F478885

General Info

Members Datasets Scaffolds Average Seq Length
746 323 746 226

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0052940|Ga0495628_0052940_1108_1899
Length 263
Sequence MTMIATMTMRAMVMKAPVVGPVGPVYAQSYRRERAGELSVSGTQEAQEWAEAVRRFGERAGVAYEPVGGINPKDGPVALCVGGSNRLTGQLVEGFWGSSCDAGEKEVGGLFGKALVPTAILAKAHMPDLAKVVPAFNVESIEGTEALTQHLVRKVEFESLEFNRRFIATVPKEHDPVALRELFSPGFLEWTTTMTGEVDFGVNDRQLWFLWRLGERSEGELKEALKNAGRLFGRIQGEMDESGIHTYPPGPWHAGLEPFPDAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
160 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
180 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
318 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 11.8
Rhizosphere 80.83
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000852 3300001977 Bacteria 4729
2 JGI24748J21848_1000142 3300002074 Bacteria 12113
3 JGI24034J26672_10002156 3300002239 Bacteria 2682
4 JGI24742J22300_10009386 3300002244 Bacteria 1614
5 JGI25404J52841_10004750 3300003659 Bacteria 2776
6 Ga0070658_10056777 3300005327 Bacteria 3183
7 Ga0070658_10095850 3300005327 Bacteria 2449
8 Ga0070683_100002869 3300005329 Bacteria 13809
9 Ga0070683_100004639 3300005329 Bacteria 11352
10 Ga0070683_100078997 3300005329 Bacteria 3079
11 Ga0070683_100125107 3300005329 Bacteria 2430
12 Ga0070677_10000081 3300005333 Bacteria 30569
13 Ga0070666_10259004 3300005335 Bacteria 1233
14 Ga0070680_100083006 3300005336 Bacteria 2646
15 Ga0070680_100132860 3300005336 Bacteria 2083
16 Ga0070682_100000009 3300005337 Bacteria 291635
17 Ga0070682_100000032 3300005337 Bacteria 155141
18 Ga0070682_100011743 3300005337 Bacteria 5008
19 Ga0070682_100205638 3300005337 Bacteria 1392
20 Ga0068868_100000138 3300005338 Bacteria 46922
21 Ga0068868_100246705 3300005338 Bacteria 1502
22 Ga0070660_100017636 3300005339 Bacteria 5205
23 Ga0070660_100410716 3300005339 Bacteria 1120
24 Ga0070689_100083814 3300005340 Bacteria 2505
25 Ga0070689_100112308 3300005340 Bacteria 2169
26 Ga0070689_100219819 3300005340 Bacteria 1558
27 Ga0070689_100443317 3300005340 Bacteria 1104
28 Ga0070668_100001413 3300005347 Bacteria 17288
29 Ga0070668_100375900 3300005347 Bacteria 1208
30 Ga0070675_100000022 3300005354 Bacteria 146580
31 Ga0070675_100018681 3300005354 Bacteria 5519
32 Ga0070674_100000021 3300005356 Bacteria 87134
33 Ga0070674_100000075 3300005356 Bacteria 45822
34 Ga0070674_100325405 3300005356 Bacteria 1234
35 Ga0070674_100631279 3300005356 Bacteria 909
36 Ga0070673_100017018 3300005364 Bacteria 5158
37 Ga0070688_100000168 3300005365 Bacteria 35364
38 Ga0070688_100052550 3300005365 Bacteria 2545
39 Ga0070659_100001004 3300005366 Bacteria 20715
40 Ga0070659_100016201 3300005366 Bacteria 5593
41 Ga0070667_100029913 3300005367 Bacteria 4541
42 Ga0070703_10048196 3300005406 Bacteria 1353
43 Ga0070713_100000171 3300005436 Bacteria 43503
44 Ga0070713_100395603 3300005436 Bacteria 1290
45 Ga0070701_10461826 3300005438 Bacteria 817
46 Ga0070711_100011385 3300005439 Bacteria 5521
47 Ga0070711_100225570 3300005439 Bacteria 1459
48 Ga0070700_100001537 3300005441 Bacteria 11499
49 Ga0070700_100022395 3300005441 Bacteria 3684
50 Ga0070700_100060903 3300005441 Bacteria 2380
51 Ga0070700_100095004 3300005441 Bacteria 1953
52 Ga0070663_100005777 3300005455 Bacteria 7384
53 Ga0070662_100000052 3300005457 Bacteria 61979
54 Ga0070662_100067597 3300005457 Unclassified 2624
55 Ga0070681_10363839 3300005458 Bacteria 1357
56 Ga0068867_100002852 3300005459 Bacteria 12156
57 Ga0068867_100005467 3300005459 Bacteria 8990
58 Ga0070685_10000058 3300005466 Bacteria 64666
59 Ga0070685_10000246 3300005466 Bacteria 35364
60 Ga0070685_10023282 3300005466 Bacteria 3390
61 Ga0070685_10139246 3300005466 Bacteria 1526
62 Ga0070679_100000190 3300005530 Bacteria 49809
63 Ga0070679_100018989 3300005530 Bacteria 6677
64 Ga0070679_100207035 3300005530 Bacteria 1926
65 Ga0070684_100004244 3300005535 Bacteria 10858
66 Ga0070684_100005286 3300005535 Bacteria 9880
67 Ga0070684_100025254 3300005535 Bacteria 4993
68 Ga0070684_100135000 3300005535 Bacteria 2228
69 Ga0070684_100166527 3300005535 Bacteria 2001
70 Ga0068853_100000830 3300005539 Bacteria 21615
71 Ga0068853_100026166 3300005539 Bacteria 4899
72 Ga0068853_100244080 3300005539 Bacteria 1647
73 Ga0070672_100000258 3300005543 Bacteria 30020
74 Ga0070686_100105526 3300005544 Bacteria 1911
75 Ga0070686_100150834 3300005544 Bacteria 1628
76 Ga0070693_100010796 3300005547 Bacteria 4583
77 Ga0070693_100442839 3300005547 Unclassified 910
78 Ga0070665_100000022 3300005548 Bacteria 379286
79 Ga0070665_100002631 3300005548 Bacteria 19567
80 Ga0070665_100041985 3300005548 Bacteria 4598
81 Ga0070704_100101516 3300005549 Bacteria 2169
82 Ga0070704_100214917 3300005549 Bacteria 1560
83 Ga0070704_100414774 3300005549 Bacteria 1152
84 Ga0068855_101079344 3300005563 Bacteria 840
85 Ga0070664_100515814 3300005564 Bacteria 1103
86 Ga0068857_100112558 3300005577 Unclassified 2447
87 Ga0068854_100000133 3300005578 Bacteria 51376
88 Ga0068854_100002063 3300005578 Bacteria 12308
89 Ga0068856_100000369 3300005614 Bacteria 49419
90 Ga0068856_100002525 3300005614 Bacteria 18856
91 Ga0068856_100063621 3300005614 Bacteria 3645
92 Ga0068852_100000024 3300005616 Bacteria 120479
93 Ga0068852_100007178 3300005616 Bacteria 8121
94 Ga0068852_100179703 3300005616 Bacteria 1989
95 Ga0068859_100382368 3300005617 Bacteria 1503
96 Ga0068859_100864701 3300005617 Bacteria 990
97 Ga0068864_100000023 3300005618 Bacteria 257064
98 Ga0068864_100803145 3300005618 Unclassified 925
99 Ga0068866_10000007 3300005718 Bacteria 121729
100 Ga0068866_10000220 3300005718 Bacteria 27117
101 Ga0068866_10028076 3300005718 Bacteria 2678
102 Ga0068866_10090266 3300005718 Bacteria 1667
103 Ga0068861_100466090 3300005719 Bacteria 1135
104 Ga0068861_101013713 3300005719 Unclassified 793
105 Ga0068851_10004687 3300005834 Bacteria 6181
106 Ga0068851_10115479 3300005834 Bacteria 1438
107 Ga0068863_100000110 3300005841 Bacteria 86415
108 Ga0068863_100015825 3300005841 Bacteria 7236
109 Ga0068863_100136020 3300005841 Bacteria 2348
110 Ga0068858_100000150 3300005842 Bacteria 73075
111 Ga0068860_100003597 3300005843 Bacteria 15930
112 Ga0068860_100120198 3300005843 Bacteria 2515
113 Ga0068860_100154142 3300005843 Bacteria 2214
114 Ga0068860_100168975 3300005843 Unclassified 2112
115 Ga0068862_100010696 3300005844 Bacteria 7577
116 Ga0068862_100563515 3300005844 Bacteria 1089
117 Ga0081455_10002533 3300005937 Bacteria 21714
118 Ga0081455_10021062 3300005937 Bacteria 6122
119 Ga0081455_10043091 3300005937 Bacteria 3953
120 Ga0081455_10367227 3300005937 Bacteria 1010
121 Ga0081538_10000034 3300005981 Bacteria 120557
122 Ga0081538_10055616 3300005981 Bacteria 2327
123 Ga0081540_1000435 3300005983 Bacteria 41191
124 Ga0081539_10001052 3300005985 Bacteria 50554
125 Ga0081539_10054756 3300005985 Bacteria 2224
126 Ga0075365_10000722 3300006038 Bacteria 13367
127 Ga0075365_10001081 3300006038 Bacteria 11830
128 Ga0075365_10020147 3300006038 Bacteria 4130
129 Ga0075365_10331469 3300006038 Bacteria 1072
130 Ga0075365_10333096 3300006038 Bacteria 1069
131 Ga0075368_10083724 3300006042 Bacteria 1300
132 Ga0075363_100012920 3300006048 Bacteria 4032
133 Ga0075363_100083218 3300006048 Bacteria 1753
134 Ga0075363_100101017 3300006048 Unclassified 1596
135 Ga0075364_10002834 3300006051 Bacteria 9763
136 Ga0075364_10072097 3300006051 Unclassified 2276
137 Ga0075364_10090037 3300006051 Archaea 2035
138 Ga0070715_10000003 3300006163 Bacteria 345282
139 Ga0070715_10308787 3300006163 Bacteria 849
140 Ga0070716_100505659 3300006173 Bacteria 892
141 Ga0070712_100007464 3300006175 Bacteria 6826
142 Ga0075367_10011862 3300006178 Bacteria 4628
143 Ga0075367_10157222 3300006178 Bacteria 1413
144 Ga0075428_100155458 3300006844 Unclassified 2485
145 Ga0075430_100057762 3300006846 Bacteria 3263
146 Ga0075430_100142504 3300006846 Bacteria 1996
147 Ga0075431_100011336 3300006847 Bacteria 8982
148 Ga0075431_100019643 3300006847 Bacteria 6893
149 Ga0075431_100487984 3300006847 Bacteria 1224
150 Ga0075431_100674159 3300006847 Unclassified 1013
151 Ga0075433_10001846 3300006852 Bacteria 15916
152 Ga0075433_10004595 3300006852 Bacteria 10768
153 Ga0075429_100216894 3300006880 Bacteria 1676
154 Ga0068865_100000024 3300006881 Bacteria 94969
155 Ga0068865_100016376 3300006881 Bacteria 4743
156 Ga0068865_100403410 3300006881 Bacteria 1120
157 Ga0075436_100207673 3300006914 Bacteria 1388
158 Ga0097620_100382350 3300006931 Bacteria 1503
159 Ga0097620_100864802 3300006931 Bacteria 990
160 Ga0075435_100011075 3300007076 Bacteria 6613
161 Ga0075435_100297381 3300007076 Unclassified 1380
162 Ga0111539_10037181 3300009094 Bacteria 5881
163 Ga0111539_10046828 3300009094 Bacteria 5171
164 Ga0111539_10200553 3300009094 Unclassified 2327
165 Ga0105245_10000022 3300009098 Bacteria 181225
166 Ga0105245_10001022 3300009098 Bacteria 25406
167 Ga0105245_10001178 3300009098 Bacteria 23683
168 Ga0105245_10003348 3300009098 Bacteria 14381
169 Ga0105245_10049393 3300009098 Bacteria 3767
170 Ga0105245_10508668 3300009098 Bacteria 1221
171 Ga0105247_10000064 3300009101 Bacteria 123994
172 Ga0105247_10080478 3300009101 Bacteria 2052
173 Ga0105247_10094102 3300009101 Bacteria 1906
174 Ga0105247_10133546 3300009101 Unclassified 1620
175 Ga0114129_10147910 3300009147 Bacteria 3217
176 Ga0114129_10152901 3300009147 Bacteria 3157
177 Ga0114129_10171735 3300009147 Bacteria 2955
178 Ga0105243_10002021 3300009148 Bacteria 17237
179 Ga0105243_10007304 3300009148 Bacteria 8494
180 Ga0105243_10067333 3300009148 Bacteria 2882
181 Ga0105243_10256601 3300009148 Bacteria 1564
182 Ga0105242_10000589 3300009176 Bacteria 28679
183 Ga0105242_10252193 3300009176 Bacteria 1590
184 Ga0105248_10000017 3300009177 Bacteria 298089
185 Ga0105248_10198412 3300009177 Bacteria 2261
186 Ga0105238_10000014 3300009551 Bacteria 241954
187 Ga0105238_10118685 3300009551 Bacteria 2625
188 Ga0105238_10930040 3300009551 Bacteria 889
189 Ga0105249_10000181 3300009553 Bacteria 73946
190 Ga0105249_10006903 3300009553 Bacteria 9898
191 Ga0105249_10034423 3300009553 Bacteria 4591
192 Ga0105249_10106918 3300009553 Bacteria 2640
193 Ga0105249_10493319 3300009553 Bacteria 1269
194 Ga0105249_10568406 3300009553 Bacteria 1186
195 Ga0105249_11336381 3300009553 Bacteria 788
196 Ga0105239_10116111 3300010375 Bacteria 2970
197 Ga0105239_10600484 3300010375 Bacteria 1255
198 Ga0105246_10084526 3300011119 Bacteria 2271
199 Ga0105246_10436146 3300011119 Bacteria 1097
200 Ga0157373_10305287 3300013100 Bacteria 1130
201 Ga0157371_10017407 3300013102 Bacteria 5340
202 Ga0157370_10043875 3300013104 Bacteria 4301
203 Ga0157370_10073991 3300013104 Bacteria 3214
