F478885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 323 | 746 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0052940|Ga0495628_0052940_1108_1899 |
| Length | 263 |
| Sequence | MTMIATMTMRAMVMKAPVVGPVGPVYAQSYRRERAGELSVSGTQEAQEWAEAVRRFGERAGVAYEPVGGINPKDGPVALCVGGSNRLTGQLVEGFWGSSCDAGEKEVGGLFGKALVPTAILAKAHMPDLAKVVPAFNVESIEGTEALTQHLVRKVEFESLEFNRRFIATVPKEHDPVALRELFSPGFLEWTTTMTGEVDFGVNDRQLWFLWRLGERSEGELKEALKNAGRLFGRIQGEMDESGIHTYPPGPWHAGLEPFPDAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 180 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 317 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 318 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 319 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 0 |
| Rhizoplane | 11.8 |
| Rhizosphere | 80.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000852 | 3300001977 | Bacteria | 4729 |
| 2 | JGI24748J21848_1000142 | 3300002074 | Bacteria | 12113 |
| 3 | JGI24034J26672_10002156 | 3300002239 | Bacteria | 2682 |
| 4 | JGI24742J22300_10009386 | 3300002244 | Bacteria | 1614 |
| 5 | JGI25404J52841_10004750 | 3300003659 | Bacteria | 2776 |
| 6 | Ga0070658_10056777 | 3300005327 | Bacteria | 3183 |
| 7 | Ga0070658_10095850 | 3300005327 | Bacteria | 2449 |
| 8 | Ga0070683_100002869 | 3300005329 | Bacteria | 13809 |
| 9 | Ga0070683_100004639 | 3300005329 | Bacteria | 11352 |
| 10 | Ga0070683_100078997 | 3300005329 | Bacteria | 3079 |
| 11 | Ga0070683_100125107 | 3300005329 | Bacteria | 2430 |
| 12 | Ga0070677_10000081 | 3300005333 | Bacteria | 30569 |
| 13 | Ga0070666_10259004 | 3300005335 | Bacteria | 1233 |
| 14 | Ga0070680_100083006 | 3300005336 | Bacteria | 2646 |
| 15 | Ga0070680_100132860 | 3300005336 | Bacteria | 2083 |
| 16 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 17 | Ga0070682_100000032 | 3300005337 | Bacteria | 155141 |
| 18 | Ga0070682_100011743 | 3300005337 | Bacteria | 5008 |
| 19 | Ga0070682_100205638 | 3300005337 | Bacteria | 1392 |
| 20 | Ga0068868_100000138 | 3300005338 | Bacteria | 46922 |
| 21 | Ga0068868_100246705 | 3300005338 | Bacteria | 1502 |
| 22 | Ga0070660_100017636 | 3300005339 | Bacteria | 5205 |
| 23 | Ga0070660_100410716 | 3300005339 | Bacteria | 1120 |
| 24 | Ga0070689_100083814 | 3300005340 | Bacteria | 2505 |
| 25 | Ga0070689_100112308 | 3300005340 | Bacteria | 2169 |
| 26 | Ga0070689_100219819 | 3300005340 | Bacteria | 1558 |
| 27 | Ga0070689_100443317 | 3300005340 | Bacteria | 1104 |
| 28 | Ga0070668_100001413 | 3300005347 | Bacteria | 17288 |
| 29 | Ga0070668_100375900 | 3300005347 | Bacteria | 1208 |
| 30 | Ga0070675_100000022 | 3300005354 | Bacteria | 146580 |
| 31 | Ga0070675_100018681 | 3300005354 | Bacteria | 5519 |
| 32 | Ga0070674_100000021 | 3300005356 | Bacteria | 87134 |
| 33 | Ga0070674_100000075 | 3300005356 | Bacteria | 45822 |
| 34 | Ga0070674_100325405 | 3300005356 | Bacteria | 1234 |
| 35 | Ga0070674_100631279 | 3300005356 | Bacteria | 909 |
| 36 | Ga0070673_100017018 | 3300005364 | Bacteria | 5158 |
| 37 | Ga0070688_100000168 | 3300005365 | Bacteria | 35364 |
| 38 | Ga0070688_100052550 | 3300005365 | Bacteria | 2545 |
| 39 | Ga0070659_100001004 | 3300005366 | Bacteria | 20715 |
| 40 | Ga0070659_100016201 | 3300005366 | Bacteria | 5593 |
| 41 | Ga0070667_100029913 | 3300005367 | Bacteria | 4541 |
| 42 | Ga0070703_10048196 | 3300005406 | Bacteria | 1353 |
| 43 | Ga0070713_100000171 | 3300005436 | Bacteria | 43503 |
| 44 | Ga0070713_100395603 | 3300005436 | Bacteria | 1290 |
| 45 | Ga0070701_10461826 | 3300005438 | Bacteria | 817 |
| 46 | Ga0070711_100011385 | 3300005439 | Bacteria | 5521 |
| 47 | Ga0070711_100225570 | 3300005439 | Bacteria | 1459 |
| 48 | Ga0070700_100001537 | 3300005441 | Bacteria | 11499 |
| 49 | Ga0070700_100022395 | 3300005441 | Bacteria | 3684 |
| 50 | Ga0070700_100060903 | 3300005441 | Bacteria | 2380 |
| 51 | Ga0070700_100095004 | 3300005441 | Bacteria | 1953 |
| 52 | Ga0070663_100005777 | 3300005455 | Bacteria | 7384 |
| 53 | Ga0070662_100000052 | 3300005457 | Bacteria | 61979 |
| 54 | Ga0070662_100067597 | 3300005457 | Unclassified | 2624 |
| 55 | Ga0070681_10363839 | 3300005458 | Bacteria | 1357 |
| 56 | Ga0068867_100002852 | 3300005459 | Bacteria | 12156 |
| 57 | Ga0068867_100005467 | 3300005459 | Bacteria | 8990 |
| 58 | Ga0070685_10000058 | 3300005466 | Bacteria | 64666 |
| 59 | Ga0070685_10000246 | 3300005466 | Bacteria | 35364 |
| 60 | Ga0070685_10023282 | 3300005466 | Bacteria | 3390 |
| 61 | Ga0070685_10139246 | 3300005466 | Bacteria | 1526 |
| 62 | Ga0070679_100000190 | 3300005530 | Bacteria | 49809 |
| 63 | Ga0070679_100018989 | 3300005530 | Bacteria | 6677 |
| 64 | Ga0070679_100207035 | 3300005530 | Bacteria | 1926 |
| 65 | Ga0070684_100004244 | 3300005535 | Bacteria | 10858 |
| 66 | Ga0070684_100005286 | 3300005535 | Bacteria | 9880 |
| 67 | Ga0070684_100025254 | 3300005535 | Bacteria | 4993 |
| 68 | Ga0070684_100135000 | 3300005535 | Bacteria | 2228 |
| 69 | Ga0070684_100166527 | 3300005535 | Bacteria | 2001 |
| 70 | Ga0068853_100000830 | 3300005539 | Bacteria | 21615 |
| 71 | Ga0068853_100026166 | 3300005539 | Bacteria | 4899 |
| 72 | Ga0068853_100244080 | 3300005539 | Bacteria | 1647 |
| 73 | Ga0070672_100000258 | 3300005543 | Bacteria | 30020 |
| 74 | Ga0070686_100105526 | 3300005544 | Bacteria | 1911 |
| 75 | Ga0070686_100150834 | 3300005544 | Bacteria | 1628 |
| 76 | Ga0070693_100010796 | 3300005547 | Bacteria | 4583 |
| 77 | Ga0070693_100442839 | 3300005547 | Unclassified | 910 |
| 78 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 79 | Ga0070665_100002631 | 3300005548 | Bacteria | 19567 |
| 80 | Ga0070665_100041985 | 3300005548 | Bacteria | 4598 |
| 81 | Ga0070704_100101516 | 3300005549 | Bacteria | 2169 |
| 82 | Ga0070704_100214917 | 3300005549 | Bacteria | 1560 |
| 83 | Ga0070704_100414774 | 3300005549 | Bacteria | 1152 |
| 84 | Ga0068855_101079344 | 3300005563 | Bacteria | 840 |
| 85 | Ga0070664_100515814 | 3300005564 | Bacteria | 1103 |
| 86 | Ga0068857_100112558 | 3300005577 | Unclassified | 2447 |
| 87 | Ga0068854_100000133 | 3300005578 | Bacteria | 51376 |
| 88 | Ga0068854_100002063 | 3300005578 | Bacteria | 12308 |
| 89 | Ga0068856_100000369 | 3300005614 | Bacteria | 49419 |
| 90 | Ga0068856_100002525 | 3300005614 | Bacteria | 18856 |
| 91 | Ga0068856_100063621 | 3300005614 | Bacteria | 3645 |
| 92 | Ga0068852_100000024 | 3300005616 | Bacteria | 120479 |
| 93 | Ga0068852_100007178 | 3300005616 | Bacteria | 8121 |
| 94 | Ga0068852_100179703 | 3300005616 | Bacteria | 1989 |
| 95 | Ga0068859_100382368 | 3300005617 | Bacteria | 1503 |
| 96 | Ga0068859_100864701 | 3300005617 | Bacteria | 990 |
| 97 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 98 | Ga0068864_100803145 | 3300005618 | Unclassified | 925 |
| 99 | Ga0068866_10000007 | 3300005718 | Bacteria | 121729 |
| 100 | Ga0068866_10000220 | 3300005718 | Bacteria | 27117 |
| 101 | Ga0068866_10028076 | 3300005718 | Bacteria | 2678 |
| 102 | Ga0068866_10090266 | 3300005718 | Bacteria | 1667 |
| 103 | Ga0068861_100466090 | 3300005719 | Bacteria | 1135 |
| 104 | Ga0068861_101013713 | 3300005719 | Unclassified | 793 |
| 105 | Ga0068851_10004687 | 3300005834 | Bacteria | 6181 |
| 106 | Ga0068851_10115479 | 3300005834 | Bacteria | 1438 |
| 107 | Ga0068863_100000110 | 3300005841 | Bacteria | 86415 |
| 108 | Ga0068863_100015825 | 3300005841 | Bacteria | 7236 |
| 109 | Ga0068863_100136020 | 3300005841 | Bacteria | 2348 |
| 110 | Ga0068858_100000150 | 3300005842 | Bacteria | 73075 |
| 111 | Ga0068860_100003597 | 3300005843 | Bacteria | 15930 |
| 112 | Ga0068860_100120198 | 3300005843 | Bacteria | 2515 |
| 113 | Ga0068860_100154142 | 3300005843 | Bacteria | 2214 |
| 114 | Ga0068860_100168975 | 3300005843 | Unclassified | 2112 |
| 115 | Ga0068862_100010696 | 3300005844 | Bacteria | 7577 |
| 116 | Ga0068862_100563515 | 3300005844 | Bacteria | 1089 |
| 117 | Ga0081455_10002533 | 3300005937 | Bacteria | 21714 |
| 118 | Ga0081455_10021062 | 3300005937 | Bacteria | 6122 |
| 119 | Ga0081455_10043091 | 3300005937 | Bacteria | 3953 |
| 120 | Ga0081455_10367227 | 3300005937 | Bacteria | 1010 |
| 121 | Ga0081538_10000034 | 3300005981 | Bacteria | 120557 |
| 122 | Ga0081538_10055616 | 3300005981 | Bacteria | 2327 |
| 123 | Ga0081540_1000435 | 3300005983 | Bacteria | 41191 |
| 124 | Ga0081539_10001052 | 3300005985 | Bacteria | 50554 |
| 125 | Ga0081539_10054756 | 3300005985 | Bacteria | 2224 |
| 126 | Ga0075365_10000722 | 3300006038 | Bacteria | 13367 |
| 127 | Ga0075365_10001081 | 3300006038 | Bacteria | 11830 |
| 128 | Ga0075365_10020147 | 3300006038 | Bacteria | 4130 |
| 129 | Ga0075365_10331469 | 3300006038 | Bacteria | 1072 |
| 130 | Ga0075365_10333096 | 3300006038 | Bacteria | 1069 |
| 131 | Ga0075368_10083724 | 3300006042 | Bacteria | 1300 |
| 132 | Ga0075363_100012920 | 3300006048 | Bacteria | 4032 |
| 133 | Ga0075363_100083218 | 3300006048 | Bacteria | 1753 |
| 134 | Ga0075363_100101017 | 3300006048 | Unclassified | 1596 |
| 135 | Ga0075364_10002834 | 3300006051 | Bacteria | 9763 |
| 136 | Ga0075364_10072097 | 3300006051 | Unclassified | 2276 |
| 137 | Ga0075364_10090037 | 3300006051 | Archaea | 2035 |
| 138 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 139 | Ga0070715_10308787 | 3300006163 | Bacteria | 849 |
| 140 | Ga0070716_100505659 | 3300006173 | Bacteria | 892 |
| 141 | Ga0070712_100007464 | 3300006175 | Bacteria | 6826 |
| 142 | Ga0075367_10011862 | 3300006178 | Bacteria | 4628 |
| 143 | Ga0075367_10157222 | 3300006178 | Bacteria | 1413 |
| 144 | Ga0075428_100155458 | 3300006844 | Unclassified | 2485 |
| 145 | Ga0075430_100057762 | 3300006846 | Bacteria | 3263 |
| 146 | Ga0075430_100142504 | 3300006846 | Bacteria | 1996 |
| 147 | Ga0075431_100011336 | 3300006847 | Bacteria | 8982 |
| 148 | Ga0075431_100019643 | 3300006847 | Bacteria | 6893 |
| 149 | Ga0075431_100487984 | 3300006847 | Bacteria | 1224 |
| 150 | Ga0075431_100674159 | 3300006847 | Unclassified | 1013 |
| 151 | Ga0075433_10001846 | 3300006852 | Bacteria | 15916 |
| 152 | Ga0075433_10004595 | 3300006852 | Bacteria | 10768 |
| 153 | Ga0075429_100216894 | 3300006880 | Bacteria | 1676 |
| 154 | Ga0068865_100000024 | 3300006881 | Bacteria | 94969 |
| 155 | Ga0068865_100016376 | 3300006881 | Bacteria | 4743 |
| 156 | Ga0068865_100403410 | 3300006881 | Bacteria | 1120 |
| 157 | Ga0075436_100207673 | 3300006914 | Bacteria | 1388 |
| 158 | Ga0097620_100382350 | 3300006931 | Bacteria | 1503 |
| 159 | Ga0097620_100864802 | 3300006931 | Bacteria | 990 |
| 160 | Ga0075435_100011075 | 3300007076 | Bacteria | 6613 |
| 161 | Ga0075435_100297381 | 3300007076 | Unclassified | 1380 |
| 162 | Ga0111539_10037181 | 3300009094 | Bacteria | 5881 |
| 163 | Ga0111539_10046828 | 3300009094 | Bacteria | 5171 |
| 164 | Ga0111539_10200553 | 3300009094 | Unclassified | 2327 |
| 165 | Ga0105245_10000022 | 3300009098 | Bacteria | 181225 |
| 166 | Ga0105245_10001022 | 3300009098 | Bacteria | 25406 |
| 167 | Ga0105245_10001178 | 3300009098 | Bacteria | 23683 |
| 168 | Ga0105245_10003348 | 3300009098 | Bacteria | 14381 |
| 169 | Ga0105245_10049393 | 3300009098 | Bacteria | 3767 |
| 170 | Ga0105245_10508668 | 3300009098 | Bacteria | 1221 |
| 171 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 172 | Ga0105247_10080478 | 3300009101 | Bacteria | 2052 |
| 173 | Ga0105247_10094102 | 3300009101 | Bacteria | 1906 |
| 174 | Ga0105247_10133546 | 3300009101 | Unclassified | 1620 |
| 175 | Ga0114129_10147910 | 3300009147 | Bacteria | 3217 |
| 176 | Ga0114129_10152901 | 3300009147 | Bacteria | 3157 |
| 177 | Ga0114129_10171735 | 3300009147 | Bacteria | 2955 |
| 178 | Ga0105243_10002021 | 3300009148 | Bacteria | 17237 |
| 179 | Ga0105243_10007304 | 3300009148 | Bacteria | 8494 |
| 180 | Ga0105243_10067333 | 3300009148 | Bacteria | 2882 |
| 181 | Ga0105243_10256601 | 3300009148 | Bacteria | 1564 |
| 182 | Ga0105242_10000589 | 3300009176 | Bacteria | 28679 |
| 183 | Ga0105242_10252193 | 3300009176 | Bacteria | 1590 |
| 184 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 185 | Ga0105248_10198412 | 3300009177 | Bacteria | 2261 |
