Ga0495633_0184763 Ga0495633_0184763_17_862 280
3 iso_pu_bacteria 2924754689 2924761117 285
4 3300005340 Ga0070689_100223463 Ga0070689_1002234632 289
5 3300005544 Ga0070686_100175520 Ga0070686_1001755202 289
6 3300026118 Ga0207675_100313582 Ga0207675_1003135822 290
7 3300035172 Ga0373955_0014117 Ga0373955_0014117_2592_3566 291
8 3300036401 Ga0373937_0055969 Ga0373937_0055969_2592_3566 291
9 3300046511 Ga0495608_0052053 Ga0495608_0052053_393_1367 291
10 3300048906 Ga0496103_0228185 Ga0496103_0228185_290_1168 292
11 3300053093 Ga0500651_0005197 Ga0500651_0005197_5477_6361 294
12 3300046559 Ga0495667_0214338 Ga0495667_0214338_43_1005 295
13 3300035170 Ga0373943_0021729 Ga0373943_0021729_1075_2049 299
14 3300037471 Ga0395905_0024428 Ga0395905_0024428_2358_3347 304
15 3300053140 Ga0500573_0063734 Ga0500573_0063734_558_1487 305
16 3300031731 Ga0307405_10037668 Ga0307405_100376683 307
17 3300003187 JGI25151J46595_10002986 JGI25151J46595_100029867 308
18 3300003781 Ga0055536_1005991 Ga0055536_10059914 308
19 3300003792 Ga0055540_1002684 Ga0055540_10026848 308
20 3300017792 Ga0163161_10000329 Ga0163161_1000032912 308
21 3300025292 Ga0209676_1000325 Ga0209676_100032558 308
22 3300025294 Ga0209025_1000521 Ga0209025_100052161 308
23 3300025303 Ga0209051_1000760 Ga0209051_100076027 308
24 3300027866 Ga0209813_10018671 Ga0209813_100186712 308
25 3300031911 Ga0307412_10002222 Ga0307412_100022229 308
26 3300013104 Ga0157370_10003845 Ga0157370_1000384516 309
27 3300031730 Ga0307516_10003513 Ga0307516_100035132 309
28 3300050494 nmdc:mga06z11_5003_c1 nmdc:mga06z11_5003_c1_72_1043 309
29 3300046684 Ga0495669_0104579 Ga0495669_0104579_41_976 310
30 3300009148 Ga0105243_10002623 Ga0105243_1000262311 311
31 3300025935 Ga0207709_10002195 Ga0207709_100021955 311
32 3300050511 nmdc:mga08y16_49249_c1 nmdc:mga08y16_49249_c1_94_1032 311
33 3300028794 Ga0307515_10131206 Ga0307515_101312062 312
34 3300035083 Ga0373926_0056296 Ga0373926_0056296_88_1083 312
35 3300053153 Ga0500616_0034346 Ga0500616_0034346_1196_2194 313
36 3300005617 Ga0068859_100558755 Ga0068859_1005587552 314
37 3300006931 Ga0097620_100558827 Ga0097620_1005588272 314
38 3300015265 Ga0182005_1036246 Ga0182005_10362462 314
39 3300050496 nmdc:mga07m45_60069_c2 nmdc:mga07m45_60069_c2_470_1483 314
40 3300025292 Ga0209676_1026578 Ga0209676_10265781 315
41 3300010159 Ga0099796_10066554 Ga0099796_100665542 316
42 3300053730 Ga0500645_000061 Ga0500645_000061_79846_80796 316
43 3300005548 Ga0070665_100220512 Ga0070665_1002205122 317
44 3300005564 Ga0070664_100325584 Ga0070664_1003255842 317
45 3300025981 Ga0207640_10359120 Ga0207640_103591201 317
46 3300028379 Ga0268266_10173298 Ga0268266_101732982 317
47 3300032002 Ga0307416_100377465 Ga0307416_1003774651 317
48 3300038443 Ga0395901_0325747 Ga0395901_0325747_337_1353 317
49 iso_pu_bacteria 2547132374 2548497884 317
50 iso_pu_bacteria 2643221717 2644649509 317
51 iso_pu_bacteria 2919704043 2919707392 317
52 3300003773 Ga0055537_1000229 Ga0055537_100022921 318
53 3300003784 Ga0055534_1000081 Ga0055534_100008154 318
54 3300003784 Ga0055534_1001320 Ga0055534_10013208 318
55 3300003790 Ga0055528_1000107 Ga0055528_100010754 318
56 3300005328 Ga0070676_10141185 Ga0070676_101411852 318
57 3300005330 Ga0070690_100192824 Ga0070690_1001928242 318
58 3300005354 Ga0070675_100026424 Ga0070675_1000264245 318
59 3300005364 Ga0070673_100067350 Ga0070673_1000673501 318
60 3300005438 Ga0070701_10125573 Ga0070701_101255732 318
61 3300005844 Ga0068862_100027364 Ga0068862_1000273644 318
62 3300006048 Ga0075363_100010846 Ga0075363_1000108464 318
63 3300006177 Ga0075362_10007059 Ga0075362_100070593 318
64 3300006195 Ga0075366_10012005 Ga0075366_100120052 318
65 3300006948 Ga0099826_10000087 Ga0099826_100000877 318
66 3300007076 Ga0075435_100118338 Ga0075435_1001183383 318
67 3300009094 Ga0111539_10023989 Ga0111539_100239896 318
68 3300009148 Ga0105243_10222758 Ga0105243_102227582 318
69 3300017792 Ga0163161_10013701 Ga0163161_100137014 318
70 3300021384 Ga0213876_10027453 Ga0213876_100274532 318
71 3300025263 Ga0209565_1000150 Ga0209565_100015036 318
72 3300025273 Ga0209673_1000114 Ga0209673_1000114118 318
73 3300025273 Ga0209673_1008634 Ga0209673_10086344 318
74 3300025284 Ga0209130_1006153 Ga0209130_10061532 318
75 3300025291 Ga0209675_1000062 Ga0209675_1000062118 318
76 3300025291 Ga0209675_1004791 Ga0209675_10047913 318
77 3300025292 Ga0209676_1008862 Ga0209676_10088622 318
78 3300025294 Ga0209025_1007738 Ga0209025_10077388 318
79 3300025303 Ga0209051_1042140 Ga0209051_10421402 318
80 3300025304 Ga0209257_1014090 Ga0209257_10140904 318
81 3300025907 Ga0207645_10115523 Ga0207645_101155232 318
82 3300025908 Ga0207643_10054228 Ga0207643_100542282 318
83 3300025923 Ga0207681_10215106 Ga0207681_102151062 318
84 3300025935 Ga0207709_10186987 Ga0207709_101869872 318
85 3300027666 Ga0209282_1000307 Ga0209282_10003075 318
86 3300028380 Ga0268265_10050607 Ga0268265_100506072 318
87 3300031903 Ga0307407_10044743 Ga0307407_100447432 318
88 3300031903 Ga0307407_10125171 Ga0307407_101251712 318
89 3300031911 Ga0307412_10206202 Ga0307412_102062022 318
90 3300032004 Ga0307414_10146811 Ga0307414_101468111 318
91 3300035118 Ga0373954_0010855 Ga0373954_0010855_2525_3484 318
92 3300035692 Ga0373935_0005687 Ga0373935_0005687_3204_4163 318
93 3300036401 Ga0373937_0051422 Ga0373937_0051422_2525_3484 318
94 3300039437 Ga0436365_0797101 Ga0436365_0797101_1707_2669 318
95 3300042145 Ga0450906_009514 Ga0450906_009514_594_1589 318
96 3300046462 Ga0495651_0004864 Ga0495651_0004864_6356_7315 318
97 3300046463 Ga0495653_0016586 Ga0495653_0016586_2522_3481 318
98 3300046477 Ga0495664_0028228 Ga0495664_0028228_2086_3045 318
99 3300046529 Ga0495652_0029175 Ga0495652_0029175_3573_4532 318
100 3300046531 Ga0495665_0001363 Ga0495665_0001363_757_1716 318