204 Ga0157369_10000068 3300013105 Bacteria 144274
205 Ga0157374_10001959 3300013296 Bacteria 17273
206 Ga0157374_10078656 3300013296 Bacteria 3124
207 Ga0157374_10354777 3300013296 Unclassified 1458
208 Ga0157374_10440350 3300013296 Bacteria 1304
209 Ga0157378_10000656 3300013297 Bacteria 32583
210 Ga0157378_10078777 3300013297 Bacteria 2973
211 Ga0157378_10718065 3300013297 Bacteria 1020
212 Ga0163162_10371032 3300013306 Bacteria 1564
213 Ga0157372_10001135 3300013307 Bacteria 28936
214 Ga0157372_11093296 3300013307 Unclassified 922
215 Ga0157375_10000126 3300013308 Bacteria 75410
216 Ga0157375_10001522 3300013308 Bacteria 19958
217 Ga0157375_10029588 3300013308 Bacteria 5154
218 Ga0157375_10041147 3300013308 Bacteria 4460
219 Ga0157375_10805836 3300013308 Bacteria 1088
220 Ga0163163_10569231 3300014325 Bacteria 1196
221 Ga0163163_11218762 3300014325 Unclassified 815
222 Ga0157380_10000326 3300014326 Bacteria 28781
223 Ga0157380_10000403 3300014326 Bacteria 26163
224 Ga0157380_10009902 3300014326 Bacteria 6842
225 Ga0157377_10022224 3300014745 Bacteria 3346
226 Ga0157379_10052910 3300014968 Bacteria 3627
227 Ga0157379_10194157 3300014968 Bacteria 1835
228 Ga0157379_10212625 3300014968 Bacteria 1751
229 Ga0157379_10286295 3300014968 Bacteria 1500
230 Ga0157376_10013349 3300014969 Bacteria 6128
231 Ga0163161_10000013 3300017792 Bacteria 258747
232 Ga0163161_10016346 3300017792 Bacteria 5179
233 Ga0207656_10000399 3300025321 Bacteria 14571
234 Ga0207656_10094055 3300025321 Bacteria 1365
235 Ga0207682_10000327 3300025893 Bacteria 21656
236 Ga0207642_10000008 3300025899 Bacteria 132651
237 Ga0207642_10000689 3300025899 Bacteria 10418
238 Ga0207710_10000165 3300025900 Bacteria 69714
239 Ga0207688_10030450 3300025901 Bacteria 2975
240 Ga0207680_10002295 3300025903 Bacteria 8915
241 Ga0207680_10017470 3300025903 Bacteria 3792
242 Ga0207680_10037141 3300025903 Bacteria 2810
243 Ga0207685_10000003 3300025905 Bacteria 344527
244 Ga0207705_10163640 3300025909 Bacteria 1672
245 Ga0207707_10109650 3300025912 Bacteria 2413
246 Ga0207707_10296001 3300025912 Bacteria 1400
247 Ga0207671_10168003 3300025914 Bacteria 1702
248 Ga0207693_10008752 3300025915 Bacteria 8273
249 Ga0207693_10008877 3300025915 Bacteria 8212
250 Ga0207693_10239386 3300025915 Bacteria 1425
251 Ga0207663_10008156 3300025916 Bacteria 5461
252 Ga0207663_10009286 3300025916 Bacteria 5189
253 Ga0207660_10081268 3300025917 Bacteria 2381
254 Ga0207660_10145019 3300025917 Bacteria 1819
255 Ga0207660_10662948 3300025917 Bacteria 851
256 Ga0207662_10164008 3300025918 Bacteria 1421
257 Ga0207657_10005356 3300025919 Bacteria 13440
258 Ga0207649_10000166 3300025920 Bacteria 53758
259 Ga0207652_10000242 3300025921 Bacteria 56966
260 Ga0207652_10000437 3300025921 Bacteria 43281
261 Ga0207694_10000008 3300025924 Bacteria 484902
262 Ga0207694_10133940 3300025924 Bacteria 1988
263 Ga0207650_10095204 3300025925 Bacteria 2283
264 Ga0207659_10000138 3300025926 Bacteria 42755
265 Ga0207659_10013476 3300025926 Bacteria 5238
266 Ga0207687_10000025 3300025927 Bacteria 175177
267 Ga0207687_10000039 3300025927 Bacteria 114303
268 Ga0207687_10000132 3300025927 Bacteria 50024
269 Ga0207687_10029007 3300025927 Bacteria 3719
270 Ga0207687_10253986 3300025927 Bacteria 1399
271 Ga0207700_10000019 3300025928 Bacteria 183117
272 Ga0207644_10045909 3300025931 Bacteria 3110
273 Ga0207690_10002070 3300025932 Bacteria 12292
274 Ga0207690_10003853 3300025932 Bacteria 8869
275 Ga0207706_10000137 3300025933 Bacteria 79758
276 Ga0207706_10018044 3300025933 Bacteria 6349
277 Ga0207686_10002761 3300025934 Bacteria 9511
278 Ga0207686_10163451 3300025934 Bacteria 1563
279 Ga0207686_10321111 3300025934 Bacteria 1157
280 Ga0207709_10008448 3300025935 Bacteria 5696
281 Ga0207709_10074071 3300025935 Bacteria 2171
282 Ga0207709_10084855 3300025935 Bacteria 2051
283 Ga0207709_10202872 3300025935 Bacteria 1417
284 Ga0207670_10042755 3300025936 Bacteria 2988
285 Ga0207670_10080833 3300025936 Bacteria 2273
286 Ga0207670_10086521 3300025936 Bacteria 2206
287 Ga0207669_10000032 3300025937 Bacteria 82757
288 Ga0207669_10000091 3300025937 Bacteria 45833
289 Ga0207669_10036052 3300025937 Bacteria 2822
290 Ga0207704_10000054 3300025938 Bacteria 79155
291 Ga0207704_10007544 3300025938 Bacteria 5146
292 Ga0207704_10179115 3300025938 Bacteria 1530
293 Ga0207691_10000871 3300025940 Bacteria 30024
294 Ga0207691_10101984 3300025940 Bacteria 2560
295 Ga0207711_10000011 3300025941 Bacteria 518817
296 Ga0207661_10011259 3300025944 Bacteria 6473
297 Ga0207661_10013754 3300025944 Bacteria 5910
298 Ga0207661_10172475 3300025944 Bacteria 1883
299 Ga0207661_10501217 3300025944 Unclassified 1109
300 Ga0207661_10506325 3300025944 Unclassified 1103
301 Ga0207679_10069800 3300025945 Bacteria 2645
302 Ga0207679_10286039 3300025945 Bacteria 1416
303 Ga0207667_10533547 3300025949 Bacteria 1188
304 Ga0207651_10003068 3300025960 Bacteria 8109
305 Ga0207712_10000067 3300025961 Bacteria 130079
306 Ga0207712_10007677 3300025961 Bacteria 6821
307 Ga0207712_10175846 3300025961 Bacteria 1677
308 Ga0207668_10031591 3300025972 Bacteria 3489
309 Ga0207640_10000147 3300025981 Bacteria 51462
310 Ga0207658_10003743 3300025986 Bacteria 10711
311 Ga0207658_10004686 3300025986 Bacteria 9477
312 Ga0207677_10000903 3300026023 Bacteria 16635
313 Ga0207677_10208902 3300026023 Bacteria 1557
314 Ga0207703_10000070 3300026035 Bacteria 123480
315 Ga0207703_10000122 3300026035 Bacteria 92656
316 Ga0207703_10034693 3300026035 Bacteria 4005
317 Ga0207703_10372524 3300026035 Bacteria 1319
318 Ga0207639_10005680 3300026041 Bacteria 8440
319 Ga0207639_10249960 3300026041 Bacteria 1546
320 Ga0207639_10615519 3300026041 Unclassified 1002
321 Ga0207678_10005860 3300026067 Bacteria 10955
322 Ga0207678_10008898 3300026067 Bacteria 8837
323 Ga0207708_10002304 3300026075 Bacteria 14042
324 Ga0207708_10035998 3300026075 Bacteria 3767
325 Ga0207708_10069224 3300026075 Bacteria 2702
326 Ga0207708_10119320 3300026075 Bacteria 2054
327 Ga0207702_10000557 3300026078 Bacteria 41471
328 Ga0207702_10008754 3300026078 Bacteria 8533
329 Ga0207702_10011625 3300026078 Bacteria 7334
330 Ga0207641_10000065 3300026088 Bacteria 156066
331 Ga0207641_10012714 3300026088 Bacteria 6901
332 Ga0207641_10054404 3300026088 Bacteria 3396
333 Ga0207648_10004608 3300026089 Bacteria 14135
334 Ga0207648_10005283 3300026089 Bacteria 13032
335 Ga0207676_10000025 3300026095 Bacteria 261714
336 Ga0207674_10082436 3300026116 Bacteria 3217
337 Ga0207675_100142208 3300026118 Bacteria 2280
338 Ga0207675_100518531 3300026118 Bacteria 1188
339 Ga0207683_10026953 3300026121 Bacteria 4966
340 Ga0207683_10056797 3300026121 Bacteria 3435
341 Ga0207683_10089063 3300026121 Bacteria 2746
342 Ga0207698_10000014 3300026142 Bacteria 240703
343 Ga0207428_10007473 3300027907 Bacteria 9962
344 Ga0207428_10339852 3300027907 Unclassified 1106
345 Ga0268266_10000029 3300028379 Bacteria 424015
346 Ga0268266_10000973 3300028379 Bacteria 36388
347 Ga0268266_10002641 3300028379 Bacteria 18887
348 Ga0268266_10038476 3300028379 Bacteria 4072
349 Ga0268266_10773598 3300028379 Bacteria 927
350 Ga0268265_10017817 3300028380 Bacteria 4910
351 Ga0268264_10002647 3300028381 Bacteria 15644
352 Ga0268264_10044924 3300028381 Bacteria 3667
353 Ga0268264_10085791 3300028381 Bacteria 2703
354 Ga0268264_10277561 3300028381 Bacteria 1568
355 Ga0265337_1000112 3300028556 Bacteria 41114
356 Ga0265326_10000040 3300028558 Bacteria 85624
357 Ga0265319_1000030 3300028563 Bacteria 129742
358 Ga0265322_10000012 3300028654 Bacteria 152373
359 Ga0265336_10005375 3300028666 Bacteria 4732
360 Ga0265338_10000156 3300028800 Bacteria 125065
361 Ga0265324_10000202 3300029957 Bacteria 45480
362 Ga0265320_10000001 3300031240 Bacteria 847191
363 Ga0265329_10008221 3300031242 Bacteria 3972
364 Ga0265331_10001236 3300031250 Bacteria 19167
365 Ga0265331_10009016 3300031250 Bacteria 5637
366 Ga0265327_10000003 3300031251 Bacteria 852750
367 Ga0265316_10063543 3300031344 Bacteria 2862
368 Ga0265314_10000178 3300031711 Bacteria 94070
369 Ga0265342_10131138 3300031712 Bacteria 1404
370 Ga0316574_0052662 3300035398 Bacteria 2539
371 Ga0373937_0006290 3300036401 Bacteria 10239
372 Ga0395898_0026087 3300037466 Bacteria 5883
373 Ga0395898_0161389 3300037466 Bacteria 2144
374 Ga0395898_0173287 3300037466 Unclassified 2062
375 Ga0395905_0015772 3300037471 Bacteria 7177
376 Ga0395905_0430491 3300037471 Bacteria 1216
377 Ga0395905_0682486 3300037471 Unclassified 929
378 Ga0395901_0028155 3300038443 Bacteria 5780
379 Ga0395901_0036480 3300038443 Bacteria 5082
380 Ga0395901_0162803 3300038443 Unclassified 2343
381 Ga0395901_0165531 3300038443 Bacteria 2322
382 Ga0451807_2152006 3300041486 Bacteria 1343
383 Ga0451839_1478570 3300041496 Bacteria 1649
384 Ga0451847_0664677 3300041503 Bacteria 821
385 Ga0451853_0220151 3300041512 Bacteria 8742
386 Ga0451853_0313996 3300041512 Bacteria 1984
387 Ga0451853_1765258 3300041512 Bacteria 1384
388 Ga0466963_0008734 3300044694 Bacteria 6083
389 Ga0466964_0046096 3300044706 Bacteria 1776
390 Ga0466957_0000193 3300044842 Bacteria 28057
391 Ga0466967_0000003 3300045976 Bacteria 169144
392 Ga0466967_0011027 3300045976 Bacteria 6819
393 Ga0466967_0015892 3300045976 Bacteria 5916
394 Ga0495592_0000752 3300046454 Bacteria 22576
395 Ga0495592_0076093 3300046454 Bacteria 2436
396 Ga0495592_0272470 3300046454 Bacteria 1110
397 Ga0495592_0398294 3300046454 Bacteria 872
398 Ga0495603_0011119 3300046455 Bacteria 5456
399 Ga0495603_0014198 3300046455 Bacteria 4819
400 Ga0495629_0000789 3300046459 Bacteria 25574
401 Ga0495629_0022877 3300046459 Bacteria 4454
402 Ga0495629_0044352 3300046459 Bacteria 3121
403 Ga0495629_0100201 3300046459 Unclassified 2022
404 Ga0495629_0244927 3300046459 Bacteria 1234
405 Ga0495629_0295508 3300046459 Bacteria 1110
406 Ga0495638_0095073 3300046460 Bacteria 1790
407 Ga0495641_0000010 3300046461 Bacteria 158798
408 Ga0495641_0005514 3300046461 Bacteria 8509
409 Ga0495641_0063820 3300046461 Bacteria 1659
410 Ga0495641_0132546 3300046461 Bacteria 1112
411 Ga0495651_0134141 3300046462 Unclassified 1804
412 Ga0495653_0088276 3300046463 Unclassified 2275
413 Ga0495653_0134943 3300046463 Bacteria 1742
414 Ga0495582_0000006 3300046473 Bacteria 140434
415 Ga0495639_0038123 3300046475 Bacteria 2157
416 Ga0495662_0000212 3300046476 Bacteria 24249
417 Ga0495662_0066891 3300046476 Bacteria 1738
418 Ga0495664_0177973 3300046477 Bacteria 1290
419 Ga0495584_0285631 3300046491 Unclassified 838
420 Ga0495594_0000001 3300046499 Bacteria 293051
421 Ga0495596_0085654 3300046500 Unclassified 1223
422 Ga0495606_0000283 3300046507 Bacteria 88309