| 186 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 187 | Ga0105238_10118685 | 3300009551 | Bacteria | 2625 |
| 188 | Ga0105238_10930040 | 3300009551 | Bacteria | 889 |
| 189 | Ga0105249_10000181 | 3300009553 | Bacteria | 73946 |
| 190 | Ga0105249_10006903 | 3300009553 | Bacteria | 9898 |
| 191 | Ga0105249_10034423 | 3300009553 | Bacteria | 4591 |
| 192 | Ga0105249_10106918 | 3300009553 | Bacteria | 2640 |
| 193 | Ga0105249_10493319 | 3300009553 | Bacteria | 1269 |
| 194 | Ga0105249_10568406 | 3300009553 | Bacteria | 1186 |
| 195 | Ga0105249_11336381 | 3300009553 | Bacteria | 788 |
| 196 | Ga0105239_10116111 | 3300010375 | Bacteria | 2970 |
| 197 | Ga0105239_10600484 | 3300010375 | Bacteria | 1255 |
| 198 | Ga0105246_10084526 | 3300011119 | Bacteria | 2271 |
| 199 | Ga0105246_10436146 | 3300011119 | Bacteria | 1097 |
| 200 | Ga0157373_10305287 | 3300013100 | Bacteria | 1130 |
| 201 | Ga0157371_10017407 | 3300013102 | Bacteria | 5340 |
| 202 | Ga0157370_10043875 | 3300013104 | Bacteria | 4301 |
| 203 | Ga0157370_10073991 | 3300013104 | Bacteria | 3214 |
| 204 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 205 | Ga0157374_10001959 | 3300013296 | Bacteria | 17273 |
| 206 | Ga0157374_10078656 | 3300013296 | Bacteria | 3124 |
| 207 | Ga0157374_10354777 | 3300013296 | Unclassified | 1458 |
| 208 | Ga0157374_10440350 | 3300013296 | Bacteria | 1304 |
| 209 | Ga0157378_10000656 | 3300013297 | Bacteria | 32583 |
| 210 | Ga0157378_10078777 | 3300013297 | Bacteria | 2973 |
| 211 | Ga0157378_10718065 | 3300013297 | Bacteria | 1020 |
| 212 | Ga0163162_10371032 | 3300013306 | Bacteria | 1564 |
| 213 | Ga0157372_10001135 | 3300013307 | Bacteria | 28936 |
| 214 | Ga0157372_11093296 | 3300013307 | Unclassified | 922 |
| 215 | Ga0157375_10000126 | 3300013308 | Bacteria | 75410 |
| 216 | Ga0157375_10001522 | 3300013308 | Bacteria | 19958 |
| 217 | Ga0157375_10029588 | 3300013308 | Bacteria | 5154 |
| 218 | Ga0157375_10041147 | 3300013308 | Bacteria | 4460 |
| 219 | Ga0157375_10805836 | 3300013308 | Bacteria | 1088 |
| 220 | Ga0163163_10569231 | 3300014325 | Bacteria | 1196 |
| 221 | Ga0163163_11218762 | 3300014325 | Unclassified | 815 |
| 222 | Ga0157380_10000326 | 3300014326 | Bacteria | 28781 |
| 223 | Ga0157380_10000403 | 3300014326 | Bacteria | 26163 |
| 224 | Ga0157380_10009902 | 3300014326 | Bacteria | 6842 |
| 225 | Ga0157377_10022224 | 3300014745 | Bacteria | 3346 |
| 226 | Ga0157379_10052910 | 3300014968 | Bacteria | 3627 |
| 227 | Ga0157379_10194157 | 3300014968 | Bacteria | 1835 |
| 228 | Ga0157379_10212625 | 3300014968 | Bacteria | 1751 |
| 229 | Ga0157379_10286295 | 3300014968 | Bacteria | 1500 |
| 230 | Ga0157376_10013349 | 3300014969 | Bacteria | 6128 |
| 231 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 232 | Ga0163161_10016346 | 3300017792 | Bacteria | 5179 |
| 233 | Ga0207656_10000399 | 3300025321 | Bacteria | 14571 |
| 234 | Ga0207656_10094055 | 3300025321 | Bacteria | 1365 |
| 235 | Ga0207682_10000327 | 3300025893 | Bacteria | 21656 |
| 236 | Ga0207642_10000008 | 3300025899 | Bacteria | 132651 |
| 237 | Ga0207642_10000689 | 3300025899 | Bacteria | 10418 |
| 238 | Ga0207710_10000165 | 3300025900 | Bacteria | 69714 |
| 239 | Ga0207688_10030450 | 3300025901 | Bacteria | 2975 |
| 240 | Ga0207680_10002295 | 3300025903 | Bacteria | 8915 |
| 241 | Ga0207680_10017470 | 3300025903 | Bacteria | 3792 |
| 242 | Ga0207680_10037141 | 3300025903 | Bacteria | 2810 |
| 243 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 244 | Ga0207705_10163640 | 3300025909 | Bacteria | 1672 |
| 245 | Ga0207707_10109650 | 3300025912 | Bacteria | 2413 |
| 246 | Ga0207707_10296001 | 3300025912 | Bacteria | 1400 |
| 247 | Ga0207671_10168003 | 3300025914 | Bacteria | 1702 |
| 248 | Ga0207693_10008752 | 3300025915 | Bacteria | 8273 |
| 249 | Ga0207693_10008877 | 3300025915 | Bacteria | 8212 |
| 250 | Ga0207693_10239386 | 3300025915 | Bacteria | 1425 |
| 251 | Ga0207663_10008156 | 3300025916 | Bacteria | 5461 |
| 252 | Ga0207663_10009286 | 3300025916 | Bacteria | 5189 |
| 253 | Ga0207660_10081268 | 3300025917 | Bacteria | 2381 |
| 254 | Ga0207660_10145019 | 3300025917 | Bacteria | 1819 |
| 255 | Ga0207660_10662948 | 3300025917 | Bacteria | 851 |
| 256 | Ga0207662_10164008 | 3300025918 | Bacteria | 1421 |
| 257 | Ga0207657_10005356 | 3300025919 | Bacteria | 13440 |
| 258 | Ga0207649_10000166 | 3300025920 | Bacteria | 53758 |
| 259 | Ga0207652_10000242 | 3300025921 | Bacteria | 56966 |
| 260 | Ga0207652_10000437 | 3300025921 | Bacteria | 43281 |
| 261 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 262 | Ga0207694_10133940 | 3300025924 | Bacteria | 1988 |
| 263 | Ga0207650_10095204 | 3300025925 | Bacteria | 2283 |
| 264 | Ga0207659_10000138 | 3300025926 | Bacteria | 42755 |
| 265 | Ga0207659_10013476 | 3300025926 | Bacteria | 5238 |
| 266 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 267 | Ga0207687_10000039 | 3300025927 | Bacteria | 114303 |
| 268 | Ga0207687_10000132 | 3300025927 | Bacteria | 50024 |
| 269 | Ga0207687_10029007 | 3300025927 | Bacteria | 3719 |
| 270 | Ga0207687_10253986 | 3300025927 | Bacteria | 1399 |
| 271 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 272 | Ga0207644_10045909 | 3300025931 | Bacteria | 3110 |
| 273 | Ga0207690_10002070 | 3300025932 | Bacteria | 12292 |
| 274 | Ga0207690_10003853 | 3300025932 | Bacteria | 8869 |
| 275 | Ga0207706_10000137 | 3300025933 | Bacteria | 79758 |
| 276 | Ga0207706_10018044 | 3300025933 | Bacteria | 6349 |
| 277 | Ga0207686_10002761 | 3300025934 | Bacteria | 9511 |
| 278 | Ga0207686_10163451 | 3300025934 | Bacteria | 1563 |
| 279 | Ga0207686_10321111 | 3300025934 | Bacteria | 1157 |
| 280 | Ga0207709_10008448 | 3300025935 | Bacteria | 5696 |
| 281 | Ga0207709_10074071 | 3300025935 | Bacteria | 2171 |
| 282 | Ga0207709_10084855 | 3300025935 | Bacteria | 2051 |
| 283 | Ga0207709_10202872 | 3300025935 | Bacteria | 1417 |
| 284 | Ga0207670_10042755 | 3300025936 | Bacteria | 2988 |
| 285 | Ga0207670_10080833 | 3300025936 | Bacteria | 2273 |
| 286 | Ga0207670_10086521 | 3300025936 | Bacteria | 2206 |
| 287 | Ga0207669_10000032 | 3300025937 | Bacteria | 82757 |
| 288 | Ga0207669_10000091 | 3300025937 | Bacteria | 45833 |
| 289 | Ga0207669_10036052 | 3300025937 | Bacteria | 2822 |
| 290 | Ga0207704_10000054 | 3300025938 | Bacteria | 79155 |
| 291 | Ga0207704_10007544 | 3300025938 | Bacteria | 5146 |
| 292 | Ga0207704_10179115 | 3300025938 | Bacteria | 1530 |
| 293 | Ga0207691_10000871 | 3300025940 | Bacteria | 30024 |
| 294 | Ga0207691_10101984 | 3300025940 | Bacteria | 2560 |
| 295 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 296 | Ga0207661_10011259 | 3300025944 | Bacteria | 6473 |
| 297 | Ga0207661_10013754 | 3300025944 | Bacteria | 5910 |
| 298 | Ga0207661_10172475 | 3300025944 | Bacteria | 1883 |
| 299 | Ga0207661_10501217 | 3300025944 | Unclassified | 1109 |
| 300 | Ga0207661_10506325 | 3300025944 | Unclassified | 1103 |
| 301 | Ga0207679_10069800 | 3300025945 | Bacteria | 2645 |
| 302 | Ga0207679_10286039 | 3300025945 | Bacteria | 1416 |
| 303 | Ga0207667_10533547 | 3300025949 | Bacteria | 1188 |
| 304 | Ga0207651_10003068 | 3300025960 | Bacteria | 8109 |
| 305 | Ga0207712_10000067 | 3300025961 | Bacteria | 130079 |
| 306 | Ga0207712_10007677 | 3300025961 | Bacteria | 6821 |
| 307 | Ga0207712_10175846 | 3300025961 | Bacteria | 1677 |
| 308 | Ga0207668_10031591 | 3300025972 | Bacteria | 3489 |
| 309 | Ga0207640_10000147 | 3300025981 | Bacteria | 51462 |
| 310 | Ga0207658_10003743 | 3300025986 | Bacteria | 10711 |
| 311 | Ga0207658_10004686 | 3300025986 | Bacteria | 9477 |
| 312 | Ga0207677_10000903 | 3300026023 | Bacteria | 16635 |
| 313 | Ga0207677_10208902 | 3300026023 | Bacteria | 1557 |
| 314 | Ga0207703_10000070 | 3300026035 | Bacteria | 123480 |
| 315 | Ga0207703_10000122 | 3300026035 | Bacteria | 92656 |
| 316 | Ga0207703_10034693 | 3300026035 | Bacteria | 4005 |
| 317 | Ga0207703_10372524 | 3300026035 | Bacteria | 1319 |
| 318 | Ga0207639_10005680 | 3300026041 | Bacteria | 8440 |
| 319 | Ga0207639_10249960 | 3300026041 | Bacteria | 1546 |
| 320 | Ga0207639_10615519 | 3300026041 | Unclassified | 1002 |
| 321 | Ga0207678_10005860 | 3300026067 | Bacteria | 10955 |
| 322 | Ga0207678_10008898 | 3300026067 | Bacteria | 8837 |
| 323 | Ga0207708_10002304 | 3300026075 | Bacteria | 14042 |
| 324 | Ga0207708_10035998 | 3300026075 | Bacteria | 3767 |
| 325 | Ga0207708_10069224 | 3300026075 | Bacteria | 2702 |
| 326 | Ga0207708_10119320 | 3300026075 | Bacteria | 2054 |
| 327 | Ga0207702_10000557 | 3300026078 | Bacteria | 41471 |
| 328 | Ga0207702_10008754 | 3300026078 | Bacteria | 8533 |
| 329 | Ga0207702_10011625 | 3300026078 | Bacteria | 7334 |
| 330 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 331 | Ga0207641_10012714 | 3300026088 | Bacteria | 6901 |
| 332 | Ga0207641_10054404 | 3300026088 | Bacteria | 3396 |
| 333 | Ga0207648_10004608 | 3300026089 | Bacteria | 14135 |
| 334 | Ga0207648_10005283 | 3300026089 | Bacteria | 13032 |
| 335 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 336 | Ga0207674_10082436 | 3300026116 | Bacteria | 3217 |
| 337 | Ga0207675_100142208 | 3300026118 | Bacteria | 2280 |
| 338 | Ga0207675_100518531 | 3300026118 | Bacteria | 1188 |
| 339 | Ga0207683_10026953 | 3300026121 | Bacteria | 4966 |
| 340 | Ga0207683_10056797 | 3300026121 | Bacteria | 3435 |
| 341 | Ga0207683_10089063 | 3300026121 | Bacteria | 2746 |
| 342 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 343 | Ga0207428_10007473 | 3300027907 | Bacteria | 9962 |
| 344 | Ga0207428_10339852 | 3300027907 | Unclassified | 1106 |
| 345 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 346 | Ga0268266_10000973 | 3300028379 | Bacteria | 36388 |
| 347 | Ga0268266_10002641 | 3300028379 | Bacteria | 18887 |
| 348 | Ga0268266_10038476 | 3300028379 | Bacteria | 4072 |
| 349 | Ga0268266_10773598 | 3300028379 | Bacteria | 927 |
| 350 | Ga0268265_10017817 | 3300028380 | Bacteria | 4910 |
| 351 | Ga0268264_10002647 | 3300028381 | Bacteria | 15644 |
| 352 | Ga0268264_10044924 | 3300028381 | Bacteria | 3667 |
| 353 | Ga0268264_10085791 | 3300028381 | Bacteria | 2703 |
| 354 | Ga0268264_10277561 | 3300028381 | Bacteria | 1568 |
| 355 | Ga0265337_1000112 | 3300028556 | Bacteria | 41114 |
| 356 | Ga0265326_10000040 | 3300028558 | Bacteria | 85624 |
| 357 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 358 | Ga0265322_10000012 | 3300028654 | Bacteria | 152373 |
| 359 | Ga0265336_10005375 | 3300028666 | Bacteria | 4732 |
| 360 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 361 | Ga0265324_10000202 | 3300029957 | Bacteria | 45480 |
| 362 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 363 | Ga0265329_10008221 | 3300031242 | Bacteria | 3972 |
| 364 | Ga0265331_10001236 | 3300031250 | Bacteria | 19167 |
| 365 | Ga0265331_10009016 | 3300031250 | Bacteria | 5637 |
| 366 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 367 | Ga0265316_10063543 | 3300031344 | Bacteria | 2862 |
| 368 | Ga0265314_10000178 | 3300031711 | Bacteria | 94070 |
| 369 | Ga0265342_10131138 | 3300031712 | Bacteria | 1404 |
| 370 | Ga0316574_0052662 | 3300035398 | Bacteria | 2539 |
| 371 | Ga0373937_0006290 | 3300036401 | Bacteria | 10239 |
| 372 | Ga0395898_0026087 | 3300037466 | Bacteria | 5883 |
| 373 | Ga0395898_0161389 | 3300037466 | Bacteria | 2144 |
| 374 | Ga0395898_0173287 | 3300037466 | Unclassified | 2062 |
| 375 | Ga0395905_0015772 | 3300037471 | Bacteria | 7177 |
| 376 | Ga0395905_0430491 | 3300037471 | Bacteria | 1216 |
| 377 | Ga0395905_0682486 | 3300037471 | Unclassified | 929 |
| 378 | Ga0395901_0028155 | 3300038443 | Bacteria | 5780 |
| 379 | Ga0395901_0036480 | 3300038443 | Bacteria | 5082 |
| 380 | Ga0395901_0162803 | 3300038443 | Unclassified | 2343 |
| 381 | Ga0395901_0165531 | 3300038443 | Bacteria | 2322 |
| 382 | Ga0451807_2152006 | 3300041486 | Bacteria | 1343 |
| 383 | Ga0451839_1478570 | 3300041496 | Bacteria | 1649 |
| 384 | Ga0451847_0664677 | 3300041503 | Bacteria | 821 |
| 385 | Ga0451853_0220151 | 3300041512 | Bacteria | 8742 |
| 386 | Ga0451853_0313996 | 3300041512 | Bacteria | 1984 |
| 387 | Ga0451853_1765258 | 3300041512 | Bacteria | 1384 |