101 3300046535 Ga0495586_0012113 Ga0495586_0012113_3157_4116 318
102 3300046536 Ga0495587_0014208 Ga0495587_0014208_2349_3308 318
103 3300046559 Ga0495667_0022002 Ga0495667_0022002_815_1774 318
104 3300046642 Ga0495634_0007734 Ga0495634_0007734_1373_2332 318
105 3300046678 Ga0495599_0006605 Ga0495599_0006605_1173_2132 318
106 3300046681 Ga0495647_0018668 Ga0495647_0018668_14_973 318
107 3300046689 Ga0495613_0078278 Ga0495613_0078278_853_1812 318
108 3300047317 Ga0495604_0019442 Ga0495604_0019442_1953_2912 318
109 3300047319 Ga0495674_0009625 Ga0495674_0009625_2105_3064 318
110 3300047322 Ga0495680_0008579 Ga0495680_0008579_2081_3040 318
111 3300047444 Ga0495675_0001332 Ga0495675_0001332_11911_12870 318
112 3300047471 Ga0495684_0008994 Ga0495684_0008994_5606_6565 318
113 3300050489 nmdc:mga03683_26926_c1 nmdc:mga03683_26926_c1_827_1822 318
114 3300050490 nmdc:mga03n38_58743_c1 nmdc:mga03n38_58743_c1_244_1239 318
115 3300050493 nmdc:mga0k408_34317_c1 nmdc:mga0k408_34317_c1_336_1298 318
116 3300050508 nmdc:mga09592_34056_c1 nmdc:mga09592_34056_c1_2804_3763 318
117 3300053077 Ga0495601_0107988 Ga0495601_0107988_316_1275 318
118 3300053084 Ga0495595_0005077 Ga0495595_0005077_150_1109 318
119 3300005330 Ga0070690_100017765 Ga0070690_1000177655 319
120 3300005343 Ga0070687_100105808 Ga0070687_1001058081 319
121 3300005546 Ga0070696_100004763 Ga0070696_1000047639 319
122 3300005548 Ga0070665_100195858 Ga0070665_1001958582 319
123 3300005842 Ga0068858_100429739 Ga0068858_1004297391 319
124 3300006028 Ga0070717_10399214 Ga0070717_103992141 319
125 3300006237 Ga0097621_100001880 Ga0097621_1000018804 319
126 3300006358 Ga0068871_100002226 Ga0068871_10000222611 319
127 3300006852 Ga0075433_10067380 Ga0075433_100673801 319
128 3300006914 Ga0075436_100102475 Ga0075436_1001024752 319
129 3300007076 Ga0075435_100002374 Ga0075435_1000023744 319
130 3300025918 Ga0207662_10076536 Ga0207662_100765362 319
131 3300026035 Ga0207703_10340960 Ga0207703_103409602 319
132 3300035410 Ga0373924_0072241 Ga0373924_0072241_383_1348 319
133 3300036401 Ga0373937_0328257 Ga0373937_0328257_133_1095 319
134 3300041512 Ga0451853_2803178 Ga0451853_2803178_68_1030 319
135 3300046539 Ga0495621_0010048 Ga0495621_0010048_309_1277 319
136 3300047318 Ga0495636_0003473 Ga0495636_0003473_4654_5616 319
137 3300048904 Ga0496101_0251577 Ga0496101_0251577_102_1070 319
138 3300048912 Ga0496109_0033593 Ga0496109_0033593_3564_4532 319
139 3300048913 Ga0496110_0070534 Ga0496110_0070534_152_1120 319
140 3300050513 nmdc:mga0rr50_4644_c1 nmdc:mga0rr50_4644_c1_1369_2331 319
141 3300050513 nmdc:mga0rr50_95867_c1 nmdc:mga0rr50_95867_c1_485_1447 319
142 3300050515 nmdc:mga0a205_26501_c1 nmdc:mga0a205_26501_c1_2465_3427 319
143 iso_pu_bacteria 2508501127 2509140513 319
144 iso_pu_bacteria 2597489875 2597813952 319
145 iso_pu_bacteria 2856342000 2856344096 319
146 iso_pu_bacteria 2869162929 2869167984 319
147 iso_pu_bacteria 2882632389 2882639023 319
148 iso_pu_bacteria 2885312484 2885317245 319
149 iso_pu_bacteria 2888343758 2888347608 319
150 iso_pu_bacteria 2970524798 2970530315 319
151 iso_pu_bacteria 8004395343 8004401782 319
152 iso_pu_bacteria 8055617313 8055621665 319
153 3300005295 Ga0065707_10086478 Ga0065707_100864784 320
154 3300005983 Ga0081540_1015210 Ga0081540_10152103 320
155 3300006844 Ga0075428_100000130 Ga0075428_10000013052 320
156 3300006880 Ga0075429_100000541 Ga0075429_10000054113 320
157 3300009094 Ga0111539_10000801 Ga0111539_1000080146 320
158 3300009094 Ga0111539_10017872 Ga0111539_100178727 320
159 3300009147 Ga0114129_10000604 Ga0114129_1000060431 320
160 3300025906 Ga0207699_10067868 Ga0207699_100678682 320
161 3300027907 Ga0207428_10001393 Ga0207428_1000139318 320
162 3300027907 Ga0207428_10214401 Ga0207428_102144012 320
163 3300031456 Ga0307513_10152164 Ga0307513_101521641 320
164 3300031730 Ga0307516_10289807 Ga0307516_102898071 320
165 3300031911 Ga0307412_10071053 Ga0307412_100710533 320
166 3300034817 Ga0373948_0008637 Ga0373948_0008637_19_984 320
167 3300034819 Ga0373958_0011585 Ga0373958_0011585_344_1309 320
168 3300034957 Ga0373938_0002172 Ga0373938_0002172_2019_2984 320
169 3300035088 Ga0373940_0002793 Ga0373940_0002793_790_1755 320
170 3300035090 Ga0373949_0005821 Ga0373949_0005821_1577_2542 320
171 3300035112 Ga0373932_0000899 Ga0373932_0000899_6152_7117 320
172 3300035114 Ga0373939_0031116 Ga0373939_0031116_214_1179 320
173 3300035115 Ga0373941_0001232 Ga0373941_0001232_3952_4917 320
174 3300035207 Ga0373942_0004480 Ga0373942_0004480_2112_3077 320
175 3300035691 Ga0373931_0000240 Ga0373931_0000240_15887_16852 320
176 3300045051 Ga0451576_0126883 Ga0451576_0126883_1094_2059 320
177 3300050507 nmdc:mga05p37_2731_c1 nmdc:mga05p37_2731_c1_10835_11800 320
178 3300050508 nmdc:mga09592_1651_c1 nmdc:mga09592_1651_c1_15915_16880 320
179 3300050511 nmdc:mga08y16_2538_c1 nmdc:mga08y16_2538_c1_12365_13330 320
180 3300050511 nmdc:mga08y16_328861_c1 nmdc:mga08y16_328861_c1_123_1091 320
181 3300053104 Ga0500556_0114877 Ga0500556_0114877_24_992 320
182 iso_pu_bacteria 2970540015 2970542389 320
183 iso_pu_bacteria 8054563764 8054568162 320
184 3300005548 Ga0070665_100041030 Ga0070665_1000410303 321
185 3300009098 Ga0105245_10083242 Ga0105245_100832424 321
186 3300009176 Ga0105242_10002310 Ga0105242_100023107 321
187 3300025927 Ga0207687_10049293 Ga0207687_100492934 321
188 3300025935 Ga0207709_10338157 Ga0207709_103381572 321
189 3300028379 Ga0268266_10028790 Ga0268266_100287903 321
190 3300035113 Ga0373936_0042274 Ga0373936_0042274_425_1393 321
191 3300035695 Ga0373927_0094091 Ga0373927_0094091_540_1508 321
192 3300036401 Ga0373937_0218702 Ga0373937_0218702_307_1275 321
193 3300037068 Ga0373925_0005088 Ga0373925_0005088_7374_8342 321
194 3300049759 Ga0501262_000209 Ga0501262_000209_1422_2420 321