423 Ga0495608_0000906 3300046511 Bacteria 20783
424 Ga0495608_0000961 3300046511 Bacteria 20346
425 Ga0495608_0016325 3300046511 Bacteria 5137
426 Ga0495608_0040410 3300046511 Bacteria 3125
427 Ga0495618_0134981 3300046514 Bacteria 1579
428 Ga0495620_0001375 3300046515 Bacteria 14659
429 Ga0495628_0002123 3300046516 Bacteria 17950
430 Ga0495628_0051337 3300046516 Bacteria 3261
431 Ga0495628_0052940 3300046516 Bacteria 3205
432 Ga0495628_0099294 3300046516 Bacteria 2248
433 Ga0495628_0101679 3300046516 Bacteria 2218
434 Ga0495628_0231255 3300046516 Bacteria 1386
435 Ga0495628_0284815 3300046516 Bacteria 1226
436 Ga0495630_0000148 3300046517 Bacteria 54619
437 Ga0495630_0003200 3300046517 Bacteria 11386
438 Ga0495630_0017766 3300046517 Bacteria 5215
439 Ga0495644_0046136 3300046523 Bacteria 1638
440 Ga0495652_0000009 3300046529 Bacteria 311000
441 Ga0495652_0018702 3300046529 Bacteria 6176
442 Ga0495640_0029026 3300046533 Bacteria 3976
443 Ga0495640_0256084 3300046533 Bacteria 1095
444 Ga0495586_0439508 3300046535 Bacteria 752
445 Ga0495587_0002768 3300046536 Bacteria 11704
446 Ga0495587_0122209 3300046536 Bacteria 1491
447 Ga0495587_0316785 3300046536 Unclassified 871
448 Ga0495587_0363098 3300046536 Bacteria 806
449 Ga0495645_0003129 3300046543 Bacteria 11212
450 Ga0495645_0005828 3300046543 Bacteria 8501
451 Ga0495622_0000069 3300046557 Bacteria 89759
452 Ga0495667_0000067 3300046559 Bacteria 81751
453 Ga0495667_0162667 3300046559 Bacteria 1435
454 Ga0495656_0000217 3300046615 Bacteria 20479
455 Ga0495668_0262150 3300046616 Bacteria 946
456 Ga0495634_0000021 3300046642 Bacteria 120521
457 Ga0495634_0000590 3300046642 Bacteria 35246
458 Ga0495634_0002438 3300046642 Bacteria 15444
459 Ga0495634_0031586 3300046642 Bacteria 3646
460 Ga0495634_0042878 3300046642 Bacteria 3068
461 Ga0495634_0064324 3300046642 Bacteria 2432
462 Ga0495625_0000109 3300046660 Bacteria 125064
463 Ga0495625_0146471 3300046660 Bacteria 1590
464 Ga0495635_0000006 3300046663 Bacteria 301820
465 Ga0495635_0011707 3300046663 Bacteria 6151
466 Ga0495635_0159165 3300046663 Bacteria 1537
467 Ga0495635_0214121 3300046663 Bacteria 1304
468 Ga0495588_0000175 3300046674 Bacteria 80911
469 Ga0495657_0001466 3300046675 Bacteria 20346
470 Ga0495657_0048746 3300046675 Bacteria 2856
471 Ga0495657_0055478 3300046675 Bacteria 2642
472 Ga0495599_0030763 3300046678 Bacteria 3370
473 Ga0495599_0108835 3300046678 Bacteria 1727
474 Ga0495647_0000002 3300046681 Bacteria 174959
475 Ga0495647_0001404 3300046681 Bacteria 7428
476 Ga0495647_0002225 3300046681 Bacteria 6074
477 Ga0495647_0031177 3300046681 Bacteria 1982
478 Ga0495658_0000027 3300046683 Bacteria 74322
479 Ga0495658_0022546 3300046683 Bacteria 3330
480 Ga0495669_0000132 3300046684 Bacteria 47843
481 Ga0495613_0000287 3300046689 Bacteria 46716
482 Ga0495624_0000005 3300046690 Bacteria 158127
483 Ga0495624_0001686 3300046690 Bacteria 16921
484 Ga0495624_0035583 3300046690 Bacteria 3215
485 Ga0495600_0002327 3300046809 Bacteria 10835
486 Ga0495600_0390129 3300046809 Unclassified 868
487 Ga0495604_0000636 3300047317 Bacteria 30130
488 Ga0495604_0039842 3300047317 Bacteria 3691
489 Ga0495604_0047775 3300047317 Bacteria 3332
490 Ga0495604_0065241 3300047317 Bacteria 2772
491 Ga0495674_0000141 3300047319 Bacteria 55539
492 Ga0495674_0285269 3300047319 Bacteria 1352
493 Ga0495672_0063182 3300047320 Bacteria 2126
494 Ga0495672_0157138 3300047320 Unclassified 1173
495 Ga0495676_0000209 3300047321 Bacteria 46557
496 Ga0495676_0003630 3300047321 Bacteria 14001
497 Ga0495676_0156171 3300047321 Bacteria 1618
498 Ga0495676_0170705 3300047321 Bacteria 1531
499 Ga0495680_0000541 3300047322 Bacteria 42487
500 Ga0495680_0009424 3300047322 Bacteria 8781
501 Ga0495680_0010471 3300047322 Bacteria 8274
502 Ga0495680_0417123 3300047322 Bacteria 924
503 Ga0495675_0000744 3300047444 Bacteria 20346
504 Ga0495679_007935 3300047446 Bacteria 4369
505 Ga0495673_0102879 3300047469 Bacteria 1152
506 Ga0495684_0336272 3300047471 Bacteria 1076
507 Ga0495684_0456242 3300047471 Bacteria 887
508 Ga0495593_0144565 3300047673 Bacteria 1204
509 Ga0495602_0000038 3300048088 Bacteria 130758
510 Ga0495602_0002031 3300048088 Bacteria 20359
511 Ga0495602_0320626 3300048088 Bacteria 1128
512 Ga0495614_0068148 3300048089 Bacteria 1532
513 Ga0495614_0154143 3300048089 Bacteria 1026
514 Ga0496100_0000006 3300048903 Bacteria 297429
515 Ga0496100_0000028 3300048903 Bacteria 113912
516 Ga0496100_0129393 3300048903 Bacteria 1776
517 Ga0496101_0000005 3300048904 Bacteria 331455
518 Ga0496101_0000009 3300048904 Bacteria 297429
519 Ga0496101_0053863 3300048904 Bacteria 2904
520 Ga0496101_0135816 3300048904 Bacteria 1871
521 Ga0496101_0271136 3300048904 Unclassified 1325
522 Ga0496102_0000021 3300048905 Bacteria 246920
523 Ga0496102_0002673 3300048905 Bacteria 15162
524 Ga0496102_0096157 3300048905 Bacteria 2746
525 Ga0496102_0237758 3300048905 Bacteria 1718
526 Ga0496102_0255827 3300048905 Bacteria 1651
527 Ga0496103_0000001 3300048906 Bacteria 643471
528 Ga0496103_0023977 3300048906 Bacteria 3681
529 Ga0496103_0029172 3300048906 Bacteria 3352
530 Ga0496103_0102441 3300048906 Bacteria 1813
531 Ga0496104_0000008 3300048907 Bacteria 516976
532 Ga0496104_0000029 3300048907 Bacteria 202968
533 Ga0496104_0000214 3300048907 Bacteria 51141
534 Ga0496104_0052830 3300048907 Bacteria 3838
535 Ga0496104_0927460 3300048907 Bacteria 775
536 Ga0496105_0000002 3300048908 Bacteria 753215
537 Ga0496105_0000003 3300048908 Bacteria 713251
538 Ga0496105_0001724 3300048908 Bacteria 15632
539 Ga0496105_0017098 3300048908 Bacteria 5807
540 Ga0496105_0019479 3300048908 Bacteria 5473
541 Ga0496106_0000070 3300048909 Bacteria 82770
542 Ga0496106_0000101 3300048909 Bacteria 65644
543 Ga0496106_0000728 3300048909 Bacteria 23707
544 Ga0496106_0319157 3300048909 Bacteria 1247
545 Ga0496106_0425903 3300048909 Bacteria 1067
546 Ga0496107_0000004 3300048910 Bacteria 297680
547 Ga0496107_0000015 3300048910 Bacteria 173644
548 Ga0496107_0022566 3300048910 Bacteria 4447
549 Ga0496107_0026016 3300048910 Bacteria 4146
550 Ga0496107_0090299 3300048910 Unclassified 2238
551 Ga0496108_0000004 3300048911 Bacteria 545055
552 Ga0496108_0000042 3300048911 Bacteria 146397
553 Ga0496108_0000339 3300048911 Bacteria 39428
554 Ga0496108_0006479 3300048911 Bacteria 9495
555 Ga0496108_0018633 3300048911 Bacteria 5688
556 Ga0496108_0196024 3300048911 Bacteria 1752
557 Ga0496108_0340366 3300048911 Bacteria 1309
558 Ga0496108_0670591 3300048911 Unclassified 900
559 Ga0496108_0716586 3300048911 Bacteria 867
560 Ga0496109_0000034 3300048912 Bacteria 160397
561 Ga0496109_0000036 3300048912 Bacteria 153972
562 Ga0496109_0000391 3300048912 Bacteria 39830
563 Ga0496109_0001321 3300048912 Bacteria 20438
564 Ga0496109_0054544 3300048912 Bacteria 3646
565 Ga0496109_0064189 3300048912 Bacteria 3360
566 Ga0496109_0226122 3300048912 Bacteria 1760
567 Ga0496109_0325920 3300048912 Unclassified 1450
568 Ga0496109_0375006 3300048912 Bacteria 1344
569 Ga0496110_0000122 3300048913 Bacteria 43513
570 Ga0496110_0014992 3300048913 Bacteria 6445
571 Ga0496110_0018529 3300048913 Bacteria 5837
572 Ga0496110_0121149 3300048913 Bacteria 2357
573 Ga0496110_0122644 3300048913 Bacteria 2342
574 Ga0496110_0179318 3300048913 Bacteria 1923
575 Ga0496111_0000037 3300048914 Bacteria 52978
576 Ga0496111_0010778 3300048914 Bacteria 6145
577 Ga0496111_0024519 3300048914 Bacteria 4249
578 Ga0496111_0031656 3300048914 Bacteria 3769
579 Ga0496111_0212970 3300048914 Bacteria 1435
580 Ga0496111_0328953 3300048914 Bacteria 1131
581 Ga0496112_0000002 3300048915 Bacteria 782039
582 Ga0496112_0002000 3300048915 Bacteria 16136
583 Ga0496112_0306431 3300048915 Bacteria 1533
584 Ga0496112_0660596 3300048915 Unclassified 975
585 Ga0496113_0000002 3300048916 Bacteria 220193
586 Ga0496113_0031981 3300048916 Bacteria 3822
587 Ga0496113_0062635 3300048916 Bacteria 2809
588 Ga0496113_0101852 3300048916 Bacteria 2226
589 Ga0496113_0294441 3300048916 Unclassified 1299
590 Ga0496113_0599258 3300048916 Bacteria 882
591 Ga0496114_0000097 3300048917 Bacteria 63410
592 Ga0496114_0021651 3300048917 Bacteria 5232
593 Ga0496114_0045364 3300048917 Bacteria 3651
594 Ga0496114_0341724 3300048917 Bacteria 1324
595 Ga0496114_0431426 3300048917 Bacteria 1167
596 Ga0496114_0460846 3300048917 Bacteria 1125
597 Ga0496114_0946699 3300048917 Unclassified 743
598 Ga0496115_0000005 3300048918 Bacteria 290756
599 Ga0496115_0000151 3300048918 Bacteria 64493
600 Ga0496115_0007257 3300048918 Bacteria 8147
601 Ga0496116_0000529 3300048919 Bacteria 51417
602 Ga0496117_0009095 3300048920 Bacteria 9338
603 Ga0496117_0111120 3300048920 Bacteria 1707
604 Ga0496118_0004226 3300048921 Bacteria 17234
605 Ga0496119_0000489 3300048922 Bacteria 54129
606 Ga0496119_0032699 3300048922 Bacteria 3462
607 Ga0496119_0062938 3300048922 Bacteria 2208
608 Ga0496119_0074055 3300048922 Bacteria 1984
609 Ga0496120_0025331 3300048923 Bacteria 3683
610 Ga0496120_0117004 3300048923 Bacteria 1383
611 Ga0496121_0020170 3300048924 Bacteria 6617
612 Ga0496121_0035115 3300048924 Bacteria 4498
613 Ga0496124_0243420 3300048927 Bacteria 1336
614 Ga0496124_0308521 3300048927 Unclassified 1139
615 Ga0496125_0037383 3300048928 Bacteria 4222
616 Ga0496125_0055740 3300048928 Bacteria 3217
617 Ga0496125_0126549 3300048928 Bacteria 1809
618 Ga0496126_0019475 3300048929 Bacteria 6682
619 Ga0496126_0048743 3300048929 Bacteria 3869
620 Ga0496126_0206190 3300048929 Bacteria 1657
621 Ga0501031_0000885 3300049568 Bacteria 18036
622 Ga0501031_0129191 3300049568 Bacteria 1650
623 Ga0501032_0000843 3300049569 Bacteria 24899
624 Ga0501033_0001203 3300049570 Bacteria 23326
625 Ga0501034_0004760 3300049571 Bacteria 15020
626 Ga0501036_0000711 3300049572 Bacteria 24631
627 Ga0501037_0000522 3300049573 Bacteria 30837
628 Ga0501038_0105353 3300049574 Bacteria 2342
629 Ga0501038_0191438 3300049574 Bacteria 1646
630 Ga0501039_0013392 3300049575 Bacteria 6270
631 Ga0501039_0056990 3300049575 Bacteria 3027
632 Ga0501039_0248670 3300049575 Bacteria 1398
633 Ga0501040_0118386 3300049576 Bacteria 1857
634 Ga0501040_0475782 3300049576 Bacteria 900
635 Ga0501041_0224172 3300049577 Unclassified 1180
636 Ga0501042_0048889 3300049578 Bacteria 3016
637 Ga0501042_0079610 3300049578 Unclassified 2348
638 Ga0501042_0115026 3300049578 Bacteria 1937
639 Ga0501042_0426975 3300049578 Unclassified 961
640 Ga0501043_0004212 3300049579 Bacteria 11739
641 Ga0501043_0669392 3300049579 Bacteria 761
642 Ga0501046_0001261 3300049580 Bacteria 24516
643 Ga0501046_0117959 3300049580 Bacteria 2022
644 Ga0501047_0001310 3300049581 Bacteria 24535