| 388 | Ga0466963_0008734 | 3300044694 | Bacteria | 6083 |
| 389 | Ga0466964_0046096 | 3300044706 | Bacteria | 1776 |
| 390 | Ga0466957_0000193 | 3300044842 | Bacteria | 28057 |
| 391 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 392 | Ga0466967_0011027 | 3300045976 | Bacteria | 6819 |
| 393 | Ga0466967_0015892 | 3300045976 | Bacteria | 5916 |
| 394 | Ga0495592_0000752 | 3300046454 | Bacteria | 22576 |
| 395 | Ga0495592_0076093 | 3300046454 | Bacteria | 2436 |
| 396 | Ga0495592_0272470 | 3300046454 | Bacteria | 1110 |
| 397 | Ga0495592_0398294 | 3300046454 | Bacteria | 872 |
| 398 | Ga0495603_0011119 | 3300046455 | Bacteria | 5456 |
| 399 | Ga0495603_0014198 | 3300046455 | Bacteria | 4819 |
| 400 | Ga0495629_0000789 | 3300046459 | Bacteria | 25574 |
| 401 | Ga0495629_0022877 | 3300046459 | Bacteria | 4454 |
| 402 | Ga0495629_0044352 | 3300046459 | Bacteria | 3121 |
| 403 | Ga0495629_0100201 | 3300046459 | Unclassified | 2022 |
| 404 | Ga0495629_0244927 | 3300046459 | Bacteria | 1234 |
| 405 | Ga0495629_0295508 | 3300046459 | Bacteria | 1110 |
| 406 | Ga0495638_0095073 | 3300046460 | Bacteria | 1790 |
| 407 | Ga0495641_0000010 | 3300046461 | Bacteria | 158798 |
| 408 | Ga0495641_0005514 | 3300046461 | Bacteria | 8509 |
| 409 | Ga0495641_0063820 | 3300046461 | Bacteria | 1659 |
| 410 | Ga0495641_0132546 | 3300046461 | Bacteria | 1112 |
| 411 | Ga0495651_0134141 | 3300046462 | Unclassified | 1804 |
| 412 | Ga0495653_0088276 | 3300046463 | Unclassified | 2275 |
| 413 | Ga0495653_0134943 | 3300046463 | Bacteria | 1742 |
| 414 | Ga0495582_0000006 | 3300046473 | Bacteria | 140434 |
| 415 | Ga0495639_0038123 | 3300046475 | Bacteria | 2157 |
| 416 | Ga0495662_0000212 | 3300046476 | Bacteria | 24249 |
| 417 | Ga0495662_0066891 | 3300046476 | Bacteria | 1738 |
| 418 | Ga0495664_0177973 | 3300046477 | Bacteria | 1290 |
| 419 | Ga0495584_0285631 | 3300046491 | Unclassified | 838 |
| 420 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 421 | Ga0495596_0085654 | 3300046500 | Unclassified | 1223 |
| 422 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 423 | Ga0495608_0000906 | 3300046511 | Bacteria | 20783 |
| 424 | Ga0495608_0000961 | 3300046511 | Bacteria | 20346 |
| 425 | Ga0495608_0016325 | 3300046511 | Bacteria | 5137 |
| 426 | Ga0495608_0040410 | 3300046511 | Bacteria | 3125 |
| 427 | Ga0495618_0134981 | 3300046514 | Bacteria | 1579 |
| 428 | Ga0495620_0001375 | 3300046515 | Bacteria | 14659 |
| 429 | Ga0495628_0002123 | 3300046516 | Bacteria | 17950 |
| 430 | Ga0495628_0051337 | 3300046516 | Bacteria | 3261 |
| 431 | Ga0495628_0052940 | 3300046516 | Bacteria | 3205 |
| 432 | Ga0495628_0099294 | 3300046516 | Bacteria | 2248 |
| 433 | Ga0495628_0101679 | 3300046516 | Bacteria | 2218 |
| 434 | Ga0495628_0231255 | 3300046516 | Bacteria | 1386 |
| 435 | Ga0495628_0284815 | 3300046516 | Bacteria | 1226 |
| 436 | Ga0495630_0000148 | 3300046517 | Bacteria | 54619 |
| 437 | Ga0495630_0003200 | 3300046517 | Bacteria | 11386 |
| 438 | Ga0495630_0017766 | 3300046517 | Bacteria | 5215 |
| 439 | Ga0495644_0046136 | 3300046523 | Bacteria | 1638 |
| 440 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 441 | Ga0495652_0018702 | 3300046529 | Bacteria | 6176 |
| 442 | Ga0495640_0029026 | 3300046533 | Bacteria | 3976 |
| 443 | Ga0495640_0256084 | 3300046533 | Bacteria | 1095 |
| 444 | Ga0495586_0439508 | 3300046535 | Bacteria | 752 |
| 445 | Ga0495587_0002768 | 3300046536 | Bacteria | 11704 |
| 446 | Ga0495587_0122209 | 3300046536 | Bacteria | 1491 |
| 447 | Ga0495587_0316785 | 3300046536 | Unclassified | 871 |
| 448 | Ga0495587_0363098 | 3300046536 | Bacteria | 806 |
| 449 | Ga0495645_0003129 | 3300046543 | Bacteria | 11212 |
| 450 | Ga0495645_0005828 | 3300046543 | Bacteria | 8501 |
| 451 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 452 | Ga0495667_0000067 | 3300046559 | Bacteria | 81751 |
| 453 | Ga0495667_0162667 | 3300046559 | Bacteria | 1435 |
| 454 | Ga0495656_0000217 | 3300046615 | Bacteria | 20479 |
| 455 | Ga0495668_0262150 | 3300046616 | Bacteria | 946 |
| 456 | Ga0495634_0000021 | 3300046642 | Bacteria | 120521 |
| 457 | Ga0495634_0000590 | 3300046642 | Bacteria | 35246 |
| 458 | Ga0495634_0002438 | 3300046642 | Bacteria | 15444 |
| 459 | Ga0495634_0031586 | 3300046642 | Bacteria | 3646 |
| 460 | Ga0495634_0042878 | 3300046642 | Bacteria | 3068 |
| 461 | Ga0495634_0064324 | 3300046642 | Bacteria | 2432 |
| 462 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 463 | Ga0495625_0146471 | 3300046660 | Bacteria | 1590 |
| 464 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 465 | Ga0495635_0011707 | 3300046663 | Bacteria | 6151 |
| 466 | Ga0495635_0159165 | 3300046663 | Bacteria | 1537 |
| 467 | Ga0495635_0214121 | 3300046663 | Bacteria | 1304 |
| 468 | Ga0495588_0000175 | 3300046674 | Bacteria | 80911 |
| 469 | Ga0495657_0001466 | 3300046675 | Bacteria | 20346 |
| 470 | Ga0495657_0048746 | 3300046675 | Bacteria | 2856 |
| 471 | Ga0495657_0055478 | 3300046675 | Bacteria | 2642 |
| 472 | Ga0495599_0030763 | 3300046678 | Bacteria | 3370 |
| 473 | Ga0495599_0108835 | 3300046678 | Bacteria | 1727 |
| 474 | Ga0495647_0000002 | 3300046681 | Bacteria | 174959 |
| 475 | Ga0495647_0001404 | 3300046681 | Bacteria | 7428 |
| 476 | Ga0495647_0002225 | 3300046681 | Bacteria | 6074 |
| 477 | Ga0495647_0031177 | 3300046681 | Bacteria | 1982 |
| 478 | Ga0495658_0000027 | 3300046683 | Bacteria | 74322 |
| 479 | Ga0495658_0022546 | 3300046683 | Bacteria | 3330 |
| 480 | Ga0495669_0000132 | 3300046684 | Bacteria | 47843 |
| 481 | Ga0495613_0000287 | 3300046689 | Bacteria | 46716 |
| 482 | Ga0495624_0000005 | 3300046690 | Bacteria | 158127 |
| 483 | Ga0495624_0001686 | 3300046690 | Bacteria | 16921 |
| 484 | Ga0495624_0035583 | 3300046690 | Bacteria | 3215 |
| 485 | Ga0495600_0002327 | 3300046809 | Bacteria | 10835 |
| 486 | Ga0495600_0390129 | 3300046809 | Unclassified | 868 |
| 487 | Ga0495604_0000636 | 3300047317 | Bacteria | 30130 |
| 488 | Ga0495604_0039842 | 3300047317 | Bacteria | 3691 |
| 489 | Ga0495604_0047775 | 3300047317 | Bacteria | 3332 |
| 490 | Ga0495604_0065241 | 3300047317 | Bacteria | 2772 |
| 491 | Ga0495674_0000141 | 3300047319 | Bacteria | 55539 |
| 492 | Ga0495674_0285269 | 3300047319 | Bacteria | 1352 |
| 493 | Ga0495672_0063182 | 3300047320 | Bacteria | 2126 |
| 494 | Ga0495672_0157138 | 3300047320 | Unclassified | 1173 |
| 495 | Ga0495676_0000209 | 3300047321 | Bacteria | 46557 |
| 496 | Ga0495676_0003630 | 3300047321 | Bacteria | 14001 |
| 497 | Ga0495676_0156171 | 3300047321 | Bacteria | 1618 |
| 498 | Ga0495676_0170705 | 3300047321 | Bacteria | 1531 |
| 499 | Ga0495680_0000541 | 3300047322 | Bacteria | 42487 |
| 500 | Ga0495680_0009424 | 3300047322 | Bacteria | 8781 |
| 501 | Ga0495680_0010471 | 3300047322 | Bacteria | 8274 |
| 502 | Ga0495680_0417123 | 3300047322 | Bacteria | 924 |
| 503 | Ga0495675_0000744 | 3300047444 | Bacteria | 20346 |
| 504 | Ga0495679_007935 | 3300047446 | Bacteria | 4369 |
| 505 | Ga0495673_0102879 | 3300047469 | Bacteria | 1152 |
| 506 | Ga0495684_0336272 | 3300047471 | Bacteria | 1076 |
| 507 | Ga0495684_0456242 | 3300047471 | Bacteria | 887 |
| 508 | Ga0495593_0144565 | 3300047673 | Bacteria | 1204 |
| 509 | Ga0495602_0000038 | 3300048088 | Bacteria | 130758 |
| 510 | Ga0495602_0002031 | 3300048088 | Bacteria | 20359 |
| 511 | Ga0495602_0320626 | 3300048088 | Bacteria | 1128 |
| 512 | Ga0495614_0068148 | 3300048089 | Bacteria | 1532 |
| 513 | Ga0495614_0154143 | 3300048089 | Bacteria | 1026 |
| 514 | Ga0496100_0000006 | 3300048903 | Bacteria | 297429 |
| 515 | Ga0496100_0000028 | 3300048903 | Bacteria | 113912 |
| 516 | Ga0496100_0129393 | 3300048903 | Bacteria | 1776 |
| 517 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 518 | Ga0496101_0000009 | 3300048904 | Bacteria | 297429 |
| 519 | Ga0496101_0053863 | 3300048904 | Bacteria | 2904 |
| 520 | Ga0496101_0135816 | 3300048904 | Bacteria | 1871 |
| 521 | Ga0496101_0271136 | 3300048904 | Unclassified | 1325 |
| 522 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 523 | Ga0496102_0002673 | 3300048905 | Bacteria | 15162 |
| 524 | Ga0496102_0096157 | 3300048905 | Bacteria | 2746 |
| 525 | Ga0496102_0237758 | 3300048905 | Bacteria | 1718 |
| 526 | Ga0496102_0255827 | 3300048905 | Bacteria | 1651 |
| 527 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 528 | Ga0496103_0023977 | 3300048906 | Bacteria | 3681 |
| 529 | Ga0496103_0029172 | 3300048906 | Bacteria | 3352 |
| 530 | Ga0496103_0102441 | 3300048906 | Bacteria | 1813 |
| 531 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 532 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 533 | Ga0496104_0000214 | 3300048907 | Bacteria | 51141 |
| 534 | Ga0496104_0052830 | 3300048907 | Bacteria | 3838 |
| 535 | Ga0496104_0927460 | 3300048907 | Bacteria | 775 |
| 536 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 537 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 538 | Ga0496105_0001724 | 3300048908 | Bacteria | 15632 |
| 539 | Ga0496105_0017098 | 3300048908 | Bacteria | 5807 |
| 540 | Ga0496105_0019479 | 3300048908 | Bacteria | 5473 |
| 541 | Ga0496106_0000070 | 3300048909 | Bacteria | 82770 |
| 542 | Ga0496106_0000101 | 3300048909 | Bacteria | 65644 |
| 543 | Ga0496106_0000728 | 3300048909 | Bacteria | 23707 |
| 544 | Ga0496106_0319157 | 3300048909 | Bacteria | 1247 |
| 545 | Ga0496106_0425903 | 3300048909 | Bacteria | 1067 |
| 546 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 547 | Ga0496107_0000015 | 3300048910 | Bacteria | 173644 |
| 548 | Ga0496107_0022566 | 3300048910 | Bacteria | 4447 |
| 549 | Ga0496107_0026016 | 3300048910 | Bacteria | 4146 |
| 550 | Ga0496107_0090299 | 3300048910 | Unclassified | 2238 |
| 551 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 552 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 553 | Ga0496108_0000339 | 3300048911 | Bacteria | 39428 |
| 554 | Ga0496108_0006479 | 3300048911 | Bacteria | 9495 |
| 555 | Ga0496108_0018633 | 3300048911 | Bacteria | 5688 |
| 556 | Ga0496108_0196024 | 3300048911 | Bacteria | 1752 |
| 557 | Ga0496108_0340366 | 3300048911 | Bacteria | 1309 |
| 558 | Ga0496108_0670591 | 3300048911 | Unclassified | 900 |
| 559 | Ga0496108_0716586 | 3300048911 | Bacteria | 867 |
| 560 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 561 | Ga0496109_0000036 | 3300048912 | Bacteria | 153972 |
| 562 | Ga0496109_0000391 | 3300048912 | Bacteria | 39830 |
| 563 | Ga0496109_0001321 | 3300048912 | Bacteria | 20438 |
| 564 | Ga0496109_0054544 | 3300048912 | Bacteria | 3646 |
| 565 | Ga0496109_0064189 | 3300048912 | Bacteria | 3360 |
| 566 | Ga0496109_0226122 | 3300048912 | Bacteria | 1760 |
| 567 | Ga0496109_0325920 | 3300048912 | Unclassified | 1450 |
| 568 | Ga0496109_0375006 | 3300048912 | Bacteria | 1344 |
| 569 | Ga0496110_0000122 | 3300048913 | Bacteria | 43513 |
| 570 | Ga0496110_0014992 | 3300048913 | Bacteria | 6445 |
| 571 | Ga0496110_0018529 | 3300048913 | Bacteria | 5837 |
| 572 | Ga0496110_0121149 | 3300048913 | Bacteria | 2357 |
| 573 | Ga0496110_0122644 | 3300048913 | Bacteria | 2342 |
| 574 | Ga0496110_0179318 | 3300048913 | Bacteria | 1923 |
| 575 | Ga0496111_0000037 | 3300048914 | Bacteria | 52978 |
| 576 | Ga0496111_0010778 | 3300048914 | Bacteria | 6145 |
| 577 | Ga0496111_0024519 | 3300048914 | Bacteria | 4249 |
| 578 | Ga0496111_0031656 | 3300048914 | Bacteria | 3769 |
| 579 | Ga0496111_0212970 | 3300048914 | Bacteria | 1435 |
| 580 | Ga0496111_0328953 | 3300048914 | Bacteria | 1131 |
| 581 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 582 | Ga0496112_0002000 | 3300048915 | Bacteria | 16136 |
| 583 | Ga0496112_0306431 | 3300048915 | Bacteria | 1533 |
| 584 | Ga0496112_0660596 | 3300048915 | Unclassified | 975 |
| 585 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 586 | Ga0496113_0031981 | 3300048916 | Bacteria | 3822 |
| 587 | Ga0496113_0062635 | 3300048916 | Bacteria | 2809 |
| 588 | Ga0496113_0101852 | 3300048916 | Bacteria | 2226 |
| 589 | Ga0496113_0294441 | 3300048916 | Unclassified | 1299 |
| 590 | Ga0496113_0599258 | 3300048916 | Bacteria | 882 |