195 iso_pu_bacteria 2508501050 2508733986 321
196 iso_pu_bacteria 8045864390 8045867992 321
197 3300005458 Ga0070681_10014937 Ga0070681_100149374 322
198 3300005530 Ga0070679_100021873 Ga0070679_1000218734 322
199 3300005547 Ga0070693_100045512 Ga0070693_1000455122 322
200 3300005548 Ga0070665_100111220 Ga0070665_1001112202 322
201 3300005841 Ga0068863_100062379 Ga0068863_1000623792 322
202 3300006186 Ga0075369_10042662 Ga0075369_100426621 322
203 3300009176 Ga0105242_10021682 Ga0105242_100216823 322
204 3300015265 Ga0182005_1028784 Ga0182005_10287842 322
205 3300025912 Ga0207707_10044809 Ga0207707_100448094 322
206 3300025934 Ga0207686_10031426 Ga0207686_100314262 322
207 3300026088 Ga0207641_10202929 Ga0207641_102029292 322
208 3300026142 Ga0207698_10136339 Ga0207698_101363392 322
209 3300028379 Ga0268266_10084949 Ga0268266_100849492 322
210 3300031911 Ga0307412_10139943 Ga0307412_101399432 322
211 3300045051 Ga0451576_0045169 Ga0451576_0045169_512_1483 322
212 3300046454 Ga0495592_0241699 Ga0495592_0241699_176_1147 322
213 3300046543 Ga0495645_0139853 Ga0495645_0139853_201_1172 322
214 3300046675 Ga0495657_0206380 Ga0495657_0206380_84_1055 322
215 3300050493 nmdc:mga0k408_70727_c1 nmdc:mga0k408_70727_c1_1049_2023 322
216 3300005290 Ga0065712_10014625 Ga0065712_100146252 323
217 3300005293 Ga0065715_10012822 Ga0065715_100128222 323
218 3300005328 Ga0070676_10062704 Ga0070676_100627043 323
219 3300005330 Ga0070690_100059812 Ga0070690_1000598121 323
220 3300005333 Ga0070677_10012753 Ga0070677_100127532 323
221 3300005334 Ga0068869_100081511 Ga0068869_1000815113 323
222 3300005335 Ga0070666_10047403 Ga0070666_100474032 323
223 3300005338 Ga0068868_100341558 Ga0068868_1003415581 323
224 3300005340 Ga0070689_100051287 Ga0070689_1000512872 323
225 3300005343 Ga0070687_100041294 Ga0070687_1000412942 323
226 3300005344 Ga0070661_100160399 Ga0070661_1001603992 323
227 3300005353 Ga0070669_100019673 Ga0070669_1000196734 323
228 3300005355 Ga0070671_100081519 Ga0070671_1000815191 323
229 3300005356 Ga0070674_100029397 Ga0070674_1000293972 323
230 3300005364 Ga0070673_100107639 Ga0070673_1001076392 323
231 3300005365 Ga0070688_100043204 Ga0070688_1000432043 323
232 3300005367 Ga0070667_100201894 Ga0070667_1002018942 323
233 3300005438 Ga0070701_10009247 Ga0070701_100092475 323
234 3300005456 Ga0070678_100081587 Ga0070678_1000815873 323
235 3300005459 Ga0068867_100036909 Ga0068867_1000369091 323
236 3300005544 Ga0070686_100028269 Ga0070686_1000282692 323
237 3300005548 Ga0070665_100013700 Ga0070665_1000137006 323
238 3300005549 Ga0070704_100281280 Ga0070704_1002812802 323
239 3300005577 Ga0068857_100177520 Ga0068857_1001775202 323
240 3300005615 Ga0070702_100063806 Ga0070702_1000638062 323
241 3300005616 Ga0068852_100248037 Ga0068852_1002480372 323
242 3300005617 Ga0068859_100381668 Ga0068859_1003816682 323
243 3300005840 Ga0068870_10048317 Ga0068870_100483172 323
244 3300005841 Ga0068863_100333192 Ga0068863_1003331922 323
245 3300005842 Ga0068858_100117342 Ga0068858_1001173422 323
246 3300005843 Ga0068860_100100078 Ga0068860_1001000782 323
247 3300005844 Ga0068862_100224900 Ga0068862_1002249002 323
248 3300006881 Ga0068865_100217357 Ga0068865_1002173572 323
249 3300006931 Ga0097620_100381709 Ga0097620_1003817092 323
250 3300009094 Ga0111539_10016103 Ga0111539_100161032 323
251 3300009098 Ga0105245_10075153 Ga0105245_100751532 323
252 3300009148 Ga0105243_10080527 Ga0105243_100805272 323
253 3300009176 Ga0105242_10064669 Ga0105242_100646692 323
254 3300009553 Ga0105249_10166771 Ga0105249_101667712 323
255 3300011119 Ga0105246_10158720 Ga0105246_101587202 323
256 3300013297 Ga0157378_10076992 Ga0157378_100769922 323
257 3300014325 Ga0163163_10078290 Ga0163163_100782902 323
258 3300014326 Ga0157380_10067279 Ga0157380_100672792 323
259 3300014745 Ga0157377_10080764 Ga0157377_100807642 323
260 3300014968 Ga0157379_10076187 Ga0157379_100761872 323
261 3300014969 Ga0157376_10163317 Ga0157376_101633172 323
262 3300017792 Ga0163161_10212954 Ga0163161_102129542 323
263 3300025271 Ga0207666_1005525 Ga0207666_10055252 323
264 3300025315 Ga0207697_10009556 Ga0207697_100095562 323
265 3300025893 Ga0207682_10001921 Ga0207682_1000192110 323
266 3300025901 Ga0207688_10004631 Ga0207688_100046312 323
267 3300025907 Ga0207645_10003092 Ga0207645_100030922 323
268 3300025908 Ga0207643_10003923 Ga0207643_100039233 323
269 3300025918 Ga0207662_10003730 Ga0207662_100037304 323
270 3300025923 Ga0207681_10074401 Ga0207681_100744011 323
271 3300025926 Ga0207659_10492099 Ga0207659_104920991 323
272 3300025927 Ga0207687_10322388 Ga0207687_103223882 323
273 3300025933 Ga0207706_10052263 Ga0207706_100522632 323
274 3300025934 Ga0207686_10028134 Ga0207686_100281343 323
275 3300025936 Ga0207670_10099193 Ga0207670_100991932 323
276 3300025938 Ga0207704_10186226 Ga0207704_101862262 323
277 3300025940 Ga0207691_10096530 Ga0207691_100965302 323
278 3300025942 Ga0207689_10003617 Ga0207689_1000361710 323
279 3300025961 Ga0207712_10291971 Ga0207712_102919712 323
280 3300026075 Ga0207708_10003042 Ga0207708_1000304210 323
281 3300026088 Ga0207641_10045647 Ga0207641_100456472 323
282 3300026089 Ga0207648_10003800 Ga0207648_100038005 323
283 3300026116 Ga0207674_10188848 Ga0207674_101888482 323
284 3300026118 Ga0207675_100003993 Ga0207675_1000039937 323
285 3300026121 Ga0207683_10006887 Ga0207683_100068874 323
286 3300027907 Ga0207428_10297530 Ga0207428_102975301 323
287 3300028379 Ga0268266_10078383 Ga0268266_100783832 323
288 3300028380 Ga0268265_10315396 Ga0268265_103153962 323
289 3300035086 Ga0373934_0003128 Ga0373934_0003128_666_1640 323
290 3300035118 Ga0373954_0075111 Ga0373954_0075111_450_1424 323
291 3300035119 Ga0373956_0004750 Ga0373956_0004750_1953_2927 323