645 Ga0501047_0019766 3300049581 Bacteria 6464
646 Ga0501048_0000689 3300049582 Bacteria 24553
647 Ga0501048_0160508 3300049582 Bacteria 1591
648 Ga0501067_0135061 3300049583 Bacteria 1373
649 Ga0501068_0020879 3300049584 Bacteria 3822
650 Ga0501068_0122344 3300049584 Bacteria 1623
651 Ga0501069_0014034 3300049585 Bacteria 4279
652 Ga0501069_0020680 3300049585 Bacteria 3567
653 Ga0501070_0000267 3300049586 Bacteria 49167
654 Ga0501070_0036301 3300049586 Bacteria 4116
655 Ga0501070_0053280 3300049586 Bacteria 3356
656 Ga0501070_0100623 3300049586 Bacteria 2391
657 Ga0501070_0444584 3300049586 Bacteria 1045
658 Ga0501072_0042532 3300049588 Bacteria 3568
659 Ga0501072_0131714 3300049588 Bacteria 1993
660 Ga0501072_0167095 3300049588 Bacteria 1755
661 Ga0501072_0202595 3300049588 Bacteria 1582
662 Ga0501072_0448722 3300049588 Unclassified 1022
663 Ga0501073_0028060 3300049589 Bacteria 4021
664 Ga0501074_0010332 3300049590 Bacteria 6772
665 Ga0501074_0042104 3300049590 Bacteria 3305
666 Ga0501074_0047438 3300049590 Bacteria 3105
667 Ga0501074_0534396 3300049590 Bacteria 830
668 Ga0501075_0004738 3300049591 Bacteria 9247
669 Ga0501075_0008822 3300049591 Bacteria 7029
670 Ga0501075_0514246 3300049591 Bacteria 914
671 Ga0501075_0544439 3300049591 Bacteria 886
672 Ga0501076_0034143 3300049592 Bacteria 3974
673 Ga0501076_0151679 3300049592 Bacteria 1885
674 Ga0501076_0381068 3300049592 Bacteria 1159
675 Ga0501077_0206649 3300049593 Bacteria 1248
676 Ga0501079_0208218 3300049741 Bacteria 1527
677 Ga0501079_0270295 3300049741 Unclassified 1329
678 Ga0501080_0011059 3300049742 Bacteria 8259
679 Ga0501080_0676504 3300049742 Bacteria 912
680 Ga0501081_0056254 3300049743 Bacteria 2718
681 Ga0501083_0055234 3300049744 Bacteria 2663
682 Ga0501083_0114365 3300049744 Unclassified 1772
683 Ga0501035_0001546 3300049822 Bacteria 23436
684 Ga0501044_0003136 3300049823 Bacteria 18695
685 Ga0501044_0235132 3300049823 Bacteria 1778
686 Ga0501045_0051674 3300049824 Bacteria 3000
687 Ga0501045_0097324 3300049824 Bacteria 2177
688 nmdc:mga03n38_169053_c1 3300050490 Bacteria 1112
689 nmdc:mga00v17_198322_c1 3300050491 Bacteria 1297
690 nmdc:mga00v17_28492_c1 3300050491 Archaea 3271
691 nmdc:mga00v17_8565_c1 3300050491 Bacteria 5505
692 nmdc:mga0yw44_102531_c1 3300050492 Bacteria 1824
693 nmdc:mga0yw44_10477_c1 3300050492 Bacteria 4739
694 nmdc:mga0yw44_175972_c1 3300050492 Bacteria 1407
695 nmdc:mga0yw44_66686_c1 3300050492 Archaea 2222
696 nmdc:mga06z11_100731_c1 3300050494 Bacteria 1584
697 nmdc:mga06z11_18188_c1 3300050494 Bacteria 3205
698 nmdc:mga05p37_135351_c1 3300050507 Bacteria 3022
699 nmdc:mga09592_398197_c1 3300050508 Bacteria 1190
700 nmdc:mga0qj67_47502_c1 3300050509 Bacteria 3391
701 nmdc:mga06r32_380009_c1 3300050510 Unclassified 1395
702 nmdc:mga06r32_477478_c1 3300050510 Bacteria 1225
703 nmdc:mga06r32_497888_c1 3300050510 Bacteria 1196
704 nmdc:mga08y16_173595_c1 3300050511 Unclassified 2238
705 nmdc:mga08y16_62734_c1 3300050511 Bacteria 3881
706 nmdc:mga08y16_7851_c1 3300050511 Bacteria 11175
707 nmdc:mga0n895_21750_c1 3300050512 Bacteria 6003
708 nmdc:mga0rr50_114078_c1 3300050513 Bacteria 2142
709 nmdc:mga08x19_311158_c1 3300050514 Bacteria 1095
710 nmdc:mga0a205_15_c1 3300050515 Bacteria 33986
711 nmdc:mga0a205_51329_c1 3300050515 Bacteria 3981
712 Ga0495601_0000019 3300053077 Bacteria 161673
713 Ga0495601_0000059 3300053077 Bacteria 60752
714 Ga0495601_0003867 3300053077 Bacteria 8624
715 Ga0495601_0026979 3300053077 Bacteria 3549
716 Ga0495601_0145749 3300053077 Bacteria 1545
717 Ga0495612_0000122 3300053078 Bacteria 32891
718 Ga0495612_0000221 3300053078 Bacteria 24147
719 Ga0495612_0012321 3300053078 Bacteria 3447
720 Ga0495612_0013769 3300053078 Bacteria 3258
721 Ga0495655_0000013 3300053083 Bacteria 63264
722 Ga0495655_0051083 3300053083 Unclassified 1094
723 Ga0495595_0000276 3300053084 Bacteria 20346
724 Ga0495595_0001135 3300053084 Bacteria 10311
725 Ga0495595_0005273 3300053084 Bacteria 5227
726 Ga0495595_0113188 3300053084 Bacteria 1317
727 Ga0495619_0000001 3300053085 Bacteria 586054
728 Ga0495619_0000069 3300053085 Bacteria 82755
729 Ga0495619_0000152 3300053085 Bacteria 51090
730 Ga0495619_0000564 3300053085 Bacteria 24556
731 Ga0495619_0001238 3300053085 Bacteria 16714
732 Ga0495619_0003763 3300053085 Bacteria 9768
733 Ga0495619_0013974 3300053085 Bacteria 5066
734 Ga0495619_0022300 3300053085 Bacteria 4050
735 Ga0495619_0349213 3300053085 Bacteria 1023
736 Ga0500566_0003812 3300053094 Bacteria 8988
737 Ga0500641_0008094 3300053096 Bacteria 3746
738 Ga0500614_000791 3300053123 Bacteria 8020
739 Ga0500628_000045 3300053129 Bacteria 45042
740 Ga0500658_0009977 3300053134 Bacteria 3503
741 Ga0500568_0057781 3300053139 Bacteria 1509
742 Ga0501084_0135644 3300054114 Bacteria 2072
743 Ga0501084_0205906 3300054114 Bacteria 1660
744 Ga0501082_0718478 3300060353 Unclassified 874
745 Ga0530510_0003841 3300061734 Bacteria 10354
746 Ga0530510_0666799 3300061734 Unclassified 792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0063820 Ga0495641_0063820_1060_1641 190
2 3300048907 Ga0496104_0927460 Ga0496104_0927460_182_763 190
3 3300061734 Ga0530510_0666799 Ga0530510_0666799_56_655 196
4 3300009148 Ga0105243_10007304 Ga0105243_100073049 208
5 3300025935 Ga0207709_10074071 Ga0207709_100740713 208
6 3300006038 Ga0075365_10001081 Ga0075365_100010816 210
7 3300006051 Ga0075364_10090037 Ga0075364_100900373 210
8 3300046516 Ga0495628_0284815 Ga0495628_0284815_408_1082 210
9 3300046517 Ga0495630_0017766 Ga0495630_0017766_2843_3517 210
10 3300046675 Ga0495657_0048746 Ga0495657_0048746_1670_2344 210
11 3300047319 Ga0495674_0285269 Ga0495674_0285269_440_1114 210
12 3300049578 Ga0501042_0426975 Ga0501042_0426975_289_930 210
13 3300050491 nmdc:mga00v17_28492_c1 nmdc:mga00v17_28492_c1_1244_1891 210
14 3300050492 nmdc:mga0yw44_66686_c1 nmdc:mga0yw44_66686_c1_809_1456 210
15 3300053077 Ga0495601_0026979 Ga0495601_0026979_2543_3217 210
16 3300053078 Ga0495612_0013769 Ga0495612_0013769_2267_2941 210
17 3300049590 Ga0501074_0534396 Ga0501074_0534396_150_818 211
18 3300025925 Ga0207650_10095204 Ga0207650_100952044 213
19 3300048907 Ga0496104_0000029 Ga0496104_0000029_161156_161827 213
20 3300048908 Ga0496105_0000002 Ga0496105_0000002_161156_161827 213
21 3300048922 Ga0496119_0074055 Ga0496119_0074055_975_1646 213
22 3300005438 Ga0070701_10461826 Ga0070701_104618261 214
23 3300035398 Ga0316574_0052662 Ga0316574_0052662_440_1132 214
24 3300046535 Ga0495586_0439508 Ga0495586_0439508_28_702 214
25 3300046642 Ga0495634_0042878 Ga0495634_0042878_349_1023 214
26 3300046674 Ga0495588_0000175 Ga0495588_0000175_72027_72710 214
27 3300046690 Ga0495624_0035583 Ga0495624_0035583_1422_2096 214
28 3300047471 Ga0495684_0336272 Ga0495684_0336272_162_836 214
29 3300048911 Ga0496108_0670591 Ga0496108_0670591_69_752 214
30 3300048912 Ga0496109_0000391 Ga0496109_0000391_24065_24748 214
31 3300053085 Ga0495619_0003763 Ga0495619_0003763_171_845 214
32 3300009176 Ga0105242_10000589 Ga0105242_1000058927 216
33 3300025934 Ga0207686_10002761 Ga0207686_100027614 216
34 3300046459 Ga0495629_0000789 Ga0495629_0000789_14836_15507 216
35 3300046660 Ga0495625_0146471 Ga0495625_0146471_732_1427 216
36 3300005985 Ga0081539_10054756 Ga0081539_100547562 218
37 3300005937 Ga0081455_10367227 Ga0081455_103672272 219
38 3300006038 Ga0075365_10331469 Ga0075365_103314692 219
39 3300006846 Ga0075430_100142504 Ga0075430_1001425043 219
40 3300006847 Ga0075431_100011336 Ga0075431_1000113362 219
41 3300006880 Ga0075429_100216894 Ga0075429_1002168943 219
42 3300013307 Ga0157372_11093296 Ga0157372_110932962 219
43 3300038443 Ga0395901_0165531 Ga0395901_0165531_339_1001 219
44 3300050508 nmdc:mga09592_398197_c1 nmdc:mga09592_398197_c1_314_982 219
45 3300050510 nmdc:mga06r32_497888_c1 nmdc:mga06r32_497888_c1_386_1054 219
46 3300006038 Ga0075365_10333096 Ga0075365_103330961 220
47 3300006042 Ga0075368_10083724 Ga0075368_100837241 220
48 3300050491 nmdc:mga00v17_198322_c1 nmdc:mga00v17_198322_c1_256_936 220
49 3300050492 nmdc:mga0yw44_102531_c1 nmdc:mga0yw44_102531_c1_1073_1753 220
50 3300005981 Ga0081538_10000034 Ga0081538_10000034118 221
51 3300046491 Ga0495584_0285631 Ga0495584_0285631_75_740 221
52 3300005329 Ga0070683_100004639 Ga0070683_10000463911 222
53 3300005337 Ga0070682_100000032 Ga0070682_100000032122 222
54 3300005354 Ga0070675_100000022 Ga0070675_10000002220 222
55 3300005535 Ga0070684_100025254 Ga0070684_1000252542 222
56 3300005564 Ga0070664_100515814 Ga0070664_1005158141 222
57 3300005578 Ga0068854_100000133 Ga0068854_10000013317 222
58 3300005614 Ga0068856_100000369 Ga0068856_10000036929 222
59 3300005981 Ga0081538_10055616 Ga0081538_100556162 222
60 3300009098 Ga0105245_10003348 Ga0105245_100033484 222
61 3300010375 Ga0105239_10600484 Ga0105239_106004841 222
62 3300011119 Ga0105246_10436146 Ga0105246_104361461 222
63 3300013297 Ga0157378_10078777 Ga0157378_100787772 222
64 3300014325 Ga0163163_11218762 Ga0163163_112187621 222
65 3300025926 Ga0207659_10000138 Ga0207659_100001387 222
66 3300025927 Ga0207687_10029007 Ga0207687_100290074 222
67 3300025944 Ga0207661_10011259 Ga0207661_100112597 222
68 3300025981 Ga0207640_10000147 Ga0207640_1000014716 222
69 3300026078 Ga0207702_10000557 Ga0207702_1000055715 222
70 3300036401 Ga0373937_0006290 Ga0373937_0006290_8262_8930 222
71 3300046461 Ga0495641_0005514 Ga0495641_0005514_7071_7739 222
72 3300046462 Ga0495651_0134141 Ga0495651_0134141_1070_1738 222
73 3300046507 Ga0495606_0000283 Ga0495606_0000283_25062_25730 222
74 3300046511 Ga0495608_0040410 Ga0495608_0040410_2084_2752 222
75 3300046663 Ga0495635_0214121 Ga0495635_0214121_511_1179 222
76 3300046681 Ga0495647_0001404 Ga0495647_0001404_1817_2485 222
77 3300047322 Ga0495680_0010471 Ga0495680_0010471_5040_5708 222
78 3300048913 Ga0496110_0000122 Ga0496110_0000122_34316_34999 222
79 3300048914 Ga0496111_0000037 Ga0496111_0000037_8894_9577 222
80 3300048917 Ga0496114_0946699 Ga0496114_0946699_16_684 222
81 3300049568 Ga0501031_0129191 Ga0501031_0129191_58_735 222
82 3300049577 Ga0501041_0224172 Ga0501041_0224172_469_1146 222
83 3300049588 Ga0501072_0042532 Ga0501072_0042532_472_1149 222
84 3300049590 Ga0501074_0047438 Ga0501074_0047438_165_842 222
85 3300049591 Ga0501075_0008822 Ga0501075_0008822_2662_3339 222
86 3300049592 Ga0501076_0034143 Ga0501076_0034143_1571_2248 222
87 3300049743 Ga0501081_0056254 Ga0501081_0056254_170_847 222
88 3300053085 Ga0495619_0000069 Ga0495619_0000069_36857_37540 222
89 3300053085 Ga0495619_0013974 Ga0495619_0013974_2048_2716 222
90 3300054114 Ga0501084_0205906 Ga0501084_0205906_764_1441 222
91 3300061734 Ga0530510_0003841 Ga0530510_0003841_2633_3310 222