| 591 | Ga0496114_0000097 | 3300048917 | Bacteria | 63410 |
| 592 | Ga0496114_0021651 | 3300048917 | Bacteria | 5232 |
| 593 | Ga0496114_0045364 | 3300048917 | Bacteria | 3651 |
| 594 | Ga0496114_0341724 | 3300048917 | Bacteria | 1324 |
| 595 | Ga0496114_0431426 | 3300048917 | Bacteria | 1167 |
| 596 | Ga0496114_0460846 | 3300048917 | Bacteria | 1125 |
| 597 | Ga0496114_0946699 | 3300048917 | Unclassified | 743 |
| 598 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 599 | Ga0496115_0000151 | 3300048918 | Bacteria | 64493 |
| 600 | Ga0496115_0007257 | 3300048918 | Bacteria | 8147 |
| 601 | Ga0496116_0000529 | 3300048919 | Bacteria | 51417 |
| 602 | Ga0496117_0009095 | 3300048920 | Bacteria | 9338 |
| 603 | Ga0496117_0111120 | 3300048920 | Bacteria | 1707 |
| 604 | Ga0496118_0004226 | 3300048921 | Bacteria | 17234 |
| 605 | Ga0496119_0000489 | 3300048922 | Bacteria | 54129 |
| 606 | Ga0496119_0032699 | 3300048922 | Bacteria | 3462 |
| 607 | Ga0496119_0062938 | 3300048922 | Bacteria | 2208 |
| 608 | Ga0496119_0074055 | 3300048922 | Bacteria | 1984 |
| 609 | Ga0496120_0025331 | 3300048923 | Bacteria | 3683 |
| 610 | Ga0496120_0117004 | 3300048923 | Bacteria | 1383 |
| 611 | Ga0496121_0020170 | 3300048924 | Bacteria | 6617 |
| 612 | Ga0496121_0035115 | 3300048924 | Bacteria | 4498 |
| 613 | Ga0496124_0243420 | 3300048927 | Bacteria | 1336 |
| 614 | Ga0496124_0308521 | 3300048927 | Unclassified | 1139 |
| 615 | Ga0496125_0037383 | 3300048928 | Bacteria | 4222 |
| 616 | Ga0496125_0055740 | 3300048928 | Bacteria | 3217 |
| 617 | Ga0496125_0126549 | 3300048928 | Bacteria | 1809 |
| 618 | Ga0496126_0019475 | 3300048929 | Bacteria | 6682 |
| 619 | Ga0496126_0048743 | 3300048929 | Bacteria | 3869 |
| 620 | Ga0496126_0206190 | 3300048929 | Bacteria | 1657 |
| 621 | Ga0501031_0000885 | 3300049568 | Bacteria | 18036 |
| 622 | Ga0501031_0129191 | 3300049568 | Bacteria | 1650 |
| 623 | Ga0501032_0000843 | 3300049569 | Bacteria | 24899 |
| 624 | Ga0501033_0001203 | 3300049570 | Bacteria | 23326 |
| 625 | Ga0501034_0004760 | 3300049571 | Bacteria | 15020 |
| 626 | Ga0501036_0000711 | 3300049572 | Bacteria | 24631 |
| 627 | Ga0501037_0000522 | 3300049573 | Bacteria | 30837 |
| 628 | Ga0501038_0105353 | 3300049574 | Bacteria | 2342 |
| 629 | Ga0501038_0191438 | 3300049574 | Bacteria | 1646 |
| 630 | Ga0501039_0013392 | 3300049575 | Bacteria | 6270 |
| 631 | Ga0501039_0056990 | 3300049575 | Bacteria | 3027 |
| 632 | Ga0501039_0248670 | 3300049575 | Bacteria | 1398 |
| 633 | Ga0501040_0118386 | 3300049576 | Bacteria | 1857 |
| 634 | Ga0501040_0475782 | 3300049576 | Bacteria | 900 |
| 635 | Ga0501041_0224172 | 3300049577 | Unclassified | 1180 |
| 636 | Ga0501042_0048889 | 3300049578 | Bacteria | 3016 |
| 637 | Ga0501042_0079610 | 3300049578 | Unclassified | 2348 |
| 638 | Ga0501042_0115026 | 3300049578 | Bacteria | 1937 |
| 639 | Ga0501042_0426975 | 3300049578 | Unclassified | 961 |
| 640 | Ga0501043_0004212 | 3300049579 | Bacteria | 11739 |
| 641 | Ga0501043_0669392 | 3300049579 | Bacteria | 761 |
| 642 | Ga0501046_0001261 | 3300049580 | Bacteria | 24516 |
| 643 | Ga0501046_0117959 | 3300049580 | Bacteria | 2022 |
| 644 | Ga0501047_0001310 | 3300049581 | Bacteria | 24535 |
| 645 | Ga0501047_0019766 | 3300049581 | Bacteria | 6464 |
| 646 | Ga0501048_0000689 | 3300049582 | Bacteria | 24553 |
| 647 | Ga0501048_0160508 | 3300049582 | Bacteria | 1591 |
| 648 | Ga0501067_0135061 | 3300049583 | Bacteria | 1373 |
| 649 | Ga0501068_0020879 | 3300049584 | Bacteria | 3822 |
| 650 | Ga0501068_0122344 | 3300049584 | Bacteria | 1623 |
| 651 | Ga0501069_0014034 | 3300049585 | Bacteria | 4279 |
| 652 | Ga0501069_0020680 | 3300049585 | Bacteria | 3567 |
| 653 | Ga0501070_0000267 | 3300049586 | Bacteria | 49167 |
| 654 | Ga0501070_0036301 | 3300049586 | Bacteria | 4116 |
| 655 | Ga0501070_0053280 | 3300049586 | Bacteria | 3356 |
| 656 | Ga0501070_0100623 | 3300049586 | Bacteria | 2391 |
| 657 | Ga0501070_0444584 | 3300049586 | Bacteria | 1045 |
| 658 | Ga0501072_0042532 | 3300049588 | Bacteria | 3568 |
| 659 | Ga0501072_0131714 | 3300049588 | Bacteria | 1993 |
| 660 | Ga0501072_0167095 | 3300049588 | Bacteria | 1755 |
| 661 | Ga0501072_0202595 | 3300049588 | Bacteria | 1582 |
| 662 | Ga0501072_0448722 | 3300049588 | Unclassified | 1022 |
| 663 | Ga0501073_0028060 | 3300049589 | Bacteria | 4021 |
| 664 | Ga0501074_0010332 | 3300049590 | Bacteria | 6772 |
| 665 | Ga0501074_0042104 | 3300049590 | Bacteria | 3305 |
| 666 | Ga0501074_0047438 | 3300049590 | Bacteria | 3105 |
| 667 | Ga0501074_0534396 | 3300049590 | Bacteria | 830 |
| 668 | Ga0501075_0004738 | 3300049591 | Bacteria | 9247 |
| 669 | Ga0501075_0008822 | 3300049591 | Bacteria | 7029 |
| 670 | Ga0501075_0514246 | 3300049591 | Bacteria | 914 |
| 671 | Ga0501075_0544439 | 3300049591 | Bacteria | 886 |
| 672 | Ga0501076_0034143 | 3300049592 | Bacteria | 3974 |
| 673 | Ga0501076_0151679 | 3300049592 | Bacteria | 1885 |
| 674 | Ga0501076_0381068 | 3300049592 | Bacteria | 1159 |
| 675 | Ga0501077_0206649 | 3300049593 | Bacteria | 1248 |
| 676 | Ga0501079_0208218 | 3300049741 | Bacteria | 1527 |
| 677 | Ga0501079_0270295 | 3300049741 | Unclassified | 1329 |
| 678 | Ga0501080_0011059 | 3300049742 | Bacteria | 8259 |
| 679 | Ga0501080_0676504 | 3300049742 | Bacteria | 912 |
| 680 | Ga0501081_0056254 | 3300049743 | Bacteria | 2718 |
| 681 | Ga0501083_0055234 | 3300049744 | Bacteria | 2663 |
| 682 | Ga0501083_0114365 | 3300049744 | Unclassified | 1772 |
| 683 | Ga0501035_0001546 | 3300049822 | Bacteria | 23436 |
| 684 | Ga0501044_0003136 | 3300049823 | Bacteria | 18695 |
| 685 | Ga0501044_0235132 | 3300049823 | Bacteria | 1778 |
| 686 | Ga0501045_0051674 | 3300049824 | Bacteria | 3000 |
| 687 | Ga0501045_0097324 | 3300049824 | Bacteria | 2177 |
| 688 | nmdc:mga03n38_169053_c1 | 3300050490 | Bacteria | 1112 |
| 689 | nmdc:mga00v17_198322_c1 | 3300050491 | Bacteria | 1297 |
| 690 | nmdc:mga00v17_28492_c1 | 3300050491 | Archaea | 3271 |
| 691 | nmdc:mga00v17_8565_c1 | 3300050491 | Bacteria | 5505 |
| 692 | nmdc:mga0yw44_102531_c1 | 3300050492 | Bacteria | 1824 |
| 693 | nmdc:mga0yw44_10477_c1 | 3300050492 | Bacteria | 4739 |
| 694 | nmdc:mga0yw44_175972_c1 | 3300050492 | Bacteria | 1407 |
| 695 | nmdc:mga0yw44_66686_c1 | 3300050492 | Archaea | 2222 |
| 696 | nmdc:mga06z11_100731_c1 | 3300050494 | Bacteria | 1584 |
| 697 | nmdc:mga06z11_18188_c1 | 3300050494 | Bacteria | 3205 |
| 698 | nmdc:mga05p37_135351_c1 | 3300050507 | Bacteria | 3022 |
| 699 | nmdc:mga09592_398197_c1 | 3300050508 | Bacteria | 1190 |
| 700 | nmdc:mga0qj67_47502_c1 | 3300050509 | Bacteria | 3391 |
| 701 | nmdc:mga06r32_380009_c1 | 3300050510 | Unclassified | 1395 |
| 702 | nmdc:mga06r32_477478_c1 | 3300050510 | Bacteria | 1225 |
| 703 | nmdc:mga06r32_497888_c1 | 3300050510 | Bacteria | 1196 |
| 704 | nmdc:mga08y16_173595_c1 | 3300050511 | Unclassified | 2238 |
| 705 | nmdc:mga08y16_62734_c1 | 3300050511 | Bacteria | 3881 |
| 706 | nmdc:mga08y16_7851_c1 | 3300050511 | Bacteria | 11175 |
| 707 | nmdc:mga0n895_21750_c1 | 3300050512 | Bacteria | 6003 |
| 708 | nmdc:mga0rr50_114078_c1 | 3300050513 | Bacteria | 2142 |
| 709 | nmdc:mga08x19_311158_c1 | 3300050514 | Bacteria | 1095 |
| 710 | nmdc:mga0a205_15_c1 | 3300050515 | Bacteria | 33986 |
| 711 | nmdc:mga0a205_51329_c1 | 3300050515 | Bacteria | 3981 |
| 712 | Ga0495601_0000019 | 3300053077 | Bacteria | 161673 |
| 713 | Ga0495601_0000059 | 3300053077 | Bacteria | 60752 |
| 714 | Ga0495601_0003867 | 3300053077 | Bacteria | 8624 |
| 715 | Ga0495601_0026979 | 3300053077 | Bacteria | 3549 |
| 716 | Ga0495601_0145749 | 3300053077 | Bacteria | 1545 |
| 717 | Ga0495612_0000122 | 3300053078 | Bacteria | 32891 |
| 718 | Ga0495612_0000221 | 3300053078 | Bacteria | 24147 |
| 719 | Ga0495612_0012321 | 3300053078 | Bacteria | 3447 |
| 720 | Ga0495612_0013769 | 3300053078 | Bacteria | 3258 |
| 721 | Ga0495655_0000013 | 3300053083 | Bacteria | 63264 |
| 722 | Ga0495655_0051083 | 3300053083 | Unclassified | 1094 |
| 723 | Ga0495595_0000276 | 3300053084 | Bacteria | 20346 |
| 724 | Ga0495595_0001135 | 3300053084 | Bacteria | 10311 |
| 725 | Ga0495595_0005273 | 3300053084 | Bacteria | 5227 |
| 726 | Ga0495595_0113188 | 3300053084 | Bacteria | 1317 |
| 727 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 728 | Ga0495619_0000069 | 3300053085 | Bacteria | 82755 |
| 729 | Ga0495619_0000152 | 3300053085 | Bacteria | 51090 |
| 730 | Ga0495619_0000564 | 3300053085 | Bacteria | 24556 |
| 731 | Ga0495619_0001238 | 3300053085 | Bacteria | 16714 |
| 732 | Ga0495619_0003763 | 3300053085 | Bacteria | 9768 |
| 733 | Ga0495619_0013974 | 3300053085 | Bacteria | 5066 |
| 734 | Ga0495619_0022300 | 3300053085 | Bacteria | 4050 |
| 735 | Ga0495619_0349213 | 3300053085 | Bacteria | 1023 |
| 736 | Ga0500566_0003812 | 3300053094 | Bacteria | 8988 |
| 737 | Ga0500641_0008094 | 3300053096 | Bacteria | 3746 |
| 738 | Ga0500614_000791 | 3300053123 | Bacteria | 8020 |
| 739 | Ga0500628_000045 | 3300053129 | Bacteria | 45042 |
| 740 | Ga0500658_0009977 | 3300053134 | Bacteria | 3503 |
| 741 | Ga0500568_0057781 | 3300053139 | Bacteria | 1509 |
| 742 | Ga0501084_0135644 | 3300054114 | Bacteria | 2072 |
| 743 | Ga0501084_0205906 | 3300054114 | Bacteria | 1660 |
| 744 | Ga0501082_0718478 | 3300060353 | Unclassified | 874 |
| 745 | Ga0530510_0003841 | 3300061734 | Bacteria | 10354 |
| 746 | Ga0530510_0666799 | 3300061734 | Unclassified | 792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046461 | Ga0495641_0063820 | Ga0495641_0063820_1060_1641 | 190 |
| 2 | 3300048907 | Ga0496104_0927460 | Ga0496104_0927460_182_763 | 190 |
| 3 | 3300061734 | Ga0530510_0666799 | Ga0530510_0666799_56_655 | 196 |
| 4 | 3300009148 | Ga0105243_10007304 | Ga0105243_100073049 | 208 |
| 5 | 3300025935 | Ga0207709_10074071 | Ga0207709_100740713 | 208 |
| 6 | 3300006038 | Ga0075365_10001081 | Ga0075365_100010816 | 210 |
| 7 | 3300006051 | Ga0075364_10090037 | Ga0075364_100900373 | 210 |
| 8 | 3300046516 | Ga0495628_0284815 | Ga0495628_0284815_408_1082 | 210 |
| 9 | 3300046517 | Ga0495630_0017766 | Ga0495630_0017766_2843_3517 | 210 |
| 10 | 3300046675 | Ga0495657_0048746 | Ga0495657_0048746_1670_2344 | 210 |
| 11 | 3300047319 | Ga0495674_0285269 | Ga0495674_0285269_440_1114 | 210 |
| 12 | 3300049578 | Ga0501042_0426975 | Ga0501042_0426975_289_930 | 210 |
| 13 | 3300050491 | nmdc:mga00v17_28492_c1 | nmdc:mga00v17_28492_c1_1244_1891 | 210 |
| 14 | 3300050492 | nmdc:mga0yw44_66686_c1 | nmdc:mga0yw44_66686_c1_809_1456 | 210 |
| 15 | 3300053077 | Ga0495601_0026979 | Ga0495601_0026979_2543_3217 | 210 |
| 16 | 3300053078 | Ga0495612_0013769 | Ga0495612_0013769_2267_2941 | 210 |
| 17 | 3300049590 | Ga0501074_0534396 | Ga0501074_0534396_150_818 | 211 |
| 18 | 3300025925 | Ga0207650_10095204 | Ga0207650_100952044 | 213 |
| 19 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_161156_161827 | 213 |
| 20 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_161156_161827 | 213 |
| 21 | 3300048922 | Ga0496119_0074055 | Ga0496119_0074055_975_1646 | 213 |
| 22 | 3300005438 | Ga0070701_10461826 | Ga0070701_104618261 | 214 |
| 23 | 3300035398 | Ga0316574_0052662 | Ga0316574_0052662_440_1132 | 214 |
| 24 | 3300046535 | Ga0495586_0439508 | Ga0495586_0439508_28_702 | 214 |
| 25 | 3300046642 | Ga0495634_0042878 | Ga0495634_0042878_349_1023 | 214 |
| 26 | 3300046674 | Ga0495588_0000175 | Ga0495588_0000175_72027_72710 | 214 |
| 27 | 3300046690 | Ga0495624_0035583 | Ga0495624_0035583_1422_2096 | 214 |
| 28 | 3300047471 | Ga0495684_0336272 | Ga0495684_0336272_162_836 | 214 |
| 29 | 3300048911 | Ga0496108_0670591 | Ga0496108_0670591_69_752 | 214 |
| 30 | 3300048912 | Ga0496109_0000391 | Ga0496109_0000391_24065_24748 | 214 |
| 31 | 3300053085 | Ga0495619_0003763 | Ga0495619_0003763_171_845 | 214 |
| 32 | 3300009176 | Ga0105242_10000589 | Ga0105242_1000058927 | 216 |
| 33 | 3300025934 | Ga0207686_10002761 | Ga0207686_100027614 | 216 |
| 34 | 3300046459 | Ga0495629_0000789 | Ga0495629_0000789_14836_15507 | 216 |
| 35 | 3300046660 | Ga0495625_0146471 | Ga0495625_0146471_732_1427 | 216 |