292 3300035692 Ga0373935_0214442 Ga0373935_0214442_39_1013 323
293 3300037068 Ga0373925_0077080 Ga0373925_0077080_890_1864 323
294 3300042876 Ga0451577_0034708 Ga0451577_0034708_1969_2943 323
295 3300046454 Ga0495592_0018276 Ga0495592_0018276_1147_2121 323
296 3300046454 Ga0495592_0038629 Ga0495592_0038629_2467_3441 323
297 3300046475 Ga0495639_0001883 Ga0495639_0001883_682_1656 323
298 3300046476 Ga0495662_0032003 Ga0495662_0032003_1047_2021 323
299 3300046511 Ga0495608_0017319 Ga0495608_0017319_2507_3481 323
300 3300046516 Ga0495628_0000826 Ga0495628_0000826_3308_4282 323
301 3300046529 Ga0495652_0005167 Ga0495652_0005167_10503_11477 323
302 3300046533 Ga0495640_0009540 Ga0495640_0009540_5693_6667 323
303 3300046537 Ga0495598_0020186 Ga0495598_0020186_422_1396 323
304 3300046543 Ga0495645_0000419 Ga0495645_0000419_13618_14592 323
305 3300046675 Ga0495657_0012040 Ga0495657_0012040_2812_3786 323
306 3300046678 Ga0495599_0000476 Ga0495599_0000476_10858_11832 323
307 3300046684 Ga0495669_0032817 Ga0495669_0032817_112_1086 323
308 3300047470 Ga0495681_0101270 Ga0495681_0101270_164_1138 323
309 3300048913 Ga0496110_0178144 Ga0496110_0178144_179_1153 323
310 3300050511 nmdc:mga08y16_260843_c1 nmdc:mga08y16_260843_c1_295_1269 323
311 3300053077 Ga0495601_0009086 Ga0495601_0009086_1736_2710 323
312 3300053077 Ga0495601_0017699 Ga0495601_0017699_1260_2234 323
313 3300053085 Ga0495619_0022417 Ga0495619_0022417_558_1532 323
314 3300053161 Ga0500634_0036397 Ga0500634_0036397_1144_2124 323
315 3300003792 Ga0055540_1001837 Ga0055540_10018374 324
316 3300005293 Ga0065715_10021301 Ga0065715_100213013 324
317 3300005339 Ga0070660_100104911 Ga0070660_1001049112 324
318 3300005353 Ga0070669_100229947 Ga0070669_1002299472 324
319 3300005354 Ga0070675_100161306 Ga0070675_1001613061 324
320 3300005356 Ga0070674_100140602 Ga0070674_1001406022 324
321 3300005616 Ga0068852_100244512 Ga0068852_1002445121 324
322 3300006038 Ga0075365_10070319 Ga0075365_100703192 324
323 3300006177 Ga0075362_10030954 Ga0075362_100309541 324
324 3300025303 Ga0209051_1000208 Ga0209051_100020825 324
325 3300025315 Ga0207697_10065936 Ga0207697_100659362 324
326 3300025901 Ga0207688_10033243 Ga0207688_100332431 324
327 3300025923 Ga0207681_10018416 Ga0207681_100184163 324
328 3300025925 Ga0207650_10069686 Ga0207650_100696863 324
329 3300025940 Ga0207691_10017865 Ga0207691_100178655 324
330 3300026089 Ga0207648_10031498 Ga0207648_100314984 324
331 3300031649 Ga0307514_10011166 Ga0307514_100111664 324
332 3300031727 Ga0316576_10022958 Ga0316576_100229583 324
333 3300031731 Ga0307405_10005918 Ga0307405_100059184 324
334 3300031901 Ga0307406_10056965 Ga0307406_100569652 324
335 3300031903 Ga0307407_10039408 Ga0307407_100394083 324
336 3300031911 Ga0307412_10046332 Ga0307412_100463322 324
337 3300032002 Ga0307416_100030125 Ga0307416_1000301253 324
338 3300032004 Ga0307414_10011967 Ga0307414_100119673 324
339 3300035118 Ga0373954_0001879 Ga0373954_0001879_4948_5925 324
340 3300042876 Ga0451577_0077656 Ga0451577_0077656_1510_2487 324
341 3300050489 nmdc:mga03683_7048_c1 nmdc:mga03683_7048_c1_1011_2006 324
342 3300050492 nmdc:mga0yw44_66710_c1 nmdc:mga0yw44_66710_c1_748_1743 324
343 3300050516 nmdc:mga0sz30_23984_c1 nmdc:mga0sz30_23984_c1_645_1640 324
344 iso_pu_bacteria 2738543013 2739251827 324
345 3300005338 Ga0068868_100022609 Ga0068868_1000226094 325
346 3300005536 Ga0070697_100165757 Ga0070697_1001657572 325
347 3300006173 Ga0070716_100009470 Ga0070716_1000094702 325
348 3300006914 Ga0075436_100097370 Ga0075436_1000973702 325
349 3300007265 Ga0099794_10097702 Ga0099794_100977022 325
350 3300025931 Ga0207644_10000068 Ga0207644_1000006817 325
351 3300025939 Ga0207665_10019966 Ga0207665_100199662 325
352 3300026023 Ga0207677_10003663 Ga0207677_100036637 325
353 3300026121 Ga0207683_10177550 Ga0207683_101775502 325
354 3300035695 Ga0373927_0015781 Ga0373927_0015781_3262_4269 325
355 3300037068 Ga0373925_0006421 Ga0373925_0006421_6420_7427 325
356 3300050514 nmdc:mga08x19_4918_c1 nmdc:mga08x19_4918_c1_6188_7168 325
357 3300005327 Ga0070658_10179870 Ga0070658_101798702 326
358 3300005355 Ga0070671_100043326 Ga0070671_1000433263 326
359 3300005456 Ga0070678_100105411 Ga0070678_1001054112 326
360 3300005834 Ga0068851_10048399 Ga0068851_100483993 326
361 3300014745 Ga0157377_10090220 Ga0157377_100902202 326
362 3300025981 Ga0207640_10167449 Ga0207640_101674492 326
363 3300026095 Ga0207676_10037212 Ga0207676_100372123 326
364 3300026121 Ga0207683_10145642 Ga0207683_101456421 326
365 3300031901 Ga0307406_10237084 Ga0307406_102370842 326
366 3300048924 Ga0496121_0004542 Ga0496121_0004542_12975_13955 326
367 3300048928 Ga0496125_0007919 Ga0496125_0007919_4340_5320 326
368 3300048928 Ga0496125_0033645 Ga0496125_0033645_3371_4351 326
369 3300005295 Ga0065707_10113710 Ga0065707_101137103 327
370 3300005335 Ga0070666_10215970 Ga0070666_102159702 327
371 3300005347 Ga0070668_100020892 Ga0070668_1000208924 327
372 3300005366 Ga0070659_100135367 Ga0070659_1001353673 327
373 3300005367 Ga0070667_100262937 Ga0070667_1002629371 327
374 3300005459 Ga0068867_100002211 Ga0068867_1000022117 327
375 3300005539 Ga0068853_100241264 Ga0068853_1002412642 327
376 3300005719 Ga0068861_100002079 Ga0068861_1000020793 327
377 3300005842 Ga0068858_100219961 Ga0068858_1002199612 327
378 3300005843 Ga0068860_100003245 Ga0068860_1000032459 327
379 3300005843 Ga0068860_100033915 Ga0068860_1000339153 327
380 3300005844 Ga0068862_100020138 Ga0068862_1000201383 327
381 3300006881 Ga0068865_100037005 Ga0068865_1000370053 327
382 3300006881 Ga0068865_100152279 Ga0068865_1001522792 327
383 3300013306 Ga0163162_10538660 Ga0163162_105386601 327
384 3300025923 Ga0207681_10081248 Ga0207681_100812482 327
385 3300025937 Ga0207669_10017506 Ga0207669_100175063 327
386 3300025938 Ga0207704_10002833 Ga0207704_100028338 327