92 3300001977 JGI24746J21847_1000852 JGI24746J21847_10008526 223
93 3300002074 JGI24748J21848_1000142 JGI24748J21848_10001429 223
94 3300002239 JGI24034J26672_10002156 JGI24034J26672_100021562 223
95 3300002244 JGI24742J22300_10009386 JGI24742J22300_100093862 223
96 3300003659 JGI25404J52841_10004750 JGI25404J52841_100047504 223
97 3300005327 Ga0070658_10056777 Ga0070658_100567771 223
98 3300005327 Ga0070658_10095850 Ga0070658_100958504 223
99 3300005329 Ga0070683_100002869 Ga0070683_10000286910 223
100 3300005329 Ga0070683_100078997 Ga0070683_1000789974 223
101 3300005329 Ga0070683_100125107 Ga0070683_1001251071 223
102 3300005333 Ga0070677_10000081 Ga0070677_1000008118 223
103 3300005335 Ga0070666_10259004 Ga0070666_102590042 223
104 3300005336 Ga0070680_100083006 Ga0070680_1000830062 223
105 3300005336 Ga0070680_100132860 Ga0070680_1001328602 223
106 3300005337 Ga0070682_100000009 Ga0070682_100000009250 223
107 3300005337 Ga0070682_100011743 Ga0070682_1000117434 223
108 3300005337 Ga0070682_100205638 Ga0070682_1002056382 223
109 3300005338 Ga0068868_100000138 Ga0068868_10000013831 223
110 3300005338 Ga0068868_100246705 Ga0068868_1002467053 223
111 3300005339 Ga0070660_100017636 Ga0070660_1000176362 223
112 3300005339 Ga0070660_100410716 Ga0070660_1004107161 223
113 3300005340 Ga0070689_100083814 Ga0070689_1000838141 223
114 3300005340 Ga0070689_100112308 Ga0070689_1001123084 223
115 3300005340 Ga0070689_100219819 Ga0070689_1002198192 223
116 3300005340 Ga0070689_100443317 Ga0070689_1004433172 223
117 3300005347 Ga0070668_100001413 Ga0070668_10000141315 223
118 3300005347 Ga0070668_100375900 Ga0070668_1003759001 223
119 3300005354 Ga0070675_100018681 Ga0070675_1000186814 223
120 3300005356 Ga0070674_100000021 Ga0070674_10000002138 223
121 3300005356 Ga0070674_100000075 Ga0070674_10000007537 223
122 3300005356 Ga0070674_100325405 Ga0070674_1003254052 223
123 3300005356 Ga0070674_100631279 Ga0070674_1006312791 223
124 3300005364 Ga0070673_100017018 Ga0070673_1000170186 223
125 3300005365 Ga0070688_100000168 Ga0070688_10000016835 223
126 3300005365 Ga0070688_100052550 Ga0070688_1000525503 223
127 3300005366 Ga0070659_100001004 Ga0070659_10000100414 223
128 3300005366 Ga0070659_100016201 Ga0070659_1000162012 223
129 3300005367 Ga0070667_100029913 Ga0070667_1000299135 223
130 3300005406 Ga0070703_10048196 Ga0070703_100481961 223
131 3300005436 Ga0070713_100000171 Ga0070713_1000001718 223
132 3300005436 Ga0070713_100395603 Ga0070713_1003956032 223
133 3300005439 Ga0070711_100011385 Ga0070711_1000113856 223
134 3300005439 Ga0070711_100225570 Ga0070711_1002255701 223
135 3300005441 Ga0070700_100001537 Ga0070700_1000015375 223
136 3300005441 Ga0070700_100022395 Ga0070700_1000223953 223
137 3300005441 Ga0070700_100060903 Ga0070700_1000609032 223
138 3300005441 Ga0070700_100095004 Ga0070700_1000950042 223
139 3300005455 Ga0070663_100005777 Ga0070663_1000057774 223
140 3300005457 Ga0070662_100000052 Ga0070662_10000005235 223
141 3300005457 Ga0070662_100067597 Ga0070662_1000675972 223
142 3300005458 Ga0070681_10363839 Ga0070681_103638392 223
143 3300005459 Ga0068867_100002852 Ga0068867_1000028522 223
144 3300005459 Ga0068867_100005467 Ga0068867_1000054676 223
145 3300005466 Ga0070685_10000058 Ga0070685_1000005860 223
146 3300005466 Ga0070685_10000246 Ga0070685_1000024635 223
147 3300005466 Ga0070685_10023282 Ga0070685_100232824 223
148 3300005466 Ga0070685_10139246 Ga0070685_101392462 223
149 3300005530 Ga0070679_100000190 Ga0070679_10000019043 223
150 3300005530 Ga0070679_100018989 Ga0070679_1000189894 223
151 3300005530 Ga0070679_100207035 Ga0070679_1002070352 223
152 3300005535 Ga0070684_100004244 Ga0070684_1000042446 223
153 3300005535 Ga0070684_100005286 Ga0070684_1000052864 223
154 3300005535 Ga0070684_100135000 Ga0070684_1001350003 223
155 3300005535 Ga0070684_100166527 Ga0070684_1001665272 223
156 3300005539 Ga0068853_100000830 Ga0068853_10000083020 223
157 3300005539 Ga0068853_100026166 Ga0068853_1000261664 223
158 3300005539 Ga0068853_100244080 Ga0068853_1002440801 223
159 3300005543 Ga0070672_100000258 Ga0070672_10000025832 223
160 3300005544 Ga0070686_100105526 Ga0070686_1001055262 223
161 3300005544 Ga0070686_100150834 Ga0070686_1001508342 223
162 3300005547 Ga0070693_100010796 Ga0070693_1000107963 223
163 3300005547 Ga0070693_100442839 Ga0070693_1004428391 223
164 3300005548 Ga0070665_100000022 Ga0070665_100000022355 223
165 3300005548 Ga0070665_100002631 Ga0070665_10000263119 223
166 3300005548 Ga0070665_100041985 Ga0070665_1000419852 223
167 3300005549 Ga0070704_100101516 Ga0070704_1001015162 223
168 3300005549 Ga0070704_100214917 Ga0070704_1002149172 223
169 3300005549 Ga0070704_100414774 Ga0070704_1004147742 223
170 3300005563 Ga0068855_101079344 Ga0068855_1010793441 223
171 3300005577 Ga0068857_100112558 Ga0068857_1001125582 223
172 3300005578 Ga0068854_100002063 Ga0068854_1000020634 223
173 3300005614 Ga0068856_100002525 Ga0068856_10000252517 223
174 3300005614 Ga0068856_100063621 Ga0068856_1000636211 223
175 3300005616 Ga0068852_100000024 Ga0068852_10000002432 223
176 3300005616 Ga0068852_100007178 Ga0068852_1000071782 223
177 3300005616 Ga0068852_100179703 Ga0068852_1001797032 223
178 3300005617 Ga0068859_100382368 Ga0068859_1003823682 223
179 3300005617 Ga0068859_100864701 Ga0068859_1008647011 223
180 3300005618 Ga0068864_100000023 Ga0068864_100000023168 223
181 3300005618 Ga0068864_100803145 Ga0068864_1008031452 223
182 3300005718 Ga0068866_10000007 Ga0068866_1000000765 223
183 3300005718 Ga0068866_10000220 Ga0068866_100002204 223
184 3300005718 Ga0068866_10028076 Ga0068866_100280764 223
185 3300005718 Ga0068866_10090266 Ga0068866_100902662 223
186 3300005719 Ga0068861_100466090 Ga0068861_1004660902 223
187 3300005719 Ga0068861_101013713 Ga0068861_1010137132 223
188 3300005834 Ga0068851_10004687 Ga0068851_100046874 223
189 3300005834 Ga0068851_10115479 Ga0068851_101154792 223
190 3300005841 Ga0068863_100000110 Ga0068863_10000011064 223
191 3300005841 Ga0068863_100015825 Ga0068863_1000158254 223
192 3300005841 Ga0068863_100136020 Ga0068863_1001360203 223
193 3300005842 Ga0068858_100000150 Ga0068858_10000015062 223
194 3300005843 Ga0068860_100003597 Ga0068860_10000359715 223
195 3300005843 Ga0068860_100120198 Ga0068860_1001201982 223
196 3300005843 Ga0068860_100154142 Ga0068860_1001541422 223
197 3300005843 Ga0068860_100168975 Ga0068860_1001689752 223
198 3300005844 Ga0068862_100010696 Ga0068862_1000106969 223
199 3300005844 Ga0068862_100563515 Ga0068862_1005635152 223
200 3300005937 Ga0081455_10002533 Ga0081455_100025334 223
201 3300005937 Ga0081455_10021062 Ga0081455_100210625 223
202 3300005937 Ga0081455_10043091 Ga0081455_100430912 223
203 3300005983 Ga0081540_1000435 Ga0081540_100043518 223
204 3300005985 Ga0081539_10001052 Ga0081539_100010525 223
205 3300006038 Ga0075365_10000722 Ga0075365_100007226 223
206 3300006038 Ga0075365_10020147 Ga0075365_100201472 223
207 3300006048 Ga0075363_100012920 Ga0075363_1000129202 223
208 3300006048 Ga0075363_100083218 Ga0075363_1000832182 223
209 3300006048 Ga0075363_100101017 Ga0075363_1001010172 223
210 3300006051 Ga0075364_10002834 Ga0075364_100028347 223
211 3300006051 Ga0075364_10072097 Ga0075364_100720973 223
212 3300006163 Ga0070715_10000003 Ga0070715_10000003295 223
213 3300006163 Ga0070715_10308787 Ga0070715_103087871 223
214 3300006173 Ga0070716_100505659 Ga0070716_1005056591 223
215 3300006175 Ga0070712_100007464 Ga0070712_1000074647 223
216 3300006178 Ga0075367_10011862 Ga0075367_100118625 223
217 3300006178 Ga0075367_10157222 Ga0075367_101572222 223
218 3300006844 Ga0075428_100155458 Ga0075428_1001554583 223
219 3300006846 Ga0075430_100057762 Ga0075430_1000577622 223
220 3300006847 Ga0075431_100019643 Ga0075431_1000196435 223
221 3300006847 Ga0075431_100487984 Ga0075431_1004879842 223
222 3300006847 Ga0075431_100674159 Ga0075431_1006741591 223
223 3300006852 Ga0075433_10001846 Ga0075433_100018467 223
224 3300006852 Ga0075433_10004595 Ga0075433_100045954 223
225 3300006881 Ga0068865_100000024 Ga0068865_10000002468 223
226 3300006881 Ga0068865_100016376 Ga0068865_1000163763 223
227 3300006881 Ga0068865_100403410 Ga0068865_1004034102 223
228 3300006914 Ga0075436_100207673 Ga0075436_1002076732 223
229 3300006931 Ga0097620_100382350 Ga0097620_1003823502 223
230 3300006931 Ga0097620_100864802 Ga0097620_1008648021 223
231 3300007076 Ga0075435_100011075 Ga0075435_1000110754 223
232 3300007076 Ga0075435_100297381 Ga0075435_1002973812 223
233 3300009094 Ga0111539_10037181 Ga0111539_100371815 223
234 3300009094 Ga0111539_10046828 Ga0111539_100468283 223
235 3300009094 Ga0111539_10200553 Ga0111539_102005532 223
236 3300009098 Ga0105245_10000022 Ga0105245_10000022140 223
237 3300009098 Ga0105245_10001022 Ga0105245_100010223 223
238 3300009098 Ga0105245_10001178 Ga0105245_100011784 223
239 3300009098 Ga0105245_10049393 Ga0105245_100493932 223
240 3300009098 Ga0105245_10508668 Ga0105245_105086682 223
241 3300009101 Ga0105247_10000064 Ga0105247_1000006477 223
242 3300009101 Ga0105247_10080478 Ga0105247_100804782 223
243 3300009101 Ga0105247_10094102 Ga0105247_100941022 223
244 3300009101 Ga0105247_10133546 Ga0105247_101335462 223
245 3300009147 Ga0114129_10147910 Ga0114129_101479102 223
246 3300009147 Ga0114129_10152901 Ga0114129_101529014 223
247 3300009147 Ga0114129_10171735 Ga0114129_101717352 223
248 3300009148 Ga0105243_10002021 Ga0105243_100020214 223
249 3300009148 Ga0105243_10067333 Ga0105243_100673333 223
250 3300009148 Ga0105243_10256601 Ga0105243_102566012 223
251 3300009176 Ga0105242_10252193 Ga0105242_102521932 223
252 3300009177 Ga0105248_10000017 Ga0105248_1000001720 223
253 3300009177 Ga0105248_10198412 Ga0105248_101984123 223
254 3300009551 Ga0105238_10000014 Ga0105238_10000014215 223
255 3300009551 Ga0105238_10118685 Ga0105238_101186853 223
256 3300009551 Ga0105238_10930040 Ga0105238_109300401 223
257 3300009553 Ga0105249_10000181 Ga0105249_1000018144 223
258 3300009553 Ga0105249_10006903 Ga0105249_100069032 223
259 3300009553 Ga0105249_10034423 Ga0105249_100344232 223
260 3300009553 Ga0105249_10106918 Ga0105249_101069182 223
261 3300009553 Ga0105249_10493319 Ga0105249_104933192 223
262 3300009553 Ga0105249_10568406 Ga0105249_105684062 223
263 3300009553 Ga0105249_11336381 Ga0105249_113363811 223
264 3300010375 Ga0105239_10116111 Ga0105239_101161112 223
265 3300011119 Ga0105246_10084526 Ga0105246_100845262 223
266 3300013100 Ga0157373_10305287 Ga0157373_103052871 223
267 3300013102 Ga0157371_10017407 Ga0157371_100174075 223
268 3300013104 Ga0157370_10043875 Ga0157370_100438754 223
269 3300013104 Ga0157370_10073991 Ga0157370_100739914 223