| 36 | 3300005985 | Ga0081539_10054756 | Ga0081539_100547562 | 218 |
| 37 | 3300005937 | Ga0081455_10367227 | Ga0081455_103672272 | 219 |
| 38 | 3300006038 | Ga0075365_10331469 | Ga0075365_103314692 | 219 |
| 39 | 3300006846 | Ga0075430_100142504 | Ga0075430_1001425043 | 219 |
| 40 | 3300006847 | Ga0075431_100011336 | Ga0075431_1000113362 | 219 |
| 41 | 3300006880 | Ga0075429_100216894 | Ga0075429_1002168943 | 219 |
| 42 | 3300013307 | Ga0157372_11093296 | Ga0157372_110932962 | 219 |
| 43 | 3300038443 | Ga0395901_0165531 | Ga0395901_0165531_339_1001 | 219 |
| 44 | 3300050508 | nmdc:mga09592_398197_c1 | nmdc:mga09592_398197_c1_314_982 | 219 |
| 45 | 3300050510 | nmdc:mga06r32_497888_c1 | nmdc:mga06r32_497888_c1_386_1054 | 219 |
| 46 | 3300006038 | Ga0075365_10333096 | Ga0075365_103330961 | 220 |
| 47 | 3300006042 | Ga0075368_10083724 | Ga0075368_100837241 | 220 |
| 48 | 3300050491 | nmdc:mga00v17_198322_c1 | nmdc:mga00v17_198322_c1_256_936 | 220 |
| 49 | 3300050492 | nmdc:mga0yw44_102531_c1 | nmdc:mga0yw44_102531_c1_1073_1753 | 220 |
| 50 | 3300005981 | Ga0081538_10000034 | Ga0081538_10000034118 | 221 |
| 51 | 3300046491 | Ga0495584_0285631 | Ga0495584_0285631_75_740 | 221 |
| 52 | 3300005329 | Ga0070683_100004639 | Ga0070683_10000463911 | 222 |
| 53 | 3300005337 | Ga0070682_100000032 | Ga0070682_100000032122 | 222 |
| 54 | 3300005354 | Ga0070675_100000022 | Ga0070675_10000002220 | 222 |
| 55 | 3300005535 | Ga0070684_100025254 | Ga0070684_1000252542 | 222 |
| 56 | 3300005564 | Ga0070664_100515814 | Ga0070664_1005158141 | 222 |
| 57 | 3300005578 | Ga0068854_100000133 | Ga0068854_10000013317 | 222 |
| 58 | 3300005614 | Ga0068856_100000369 | Ga0068856_10000036929 | 222 |
| 59 | 3300005981 | Ga0081538_10055616 | Ga0081538_100556162 | 222 |
| 60 | 3300009098 | Ga0105245_10003348 | Ga0105245_100033484 | 222 |
| 61 | 3300010375 | Ga0105239_10600484 | Ga0105239_106004841 | 222 |
| 62 | 3300011119 | Ga0105246_10436146 | Ga0105246_104361461 | 222 |
| 63 | 3300013297 | Ga0157378_10078777 | Ga0157378_100787772 | 222 |
| 64 | 3300014325 | Ga0163163_11218762 | Ga0163163_112187621 | 222 |
| 65 | 3300025926 | Ga0207659_10000138 | Ga0207659_100001387 | 222 |
| 66 | 3300025927 | Ga0207687_10029007 | Ga0207687_100290074 | 222 |
| 67 | 3300025944 | Ga0207661_10011259 | Ga0207661_100112597 | 222 |
| 68 | 3300025981 | Ga0207640_10000147 | Ga0207640_1000014716 | 222 |
| 69 | 3300026078 | Ga0207702_10000557 | Ga0207702_1000055715 | 222 |
| 70 | 3300036401 | Ga0373937_0006290 | Ga0373937_0006290_8262_8930 | 222 |
| 71 | 3300046461 | Ga0495641_0005514 | Ga0495641_0005514_7071_7739 | 222 |
| 72 | 3300046462 | Ga0495651_0134141 | Ga0495651_0134141_1070_1738 | 222 |
| 73 | 3300046507 | Ga0495606_0000283 | Ga0495606_0000283_25062_25730 | 222 |
| 74 | 3300046511 | Ga0495608_0040410 | Ga0495608_0040410_2084_2752 | 222 |
| 75 | 3300046663 | Ga0495635_0214121 | Ga0495635_0214121_511_1179 | 222 |
| 76 | 3300046681 | Ga0495647_0001404 | Ga0495647_0001404_1817_2485 | 222 |
| 77 | 3300047322 | Ga0495680_0010471 | Ga0495680_0010471_5040_5708 | 222 |
| 78 | 3300048913 | Ga0496110_0000122 | Ga0496110_0000122_34316_34999 | 222 |
| 79 | 3300048914 | Ga0496111_0000037 | Ga0496111_0000037_8894_9577 | 222 |
| 80 | 3300048917 | Ga0496114_0946699 | Ga0496114_0946699_16_684 | 222 |
| 81 | 3300049568 | Ga0501031_0129191 | Ga0501031_0129191_58_735 | 222 |
| 82 | 3300049577 | Ga0501041_0224172 | Ga0501041_0224172_469_1146 | 222 |
| 83 | 3300049588 | Ga0501072_0042532 | Ga0501072_0042532_472_1149 | 222 |
| 84 | 3300049590 | Ga0501074_0047438 | Ga0501074_0047438_165_842 | 222 |
| 85 | 3300049591 | Ga0501075_0008822 | Ga0501075_0008822_2662_3339 | 222 |
| 86 | 3300049592 | Ga0501076_0034143 | Ga0501076_0034143_1571_2248 | 222 |
| 87 | 3300049743 | Ga0501081_0056254 | Ga0501081_0056254_170_847 | 222 |
| 88 | 3300053085 | Ga0495619_0000069 | Ga0495619_0000069_36857_37540 | 222 |
| 89 | 3300053085 | Ga0495619_0013974 | Ga0495619_0013974_2048_2716 | 222 |
| 90 | 3300054114 | Ga0501084_0205906 | Ga0501084_0205906_764_1441 | 222 |
| 91 | 3300061734 | Ga0530510_0003841 | Ga0530510_0003841_2633_3310 | 222 |
| 92 | 3300001977 | JGI24746J21847_1000852 | JGI24746J21847_10008526 | 223 |
| 93 | 3300002074 | JGI24748J21848_1000142 | JGI24748J21848_10001429 | 223 |
| 94 | 3300002239 | JGI24034J26672_10002156 | JGI24034J26672_100021562 | 223 |
| 95 | 3300002244 | JGI24742J22300_10009386 | JGI24742J22300_100093862 | 223 |
| 96 | 3300003659 | JGI25404J52841_10004750 | JGI25404J52841_100047504 | 223 |
| 97 | 3300005327 | Ga0070658_10056777 | Ga0070658_100567771 | 223 |
| 98 | 3300005327 | Ga0070658_10095850 | Ga0070658_100958504 | 223 |
| 99 | 3300005329 | Ga0070683_100002869 | Ga0070683_10000286910 | 223 |
| 100 | 3300005329 | Ga0070683_100078997 | Ga0070683_1000789974 | 223 |
| 101 | 3300005329 | Ga0070683_100125107 | Ga0070683_1001251071 | 223 |
| 102 | 3300005333 | Ga0070677_10000081 | Ga0070677_1000008118 | 223 |
| 103 | 3300005335 | Ga0070666_10259004 | Ga0070666_102590042 | 223 |
| 104 | 3300005336 | Ga0070680_100083006 | Ga0070680_1000830062 | 223 |
| 105 | 3300005336 | Ga0070680_100132860 | Ga0070680_1001328602 | 223 |
| 106 | 3300005337 | Ga0070682_100000009 | Ga0070682_100000009250 | 223 |
| 107 | 3300005337 | Ga0070682_100011743 | Ga0070682_1000117434 | 223 |
| 108 | 3300005337 | Ga0070682_100205638 | Ga0070682_1002056382 | 223 |
| 109 | 3300005338 | Ga0068868_100000138 | Ga0068868_10000013831 | 223 |
| 110 | 3300005338 | Ga0068868_100246705 | Ga0068868_1002467053 | 223 |
| 111 | 3300005339 | Ga0070660_100017636 | Ga0070660_1000176362 | 223 |
| 112 | 3300005339 | Ga0070660_100410716 | Ga0070660_1004107161 | 223 |
| 113 | 3300005340 | Ga0070689_100083814 | Ga0070689_1000838141 | 223 |
| 114 | 3300005340 | Ga0070689_100112308 | Ga0070689_1001123084 | 223 |
| 115 | 3300005340 | Ga0070689_100219819 | Ga0070689_1002198192 | 223 |
| 116 | 3300005340 | Ga0070689_100443317 | Ga0070689_1004433172 | 223 |
| 117 | 3300005347 | Ga0070668_100001413 | Ga0070668_10000141315 | 223 |
| 118 | 3300005347 | Ga0070668_100375900 | Ga0070668_1003759001 | 223 |
| 119 | 3300005354 | Ga0070675_100018681 | Ga0070675_1000186814 | 223 |
| 120 | 3300005356 | Ga0070674_100000021 | Ga0070674_10000002138 | 223 |
| 121 | 3300005356 | Ga0070674_100000075 | Ga0070674_10000007537 | 223 |
| 122 | 3300005356 | Ga0070674_100325405 | Ga0070674_1003254052 | 223 |
| 123 | 3300005356 | Ga0070674_100631279 | Ga0070674_1006312791 | 223 |
| 124 | 3300005364 | Ga0070673_100017018 | Ga0070673_1000170186 | 223 |
| 125 | 3300005365 | Ga0070688_100000168 | Ga0070688_10000016835 | 223 |
| 126 | 3300005365 | Ga0070688_100052550 | Ga0070688_1000525503 | 223 |
| 127 | 3300005366 | Ga0070659_100001004 | Ga0070659_10000100414 | 223 |
| 128 | 3300005366 | Ga0070659_100016201 | Ga0070659_1000162012 | 223 |
| 129 | 3300005367 | Ga0070667_100029913 | Ga0070667_1000299135 | 223 |
| 130 | 3300005406 | Ga0070703_10048196 | Ga0070703_100481961 | 223 |
| 131 | 3300005436 | Ga0070713_100000171 | Ga0070713_1000001718 | 223 |
| 132 | 3300005436 | Ga0070713_100395603 | Ga0070713_1003956032 | 223 |
| 133 | 3300005439 | Ga0070711_100011385 | Ga0070711_1000113856 | 223 |
| 134 | 3300005439 | Ga0070711_100225570 | Ga0070711_1002255701 | 223 |
| 135 | 3300005441 | Ga0070700_100001537 | Ga0070700_1000015375 | 223 |
| 136 | 3300005441 | Ga0070700_100022395 | Ga0070700_1000223953 | 223 |
| 137 | 3300005441 | Ga0070700_100060903 | Ga0070700_1000609032 | 223 |
| 138 | 3300005441 | Ga0070700_100095004 | Ga0070700_1000950042 | 223 |
| 139 | 3300005455 | Ga0070663_100005777 | Ga0070663_1000057774 | 223 |
| 140 | 3300005457 | Ga0070662_100000052 | Ga0070662_10000005235 | 223 |
| 141 | 3300005457 | Ga0070662_100067597 | Ga0070662_1000675972 | 223 |
| 142 | 3300005458 | Ga0070681_10363839 | Ga0070681_103638392 | 223 |
| 143 | 3300005459 | Ga0068867_100002852 | Ga0068867_1000028522 | 223 |
| 144 | 3300005459 | Ga0068867_100005467 | Ga0068867_1000054676 | 223 |
| 145 | 3300005466 | Ga0070685_10000058 | Ga0070685_1000005860 | 223 |
| 146 | 3300005466 | Ga0070685_10000246 | Ga0070685_1000024635 | 223 |
| 147 | 3300005466 | Ga0070685_10023282 | Ga0070685_100232824 | 223 |
| 148 | 3300005466 | Ga0070685_10139246 | Ga0070685_101392462 | 223 |
| 149 | 3300005530 | Ga0070679_100000190 | Ga0070679_10000019043 | 223 |
| 150 | 3300005530 | Ga0070679_100018989 | Ga0070679_1000189894 | 223 |
| 151 | 3300005530 | Ga0070679_100207035 | Ga0070679_1002070352 | 223 |
| 152 | 3300005535 | Ga0070684_100004244 | Ga0070684_1000042446 | 223 |
| 153 | 3300005535 | Ga0070684_100005286 | Ga0070684_1000052864 | 223 |
| 154 | 3300005535 | Ga0070684_100135000 | Ga0070684_1001350003 | 223 |
| 155 | 3300005535 | Ga0070684_100166527 | Ga0070684_1001665272 | 223 |
| 156 | 3300005539 | Ga0068853_100000830 | Ga0068853_10000083020 | 223 |
| 157 | 3300005539 | Ga0068853_100026166 | Ga0068853_1000261664 | 223 |
| 158 | 3300005539 | Ga0068853_100244080 | Ga0068853_1002440801 | 223 |
| 159 | 3300005543 | Ga0070672_100000258 | Ga0070672_10000025832 | 223 |
| 160 | 3300005544 | Ga0070686_100105526 | Ga0070686_1001055262 | 223 |
| 161 | 3300005544 | Ga0070686_100150834 | Ga0070686_1001508342 | 223 |
| 162 | 3300005547 | Ga0070693_100010796 | Ga0070693_1000107963 | 223 |
| 163 | 3300005547 | Ga0070693_100442839 | Ga0070693_1004428391 | 223 |
| 164 | 3300005548 | Ga0070665_100000022 | Ga0070665_100000022355 | 223 |
| 165 | 3300005548 | Ga0070665_100002631 | Ga0070665_10000263119 | 223 |
| 166 | 3300005548 | Ga0070665_100041985 | Ga0070665_1000419852 | 223 |
| 167 | 3300005549 | Ga0070704_100101516 | Ga0070704_1001015162 | 223 |
| 168 | 3300005549 | Ga0070704_100214917 | Ga0070704_1002149172 | 223 |
| 169 | 3300005549 | Ga0070704_100414774 | Ga0070704_1004147742 | 223 |
| 170 | 3300005563 | Ga0068855_101079344 | Ga0068855_1010793441 | 223 |
| 171 | 3300005577 | Ga0068857_100112558 | Ga0068857_1001125582 | 223 |
| 172 | 3300005578 | Ga0068854_100002063 | Ga0068854_1000020634 | 223 |
| 173 | 3300005614 | Ga0068856_100002525 | Ga0068856_10000252517 | 223 |
| 174 | 3300005614 | Ga0068856_100063621 | Ga0068856_1000636211 | 223 |
| 175 | 3300005616 | Ga0068852_100000024 | Ga0068852_10000002432 | 223 |
| 176 | 3300005616 | Ga0068852_100007178 | Ga0068852_1000071782 | 223 |
| 177 | 3300005616 | Ga0068852_100179703 | Ga0068852_1001797032 | 223 |
| 178 | 3300005617 | Ga0068859_100382368 | Ga0068859_1003823682 | 223 |
| 179 | 3300005617 | Ga0068859_100864701 | Ga0068859_1008647011 | 223 |
| 180 | 3300005618 | Ga0068864_100000023 | Ga0068864_100000023168 | 223 |
| 181 | 3300005618 | Ga0068864_100803145 | Ga0068864_1008031452 | 223 |
| 182 | 3300005718 | Ga0068866_10000007 | Ga0068866_1000000765 | 223 |
| 183 | 3300005718 | Ga0068866_10000220 | Ga0068866_100002204 | 223 |
| 184 | 3300005718 | Ga0068866_10028076 | Ga0068866_100280764 | 223 |
| 185 | 3300005718 | Ga0068866_10090266 | Ga0068866_100902662 | 223 |
| 186 | 3300005719 | Ga0068861_100466090 | Ga0068861_1004660902 | 223 |
| 187 | 3300005719 | Ga0068861_101013713 | Ga0068861_1010137132 | 223 |
| 188 | 3300005834 | Ga0068851_10004687 | Ga0068851_100046874 | 223 |
| 189 | 3300005834 | Ga0068851_10115479 | Ga0068851_101154792 | 223 |
| 190 | 3300005841 | Ga0068863_100000110 | Ga0068863_10000011064 | 223 |
| 191 | 3300005841 | Ga0068863_100015825 | Ga0068863_1000158254 | 223 |
| 192 | 3300005841 | Ga0068863_100136020 | Ga0068863_1001360203 | 223 |
| 193 | 3300005842 | Ga0068858_100000150 | Ga0068858_10000015062 | 223 |
| 194 | 3300005843 | Ga0068860_100003597 | Ga0068860_10000359715 | 223 |
| 195 | 3300005843 | Ga0068860_100120198 | Ga0068860_1001201982 | 223 |
| 196 | 3300005843 | Ga0068860_100154142 | Ga0068860_1001541422 | 223 |
| 197 | 3300005843 | Ga0068860_100168975 | Ga0068860_1001689752 | 223 |
| 198 | 3300005844 | Ga0068862_100010696 | Ga0068862_1000106969 | 223 |
| 199 | 3300005844 | Ga0068862_100563515 | Ga0068862_1005635152 | 223 |
| 200 | 3300005937 | Ga0081455_10002533 | Ga0081455_100025334 | 223 |
| 201 | 3300005937 | Ga0081455_10021062 | Ga0081455_100210625 | 223 |
| 202 | 3300005937 | Ga0081455_10043091 | Ga0081455_100430912 | 223 |