387 3300025940 Ga0207691_10038713 Ga0207691_100387134 327
388 3300025942 Ga0207689_10093231 Ga0207689_100932312 327
389 3300026035 Ga0207703_10021291 Ga0207703_100212914 327
390 3300026075 Ga0207708_10174301 Ga0207708_101743012 327
391 3300026089 Ga0207648_10005299 Ga0207648_100052996 327
392 3300026089 Ga0207648_10135611 Ga0207648_101356113 327
393 3300026118 Ga0207675_100002241 Ga0207675_1000022418 327
394 3300026121 Ga0207683_10135215 Ga0207683_101352152 327
395 3300028381 Ga0268264_10011781 Ga0268264_100117813 327
396 3300028381 Ga0268264_10015030 Ga0268264_100150303 327
397 3300037312 Ga0395899_0003326 Ga0395899_0003326_6475_7458 327
398 3300037418 Ga0395900_0145283 Ga0395900_0145283_484_1467 327
399 3300037466 Ga0395898_0007717 Ga0395898_0007717_5216_6199 327
400 3300037471 Ga0395905_0000492 Ga0395905_0000492_16347_17330 327
401 3300037471 Ga0395905_0005285 Ga0395905_0005285_3765_4748 327
402 3300038443 Ga0395901_0060974 Ga0395901_0060974_2459_3442 327
403 iso_pu_bacteria 2885192300 2885196590 327
404 iso_pu_bacteria 2904449895 2904454126 327
405 iso_pu_bacteria 2904456579 2904462017 327
406 iso_pu_bacteria 2904541872 2904545948 327
407 iso_pu_bacteria 2919462493 2919465273 327
408 iso_pu_bacteria 2929160207 2929161143 327
409 iso_pu_bacteria 2929520902 2929521857 327
410 iso_pu_bacteria 2945945610 2945949906 327
411 iso_pu_bacteria 2945972063 2945973925 327
412 iso_pu_bacteria 2954767861 2954770487 327
413 3300005530 Ga0070679_100212154 Ga0070679_1002121542 328
414 3300006846 Ga0075430_100009841 Ga0075430_1000098413 328
415 3300006880 Ga0075429_100003178 Ga0075429_1000031788 328
416 3300025912 Ga0207707_10104139 Ga0207707_101041392 328
417 3300025917 Ga0207660_10131999 Ga0207660_101319992 328
418 3300025921 Ga0207652_10282909 Ga0207652_102829092 328
419 3300025939 Ga0207665_10062982 Ga0207665_100629823 328
420 3300031731 Ga0307405_10172422 Ga0307405_101724222 328
421 3300037418 Ga0395900_0409358 Ga0395900_0409358_135_1121 328
422 3300041404 Ga0439436_0032296 Ga0439436_0032296_308_1294 328
423 3300041411 Ga0439466_0008218 Ga0439466_0008218_645_1631 328
424 3300042004 Ga0439445_0017625 Ga0439445_0017625_110_1096 328
425 3300042006 Ga0439432_028932 Ga0439432_028932_233_1219 328
426 3300042007 Ga0439449_0002753 Ga0439449_0002753_1752_2738 328
427 3300042010 Ga0439452_020482 Ga0439452_020482_678_1664 328
428 3300042015 Ga0439462_0013144 Ga0439462_0013144_572_1558 328
429 3300042115 Ga0450911_000714 Ga0450911_000714_4928_5914 328
430 3300042435 Ga0439434_0032229 Ga0439434_0032229_152_1138 328
431 3300042531 Ga0450918_007268 Ga0450918_007268_835_1821 328
432 3300045051 Ga0451576_0046886 Ga0451576_0046886_1978_2964 328
433 3300050508 nmdc:mga09592_7768_c1 nmdc:mga09592_7768_c1_7379_8365 328
434 3300050509 nmdc:mga0qj67_8225_c2 nmdc:mga0qj67_8225_c2_5043_6029 328
435 iso_pu_bacteria 2842677519 2842681152 328
436 3300037471 Ga0395905_0000027 Ga0395905_0000027_229823_230812 329
437 3300042184 Ga0450908_023022 Ga0450908_023022_28_1017 329
438 3300044901 Ga0466960_0034266 Ga0466960_0034266_538_1527 329
439 3300005336 Ga0070680_100112248 Ga0070680_1001122483 330
440 3300005458 Ga0070681_10130574 Ga0070681_101305741 330
441 3300005530 Ga0070679_100010948 Ga0070679_1000109488 330
442 3300006051 Ga0075364_10079127 Ga0075364_100791272 330
443 3300012512 Ga0157327_1000947 Ga0157327_10009472 330
444 3300014326 Ga0157380_10019525 Ga0157380_100195255 330
445 3300025917 Ga0207660_10007738 Ga0207660_100077383 330
446 3300025921 Ga0207652_10005260 Ga0207652_100052603 330
447 3300046530 Ga0495654_0003475 Ga0495654_0003475_7718_8719 330
448 3300050496 nmdc:mga07m45_67103_c1 nmdc:mga07m45_67103_c1_46_1038 330
449 iso_pu_bacteria 2511231002 2511243466 330
450 3300005288 Ga0065714_10109949 Ga0065714_101099492 331
451 3300005289 Ga0065704_10083585 Ga0065704_100835852 331
452 3300005328 Ga0070676_10049045 Ga0070676_100490452 331
453 3300005328 Ga0070676_10149960 Ga0070676_101499602 331
454 3300005330 Ga0070690_100069129 Ga0070690_1000691292 331
455 3300005331 Ga0070670_100049162 Ga0070670_1000491623 331
456 3300005331 Ga0070670_100073813 Ga0070670_1000738133 331
457 3300005331 Ga0070670_100155929 Ga0070670_1001559293 331
458 3300005333 Ga0070677_10029393 Ga0070677_100293933 331
459 3300005333 Ga0070677_10031593 Ga0070677_100315932 331
460 3300005334 Ga0068869_100011970 Ga0068869_1000119703 331
461 3300005334 Ga0068869_100100809 Ga0068869_1001008092 331
462 3300005335 Ga0070666_10007413 Ga0070666_100074133 331
463 3300005338 Ga0068868_100001955 Ga0068868_1000019559 331
464 3300005338 Ga0068868_100253216 Ga0068868_1002532162 331
465 3300005347 Ga0070668_100003555 Ga0070668_1000035553 331
466 3300005347 Ga0070668_100123058 Ga0070668_1001230582 331
467 3300005353 Ga0070669_100017475 Ga0070669_1000174756 331
468 3300005353 Ga0070669_100080235 Ga0070669_1000802352 331
469 3300005354 Ga0070675_100005320 Ga0070675_1000053206 331
470 3300005354 Ga0070675_100061363 Ga0070675_1000613633 331
471 3300005354 Ga0070675_100079423 Ga0070675_1000794233 331
472 3300005354 Ga0070675_100229391 Ga0070675_1002293912 331
473 3300005354 Ga0070675_100316084 Ga0070675_1003160842 331
474 3300005355 Ga0070671_100006632 Ga0070671_1000066324 331
475 3300005355 Ga0070671_100069616 Ga0070671_1000696162 331
476 3300005356 Ga0070674_100018239 Ga0070674_1000182394 331
477 3300005356 Ga0070674_100070201 Ga0070674_1000702013 331
478 3300005356 Ga0070674_100216580 Ga0070674_1002165802 331
479 3300005356 Ga0070674_100308897 Ga0070674_1003088971 331
480 3300005364 Ga0070673_100029782 Ga0070673_1000297823 331
481 3300005367 Ga0070667_100018788 Ga0070667_1000187882 331
482 3300005367 Ga0070667_100036122 Ga0070667_1000361224 331
483 3300005367 Ga0070667_100038123 Ga0070667_1000381233 331