270 3300013105 Ga0157369_10000068 Ga0157369_10000068108 223
271 3300013296 Ga0157374_10001959 Ga0157374_1000195915 223
272 3300013296 Ga0157374_10078656 Ga0157374_100786564 223
273 3300013296 Ga0157374_10354777 Ga0157374_103547771 223
274 3300013296 Ga0157374_10440350 Ga0157374_104403502 223
275 3300013297 Ga0157378_10000656 Ga0157378_1000065611 223
276 3300013297 Ga0157378_10718065 Ga0157378_107180652 223
277 3300013306 Ga0163162_10371032 Ga0163162_103710322 223
278 3300013307 Ga0157372_10001135 Ga0157372_1000113532 223
279 3300013308 Ga0157375_10000126 Ga0157375_1000012659 223
280 3300013308 Ga0157375_10001522 Ga0157375_1000152211 223
281 3300013308 Ga0157375_10029588 Ga0157375_100295885 223
282 3300013308 Ga0157375_10041147 Ga0157375_100411472 223
283 3300013308 Ga0157375_10805836 Ga0157375_108058361 223
284 3300014325 Ga0163163_10569231 Ga0163163_105692312 223
285 3300014326 Ga0157380_10000326 Ga0157380_1000032631 223
286 3300014326 Ga0157380_10000403 Ga0157380_100004039 223
287 3300014326 Ga0157380_10009902 Ga0157380_100099024 223
288 3300014745 Ga0157377_10022224 Ga0157377_100222244 223
289 3300014968 Ga0157379_10052910 Ga0157379_100529103 223
290 3300014968 Ga0157379_10194157 Ga0157379_101941572 223
291 3300014968 Ga0157379_10212625 Ga0157379_102126252 223
292 3300014968 Ga0157379_10286295 Ga0157379_102862951 223
293 3300014969 Ga0157376_10013349 Ga0157376_100133497 223
294 3300017792 Ga0163161_10000013 Ga0163161_10000013130 223
295 3300017792 Ga0163161_10016346 Ga0163161_100163464 223
296 3300025321 Ga0207656_10000399 Ga0207656_1000039915 223
297 3300025321 Ga0207656_10094055 Ga0207656_100940552 223
298 3300025893 Ga0207682_10000327 Ga0207682_100003278 223
299 3300025899 Ga0207642_10000008 Ga0207642_1000000873 223
300 3300025899 Ga0207642_10000689 Ga0207642_1000068910 223
301 3300025900 Ga0207710_10000165 Ga0207710_1000016563 223
302 3300025901 Ga0207688_10030450 Ga0207688_100304503 223
303 3300025903 Ga0207680_10002295 Ga0207680_100022954 223
304 3300025903 Ga0207680_10017470 Ga0207680_100174704 223
305 3300025903 Ga0207680_10037141 Ga0207680_100371414 223
306 3300025905 Ga0207685_10000003 Ga0207685_10000003289 223
307 3300025909 Ga0207705_10163640 Ga0207705_101636403 223
308 3300025912 Ga0207707_10109650 Ga0207707_101096502 223
309 3300025912 Ga0207707_10296001 Ga0207707_102960012 223
310 3300025914 Ga0207671_10168003 Ga0207671_101680032 223
311 3300025915 Ga0207693_10008752 Ga0207693_100087524 223
312 3300025915 Ga0207693_10008877 Ga0207693_100088775 223
313 3300025915 Ga0207693_10239386 Ga0207693_102393863 223
314 3300025916 Ga0207663_10008156 Ga0207663_100081564 223
315 3300025916 Ga0207663_10009286 Ga0207663_100092864 223
316 3300025917 Ga0207660_10081268 Ga0207660_100812682 223
317 3300025917 Ga0207660_10145019 Ga0207660_101450192 223
318 3300025917 Ga0207660_10662948 Ga0207660_106629482 223
319 3300025918 Ga0207662_10164008 Ga0207662_101640082 223
320 3300025919 Ga0207657_10005356 Ga0207657_100053565 223
321 3300025920 Ga0207649_10000166 Ga0207649_1000016640 223
322 3300025921 Ga0207652_10000242 Ga0207652_1000024251 223
323 3300025921 Ga0207652_10000437 Ga0207652_100004375 223
324 3300025924 Ga0207694_10000008 Ga0207694_1000000823 223
325 3300025924 Ga0207694_10133940 Ga0207694_101339402 223
326 3300025926 Ga0207659_10013476 Ga0207659_100134762 223
327 3300025927 Ga0207687_10000025 Ga0207687_1000002558 223
328 3300025927 Ga0207687_10000039 Ga0207687_1000003993 223
329 3300025927 Ga0207687_10000132 Ga0207687_100001323 223
330 3300025927 Ga0207687_10253986 Ga0207687_102539862 223
331 3300025928 Ga0207700_10000019 Ga0207700_10000019147 223
332 3300025931 Ga0207644_10045909 Ga0207644_100459093 223
333 3300025932 Ga0207690_10002070 Ga0207690_100020704 223
334 3300025932 Ga0207690_10003853 Ga0207690_100038534 223
335 3300025933 Ga0207706_10000137 Ga0207706_1000013748 223
336 3300025933 Ga0207706_10018044 Ga0207706_100180446 223
337 3300025934 Ga0207686_10163451 Ga0207686_101634512 223
338 3300025934 Ga0207686_10321111 Ga0207686_103211112 223
339 3300025935 Ga0207709_10008448 Ga0207709_100084484 223
340 3300025935 Ga0207709_10084855 Ga0207709_100848552 223
341 3300025935 Ga0207709_10202872 Ga0207709_102028722 223
342 3300025936 Ga0207670_10042755 Ga0207670_100427552 223
343 3300025936 Ga0207670_10080833 Ga0207670_100808332 223
344 3300025936 Ga0207670_10086521 Ga0207670_100865211 223
345 3300025937 Ga0207669_10000032 Ga0207669_1000003238 223
346 3300025937 Ga0207669_10000091 Ga0207669_1000009118 223
347 3300025937 Ga0207669_10036052 Ga0207669_100360524 223
348 3300025938 Ga0207704_10000054 Ga0207704_1000005413 223
349 3300025938 Ga0207704_10007544 Ga0207704_100075443 223
350 3300025938 Ga0207704_10179115 Ga0207704_101791151 223
351 3300025940 Ga0207691_10000871 Ga0207691_1000087130 223
352 3300025940 Ga0207691_10101984 Ga0207691_101019843 223
353 3300025941 Ga0207711_10000011 Ga0207711_1000001167 223
354 3300025944 Ga0207661_10013754 Ga0207661_100137544 223
355 3300025944 Ga0207661_10172475 Ga0207661_101724752 223
356 3300025944 Ga0207661_10501217 Ga0207661_105012172 223
357 3300025944 Ga0207661_10506325 Ga0207661_105063252 223
358 3300025945 Ga0207679_10069800 Ga0207679_100698002 223
359 3300025945 Ga0207679_10286039 Ga0207679_102860392 223
360 3300025949 Ga0207667_10533547 Ga0207667_105335472 223
361 3300025960 Ga0207651_10003068 Ga0207651_100030682 223
362 3300025961 Ga0207712_10000067 Ga0207712_10000067102 223
363 3300025961 Ga0207712_10007677 Ga0207712_100076771 223
364 3300025961 Ga0207712_10175846 Ga0207712_101758462 223
365 3300025972 Ga0207668_10031591 Ga0207668_100315914 223
366 3300025986 Ga0207658_10003743 Ga0207658_100037432 223
367 3300025986 Ga0207658_10004686 Ga0207658_100046869 223
368 3300026023 Ga0207677_10000903 Ga0207677_100009034 223
369 3300026023 Ga0207677_10208902 Ga0207677_102089022 223
370 3300026035 Ga0207703_10000070 Ga0207703_10000070113 223
371 3300026035 Ga0207703_10000122 Ga0207703_1000012245 223
372 3300026035 Ga0207703_10034693 Ga0207703_100346932 223
373 3300026035 Ga0207703_10372524 Ga0207703_103725242 223
374 3300026041 Ga0207639_10005680 Ga0207639_100056805 223
375 3300026041 Ga0207639_10249960 Ga0207639_102499602 223
376 3300026041 Ga0207639_10615519 Ga0207639_106155191 223
377 3300026067 Ga0207678_10005860 Ga0207678_100058606 223
378 3300026067 Ga0207678_10008898 Ga0207678_100088987 223
379 3300026075 Ga0207708_10002304 Ga0207708_1000230412 223
380 3300026075 Ga0207708_10035998 Ga0207708_100359983 223
381 3300026075 Ga0207708_10069224 Ga0207708_100692244 223
382 3300026075 Ga0207708_10119320 Ga0207708_101193202 223
383 3300026078 Ga0207702_10008754 Ga0207702_100087547 223
384 3300026078 Ga0207702_10011625 Ga0207702_100116257 223
385 3300026088 Ga0207641_10000065 Ga0207641_10000065133 223
386 3300026088 Ga0207641_10012714 Ga0207641_100127146 223
387 3300026088 Ga0207641_10054404 Ga0207641_100544043 223
388 3300026089 Ga0207648_10004608 Ga0207648_1000460815 223
389 3300026089 Ga0207648_10005283 Ga0207648_100052834 223
390 3300026095 Ga0207676_10000025 Ga0207676_10000025110 223
391 3300026116 Ga0207674_10082436 Ga0207674_100824364 223
392 3300026118 Ga0207675_100142208 Ga0207675_1001422084 223
393 3300026118 Ga0207675_100518531 Ga0207675_1005185312 223
394 3300026121 Ga0207683_10026953 Ga0207683_100269536 223
395 3300026121 Ga0207683_10056797 Ga0207683_100567974 223
396 3300026121 Ga0207683_10089063 Ga0207683_100890633 223
397 3300026142 Ga0207698_10000014 Ga0207698_1000001488 223
398 3300027907 Ga0207428_10007473 Ga0207428_100074737 223
399 3300027907 Ga0207428_10339852 Ga0207428_103398522 223
400 3300028379 Ga0268266_10000029 Ga0268266_1000002999 223
401 3300028379 Ga0268266_10000973 Ga0268266_1000097328 223
402 3300028379 Ga0268266_10002641 Ga0268266_100026416 223
403 3300028379 Ga0268266_10038476 Ga0268266_100384765 223
404 3300028379 Ga0268266_10773598 Ga0268266_107735981 223
405 3300028380 Ga0268265_10017817 Ga0268265_100178172 223
406 3300028381 Ga0268264_10002647 Ga0268264_100026475 223
407 3300028381 Ga0268264_10044924 Ga0268264_100449242 223
408 3300028381 Ga0268264_10085791 Ga0268264_100857912 223
409 3300028381 Ga0268264_10277561 Ga0268264_102775612 223
410 3300028556 Ga0265337_1000112 Ga0265337_100011224 223
411 3300028558 Ga0265326_10000040 Ga0265326_1000004063 223
412 3300028563 Ga0265319_1000030 Ga0265319_100003072 223
413 3300028654 Ga0265322_10000012 Ga0265322_1000001286 223
414 3300028666 Ga0265336_10005375 Ga0265336_100053752 223
415 3300028800 Ga0265338_10000156 Ga0265338_1000015672 223
416 3300029957 Ga0265324_10000202 Ga0265324_100002029 223
417 3300031240 Ga0265320_10000001 Ga0265320_10000001784 223
418 3300031242 Ga0265329_10008221 Ga0265329_100082214 223
419 3300031250 Ga0265331_10001236 Ga0265331_1000123614 223
420 3300031250 Ga0265331_10009016 Ga0265331_100090162 223
421 3300031251 Ga0265327_10000003 Ga0265327_10000003784 223
422 3300031344 Ga0265316_10063543 Ga0265316_100635433 223
423 3300031711 Ga0265314_10000178 Ga0265314_100001787 223
424 3300031712 Ga0265342_10131138 Ga0265342_101311382 223
425 3300037466 Ga0395898_0026087 Ga0395898_0026087_2062_2742 223
426 3300037466 Ga0395898_0161389 Ga0395898_0161389_494_1174 223
427 3300037466 Ga0395898_0173287 Ga0395898_0173287_1181_1861 223
428 3300037471 Ga0395905_0015772 Ga0395905_0015772_1648_2328 223
429 3300037471 Ga0395905_0430491 Ga0395905_0430491_336_1013 223
430 3300037471 Ga0395905_0682486 Ga0395905_0682486_181_861 223
431 3300038443 Ga0395901_0028155 Ga0395901_0028155_3094_3774 223
432 3300038443 Ga0395901_0036480 Ga0395901_0036480_4095_4775 223
433 3300038443 Ga0395901_0162803 Ga0395901_0162803_679_1365 223
434 3300041486 Ga0451807_2152006 Ga0451807_2152006_424_1095 223
435 3300041496 Ga0451839_1478570 Ga0451839_1478570_478_1149 223
436 3300041503 Ga0451847_0664677 Ga0451847_0664677_55_726 223
437 3300041512 Ga0451853_0220151 Ga0451853_0220151_6618_7289 223
438 3300041512 Ga0451853_0313996 Ga0451853_0313996_445_1137 223
439 3300041512 Ga0451853_1765258 Ga0451853_1765258_405_1076 223
440 3300044694 Ga0466963_0008734 Ga0466963_0008734_2883_3554 223
441 3300044706 Ga0466964_0046096 Ga0466964_0046096_765_1445 223
442 3300044842 Ga0466957_0000193 Ga0466957_0000193_22140_22829 223
443 3300045976 Ga0466967_0000003 Ga0466967_0000003_11708_12379 223
444 3300045976 Ga0466967_0011027 Ga0466967_0011027_4418_5092 223
445 3300045976 Ga0466967_0015892 Ga0466967_0015892_5038_5718 223
446 3300046454 Ga0495592_0000752 Ga0495592_0000752_12970_13641 223
447 3300046454 Ga0495592_0076093 Ga0495592_0076093_1348_2019 223
448 3300046454 Ga0495592_0272470 Ga0495592_0272470_338_1009 223