| 203 | 3300005983 | Ga0081540_1000435 | Ga0081540_100043518 | 223 |
| 204 | 3300005985 | Ga0081539_10001052 | Ga0081539_100010525 | 223 |
| 205 | 3300006038 | Ga0075365_10000722 | Ga0075365_100007226 | 223 |
| 206 | 3300006038 | Ga0075365_10020147 | Ga0075365_100201472 | 223 |
| 207 | 3300006048 | Ga0075363_100012920 | Ga0075363_1000129202 | 223 |
| 208 | 3300006048 | Ga0075363_100083218 | Ga0075363_1000832182 | 223 |
| 209 | 3300006048 | Ga0075363_100101017 | Ga0075363_1001010172 | 223 |
| 210 | 3300006051 | Ga0075364_10002834 | Ga0075364_100028347 | 223 |
| 211 | 3300006051 | Ga0075364_10072097 | Ga0075364_100720973 | 223 |
| 212 | 3300006163 | Ga0070715_10000003 | Ga0070715_10000003295 | 223 |
| 213 | 3300006163 | Ga0070715_10308787 | Ga0070715_103087871 | 223 |
| 214 | 3300006173 | Ga0070716_100505659 | Ga0070716_1005056591 | 223 |
| 215 | 3300006175 | Ga0070712_100007464 | Ga0070712_1000074647 | 223 |
| 216 | 3300006178 | Ga0075367_10011862 | Ga0075367_100118625 | 223 |
| 217 | 3300006178 | Ga0075367_10157222 | Ga0075367_101572222 | 223 |
| 218 | 3300006844 | Ga0075428_100155458 | Ga0075428_1001554583 | 223 |
| 219 | 3300006846 | Ga0075430_100057762 | Ga0075430_1000577622 | 223 |
| 220 | 3300006847 | Ga0075431_100019643 | Ga0075431_1000196435 | 223 |
| 221 | 3300006847 | Ga0075431_100487984 | Ga0075431_1004879842 | 223 |
| 222 | 3300006847 | Ga0075431_100674159 | Ga0075431_1006741591 | 223 |
| 223 | 3300006852 | Ga0075433_10001846 | Ga0075433_100018467 | 223 |
| 224 | 3300006852 | Ga0075433_10004595 | Ga0075433_100045954 | 223 |
| 225 | 3300006881 | Ga0068865_100000024 | Ga0068865_10000002468 | 223 |
| 226 | 3300006881 | Ga0068865_100016376 | Ga0068865_1000163763 | 223 |
| 227 | 3300006881 | Ga0068865_100403410 | Ga0068865_1004034102 | 223 |
| 228 | 3300006914 | Ga0075436_100207673 | Ga0075436_1002076732 | 223 |
| 229 | 3300006931 | Ga0097620_100382350 | Ga0097620_1003823502 | 223 |
| 230 | 3300006931 | Ga0097620_100864802 | Ga0097620_1008648021 | 223 |
| 231 | 3300007076 | Ga0075435_100011075 | Ga0075435_1000110754 | 223 |
| 232 | 3300007076 | Ga0075435_100297381 | Ga0075435_1002973812 | 223 |
| 233 | 3300009094 | Ga0111539_10037181 | Ga0111539_100371815 | 223 |
| 234 | 3300009094 | Ga0111539_10046828 | Ga0111539_100468283 | 223 |
| 235 | 3300009094 | Ga0111539_10200553 | Ga0111539_102005532 | 223 |
| 236 | 3300009098 | Ga0105245_10000022 | Ga0105245_10000022140 | 223 |
| 237 | 3300009098 | Ga0105245_10001022 | Ga0105245_100010223 | 223 |
| 238 | 3300009098 | Ga0105245_10001178 | Ga0105245_100011784 | 223 |
| 239 | 3300009098 | Ga0105245_10049393 | Ga0105245_100493932 | 223 |
| 240 | 3300009098 | Ga0105245_10508668 | Ga0105245_105086682 | 223 |
| 241 | 3300009101 | Ga0105247_10000064 | Ga0105247_1000006477 | 223 |
| 242 | 3300009101 | Ga0105247_10080478 | Ga0105247_100804782 | 223 |
| 243 | 3300009101 | Ga0105247_10094102 | Ga0105247_100941022 | 223 |
| 244 | 3300009101 | Ga0105247_10133546 | Ga0105247_101335462 | 223 |
| 245 | 3300009147 | Ga0114129_10147910 | Ga0114129_101479102 | 223 |
| 246 | 3300009147 | Ga0114129_10152901 | Ga0114129_101529014 | 223 |
| 247 | 3300009147 | Ga0114129_10171735 | Ga0114129_101717352 | 223 |
| 248 | 3300009148 | Ga0105243_10002021 | Ga0105243_100020214 | 223 |
| 249 | 3300009148 | Ga0105243_10067333 | Ga0105243_100673333 | 223 |
| 250 | 3300009148 | Ga0105243_10256601 | Ga0105243_102566012 | 223 |
| 251 | 3300009176 | Ga0105242_10252193 | Ga0105242_102521932 | 223 |
| 252 | 3300009177 | Ga0105248_10000017 | Ga0105248_1000001720 | 223 |
| 253 | 3300009177 | Ga0105248_10198412 | Ga0105248_101984123 | 223 |
| 254 | 3300009551 | Ga0105238_10000014 | Ga0105238_10000014215 | 223 |
| 255 | 3300009551 | Ga0105238_10118685 | Ga0105238_101186853 | 223 |
| 256 | 3300009551 | Ga0105238_10930040 | Ga0105238_109300401 | 223 |
| 257 | 3300009553 | Ga0105249_10000181 | Ga0105249_1000018144 | 223 |
| 258 | 3300009553 | Ga0105249_10006903 | Ga0105249_100069032 | 223 |
| 259 | 3300009553 | Ga0105249_10034423 | Ga0105249_100344232 | 223 |
| 260 | 3300009553 | Ga0105249_10106918 | Ga0105249_101069182 | 223 |
| 261 | 3300009553 | Ga0105249_10493319 | Ga0105249_104933192 | 223 |
| 262 | 3300009553 | Ga0105249_10568406 | Ga0105249_105684062 | 223 |
| 263 | 3300009553 | Ga0105249_11336381 | Ga0105249_113363811 | 223 |
| 264 | 3300010375 | Ga0105239_10116111 | Ga0105239_101161112 | 223 |
| 265 | 3300011119 | Ga0105246_10084526 | Ga0105246_100845262 | 223 |
| 266 | 3300013100 | Ga0157373_10305287 | Ga0157373_103052871 | 223 |
| 267 | 3300013102 | Ga0157371_10017407 | Ga0157371_100174075 | 223 |
| 268 | 3300013104 | Ga0157370_10043875 | Ga0157370_100438754 | 223 |
| 269 | 3300013104 | Ga0157370_10073991 | Ga0157370_100739914 | 223 |
| 270 | 3300013105 | Ga0157369_10000068 | Ga0157369_10000068108 | 223 |
| 271 | 3300013296 | Ga0157374_10001959 | Ga0157374_1000195915 | 223 |
| 272 | 3300013296 | Ga0157374_10078656 | Ga0157374_100786564 | 223 |
| 273 | 3300013296 | Ga0157374_10354777 | Ga0157374_103547771 | 223 |
| 274 | 3300013296 | Ga0157374_10440350 | Ga0157374_104403502 | 223 |
| 275 | 3300013297 | Ga0157378_10000656 | Ga0157378_1000065611 | 223 |
| 276 | 3300013297 | Ga0157378_10718065 | Ga0157378_107180652 | 223 |
| 277 | 3300013306 | Ga0163162_10371032 | Ga0163162_103710322 | 223 |
| 278 | 3300013307 | Ga0157372_10001135 | Ga0157372_1000113532 | 223 |
| 279 | 3300013308 | Ga0157375_10000126 | Ga0157375_1000012659 | 223 |
| 280 | 3300013308 | Ga0157375_10001522 | Ga0157375_1000152211 | 223 |
| 281 | 3300013308 | Ga0157375_10029588 | Ga0157375_100295885 | 223 |
| 282 | 3300013308 | Ga0157375_10041147 | Ga0157375_100411472 | 223 |
| 283 | 3300013308 | Ga0157375_10805836 | Ga0157375_108058361 | 223 |
| 284 | 3300014325 | Ga0163163_10569231 | Ga0163163_105692312 | 223 |
| 285 | 3300014326 | Ga0157380_10000326 | Ga0157380_1000032631 | 223 |
| 286 | 3300014326 | Ga0157380_10000403 | Ga0157380_100004039 | 223 |
| 287 | 3300014326 | Ga0157380_10009902 | Ga0157380_100099024 | 223 |
| 288 | 3300014745 | Ga0157377_10022224 | Ga0157377_100222244 | 223 |
| 289 | 3300014968 | Ga0157379_10052910 | Ga0157379_100529103 | 223 |
| 290 | 3300014968 | Ga0157379_10194157 | Ga0157379_101941572 | 223 |
| 291 | 3300014968 | Ga0157379_10212625 | Ga0157379_102126252 | 223 |
| 292 | 3300014968 | Ga0157379_10286295 | Ga0157379_102862951 | 223 |
| 293 | 3300014969 | Ga0157376_10013349 | Ga0157376_100133497 | 223 |
| 294 | 3300017792 | Ga0163161_10000013 | Ga0163161_10000013130 | 223 |
| 295 | 3300017792 | Ga0163161_10016346 | Ga0163161_100163464 | 223 |
| 296 | 3300025321 | Ga0207656_10000399 | Ga0207656_1000039915 | 223 |
| 297 | 3300025321 | Ga0207656_10094055 | Ga0207656_100940552 | 223 |
| 298 | 3300025893 | Ga0207682_10000327 | Ga0207682_100003278 | 223 |
| 299 | 3300025899 | Ga0207642_10000008 | Ga0207642_1000000873 | 223 |
| 300 | 3300025899 | Ga0207642_10000689 | Ga0207642_1000068910 | 223 |
| 301 | 3300025900 | Ga0207710_10000165 | Ga0207710_1000016563 | 223 |
| 302 | 3300025901 | Ga0207688_10030450 | Ga0207688_100304503 | 223 |
| 303 | 3300025903 | Ga0207680_10002295 | Ga0207680_100022954 | 223 |
| 304 | 3300025903 | Ga0207680_10017470 | Ga0207680_100174704 | 223 |
| 305 | 3300025903 | Ga0207680_10037141 | Ga0207680_100371414 | 223 |
| 306 | 3300025905 | Ga0207685_10000003 | Ga0207685_10000003289 | 223 |
| 307 | 3300025909 | Ga0207705_10163640 | Ga0207705_101636403 | 223 |
| 308 | 3300025912 | Ga0207707_10109650 | Ga0207707_101096502 | 223 |
| 309 | 3300025912 | Ga0207707_10296001 | Ga0207707_102960012 | 223 |
| 310 | 3300025914 | Ga0207671_10168003 | Ga0207671_101680032 | 223 |
| 311 | 3300025915 | Ga0207693_10008752 | Ga0207693_100087524 | 223 |
| 312 | 3300025915 | Ga0207693_10008877 | Ga0207693_100088775 | 223 |
| 313 | 3300025915 | Ga0207693_10239386 | Ga0207693_102393863 | 223 |
| 314 | 3300025916 | Ga0207663_10008156 | Ga0207663_100081564 | 223 |
| 315 | 3300025916 | Ga0207663_10009286 | Ga0207663_100092864 | 223 |
| 316 | 3300025917 | Ga0207660_10081268 | Ga0207660_100812682 | 223 |
| 317 | 3300025917 | Ga0207660_10145019 | Ga0207660_101450192 | 223 |
| 318 | 3300025917 | Ga0207660_10662948 | Ga0207660_106629482 | 223 |
| 319 | 3300025918 | Ga0207662_10164008 | Ga0207662_101640082 | 223 |
| 320 | 3300025919 | Ga0207657_10005356 | Ga0207657_100053565 | 223 |
| 321 | 3300025920 | Ga0207649_10000166 | Ga0207649_1000016640 | 223 |
| 322 | 3300025921 | Ga0207652_10000242 | Ga0207652_1000024251 | 223 |
| 323 | 3300025921 | Ga0207652_10000437 | Ga0207652_100004375 | 223 |
| 324 | 3300025924 | Ga0207694_10000008 | Ga0207694_1000000823 | 223 |
| 325 | 3300025924 | Ga0207694_10133940 | Ga0207694_101339402 | 223 |
| 326 | 3300025926 | Ga0207659_10013476 | Ga0207659_100134762 | 223 |
| 327 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002558 | 223 |
| 328 | 3300025927 | Ga0207687_10000039 | Ga0207687_1000003993 | 223 |
| 329 | 3300025927 | Ga0207687_10000132 | Ga0207687_100001323 | 223 |
| 330 | 3300025927 | Ga0207687_10253986 | Ga0207687_102539862 | 223 |
| 331 | 3300025928 | Ga0207700_10000019 | Ga0207700_10000019147 | 223 |
| 332 | 3300025931 | Ga0207644_10045909 | Ga0207644_100459093 | 223 |
| 333 | 3300025932 | Ga0207690_10002070 | Ga0207690_100020704 | 223 |
| 334 | 3300025932 | Ga0207690_10003853 | Ga0207690_100038534 | 223 |
| 335 | 3300025933 | Ga0207706_10000137 | Ga0207706_1000013748 | 223 |
| 336 | 3300025933 | Ga0207706_10018044 | Ga0207706_100180446 | 223 |
| 337 | 3300025934 | Ga0207686_10163451 | Ga0207686_101634512 | 223 |
| 338 | 3300025934 | Ga0207686_10321111 | Ga0207686_103211112 | 223 |
| 339 | 3300025935 | Ga0207709_10008448 | Ga0207709_100084484 | 223 |
| 340 | 3300025935 | Ga0207709_10084855 | Ga0207709_100848552 | 223 |
| 341 | 3300025935 | Ga0207709_10202872 | Ga0207709_102028722 | 223 |
| 342 | 3300025936 | Ga0207670_10042755 | Ga0207670_100427552 | 223 |
| 343 | 3300025936 | Ga0207670_10080833 | Ga0207670_100808332 | 223 |
| 344 | 3300025936 | Ga0207670_10086521 | Ga0207670_100865211 | 223 |
| 345 | 3300025937 | Ga0207669_10000032 | Ga0207669_1000003238 | 223 |
| 346 | 3300025937 | Ga0207669_10000091 | Ga0207669_1000009118 | 223 |
| 347 | 3300025937 | Ga0207669_10036052 | Ga0207669_100360524 | 223 |
| 348 | 3300025938 | Ga0207704_10000054 | Ga0207704_1000005413 | 223 |
| 349 | 3300025938 | Ga0207704_10007544 | Ga0207704_100075443 | 223 |
| 350 | 3300025938 | Ga0207704_10179115 | Ga0207704_101791151 | 223 |
| 351 | 3300025940 | Ga0207691_10000871 | Ga0207691_1000087130 | 223 |
| 352 | 3300025940 | Ga0207691_10101984 | Ga0207691_101019843 | 223 |
| 353 | 3300025941 | Ga0207711_10000011 | Ga0207711_1000001167 | 223 |
| 354 | 3300025944 | Ga0207661_10013754 | Ga0207661_100137544 | 223 |
| 355 | 3300025944 | Ga0207661_10172475 | Ga0207661_101724752 | 223 |
| 356 | 3300025944 | Ga0207661_10501217 | Ga0207661_105012172 | 223 |
| 357 | 3300025944 | Ga0207661_10506325 | Ga0207661_105063252 | 223 |
| 358 | 3300025945 | Ga0207679_10069800 | Ga0207679_100698002 | 223 |
| 359 | 3300025945 | Ga0207679_10286039 | Ga0207679_102860392 | 223 |
| 360 | 3300025949 | Ga0207667_10533547 | Ga0207667_105335472 | 223 |
| 361 | 3300025960 | Ga0207651_10003068 | Ga0207651_100030682 | 223 |
| 362 | 3300025961 | Ga0207712_10000067 | Ga0207712_10000067102 | 223 |
| 363 | 3300025961 | Ga0207712_10007677 | Ga0207712_100076771 | 223 |
| 364 | 3300025961 | Ga0207712_10175846 | Ga0207712_101758462 | 223 |
| 365 | 3300025972 | Ga0207668_10031591 | Ga0207668_100315914 | 223 |
| 366 | 3300025986 | Ga0207658_10003743 | Ga0207658_100037432 | 223 |
| 367 | 3300025986 | Ga0207658_10004686 | Ga0207658_100046869 | 223 |
| 368 | 3300026023 | Ga0207677_10000903 | Ga0207677_100009034 | 223 |
| 369 | 3300026023 | Ga0207677_10208902 | Ga0207677_102089022 | 223 |
| 370 | 3300026035 | Ga0207703_10000070 | Ga0207703_10000070113 | 223 |
| 371 | 3300026035 | Ga0207703_10000122 | Ga0207703_1000012245 | 223 |
| 372 | 3300026035 | Ga0207703_10034693 | Ga0207703_100346932 | 223 |
| 373 | 3300026035 | Ga0207703_10372524 | Ga0207703_103725242 | 223 |