484 3300005455 Ga0070663_100325826 Ga0070663_1003258261 331
485 3300005456 Ga0070678_100053734 Ga0070678_1000537342 331
486 3300005456 Ga0070678_100058482 Ga0070678_1000584822 331
487 3300005456 Ga0070678_100075327 Ga0070678_1000753273 331
488 3300005457 Ga0070662_100012157 Ga0070662_1000121572 331
489 3300005457 Ga0070662_100023662 Ga0070662_1000236623 331
490 3300005457 Ga0070662_100047737 Ga0070662_1000477372 331
491 3300005457 Ga0070662_100091956 Ga0070662_1000919563 331
492 3300005459 Ga0068867_100033665 Ga0068867_1000336653 331
493 3300005459 Ga0068867_100047053 Ga0068867_1000470533 331
494 3300005535 Ga0070684_100019585 Ga0070684_1000195855 331
495 3300005539 Ga0068853_100046393 Ga0068853_1000463932 331
496 3300005543 Ga0070672_100060460 Ga0070672_1000604603 331
497 3300005543 Ga0070672_100153963 Ga0070672_1001539631 331
498 3300005543 Ga0070672_100343199 Ga0070672_1003431991 331
499 3300005544 Ga0070686_100087148 Ga0070686_1000871483 331
500 3300005548 Ga0070665_100583693 Ga0070665_1005836931 331
501 3300005563 Ga0068855_100039058 Ga0068855_1000390584 331
502 3300005578 Ga0068854_100147454 Ga0068854_1001474542 331
503 3300005614 Ga0068856_100083350 Ga0068856_1000833503 331
504 3300005617 Ga0068859_100004027 Ga0068859_10000402711 331
505 3300005617 Ga0068859_100068114 Ga0068859_1000681144 331
506 3300005618 Ga0068864_100083775 Ga0068864_1000837752 331
507 3300005618 Ga0068864_100126759 Ga0068864_1001267592 331
508 3300005719 Ga0068861_100011946 Ga0068861_1000119466 331
509 3300005834 Ga0068851_10036813 Ga0068851_100368132 331
510 3300005834 Ga0068851_10122175 Ga0068851_101221752 331
511 3300005841 Ga0068863_100004155 Ga0068863_1000041558 331
512 3300005841 Ga0068863_100071438 Ga0068863_1000714383 331
513 3300005841 Ga0068863_100167627 Ga0068863_1001676273 331
514 3300005842 Ga0068858_100002678 Ga0068858_1000026788 331
515 3300005843 Ga0068860_100005443 Ga0068860_1000054433 331
516 3300006237 Ga0097621_100061406 Ga0097621_1000614062 331
517 3300006237 Ga0097621_100117798 Ga0097621_1001177981 331
518 3300006358 Ga0068871_100040497 Ga0068871_1000404972 331
519 3300006931 Ga0097620_100004027 Ga0097620_10000402711 331
520 3300006931 Ga0097620_100068114 Ga0097620_1000681142 331
521 3300009148 Ga0105243_10068322 Ga0105243_100683223 331
522 3300009174 Ga0105241_10351492 Ga0105241_103514921 331
523 3300009177 Ga0105248_10051302 Ga0105248_100513024 331
524 3300009177 Ga0105248_10128074 Ga0105248_101280743 331
525 3300009545 Ga0105237_10060033 Ga0105237_100600334 331
526 3300009551 Ga0105238_10293509 Ga0105238_102935092 331
527 3300009553 Ga0105249_10017865 Ga0105249_100178653 331
528 3300009553 Ga0105249_10248077 Ga0105249_102480772 331
529 3300010375 Ga0105239_10066299 Ga0105239_100662992 331
530 3300013105 Ga0157369_10166440 Ga0157369_101664403 331
531 3300013296 Ga0157374_10037741 Ga0157374_100377414 331
532 3300013296 Ga0157374_10100494 Ga0157374_101004941 331
533 3300013306 Ga0163162_10106194 Ga0163162_101061943 331
534 3300013306 Ga0163162_10222435 Ga0163162_102224353 331
535 3300013308 Ga0157375_10125411 Ga0157375_101254113 331
536 3300014325 Ga0163163_10016809 Ga0163163_100168095 331
537 3300014326 Ga0157380_10019496 Ga0157380_100194963 331
538 3300014745 Ga0157377_10012265 Ga0157377_100122654 331
539 3300014969 Ga0157376_10103751 Ga0157376_101037512 331
540 3300017792 Ga0163161_10053805 Ga0163161_100538053 331
541 3300017792 Ga0163161_10098799 Ga0163161_100987993 331
542 3300017792 Ga0163161_10129110 Ga0163161_101291102 331
543 3300025271 Ga0207666_1001766 Ga0207666_10017662 331
544 3300025315 Ga0207697_10032926 Ga0207697_100329262 331
545 3300025893 Ga0207682_10009146 Ga0207682_100091463 331
546 3300025893 Ga0207682_10038424 Ga0207682_100384243 331
547 3300025893 Ga0207682_10057923 Ga0207682_100579232 331
548 3300025899 Ga0207642_10015639 Ga0207642_100156392 331
549 3300025907 Ga0207645_10007091 Ga0207645_100070916 331
550 3300025907 Ga0207645_10027206 Ga0207645_100272064 331
551 3300025914 Ga0207671_10162669 Ga0207671_101626692 331
552 3300025919 Ga0207657_10049797 Ga0207657_100497971 331
553 3300025923 Ga0207681_10007401 Ga0207681_100074013 331
554 3300025923 Ga0207681_10124240 Ga0207681_101242402 331
555 3300025924 Ga0207694_10076303 Ga0207694_100763032 331
556 3300025925 Ga0207650_10023527 Ga0207650_100235273 331
557 3300025926 Ga0207659_10007169 Ga0207659_100071695 331
558 3300025926 Ga0207659_10020490 Ga0207659_100204904 331
559 3300025926 Ga0207659_10058986 Ga0207659_100589862 331
560 3300025926 Ga0207659_10059908 Ga0207659_100599082 331
561 3300025926 Ga0207659_10138499 Ga0207659_101384993 331
562 3300025926 Ga0207659_10356728 Ga0207659_103567282 331
563 3300025931 Ga0207644_10015661 Ga0207644_100156614 331
564 3300025931 Ga0207644_10051778 Ga0207644_100517782 331
565 3300025932 Ga0207690_10095883 Ga0207690_100958833 331
566 3300025933 Ga0207706_10152950 Ga0207706_101529501 331
567 3300025935 Ga0207709_10021397 Ga0207709_100213972 331
568 3300025937 Ga0207669_10026733 Ga0207669_100267331 331
569 3300025937 Ga0207669_10067712 Ga0207669_100677122 331
570 3300025938 Ga0207704_10058905 Ga0207704_100589052 331
571 3300025940 Ga0207691_10135806 Ga0207691_101358063 331
572 3300025940 Ga0207691_10140623 Ga0207691_101406231 331
573 3300025940 Ga0207691_10168616 Ga0207691_101686163 331
574 3300025941 Ga0207711_10019765 Ga0207711_100197654 331
575 3300025941 Ga0207711_10054755 Ga0207711_100547551 331
576 3300025942 Ga0207689_10001957 Ga0207689_1000195715 331
577 3300025942 Ga0207689_10028597 Ga0207689_100285973 331
578 3300025942 Ga0207689_10057292 Ga0207689_100572923 331
579 3300025960 Ga0207651_10183129 Ga0207651_101831292 331
580 3300025960 Ga0207651_10425300 Ga0207651_104253001 331
581 3300025961 Ga0207712_10085529 Ga0207712_100855293 331