449 3300046454 Ga0495592_0398294 Ga0495592_0398294_174_845 223
450 3300046455 Ga0495603_0011119 Ga0495603_0011119_3238_3909 223
451 3300046455 Ga0495603_0014198 Ga0495603_0014198_1564_2235 223
452 3300046459 Ga0495629_0022877 Ga0495629_0022877_2126_2797 223
453 3300046459 Ga0495629_0044352 Ga0495629_0044352_2013_2684 223
454 3300046459 Ga0495629_0100201 Ga0495629_0100201_777_1448 223
455 3300046459 Ga0495629_0244927 Ga0495629_0244927_512_1183 223
456 3300046459 Ga0495629_0295508 Ga0495629_0295508_276_956 223
457 3300046460 Ga0495638_0095073 Ga0495638_0095073_1069_1740 223
458 3300046461 Ga0495641_0000010 Ga0495641_0000010_23499_24170 223
459 3300046461 Ga0495641_0132546 Ga0495641_0132546_263_934 223
460 3300046463 Ga0495653_0088276 Ga0495653_0088276_831_1505 223
461 3300046463 Ga0495653_0134943 Ga0495653_0134943_952_1626 223
462 3300046473 Ga0495582_0000006 Ga0495582_0000006_68695_69366 223
463 3300046475 Ga0495639_0038123 Ga0495639_0038123_1168_1848 223
464 3300046476 Ga0495662_0000212 Ga0495662_0000212_9580_10251 223
465 3300046476 Ga0495662_0066891 Ga0495662_0066891_388_1059 223
466 3300046477 Ga0495664_0177973 Ga0495664_0177973_559_1230 223
467 3300046499 Ga0495594_0000001 Ga0495594_0000001_65164_65844 223
468 3300046500 Ga0495596_0085654 Ga0495596_0085654_36_716 223
469 3300046511 Ga0495608_0000906 Ga0495608_0000906_1277_1954 223
470 3300046511 Ga0495608_0000961 Ga0495608_0000961_7122_7802 223
471 3300046511 Ga0495608_0016325 Ga0495608_0016325_566_1237 223
472 3300046514 Ga0495618_0134981 Ga0495618_0134981_59_730 223
473 3300046515 Ga0495620_0001375 Ga0495620_0001375_2094_2765 223
474 3300046516 Ga0495628_0002123 Ga0495628_0002123_2534_3208 223
475 3300046516 Ga0495628_0051337 Ga0495628_0051337_2255_2926 223
476 3300046516 Ga0495628_0052940 Ga0495628_0052940_1108_1899 223
477 3300046516 Ga0495628_0099294 Ga0495628_0099294_1186_1857 223
478 3300046516 Ga0495628_0101679 Ga0495628_0101679_346_1017 223
479 3300046516 Ga0495628_0231255 Ga0495628_0231255_27_707 223
480 3300046517 Ga0495630_0000148 Ga0495630_0000148_18274_18945 223
481 3300046517 Ga0495630_0003200 Ga0495630_0003200_9407_10078 223
482 3300046523 Ga0495644_0046136 Ga0495644_0046136_917_1594 223
483 3300046529 Ga0495652_0000009 Ga0495652_0000009_200402_201073 223
484 3300046529 Ga0495652_0018702 Ga0495652_0018702_5313_6071 223
485 3300046533 Ga0495640_0029026 Ga0495640_0029026_716_1387 223
486 3300046533 Ga0495640_0256084 Ga0495640_0256084_308_991 223
487 3300046536 Ga0495587_0002768 Ga0495587_0002768_3859_4530 223
488 3300046536 Ga0495587_0122209 Ga0495587_0122209_189_860 223
489 3300046536 Ga0495587_0316785 Ga0495587_0316785_32_703 223
490 3300046536 Ga0495587_0363098 Ga0495587_0363098_44_715 223
491 3300046543 Ga0495645_0003129 Ga0495645_0003129_5760_6431 223
492 3300046543 Ga0495645_0005828 Ga0495645_0005828_6038_6829 223
493 3300046557 Ga0495622_0000069 Ga0495622_0000069_68362_69042 223
494 3300046559 Ga0495667_0000067 Ga0495667_0000067_3489_4166 223
495 3300046559 Ga0495667_0162667 Ga0495667_0162667_562_1236 223
496 3300046615 Ga0495656_0000217 Ga0495656_0000217_14694_15383 223
497 3300046616 Ga0495668_0262150 Ga0495668_0262150_240_911 223
498 3300046642 Ga0495634_0000021 Ga0495634_0000021_68244_68915 223
499 3300046642 Ga0495634_0000590 Ga0495634_0000590_10382_11053 223
500 3300046642 Ga0495634_0002438 Ga0495634_0002438_5091_5762 223
501 3300046642 Ga0495634_0031586 Ga0495634_0031586_2612_3283 223
502 3300046642 Ga0495634_0064324 Ga0495634_0064324_375_1046 223
503 3300046660 Ga0495625_0000109 Ga0495625_0000109_47850_48548 223
504 3300046663 Ga0495635_0000006 Ga0495635_0000006_41886_42557 223
505 3300046663 Ga0495635_0011707 Ga0495635_0011707_3736_4410 223
506 3300046663 Ga0495635_0159165 Ga0495635_0159165_213_884 223
507 3300046675 Ga0495657_0001466 Ga0495657_0001466_12545_13225 223
508 3300046675 Ga0495657_0055478 Ga0495657_0055478_1016_1687 223
509 3300046678 Ga0495599_0030763 Ga0495599_0030763_2534_3211 223
510 3300046678 Ga0495599_0108835 Ga0495599_0108835_456_1214 223
511 3300046681 Ga0495647_0000002 Ga0495647_0000002_23347_24018 223
512 3300046681 Ga0495647_0002225 Ga0495647_0002225_4391_5062 223
513 3300046681 Ga0495647_0031177 Ga0495647_0031177_1176_1847 223
514 3300046683 Ga0495658_0000027 Ga0495658_0000027_71069_71740 223
515 3300046683 Ga0495658_0022546 Ga0495658_0022546_593_1279 223
516 3300046684 Ga0495669_0000132 Ga0495669_0000132_45644_46315 223
517 3300046689 Ga0495613_0000287 Ga0495613_0000287_24179_24850 223
518 3300046690 Ga0495624_0000005 Ga0495624_0000005_21505_22176 223
519 3300046690 Ga0495624_0001686 Ga0495624_0001686_64_747 223
520 3300046809 Ga0495600_0002327 Ga0495600_0002327_7410_8084 223
521 3300046809 Ga0495600_0390129 Ga0495600_0390129_26_700 223
522 3300047317 Ga0495604_0000636 Ga0495604_0000636_29411_30082 223
523 3300047317 Ga0495604_0039842 Ga0495604_0039842_498_1169 223
524 3300047317 Ga0495604_0047775 Ga0495604_0047775_719_1390 223
525 3300047317 Ga0495604_0065241 Ga0495604_0065241_1898_2569 223
526 3300047319 Ga0495674_0000141 Ga0495674_0000141_41159_41830 223
527 3300047320 Ga0495672_0063182 Ga0495672_0063182_775_1470 223
528 3300047320 Ga0495672_0157138 Ga0495672_0157138_60_743 223
529 3300047321 Ga0495676_0000209 Ga0495676_0000209_31723_32394 223
530 3300047321 Ga0495676_0003630 Ga0495676_0003630_1248_1919 223
531 3300047321 Ga0495676_0156171 Ga0495676_0156171_675_1355 223
532 3300047321 Ga0495676_0170705 Ga0495676_0170705_83_754 223
533 3300047322 Ga0495680_0000541 Ga0495680_0000541_19836_20507 223
534 3300047322 Ga0495680_0009424 Ga0495680_0009424_3449_4126 223
535 3300047322 Ga0495680_0417123 Ga0495680_0417123_64_735 223
536 3300047444 Ga0495675_0000744 Ga0495675_0000744_7122_7802 223
537 3300047446 Ga0495679_007935 Ga0495679_007935_1718_2395 223
538 3300047469 Ga0495673_0102879 Ga0495673_0102879_152_823 223
539 3300047471 Ga0495684_0456242 Ga0495684_0456242_188_859 223
540 3300047673 Ga0495593_0144565 Ga0495593_0144565_184_855 223
541 3300048088 Ga0495602_0000038 Ga0495602_0000038_52149_52820 223
542 3300048088 Ga0495602_0002031 Ga0495602_0002031_137_808 223
543 3300048088 Ga0495602_0320626 Ga0495602_0320626_195_866 223
544 3300048089 Ga0495614_0068148 Ga0495614_0068148_677_1348 223
545 3300048089 Ga0495614_0154143 Ga0495614_0154143_82_762 223
546 3300048903 Ga0496100_0000006 Ga0496100_0000006_273845_274516 223
547 3300048903 Ga0496100_0000028 Ga0496100_0000028_72213_72884 223
548 3300048903 Ga0496100_0129393 Ga0496100_0129393_89_769 223
549 3300048904 Ga0496101_0000005 Ga0496101_0000005_222212_222883 223
550 3300048904 Ga0496101_0000009 Ga0496101_0000009_273845_274516 223
551 3300048904 Ga0496101_0053863 Ga0496101_0053863_1183_1863 223
552 3300048904 Ga0496101_0135816 Ga0496101_0135816_330_1010 223
553 3300048904 Ga0496101_0271136 Ga0496101_0271136_519_1205 223
554 3300048905 Ga0496102_0000021 Ga0496102_0000021_149804_150475 223
555 3300048905 Ga0496102_0002673 Ga0496102_0002673_8926_9636 223
556 3300048905 Ga0496102_0096157 Ga0496102_0096157_1987_2658 223
557 3300048905 Ga0496102_0237758 Ga0496102_0237758_976_1656 223
558 3300048905 Ga0496102_0255827 Ga0496102_0255827_389_1066 223
559 3300048906 Ga0496103_0000001 Ga0496103_0000001_445432_446103 223
560 3300048906 Ga0496103_0023977 Ga0496103_0023977_545_1255 223
561 3300048906 Ga0496103_0029172 Ga0496103_0029172_1034_1705 223
562 3300048906 Ga0496103_0102441 Ga0496103_0102441_511_1218 223
563 3300048907 Ga0496104_0000008 Ga0496104_0000008_454157_454846 223
564 3300048907 Ga0496104_0000214 Ga0496104_0000214_36250_36921 223
565 3300048907 Ga0496104_0052830 Ga0496104_0052830_1303_1974 223
566 3300048908 Ga0496105_0000003 Ga0496105_0000003_454157_454846 223
567 3300048908 Ga0496105_0001724 Ga0496105_0001724_357_1028 223
568 3300048908 Ga0496105_0017098 Ga0496105_0017098_4246_4926 223
569 3300048908 Ga0496105_0019479 Ga0496105_0019479_1661_2344 223
570 3300048909 Ga0496106_0000070 Ga0496106_0000070_41109_41780 223
571 3300048909 Ga0496106_0000101 Ga0496106_0000101_13_684 223
572 3300048909 Ga0496106_0000728 Ga0496106_0000728_123_794 223
573 3300048909 Ga0496106_0319157 Ga0496106_0319157_153_860 223
574 3300048909 Ga0496106_0425903 Ga0496106_0425903_189_875 223
575 3300048910 Ga0496107_0000004 Ga0496107_0000004_222429_223100 223
576 3300048910 Ga0496107_0000015 Ga0496107_0000015_170073_170744 223
577 3300048910 Ga0496107_0022566 Ga0496107_0022566_3117_3803 223
578 3300048910 Ga0496107_0026016 Ga0496107_0026016_817_1497 223
579 3300048910 Ga0496107_0090299 Ga0496107_0090299_773_1477 223
580 3300048911 Ga0496108_0000004 Ga0496108_0000004_113663_114352 223
581 3300048911 Ga0496108_0000042 Ga0496108_0000042_85807_86478 223
582 3300048911 Ga0496108_0000339 Ga0496108_0000339_36054_36740 223
583 3300048911 Ga0496108_0006479 Ga0496108_0006479_5545_6225 223
584 3300048911 Ga0496108_0018633 Ga0496108_0018633_731_1417 223
585 3300048911 Ga0496108_0196024 Ga0496108_0196024_213_884 223
586 3300048911 Ga0496108_0340366 Ga0496108_0340366_222_902 223
587 3300048911 Ga0496108_0716586 Ga0496108_0716586_175_846 223
588 3300048912 Ga0496109_0000034 Ga0496109_0000034_118446_119117 223
589 3300048912 Ga0496109_0000036 Ga0496109_0000036_39622_40311 223
590 3300048912 Ga0496109_0001321 Ga0496109_0001321_13885_14571 223
591 3300048912 Ga0496109_0054544 Ga0496109_0054544_1913_2599 223
592 3300048912 Ga0496109_0064189 Ga0496109_0064189_213_884 223
593 3300048912 Ga0496109_0226122 Ga0496109_0226122_640_1311 223
594 3300048912 Ga0496109_0325920 Ga0496109_0325920_546_1217 223
595 3300048912 Ga0496109_0375006 Ga0496109_0375006_377_1054 223
596 3300048913 Ga0496110_0014992 Ga0496110_0014992_3056_3739 223
597 3300048913 Ga0496110_0018529 Ga0496110_0018529_3370_4041 223
598 3300048913 Ga0496110_0121149 Ga0496110_0121149_1478_2155 223
599 3300048913 Ga0496110_0122644 Ga0496110_0122644_1465_2145 223
600 3300048913 Ga0496110_0179318 Ga0496110_0179318_1157_1843 223
601 3300048914 Ga0496111_0010778 Ga0496111_0010778_1184_1870 223
602 3300048914 Ga0496111_0024519 Ga0496111_0024519_598_1284 223
603 3300048914 Ga0496111_0031656 Ga0496111_0031656_1353_2030 223
604 3300048914 Ga0496111_0212970 Ga0496111_0212970_82_765 223
605 3300048914 Ga0496111_0328953 Ga0496111_0328953_387_1067 223
606 3300048915 Ga0496112_0000002 Ga0496112_0000002_196147_196821 223
607 3300048915 Ga0496112_0002000 Ga0496112_0002000_4400_5071 223
608 3300048915 Ga0496112_0306431 Ga0496112_0306431_55_735 223
609 3300048915 Ga0496112_0660596 Ga0496112_0660596_78_764 223
610 3300048916 Ga0496113_0000002 Ga0496113_0000002_70175_70846 223
611 3300048916 Ga0496113_0031981 Ga0496113_0031981_2465_3136 223