| 374 | 3300026041 | Ga0207639_10005680 | Ga0207639_100056805 | 223 |
| 375 | 3300026041 | Ga0207639_10249960 | Ga0207639_102499602 | 223 |
| 376 | 3300026041 | Ga0207639_10615519 | Ga0207639_106155191 | 223 |
| 377 | 3300026067 | Ga0207678_10005860 | Ga0207678_100058606 | 223 |
| 378 | 3300026067 | Ga0207678_10008898 | Ga0207678_100088987 | 223 |
| 379 | 3300026075 | Ga0207708_10002304 | Ga0207708_1000230412 | 223 |
| 380 | 3300026075 | Ga0207708_10035998 | Ga0207708_100359983 | 223 |
| 381 | 3300026075 | Ga0207708_10069224 | Ga0207708_100692244 | 223 |
| 382 | 3300026075 | Ga0207708_10119320 | Ga0207708_101193202 | 223 |
| 383 | 3300026078 | Ga0207702_10008754 | Ga0207702_100087547 | 223 |
| 384 | 3300026078 | Ga0207702_10011625 | Ga0207702_100116257 | 223 |
| 385 | 3300026088 | Ga0207641_10000065 | Ga0207641_10000065133 | 223 |
| 386 | 3300026088 | Ga0207641_10012714 | Ga0207641_100127146 | 223 |
| 387 | 3300026088 | Ga0207641_10054404 | Ga0207641_100544043 | 223 |
| 388 | 3300026089 | Ga0207648_10004608 | Ga0207648_1000460815 | 223 |
| 389 | 3300026089 | Ga0207648_10005283 | Ga0207648_100052834 | 223 |
| 390 | 3300026095 | Ga0207676_10000025 | Ga0207676_10000025110 | 223 |
| 391 | 3300026116 | Ga0207674_10082436 | Ga0207674_100824364 | 223 |
| 392 | 3300026118 | Ga0207675_100142208 | Ga0207675_1001422084 | 223 |
| 393 | 3300026118 | Ga0207675_100518531 | Ga0207675_1005185312 | 223 |
| 394 | 3300026121 | Ga0207683_10026953 | Ga0207683_100269536 | 223 |
| 395 | 3300026121 | Ga0207683_10056797 | Ga0207683_100567974 | 223 |
| 396 | 3300026121 | Ga0207683_10089063 | Ga0207683_100890633 | 223 |
| 397 | 3300026142 | Ga0207698_10000014 | Ga0207698_1000001488 | 223 |
| 398 | 3300027907 | Ga0207428_10007473 | Ga0207428_100074737 | 223 |
| 399 | 3300027907 | Ga0207428_10339852 | Ga0207428_103398522 | 223 |
| 400 | 3300028379 | Ga0268266_10000029 | Ga0268266_1000002999 | 223 |
| 401 | 3300028379 | Ga0268266_10000973 | Ga0268266_1000097328 | 223 |
| 402 | 3300028379 | Ga0268266_10002641 | Ga0268266_100026416 | 223 |
| 403 | 3300028379 | Ga0268266_10038476 | Ga0268266_100384765 | 223 |
| 404 | 3300028379 | Ga0268266_10773598 | Ga0268266_107735981 | 223 |
| 405 | 3300028380 | Ga0268265_10017817 | Ga0268265_100178172 | 223 |
| 406 | 3300028381 | Ga0268264_10002647 | Ga0268264_100026475 | 223 |
| 407 | 3300028381 | Ga0268264_10044924 | Ga0268264_100449242 | 223 |
| 408 | 3300028381 | Ga0268264_10085791 | Ga0268264_100857912 | 223 |
| 409 | 3300028381 | Ga0268264_10277561 | Ga0268264_102775612 | 223 |
| 410 | 3300028556 | Ga0265337_1000112 | Ga0265337_100011224 | 223 |
| 411 | 3300028558 | Ga0265326_10000040 | Ga0265326_1000004063 | 223 |
| 412 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003072 | 223 |
| 413 | 3300028654 | Ga0265322_10000012 | Ga0265322_1000001286 | 223 |
| 414 | 3300028666 | Ga0265336_10005375 | Ga0265336_100053752 | 223 |
| 415 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015672 | 223 |
| 416 | 3300029957 | Ga0265324_10000202 | Ga0265324_100002029 | 223 |
| 417 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001784 | 223 |
| 418 | 3300031242 | Ga0265329_10008221 | Ga0265329_100082214 | 223 |
| 419 | 3300031250 | Ga0265331_10001236 | Ga0265331_1000123614 | 223 |
| 420 | 3300031250 | Ga0265331_10009016 | Ga0265331_100090162 | 223 |
| 421 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003784 | 223 |
| 422 | 3300031344 | Ga0265316_10063543 | Ga0265316_100635433 | 223 |
| 423 | 3300031711 | Ga0265314_10000178 | Ga0265314_100001787 | 223 |
| 424 | 3300031712 | Ga0265342_10131138 | Ga0265342_101311382 | 223 |
| 425 | 3300037466 | Ga0395898_0026087 | Ga0395898_0026087_2062_2742 | 223 |
| 426 | 3300037466 | Ga0395898_0161389 | Ga0395898_0161389_494_1174 | 223 |
| 427 | 3300037466 | Ga0395898_0173287 | Ga0395898_0173287_1181_1861 | 223 |
| 428 | 3300037471 | Ga0395905_0015772 | Ga0395905_0015772_1648_2328 | 223 |
| 429 | 3300037471 | Ga0395905_0430491 | Ga0395905_0430491_336_1013 | 223 |
| 430 | 3300037471 | Ga0395905_0682486 | Ga0395905_0682486_181_861 | 223 |
| 431 | 3300038443 | Ga0395901_0028155 | Ga0395901_0028155_3094_3774 | 223 |
| 432 | 3300038443 | Ga0395901_0036480 | Ga0395901_0036480_4095_4775 | 223 |
| 433 | 3300038443 | Ga0395901_0162803 | Ga0395901_0162803_679_1365 | 223 |
| 434 | 3300041486 | Ga0451807_2152006 | Ga0451807_2152006_424_1095 | 223 |
| 435 | 3300041496 | Ga0451839_1478570 | Ga0451839_1478570_478_1149 | 223 |
| 436 | 3300041503 | Ga0451847_0664677 | Ga0451847_0664677_55_726 | 223 |
| 437 | 3300041512 | Ga0451853_0220151 | Ga0451853_0220151_6618_7289 | 223 |
| 438 | 3300041512 | Ga0451853_0313996 | Ga0451853_0313996_445_1137 | 223 |
| 439 | 3300041512 | Ga0451853_1765258 | Ga0451853_1765258_405_1076 | 223 |
| 440 | 3300044694 | Ga0466963_0008734 | Ga0466963_0008734_2883_3554 | 223 |
| 441 | 3300044706 | Ga0466964_0046096 | Ga0466964_0046096_765_1445 | 223 |
| 442 | 3300044842 | Ga0466957_0000193 | Ga0466957_0000193_22140_22829 | 223 |
| 443 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_11708_12379 | 223 |
| 444 | 3300045976 | Ga0466967_0011027 | Ga0466967_0011027_4418_5092 | 223 |
| 445 | 3300045976 | Ga0466967_0015892 | Ga0466967_0015892_5038_5718 | 223 |
| 446 | 3300046454 | Ga0495592_0000752 | Ga0495592_0000752_12970_13641 | 223 |
| 447 | 3300046454 | Ga0495592_0076093 | Ga0495592_0076093_1348_2019 | 223 |
| 448 | 3300046454 | Ga0495592_0272470 | Ga0495592_0272470_338_1009 | 223 |
| 449 | 3300046454 | Ga0495592_0398294 | Ga0495592_0398294_174_845 | 223 |
| 450 | 3300046455 | Ga0495603_0011119 | Ga0495603_0011119_3238_3909 | 223 |
| 451 | 3300046455 | Ga0495603_0014198 | Ga0495603_0014198_1564_2235 | 223 |
| 452 | 3300046459 | Ga0495629_0022877 | Ga0495629_0022877_2126_2797 | 223 |
| 453 | 3300046459 | Ga0495629_0044352 | Ga0495629_0044352_2013_2684 | 223 |
| 454 | 3300046459 | Ga0495629_0100201 | Ga0495629_0100201_777_1448 | 223 |
| 455 | 3300046459 | Ga0495629_0244927 | Ga0495629_0244927_512_1183 | 223 |
| 456 | 3300046459 | Ga0495629_0295508 | Ga0495629_0295508_276_956 | 223 |
| 457 | 3300046460 | Ga0495638_0095073 | Ga0495638_0095073_1069_1740 | 223 |
| 458 | 3300046461 | Ga0495641_0000010 | Ga0495641_0000010_23499_24170 | 223 |
| 459 | 3300046461 | Ga0495641_0132546 | Ga0495641_0132546_263_934 | 223 |
| 460 | 3300046463 | Ga0495653_0088276 | Ga0495653_0088276_831_1505 | 223 |
| 461 | 3300046463 | Ga0495653_0134943 | Ga0495653_0134943_952_1626 | 223 |
| 462 | 3300046473 | Ga0495582_0000006 | Ga0495582_0000006_68695_69366 | 223 |
| 463 | 3300046475 | Ga0495639_0038123 | Ga0495639_0038123_1168_1848 | 223 |
| 464 | 3300046476 | Ga0495662_0000212 | Ga0495662_0000212_9580_10251 | 223 |
| 465 | 3300046476 | Ga0495662_0066891 | Ga0495662_0066891_388_1059 | 223 |
| 466 | 3300046477 | Ga0495664_0177973 | Ga0495664_0177973_559_1230 | 223 |
| 467 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_65164_65844 | 223 |
| 468 | 3300046500 | Ga0495596_0085654 | Ga0495596_0085654_36_716 | 223 |
| 469 | 3300046511 | Ga0495608_0000906 | Ga0495608_0000906_1277_1954 | 223 |
| 470 | 3300046511 | Ga0495608_0000961 | Ga0495608_0000961_7122_7802 | 223 |
| 471 | 3300046511 | Ga0495608_0016325 | Ga0495608_0016325_566_1237 | 223 |
| 472 | 3300046514 | Ga0495618_0134981 | Ga0495618_0134981_59_730 | 223 |
| 473 | 3300046515 | Ga0495620_0001375 | Ga0495620_0001375_2094_2765 | 223 |
| 474 | 3300046516 | Ga0495628_0002123 | Ga0495628_0002123_2534_3208 | 223 |
| 475 | 3300046516 | Ga0495628_0051337 | Ga0495628_0051337_2255_2926 | 223 |
| 476 | 3300046516 | Ga0495628_0052940 | Ga0495628_0052940_1108_1899 | 223 |
| 477 | 3300046516 | Ga0495628_0099294 | Ga0495628_0099294_1186_1857 | 223 |
| 478 | 3300046516 | Ga0495628_0101679 | Ga0495628_0101679_346_1017 | 223 |
| 479 | 3300046516 | Ga0495628_0231255 | Ga0495628_0231255_27_707 | 223 |
| 480 | 3300046517 | Ga0495630_0000148 | Ga0495630_0000148_18274_18945 | 223 |
| 481 | 3300046517 | Ga0495630_0003200 | Ga0495630_0003200_9407_10078 | 223 |
| 482 | 3300046523 | Ga0495644_0046136 | Ga0495644_0046136_917_1594 | 223 |
| 483 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_200402_201073 | 223 |
| 484 | 3300046529 | Ga0495652_0018702 | Ga0495652_0018702_5313_6071 | 223 |
| 485 | 3300046533 | Ga0495640_0029026 | Ga0495640_0029026_716_1387 | 223 |
| 486 | 3300046533 | Ga0495640_0256084 | Ga0495640_0256084_308_991 | 223 |
| 487 | 3300046536 | Ga0495587_0002768 | Ga0495587_0002768_3859_4530 | 223 |
| 488 | 3300046536 | Ga0495587_0122209 | Ga0495587_0122209_189_860 | 223 |
| 489 | 3300046536 | Ga0495587_0316785 | Ga0495587_0316785_32_703 | 223 |
| 490 | 3300046536 | Ga0495587_0363098 | Ga0495587_0363098_44_715 | 223 |
| 491 | 3300046543 | Ga0495645_0003129 | Ga0495645_0003129_5760_6431 | 223 |
| 492 | 3300046543 | Ga0495645_0005828 | Ga0495645_0005828_6038_6829 | 223 |
| 493 | 3300046557 | Ga0495622_0000069 | Ga0495622_0000069_68362_69042 | 223 |
| 494 | 3300046559 | Ga0495667_0000067 | Ga0495667_0000067_3489_4166 | 223 |
| 495 | 3300046559 | Ga0495667_0162667 | Ga0495667_0162667_562_1236 | 223 |
| 496 | 3300046615 | Ga0495656_0000217 | Ga0495656_0000217_14694_15383 | 223 |
| 497 | 3300046616 | Ga0495668_0262150 | Ga0495668_0262150_240_911 | 223 |
| 498 | 3300046642 | Ga0495634_0000021 | Ga0495634_0000021_68244_68915 | 223 |
| 499 | 3300046642 | Ga0495634_0000590 | Ga0495634_0000590_10382_11053 | 223 |
| 500 | 3300046642 | Ga0495634_0002438 | Ga0495634_0002438_5091_5762 | 223 |
| 501 | 3300046642 | Ga0495634_0031586 | Ga0495634_0031586_2612_3283 | 223 |
| 502 | 3300046642 | Ga0495634_0064324 | Ga0495634_0064324_375_1046 | 223 |
| 503 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_47850_48548 | 223 |
| 504 | 3300046663 | Ga0495635_0000006 | Ga0495635_0000006_41886_42557 | 223 |
| 505 | 3300046663 | Ga0495635_0011707 | Ga0495635_0011707_3736_4410 | 223 |
| 506 | 3300046663 | Ga0495635_0159165 | Ga0495635_0159165_213_884 | 223 |
| 507 | 3300046675 | Ga0495657_0001466 | Ga0495657_0001466_12545_13225 | 223 |
| 508 | 3300046675 | Ga0495657_0055478 | Ga0495657_0055478_1016_1687 | 223 |
| 509 | 3300046678 | Ga0495599_0030763 | Ga0495599_0030763_2534_3211 | 223 |
| 510 | 3300046678 | Ga0495599_0108835 | Ga0495599_0108835_456_1214 | 223 |
| 511 | 3300046681 | Ga0495647_0000002 | Ga0495647_0000002_23347_24018 | 223 |
| 512 | 3300046681 | Ga0495647_0002225 | Ga0495647_0002225_4391_5062 | 223 |
| 513 | 3300046681 | Ga0495647_0031177 | Ga0495647_0031177_1176_1847 | 223 |
| 514 | 3300046683 | Ga0495658_0000027 | Ga0495658_0000027_71069_71740 | 223 |
| 515 | 3300046683 | Ga0495658_0022546 | Ga0495658_0022546_593_1279 | 223 |
| 516 | 3300046684 | Ga0495669_0000132 | Ga0495669_0000132_45644_46315 | 223 |
| 517 | 3300046689 | Ga0495613_0000287 | Ga0495613_0000287_24179_24850 | 223 |
| 518 | 3300046690 | Ga0495624_0000005 | Ga0495624_0000005_21505_22176 | 223 |
| 519 | 3300046690 | Ga0495624_0001686 | Ga0495624_0001686_64_747 | 223 |
| 520 | 3300046809 | Ga0495600_0002327 | Ga0495600_0002327_7410_8084 | 223 |
| 521 | 3300046809 | Ga0495600_0390129 | Ga0495600_0390129_26_700 | 223 |
| 522 | 3300047317 | Ga0495604_0000636 | Ga0495604_0000636_29411_30082 | 223 |
| 523 | 3300047317 | Ga0495604_0039842 | Ga0495604_0039842_498_1169 | 223 |
| 524 | 3300047317 | Ga0495604_0047775 | Ga0495604_0047775_719_1390 | 223 |
| 525 | 3300047317 | Ga0495604_0065241 | Ga0495604_0065241_1898_2569 | 223 |
| 526 | 3300047319 | Ga0495674_0000141 | Ga0495674_0000141_41159_41830 | 223 |
| 527 | 3300047320 | Ga0495672_0063182 | Ga0495672_0063182_775_1470 | 223 |
| 528 | 3300047320 | Ga0495672_0157138 | Ga0495672_0157138_60_743 | 223 |
| 529 | 3300047321 | Ga0495676_0000209 | Ga0495676_0000209_31723_32394 | 223 |
| 530 | 3300047321 | Ga0495676_0003630 | Ga0495676_0003630_1248_1919 | 223 |
| 531 | 3300047321 | Ga0495676_0156171 | Ga0495676_0156171_675_1355 | 223 |
| 532 | 3300047321 | Ga0495676_0170705 | Ga0495676_0170705_83_754 | 223 |
| 533 | 3300047322 | Ga0495680_0000541 | Ga0495680_0000541_19836_20507 | 223 |
| 534 | 3300047322 | Ga0495680_0009424 | Ga0495680_0009424_3449_4126 | 223 |