582 3300025972 Ga0207668_10159663 Ga0207668_101596632 331
583 3300025981 Ga0207640_10314162 Ga0207640_103141622 331
584 3300025986 Ga0207658_10040984 Ga0207658_100409843 331
585 3300026023 Ga0207677_10010533 Ga0207677_100105332 331
586 3300026035 Ga0207703_10007902 Ga0207703_100079022 331
587 3300026041 Ga0207639_10169145 Ga0207639_101691452 331
588 3300026078 Ga0207702_10121901 Ga0207702_101219012 331
589 3300026088 Ga0207641_10005089 Ga0207641_100050897 331
590 3300026088 Ga0207641_10012091 Ga0207641_100120918 331
591 3300026088 Ga0207641_10021771 Ga0207641_100217715 331
592 3300026088 Ga0207641_10097342 Ga0207641_100973422 331
593 3300026089 Ga0207648_10120272 Ga0207648_101202722 331
594 3300026089 Ga0207648_10230632 Ga0207648_102306322 331
595 3300026089 Ga0207648_10256610 Ga0207648_102566102 331
596 3300026095 Ga0207676_10005921 Ga0207676_100059218 331
597 3300026095 Ga0207676_10067533 Ga0207676_100675332 331
598 3300026118 Ga0207675_100004245 Ga0207675_1000042454 331
599 3300026118 Ga0207675_100004891 Ga0207675_1000048916 331
600 3300026121 Ga0207683_10009318 Ga0207683_100093185 331
601 3300026121 Ga0207683_10037761 Ga0207683_100377613 331
602 3300026121 Ga0207683_10051292 Ga0207683_100512922 331
603 3300026121 Ga0207683_10066018 Ga0207683_100660183 331
604 3300026121 Ga0207683_10082714 Ga0207683_100827143 331
605 3300028379 Ga0268266_10260665 Ga0268266_102606651 331
606 3300028380 Ga0268265_10311769 Ga0268265_103117692 331
607 3300028381 Ga0268264_10004057 Ga0268264_1000405710 331
608 3300028794 Ga0307515_10000064 Ga0307515_10000064111 331
609 3300031456 Ga0307513_10282106 Ga0307513_102821062 331
610 3300031731 Ga0307405_10156098 Ga0307405_101560982 331
611 3300031731 Ga0307405_10312652 Ga0307405_103126522 331
612 3300031901 Ga0307406_10018017 Ga0307406_100180173 331
613 3300031995 Ga0307409_100000592 Ga0307409_10000059212 331
614 3300032002 Ga0307416_100006736 Ga0307416_1000067366 331
615 3300032002 Ga0307416_100214103 Ga0307416_1002141031 331
616 3300032126 Ga0307415_100002275 Ga0307415_1000022751 331
617 3300035691 Ga0373931_0045475 Ga0373931_0045475_99_1094 331
618 3300037068 Ga0373925_0232377 Ga0373925_0232377_445_1440 331
619 3300041404 Ga0439436_0040343 Ga0439436_0040343_217_1212 331
620 3300041407 Ga0439447_031399 Ga0439447_031399_328_1323 331
621 3300041501 Ga0451845_0923310 Ga0451845_0923310_32_1027 331
622 3300041512 Ga0451853_2861878 Ga0451853_2861878_228_1223 331
623 3300042004 Ga0439445_0001503 Ga0439445_0001503_2807_3802 331
624 3300042006 Ga0439432_000751 Ga0439432_000751_7964_8959 331
625 3300042008 Ga0439450_002769 Ga0439450_002769_484_1479 331
626 3300042156 Ga0439446_0025803 Ga0439446_0025803_650_1645 331
627 3300042435 Ga0439434_0000521 Ga0439434_0000521_3518_4513 331
628 3300042439 Ga0439464_0009427 Ga0439464_0009427_441_1436 331
629 3300046472 Ga0495580_0030828 Ga0495580_0030828_2093_3130 331
630 3300046525 Ga0495663_0023705 Ga0495663_0023705_737_1732 331
631 3300046615 Ga0495656_0002368 Ga0495656_0002368_3088_4083 331
632 3300046683 Ga0495658_0063549 Ga0495658_0063549_58_1152 331
633 3300047315 Ga0495581_0155442 Ga0495581_0155442_174_1169 331
634 3300048903 Ga0496100_0190733 Ga0496100_0190733_189_1184 331
635 3300048904 Ga0496101_0004340 Ga0496101_0004340_1384_2379 331
636 3300048905 Ga0496102_0043995 Ga0496102_0043995_1422_2417 331
637 3300048906 Ga0496103_0042834 Ga0496103_0042834_117_1112 331
638 3300048906 Ga0496103_0065059 Ga0496103_0065059_1267_2262 331
639 3300048907 Ga0496104_0075420 Ga0496104_0075420_1364_2359 331
640 3300048907 Ga0496104_0135850 Ga0496104_0135850_835_1830 331
641 3300048907 Ga0496104_0358800 Ga0496104_0358800_165_1160 331
642 3300048908 Ga0496105_0013954 Ga0496105_0013954_3255_4250 331
643 3300048909 Ga0496106_0113688 Ga0496106_0113688_937_1932 331
644 3300048911 Ga0496108_0188870 Ga0496108_0188870_166_1161 331
645 3300048912 Ga0496109_0192357 Ga0496109_0192357_241_1236 331
646 3300048913 Ga0496110_0241034 Ga0496110_0241034_382_1377 331
647 3300048914 Ga0496111_0112321 Ga0496111_0112321_729_1724 331
648 3300048914 Ga0496111_0134709 Ga0496111_0134709_456_1451 331
649 3300048915 Ga0496112_0104512 Ga0496112_0104512_1439_2434 331
650 3300048916 Ga0496113_0373480 Ga0496113_0373480_130_1125 331
651 3300048925 Ga0496122_0000184 Ga0496122_0000184_63226_64233 331
652 3300048926 Ga0496123_0000181 Ga0496123_0000181_173_1180 331
653 3300048927 Ga0496124_0033333 Ga0496124_0033333_1640_2647 331
654 3300053118 Ga0500594_0009084 Ga0500594_0009084_777_1784 331
655 iso_pu_bacteria 2643221683 2644466121 331
656 iso_pu_bacteria 2842733646 2842737420 331
657 iso_pu_bacteria 2842747753 2842749839 331
658 iso_pu_bacteria 2945909444 2945914375 331
659 iso_pu_bacteria 2945984333 2945990230 331
660 3300005441 Ga0070700_100061684 Ga0070700_1000616842 332
661 3300005456 Ga0070678_100206128 Ga0070678_1002061282 332
662 3300005543 Ga0070672_100061360 Ga0070672_1000613602 332
663 3300005718 Ga0068866_10008823 Ga0068866_100088233 332
664 3300006195 Ga0075366_10001983 Ga0075366_100019833 332
665 3300006353 Ga0075370_10021532 Ga0075370_100215322 332
666 3300009553 Ga0105249_10139785 Ga0105249_101397851 332
667 3300013297 Ga0157378_10022765 Ga0157378_100227653 332
668 3300013306 Ga0163162_10005074 Ga0163162_1000507414 332
669 3300013308 Ga0157375_10024303 Ga0157375_100243032 332
670 3300014968 Ga0157379_10052219 Ga0157379_100522192 332
671 3300025940 Ga0207691_10076011 Ga0207691_100760112 332
672 3300025972 Ga0207668_10050743 Ga0207668_100507432 332
673 3300028380 Ga0268265_10093826 Ga0268265_100938262 332
674 3300030733 Ga0314311_1070027 Ga0314311_10700271 332
675 3300030735 Ga0316178_1126380 Ga0316178_11263802 332
676 3300030742 Ga0316183_1110495 Ga0316183_11104953 332
677 3300048928 Ga0496125_0007111 Ga0496125_0007111_1883_2881 332