612 3300048916 Ga0496113_0062635 Ga0496113_0062635_42_716 223
613 3300048916 Ga0496113_0101852 Ga0496113_0101852_466_1146 223
614 3300048916 Ga0496113_0294441 Ga0496113_0294441_186_857 223
615 3300048916 Ga0496113_0599258 Ga0496113_0599258_52_741 223
616 3300048917 Ga0496114_0000097 Ga0496114_0000097_56082_56756 223
617 3300048917 Ga0496114_0021651 Ga0496114_0021651_1453_2124 223
618 3300048917 Ga0496114_0045364 Ga0496114_0045364_1317_1988 223
619 3300048917 Ga0496114_0341724 Ga0496114_0341724_148_828 223
620 3300048917 Ga0496114_0431426 Ga0496114_0431426_50_754 223
621 3300048917 Ga0496114_0460846 Ga0496114_0460846_234_905 223
622 3300048918 Ga0496115_0000005 Ga0496115_0000005_83235_83906 223
623 3300048918 Ga0496115_0000151 Ga0496115_0000151_57184_57858 223
624 3300048918 Ga0496115_0007257 Ga0496115_0007257_2439_3110 223
625 3300048919 Ga0496116_0000529 Ga0496116_0000529_2667_3371 223
626 3300048920 Ga0496117_0009095 Ga0496117_0009095_7470_8180 223
627 3300048920 Ga0496117_0111120 Ga0496117_0111120_704_1408 223
628 3300048921 Ga0496118_0004226 Ga0496118_0004226_8772_9482 223
629 3300048922 Ga0496119_0000489 Ga0496119_0000489_50846_51550 223
630 3300048922 Ga0496119_0032699 Ga0496119_0032699_2567_3274 223
631 3300048922 Ga0496119_0062938 Ga0496119_0062938_1204_1908 223
632 3300048923 Ga0496120_0025331 Ga0496120_0025331_2798_3502 223
633 3300048923 Ga0496120_0117004 Ga0496120_0117004_428_1099 223
634 3300048924 Ga0496121_0020170 Ga0496121_0020170_2929_3636 223
635 3300048924 Ga0496121_0035115 Ga0496121_0035115_2003_2707 223
636 3300048927 Ga0496124_0243420 Ga0496124_0243420_353_1057 223
637 3300048927 Ga0496124_0308521 Ga0496124_0308521_30_734 223
638 3300048928 Ga0496125_0037383 Ga0496125_0037383_2034_2741 223
639 3300048928 Ga0496125_0055740 Ga0496125_0055740_1847_2536 223
640 3300048928 Ga0496125_0126549 Ga0496125_0126549_208_918 223
641 3300048929 Ga0496126_0019475 Ga0496126_0019475_4908_5612 223
642 3300048929 Ga0496126_0048743 Ga0496126_0048743_1126_1830 223
643 3300048929 Ga0496126_0206190 Ga0496126_0206190_685_1389 223
644 3300049568 Ga0501031_0000885 Ga0501031_0000885_5784_6491 223
645 3300049569 Ga0501032_0000843 Ga0501032_0000843_18437_19144 223
646 3300049570 Ga0501033_0001203 Ga0501033_0001203_16836_17543 223
647 3300049571 Ga0501034_0004760 Ga0501034_0004760_5784_6491 223
648 3300049572 Ga0501036_0000711 Ga0501036_0000711_18141_18848 223
649 3300049573 Ga0501037_0000522 Ga0501037_0000522_24375_25082 223
650 3300049574 Ga0501038_0105353 Ga0501038_0105353_941_1648 223
651 3300049574 Ga0501038_0191438 Ga0501038_0191438_265_945 223
652 3300049575 Ga0501039_0013392 Ga0501039_0013392_5248_5955 223
653 3300049575 Ga0501039_0056990 Ga0501039_0056990_2304_2975 223
654 3300049575 Ga0501039_0248670 Ga0501039_0248670_237_917 223
655 3300049576 Ga0501040_0118386 Ga0501040_0118386_241_948 223
656 3300049576 Ga0501040_0475782 Ga0501040_0475782_31_705 223
657 3300049578 Ga0501042_0048889 Ga0501042_0048889_1839_2543 223
658 3300049578 Ga0501042_0079610 Ga0501042_0079610_1624_2313 223
659 3300049578 Ga0501042_0115026 Ga0501042_0115026_931_1638 223
660 3300049579 Ga0501043_0004212 Ga0501043_0004212_939_1646 223
661 3300049579 Ga0501043_0669392 Ga0501043_0669392_64_744 223
662 3300049580 Ga0501046_0001261 Ga0501046_0001261_5653_6360 223
663 3300049580 Ga0501046_0117959 Ga0501046_0117959_911_1591 223
664 3300049581 Ga0501047_0001310 Ga0501047_0001310_18116_18823 223
665 3300049581 Ga0501047_0019766 Ga0501047_0019766_2853_3557 223
666 3300049582 Ga0501048_0000689 Ga0501048_0000689_5784_6491 223
667 3300049582 Ga0501048_0160508 Ga0501048_0160508_291_971 223
668 3300049583 Ga0501067_0135061 Ga0501067_0135061_50_727 223
669 3300049584 Ga0501068_0020879 Ga0501068_0020879_290_994 223
670 3300049584 Ga0501068_0122344 Ga0501068_0122344_22_729 223
671 3300049585 Ga0501069_0014034 Ga0501069_0014034_1639_2346 223
672 3300049585 Ga0501069_0020680 Ga0501069_0020680_2139_2843 223
673 3300049586 Ga0501070_0000267 Ga0501070_0000267_42677_43384 223
674 3300049586 Ga0501070_0036301 Ga0501070_0036301_1092_1799 223
675 3300049586 Ga0501070_0053280 Ga0501070_0053280_2501_3205 223
676 3300049586 Ga0501070_0100623 Ga0501070_0100623_696_1367 223
677 3300049586 Ga0501070_0444584 Ga0501070_0444584_152_856 223
678 3300049588 Ga0501072_0131714 Ga0501072_0131714_870_1541 223
679 3300049588 Ga0501072_0167095 Ga0501072_0167095_65_745 223
680 3300049588 Ga0501072_0202595 Ga0501072_0202595_579_1286 223
681 3300049588 Ga0501072_0448722 Ga0501072_0448722_87_767 223
682 3300049589 Ga0501073_0028060 Ga0501073_0028060_1037_1744 223
683 3300049590 Ga0501074_0010332 Ga0501074_0010332_744_1451 223
684 3300049590 Ga0501074_0042104 Ga0501074_0042104_268_948 223
685 3300049591 Ga0501075_0004738 Ga0501075_0004738_57_728 223
686 3300049591 Ga0501075_0514246 Ga0501075_0514246_22_702 223
687 3300049591 Ga0501075_0544439 Ga0501075_0544439_37_708 223
688 3300049592 Ga0501076_0151679 Ga0501076_0151679_476_1156 223
689 3300049592 Ga0501076_0381068 Ga0501076_0381068_308_988 223
690 3300049593 Ga0501077_0206649 Ga0501077_0206649_530_1210 223
691 3300049741 Ga0501079_0208218 Ga0501079_0208218_775_1479 223
692 3300049741 Ga0501079_0270295 Ga0501079_0270295_352_1032 223
693 3300049742 Ga0501080_0011059 Ga0501080_0011059_4321_5028 223
694 3300049742 Ga0501080_0676504 Ga0501080_0676504_91_798 223
695 3300049744 Ga0501083_0055234 Ga0501083_0055234_1184_1888 223
696 3300049744 Ga0501083_0114365 Ga0501083_0114365_77_757 223
697 3300049822 Ga0501035_0001546 Ga0501035_0001546_5766_6473 223
698 3300049823 Ga0501044_0003136 Ga0501044_0003136_12276_12983 223
699 3300049823 Ga0501044_0235132 Ga0501044_0235132_168_872 223
700 3300049824 Ga0501045_0051674 Ga0501045_0051674_1995_2666 223
701 3300049824 Ga0501045_0097324 Ga0501045_0097324_850_1530 223
702 3300050490 nmdc:mga03n38_169053_c1 nmdc:mga03n38_169053_c1_91_771 223
703 3300050491 nmdc:mga00v17_8565_c1 nmdc:mga00v17_8565_c1_283_969 223
704 3300050492 nmdc:mga0yw44_10477_c1 nmdc:mga0yw44_10477_c1_3661_4341 223
705 3300050492 nmdc:mga0yw44_175972_c1 nmdc:mga0yw44_175972_c1_624_1304 223
706 3300050494 nmdc:mga06z11_100731_c1 nmdc:mga06z11_100731_c1_435_1115 223
707 3300050494 nmdc:mga06z11_18188_c1 nmdc:mga06z11_18188_c1_2452_3138 223
708 3300050507 nmdc:mga05p37_135351_c1 nmdc:mga05p37_135351_c1_839_1519 223
709 3300050509 nmdc:mga0qj67_47502_c1 nmdc:mga0qj67_47502_c1_2457_3158 223
710 3300050510 nmdc:mga06r32_380009_c1 nmdc:mga06r32_380009_c1_532_1212 223
711 3300050510 nmdc:mga06r32_477478_c1 nmdc:mga06r32_477478_c1_125_808 223
712 3300050511 nmdc:mga08y16_173595_c1 nmdc:mga08y16_173595_c1_1386_2063 223
713 3300050511 nmdc:mga08y16_62734_c1 nmdc:mga08y16_62734_c1_2676_3362 223
714 3300050511 nmdc:mga08y16_7851_c1 nmdc:mga08y16_7851_c1_1384_2064 223
715 3300050512 nmdc:mga0n895_21750_c1 nmdc:mga0n895_21750_c1_2508_3188 223
716 3300050513 nmdc:mga0rr50_114078_c1 nmdc:mga0rr50_114078_c1_1057_1737 223
717 3300050514 nmdc:mga08x19_311158_c1 nmdc:mga08x19_311158_c1_178_858 223
718 3300050515 nmdc:mga0a205_15_c1 nmdc:mga0a205_15_c1_26070_26741 223
719 3300050515 nmdc:mga0a205_51329_c1 nmdc:mga0a205_51329_c1_1293_1973 223
720 3300053077 Ga0495601_0000019 Ga0495601_0000019_154483_155154 223
721 3300053077 Ga0495601_0000059 Ga0495601_0000059_35637_36314 223
722 3300053077 Ga0495601_0003867 Ga0495601_0003867_2459_3130 223
723 3300053077 Ga0495601_0145749 Ga0495601_0145749_402_1073 223
724 3300053078 Ga0495612_0000122 Ga0495612_0000122_20707_21378 223
725 3300053078 Ga0495612_0000221 Ga0495612_0000221_14148_14819 223
726 3300053078 Ga0495612_0012321 Ga0495612_0012321_2323_3006 223
727 3300053083 Ga0495655_0000013 Ga0495655_0000013_6543_7214 223
728 3300053083 Ga0495655_0051083 Ga0495655_0051083_37_708 223
729 3300053084 Ga0495595_0000276 Ga0495595_0000276_7122_7802 223
730 3300053084 Ga0495595_0001135 Ga0495595_0001135_9554_10231 223
731 3300053084 Ga0495595_0005273 Ga0495595_0005273_1834_2505 223
732 3300053084 Ga0495595_0113188 Ga0495595_0113188_618_1304 223
733 3300053085 Ga0495619_0000001 Ga0495619_0000001_897_1586 223
734 3300053085 Ga0495619_0000152 Ga0495619_0000152_43291_43971 223
735 3300053085 Ga0495619_0000564 Ga0495619_0000564_4214_4888 223
736 3300053085 Ga0495619_0001238 Ga0495619_0001238_3554_4228 223
737 3300053085 Ga0495619_0022300 Ga0495619_0022300_935_1606 223
738 3300053085 Ga0495619_0349213 Ga0495619_0349213_268_951 223
739 3300053094 Ga0500566_0003812 Ga0500566_0003812_7715_8386 223
740 3300053096 Ga0500641_0008094 Ga0500641_0008094_572_1249 223
741 3300053123 Ga0500614_000791 Ga0500614_000791_2988_3659 223
742 3300053129 Ga0500628_000045 Ga0500628_000045_35267_35938 223
743 3300053134 Ga0500658_0009977 Ga0500658_0009977_1806_2516 223
744 3300053139 Ga0500568_0057781 Ga0500568_0057781_648_1358 223
745 3300054114 Ga0501084_0135644 Ga0501084_0135644_1015_1695 223
746 3300060353 Ga0501082_0718478 Ga0501082_0718478_58_738 223

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a72-assembly1.cif.gz_A crystal structure of the omega transaminase from chromobacterium violaceum in a mixture of apo and plp-bound states 0.7135 166 206
4a6r-assembly1.cif.gz_B crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid 0.7053 166 206
4a6u-assembly1.cif.gz_B crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from peg 3350 0.6894 161 206
4a6u-assembly1.cif.gz_A crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from peg 3350 0.6867 161 206
6t84-assembly1.cif.gz_A crystal structure of the mycobacterial trehalose monomycolate transport factor a, ttfa 0.672 10 196
ID Description Score Start End Superfamily
af_I1LKK8_3_90_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.6667 161 204 3.30.310.50
af_Q2G0R8_1016_1167_3.90.1150.50 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Transcription-repair-coupling factor, D7 domain 0.6592 159 187 3.90.1150.50
1l5aB03 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Nonribosomal peptide synthetase, condensation domain 0.6475 167 204 3.30.559.30
af_Q5JSP0_362_483_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6468 159 204 2.30.29.30
af_O08816_6_147_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6303 159 204 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A538A327-F1-model_v4 Uncharacterized protein 0.9511 1 223
AF-A0A538A327-F1-model_v4 Uncharacterized protein 0.9468 1 223
AF-A0A535HG65-F1-model_v4 Uncharacterized protein 0.8259 80 199
AF-A0A0M0BZR0-F1-model_v4 Uncharacterized protein 0.7735 158 204
AF-D2R360-F1-model_v4 RING-type domain-containing protein 0.7719 10 199

Feature Viewer

pLDDT pTM Quality
88.34 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map