678 3300050493 nmdc:mga0k408_29966_c1 nmdc:mga0k408_29966_c1_728_1726 332
679 3300050496 nmdc:mga07m45_43661_c1 nmdc:mga07m45_43661_c1_1061_2059 332
680 3300002704 JGI25155J39150_1000028 JGI25155J39150_100002881 334
681 3300002705 JGI25156J39149_1000013 JGI25156J39149_100001332 334
682 3300002738 JGI25154J39366_1000032 JGI25154J39366_100003232 334
683 3300002741 JGI25157J39369_1000017 JGI25157J39369_100001732 334
684 3300002774 JGI25150J39212_1008334 JGI25150J39212_10083341 334
685 3300002987 JGI25159J45721_1004214 JGI25159J45721_10042143 334
686 3300002987 JGI25159J45721_1006741 JGI25159J45721_10067412 334
687 3300003187 JGI25151J46595_10008595 JGI25151J46595_100085953 334
688 3300003187 JGI25151J46595_10012976 JGI25151J46595_100129764 334
689 3300003187 JGI25151J46595_10026532 JGI25151J46595_100265322 334
690 3300003354 JGI25160J50197_1000106 JGI25160J50197_10001063 334
691 3300003374 JGI25161J50226_1000041 JGI25161J50226_100004143 334
692 3300003771 Ga0055526_1006939 Ga0055526_10069393 334
693 3300003771 Ga0055526_1006976 Ga0055526_10069763 334
694 3300003773 Ga0055537_1000029 Ga0055537_100002993 334
695 3300003773 Ga0055537_1008434 Ga0055537_10084343 334
696 3300003775 Ga0055524_1000040 Ga0055524_100004039 334
697 3300003781 Ga0055536_1003958 Ga0055536_10039585 334
698 3300003790 Ga0055528_1003803 Ga0055528_10038035 334
699 3300003791 Ga0055530_10000493 Ga0055530_1000049325 334
700 3300003792 Ga0055540_1000030 Ga0055540_1000030119 334
701 3300003794 Ga0055531_10009620 Ga0055531_100096203 334
702 3300004625 Ga0055543_1001200 Ga0055543_10012003 334
703 3300005262 Ga0065165_1017710 Ga0065165_10177102 334
704 3300006038 Ga0075365_10143044 Ga0075365_101430442 334
705 3300006948 Ga0099826_10073699 Ga0099826_100736993 334
706 3300012513 Ga0157326_1000451 Ga0157326_10004513 334
707 3300025206 Ga0209435_100003 Ga0209435_100003140 334
708 3300025208 Ga0209436_105046 Ga0209436_1050463 334
709 3300025245 Ga0207425_1007648 Ga0207425_10076483 334
710 3300025246 Ga0209646_1000008 Ga0209646_1000008140 334
711 3300025250 Ga0209026_1000007 Ga0209026_1000007140 334
712 3300025256 Ga0209759_1000026 Ga0209759_1000026140 334
713 3300025258 Ga0209129_1007409 Ga0209129_10074093 334
714 3300025258 Ga0209129_1020623 Ga0209129_10206231 334
715 3300025263 Ga0209565_1000026 Ga0209565_1000026343 334
716 3300025263 Ga0209565_1001312 Ga0209565_10013127 334
717 3300025273 Ga0209673_1000009 Ga0209673_1000009350 334
718 3300025273 Ga0209673_1000012 Ga0209673_1000012251 334
719 3300025284 Ga0209130_1000099 Ga0209130_100009993 334
720 3300025284 Ga0209130_1000123 Ga0209130_10001233 334
721 3300025291 Ga0209675_1000155 Ga0209675_100015512 334
722 3300025291 Ga0209675_1005864 Ga0209675_10058643 334
723 3300025292 Ga0209676_1000051 Ga0209676_1000051119 334
724 3300025292 Ga0209676_1009460 Ga0209676_10094605 334
725 3300025294 Ga0209025_1004061 Ga0209025_10040618 334
726 3300025294 Ga0209025_1009286 Ga0209025_10092867 334
727 3300025295 Ga0209564_1000211 Ga0209564_100021123 334
728 3300025295 Ga0209564_1000228 Ga0209564_100022823 334
729 3300025295 Ga0209564_1004815 Ga0209564_10048156 334
730 3300025297 Ga0209758_1054147 Ga0209758_10541471 334
731 3300025298 Ga0209050_1000044 Ga0209050_1000044227 334
732 3300025298 Ga0209050_1003950 Ga0209050_10039503 334
733 3300025298 Ga0209050_1010312 Ga0209050_10103123 334
734 3300025299 Ga0209256_1000003 Ga0209256_1000003505 334
735 3300025302 Ga0207426_1000062 Ga0207426_1000062258 334
736 3300025302 Ga0207426_1003919 Ga0207426_10039192 334
737 3300025303 Ga0209051_1000031 Ga0209051_1000031227 334
738 3300025304 Ga0209257_1000058 Ga0209257_1000058221 334
739 3300025304 Ga0209257_1008393 Ga0209257_10083933 334
740 3300031456 Ga0307513_10000090 Ga0307513_1000009037 334
741 3300031548 Ga0307408_100005621 Ga0307408_1000056212 334
742 3300031901 Ga0307406_10006495 Ga0307406_100064956 334
743 3300050492 nmdc:mga0yw44_135850_c1 nmdc:mga0yw44_135850_c1_202_1206 334
744 3300050496 nmdc:mga07m45_36834_c1 nmdc:mga07m45_36834_c1_711_1715 334
745 3300053088 Ga0500644_0001138 Ga0500644_0001138_980_1984 334
746 3300053117 Ga0500593_002149 Ga0500593_002149_5783_6787 334
747 3300055283 Ga0500661_000809 Ga0500661_000809_3387_4424 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

50

328

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pdd-assembly3.cif.gz_C crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d-erythronate 0.9397 33 334
4nq8-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate 0.9339 33 334
4xeq-assembly4.cif.gz_D crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid 0.9331 35 333
4p9k-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d-erythronate with residual density suggestive of superposition with copurified alternative ligand. 0.932 32 334
4pdh-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d-erythronate 0.9316 33 334
ID Description Score Start End Superfamily
4nq8A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9339 34 334 3.40.190.170
4nq8A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9279 34 334 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9257 35 334 3.40.190.170
4xeqD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9197 35 334 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9168 34 315 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A4Q3MNW1-F1-model_v4 deleted 0.9827 173 334
AF-A0A4Q3MNW1-F1-model_v4 deleted 0.9708 173 334
AF-A0A3D5VSW4-F1-model_v4 ABC transporter substrate-binding protein 0.9675 23 334 GO:0030288
GO:0055085
AF-A0A3P3EGW7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9661 70 334 GO:0030288
GO:0055085
AF-A0A3P3EGW7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9625 70 334 GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
88.59 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map