| 535 | 3300047322 | Ga0495680_0417123 | Ga0495680_0417123_64_735 | 223 |
| 536 | 3300047444 | Ga0495675_0000744 | Ga0495675_0000744_7122_7802 | 223 |
| 537 | 3300047446 | Ga0495679_007935 | Ga0495679_007935_1718_2395 | 223 |
| 538 | 3300047469 | Ga0495673_0102879 | Ga0495673_0102879_152_823 | 223 |
| 539 | 3300047471 | Ga0495684_0456242 | Ga0495684_0456242_188_859 | 223 |
| 540 | 3300047673 | Ga0495593_0144565 | Ga0495593_0144565_184_855 | 223 |
| 541 | 3300048088 | Ga0495602_0000038 | Ga0495602_0000038_52149_52820 | 223 |
| 542 | 3300048088 | Ga0495602_0002031 | Ga0495602_0002031_137_808 | 223 |
| 543 | 3300048088 | Ga0495602_0320626 | Ga0495602_0320626_195_866 | 223 |
| 544 | 3300048089 | Ga0495614_0068148 | Ga0495614_0068148_677_1348 | 223 |
| 545 | 3300048089 | Ga0495614_0154143 | Ga0495614_0154143_82_762 | 223 |
| 546 | 3300048903 | Ga0496100_0000006 | Ga0496100_0000006_273845_274516 | 223 |
| 547 | 3300048903 | Ga0496100_0000028 | Ga0496100_0000028_72213_72884 | 223 |
| 548 | 3300048903 | Ga0496100_0129393 | Ga0496100_0129393_89_769 | 223 |
| 549 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_222212_222883 | 223 |
| 550 | 3300048904 | Ga0496101_0000009 | Ga0496101_0000009_273845_274516 | 223 |
| 551 | 3300048904 | Ga0496101_0053863 | Ga0496101_0053863_1183_1863 | 223 |
| 552 | 3300048904 | Ga0496101_0135816 | Ga0496101_0135816_330_1010 | 223 |
| 553 | 3300048904 | Ga0496101_0271136 | Ga0496101_0271136_519_1205 | 223 |
| 554 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_149804_150475 | 223 |
| 555 | 3300048905 | Ga0496102_0002673 | Ga0496102_0002673_8926_9636 | 223 |
| 556 | 3300048905 | Ga0496102_0096157 | Ga0496102_0096157_1987_2658 | 223 |
| 557 | 3300048905 | Ga0496102_0237758 | Ga0496102_0237758_976_1656 | 223 |
| 558 | 3300048905 | Ga0496102_0255827 | Ga0496102_0255827_389_1066 | 223 |
| 559 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_445432_446103 | 223 |
| 560 | 3300048906 | Ga0496103_0023977 | Ga0496103_0023977_545_1255 | 223 |
| 561 | 3300048906 | Ga0496103_0029172 | Ga0496103_0029172_1034_1705 | 223 |
| 562 | 3300048906 | Ga0496103_0102441 | Ga0496103_0102441_511_1218 | 223 |
| 563 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_454157_454846 | 223 |
| 564 | 3300048907 | Ga0496104_0000214 | Ga0496104_0000214_36250_36921 | 223 |
| 565 | 3300048907 | Ga0496104_0052830 | Ga0496104_0052830_1303_1974 | 223 |
| 566 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_454157_454846 | 223 |
| 567 | 3300048908 | Ga0496105_0001724 | Ga0496105_0001724_357_1028 | 223 |
| 568 | 3300048908 | Ga0496105_0017098 | Ga0496105_0017098_4246_4926 | 223 |
| 569 | 3300048908 | Ga0496105_0019479 | Ga0496105_0019479_1661_2344 | 223 |
| 570 | 3300048909 | Ga0496106_0000070 | Ga0496106_0000070_41109_41780 | 223 |
| 571 | 3300048909 | Ga0496106_0000101 | Ga0496106_0000101_13_684 | 223 |
| 572 | 3300048909 | Ga0496106_0000728 | Ga0496106_0000728_123_794 | 223 |
| 573 | 3300048909 | Ga0496106_0319157 | Ga0496106_0319157_153_860 | 223 |
| 574 | 3300048909 | Ga0496106_0425903 | Ga0496106_0425903_189_875 | 223 |
| 575 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_222429_223100 | 223 |
| 576 | 3300048910 | Ga0496107_0000015 | Ga0496107_0000015_170073_170744 | 223 |
| 577 | 3300048910 | Ga0496107_0022566 | Ga0496107_0022566_3117_3803 | 223 |
| 578 | 3300048910 | Ga0496107_0026016 | Ga0496107_0026016_817_1497 | 223 |
| 579 | 3300048910 | Ga0496107_0090299 | Ga0496107_0090299_773_1477 | 223 |
| 580 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_113663_114352 | 223 |
| 581 | 3300048911 | Ga0496108_0000042 | Ga0496108_0000042_85807_86478 | 223 |
| 582 | 3300048911 | Ga0496108_0000339 | Ga0496108_0000339_36054_36740 | 223 |
| 583 | 3300048911 | Ga0496108_0006479 | Ga0496108_0006479_5545_6225 | 223 |
| 584 | 3300048911 | Ga0496108_0018633 | Ga0496108_0018633_731_1417 | 223 |
| 585 | 3300048911 | Ga0496108_0196024 | Ga0496108_0196024_213_884 | 223 |
| 586 | 3300048911 | Ga0496108_0340366 | Ga0496108_0340366_222_902 | 223 |
| 587 | 3300048911 | Ga0496108_0716586 | Ga0496108_0716586_175_846 | 223 |
| 588 | 3300048912 | Ga0496109_0000034 | Ga0496109_0000034_118446_119117 | 223 |
| 589 | 3300048912 | Ga0496109_0000036 | Ga0496109_0000036_39622_40311 | 223 |
| 590 | 3300048912 | Ga0496109_0001321 | Ga0496109_0001321_13885_14571 | 223 |
| 591 | 3300048912 | Ga0496109_0054544 | Ga0496109_0054544_1913_2599 | 223 |
| 592 | 3300048912 | Ga0496109_0064189 | Ga0496109_0064189_213_884 | 223 |
| 593 | 3300048912 | Ga0496109_0226122 | Ga0496109_0226122_640_1311 | 223 |
| 594 | 3300048912 | Ga0496109_0325920 | Ga0496109_0325920_546_1217 | 223 |
| 595 | 3300048912 | Ga0496109_0375006 | Ga0496109_0375006_377_1054 | 223 |
| 596 | 3300048913 | Ga0496110_0014992 | Ga0496110_0014992_3056_3739 | 223 |
| 597 | 3300048913 | Ga0496110_0018529 | Ga0496110_0018529_3370_4041 | 223 |
| 598 | 3300048913 | Ga0496110_0121149 | Ga0496110_0121149_1478_2155 | 223 |
| 599 | 3300048913 | Ga0496110_0122644 | Ga0496110_0122644_1465_2145 | 223 |
| 600 | 3300048913 | Ga0496110_0179318 | Ga0496110_0179318_1157_1843 | 223 |
| 601 | 3300048914 | Ga0496111_0010778 | Ga0496111_0010778_1184_1870 | 223 |
| 602 | 3300048914 | Ga0496111_0024519 | Ga0496111_0024519_598_1284 | 223 |
| 603 | 3300048914 | Ga0496111_0031656 | Ga0496111_0031656_1353_2030 | 223 |
| 604 | 3300048914 | Ga0496111_0212970 | Ga0496111_0212970_82_765 | 223 |
| 605 | 3300048914 | Ga0496111_0328953 | Ga0496111_0328953_387_1067 | 223 |
| 606 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_196147_196821 | 223 |
| 607 | 3300048915 | Ga0496112_0002000 | Ga0496112_0002000_4400_5071 | 223 |
| 608 | 3300048915 | Ga0496112_0306431 | Ga0496112_0306431_55_735 | 223 |
| 609 | 3300048915 | Ga0496112_0660596 | Ga0496112_0660596_78_764 | 223 |
| 610 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_70175_70846 | 223 |
| 611 | 3300048916 | Ga0496113_0031981 | Ga0496113_0031981_2465_3136 | 223 |
| 612 | 3300048916 | Ga0496113_0062635 | Ga0496113_0062635_42_716 | 223 |
| 613 | 3300048916 | Ga0496113_0101852 | Ga0496113_0101852_466_1146 | 223 |
| 614 | 3300048916 | Ga0496113_0294441 | Ga0496113_0294441_186_857 | 223 |
| 615 | 3300048916 | Ga0496113_0599258 | Ga0496113_0599258_52_741 | 223 |
| 616 | 3300048917 | Ga0496114_0000097 | Ga0496114_0000097_56082_56756 | 223 |
| 617 | 3300048917 | Ga0496114_0021651 | Ga0496114_0021651_1453_2124 | 223 |
| 618 | 3300048917 | Ga0496114_0045364 | Ga0496114_0045364_1317_1988 | 223 |
| 619 | 3300048917 | Ga0496114_0341724 | Ga0496114_0341724_148_828 | 223 |
| 620 | 3300048917 | Ga0496114_0431426 | Ga0496114_0431426_50_754 | 223 |
| 621 | 3300048917 | Ga0496114_0460846 | Ga0496114_0460846_234_905 | 223 |
| 622 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_83235_83906 | 223 |
| 623 | 3300048918 | Ga0496115_0000151 | Ga0496115_0000151_57184_57858 | 223 |
| 624 | 3300048918 | Ga0496115_0007257 | Ga0496115_0007257_2439_3110 | 223 |
| 625 | 3300048919 | Ga0496116_0000529 | Ga0496116_0000529_2667_3371 | 223 |
| 626 | 3300048920 | Ga0496117_0009095 | Ga0496117_0009095_7470_8180 | 223 |
| 627 | 3300048920 | Ga0496117_0111120 | Ga0496117_0111120_704_1408 | 223 |
| 628 | 3300048921 | Ga0496118_0004226 | Ga0496118_0004226_8772_9482 | 223 |
| 629 | 3300048922 | Ga0496119_0000489 | Ga0496119_0000489_50846_51550 | 223 |
| 630 | 3300048922 | Ga0496119_0032699 | Ga0496119_0032699_2567_3274 | 223 |
| 631 | 3300048922 | Ga0496119_0062938 | Ga0496119_0062938_1204_1908 | 223 |
| 632 | 3300048923 | Ga0496120_0025331 | Ga0496120_0025331_2798_3502 | 223 |
| 633 | 3300048923 | Ga0496120_0117004 | Ga0496120_0117004_428_1099 | 223 |
| 634 | 3300048924 | Ga0496121_0020170 | Ga0496121_0020170_2929_3636 | 223 |
| 635 | 3300048924 | Ga0496121_0035115 | Ga0496121_0035115_2003_2707 | 223 |
| 636 | 3300048927 | Ga0496124_0243420 | Ga0496124_0243420_353_1057 | 223 |
| 637 | 3300048927 | Ga0496124_0308521 | Ga0496124_0308521_30_734 | 223 |
| 638 | 3300048928 | Ga0496125_0037383 | Ga0496125_0037383_2034_2741 | 223 |
| 639 | 3300048928 | Ga0496125_0055740 | Ga0496125_0055740_1847_2536 | 223 |
| 640 | 3300048928 | Ga0496125_0126549 | Ga0496125_0126549_208_918 | 223 |
| 641 | 3300048929 | Ga0496126_0019475 | Ga0496126_0019475_4908_5612 | 223 |
| 642 | 3300048929 | Ga0496126_0048743 | Ga0496126_0048743_1126_1830 | 223 |
| 643 | 3300048929 | Ga0496126_0206190 | Ga0496126_0206190_685_1389 | 223 |
| 644 | 3300049568 | Ga0501031_0000885 | Ga0501031_0000885_5784_6491 | 223 |
| 645 | 3300049569 | Ga0501032_0000843 | Ga0501032_0000843_18437_19144 | 223 |
| 646 | 3300049570 | Ga0501033_0001203 | Ga0501033_0001203_16836_17543 | 223 |
| 647 | 3300049571 | Ga0501034_0004760 | Ga0501034_0004760_5784_6491 | 223 |
| 648 | 3300049572 | Ga0501036_0000711 | Ga0501036_0000711_18141_18848 | 223 |
| 649 | 3300049573 | Ga0501037_0000522 | Ga0501037_0000522_24375_25082 | 223 |
| 650 | 3300049574 | Ga0501038_0105353 | Ga0501038_0105353_941_1648 | 223 |
| 651 | 3300049574 | Ga0501038_0191438 | Ga0501038_0191438_265_945 | 223 |
| 652 | 3300049575 | Ga0501039_0013392 | Ga0501039_0013392_5248_5955 | 223 |
| 653 | 3300049575 | Ga0501039_0056990 | Ga0501039_0056990_2304_2975 | 223 |
| 654 | 3300049575 | Ga0501039_0248670 | Ga0501039_0248670_237_917 | 223 |
| 655 | 3300049576 | Ga0501040_0118386 | Ga0501040_0118386_241_948 | 223 |
| 656 | 3300049576 | Ga0501040_0475782 | Ga0501040_0475782_31_705 | 223 |
| 657 | 3300049578 | Ga0501042_0048889 | Ga0501042_0048889_1839_2543 | 223 |
| 658 | 3300049578 | Ga0501042_0079610 | Ga0501042_0079610_1624_2313 | 223 |
| 659 | 3300049578 | Ga0501042_0115026 | Ga0501042_0115026_931_1638 | 223 |
| 660 | 3300049579 | Ga0501043_0004212 | Ga0501043_0004212_939_1646 | 223 |
| 661 | 3300049579 | Ga0501043_0669392 | Ga0501043_0669392_64_744 | 223 |
| 662 | 3300049580 | Ga0501046_0001261 | Ga0501046_0001261_5653_6360 | 223 |
| 663 | 3300049580 | Ga0501046_0117959 | Ga0501046_0117959_911_1591 | 223 |
| 664 | 3300049581 | Ga0501047_0001310 | Ga0501047_0001310_18116_18823 | 223 |
| 665 | 3300049581 | Ga0501047_0019766 | Ga0501047_0019766_2853_3557 | 223 |
| 666 | 3300049582 | Ga0501048_0000689 | Ga0501048_0000689_5784_6491 | 223 |
| 667 | 3300049582 | Ga0501048_0160508 | Ga0501048_0160508_291_971 | 223 |
| 668 | 3300049583 | Ga0501067_0135061 | Ga0501067_0135061_50_727 | 223 |
| 669 | 3300049584 | Ga0501068_0020879 | Ga0501068_0020879_290_994 | 223 |
| 670 | 3300049584 | Ga0501068_0122344 | Ga0501068_0122344_22_729 | 223 |
| 671 | 3300049585 | Ga0501069_0014034 | Ga0501069_0014034_1639_2346 | 223 |
| 672 | 3300049585 | Ga0501069_0020680 | Ga0501069_0020680_2139_2843 | 223 |
| 673 | 3300049586 | Ga0501070_0000267 | Ga0501070_0000267_42677_43384 | 223 |
| 674 | 3300049586 | Ga0501070_0036301 | Ga0501070_0036301_1092_1799 | 223 |
| 675 | 3300049586 | Ga0501070_0053280 | Ga0501070_0053280_2501_3205 | 223 |
| 676 | 3300049586 | Ga0501070_0100623 | Ga0501070_0100623_696_1367 | 223 |
| 677 | 3300049586 | Ga0501070_0444584 | Ga0501070_0444584_152_856 | 223 |
| 678 | 3300049588 | Ga0501072_0131714 | Ga0501072_0131714_870_1541 | 223 |
| 679 | 3300049588 | Ga0501072_0167095 | Ga0501072_0167095_65_745 | 223 |
| 680 | 3300049588 | Ga0501072_0202595 | Ga0501072_0202595_579_1286 | 223 |
| 681 | 3300049588 | Ga0501072_0448722 | Ga0501072_0448722_87_767 | 223 |
| 682 | 3300049589 | Ga0501073_0028060 | Ga0501073_0028060_1037_1744 | 223 |
| 683 | 3300049590 | Ga0501074_0010332 | Ga0501074_0010332_744_1451 | 223 |
| 684 | 3300049590 | Ga0501074_0042104 | Ga0501074_0042104_268_948 | 223 |
| 685 | 3300049591 | Ga0501075_0004738 | Ga0501075_0004738_57_728 | 223 |
| 686 | 3300049591 | Ga0501075_0514246 | Ga0501075_0514246_22_702 | 223 |
| 687 | 3300049591 | Ga0501075_0544439 | Ga0501075_0544439_37_708 | 223 |
| 688 | 3300049592 | Ga0501076_0151679 | Ga0501076_0151679_476_1156 | 223 |
| 689 | 3300049592 | Ga0501076_0381068 | Ga0501076_0381068_308_988 | 223 |
| 690 | 3300049593 | Ga0501077_0206649 | Ga0501077_0206649_530_1210 | 223 |
| 691 | 3300049741 | Ga0501079_0208218 | Ga0501079_0208218_775_1479 | 223 |
| 692 | 3300049741 | Ga0501079_0270295 | Ga0501079_0270295_352_1032 | 223 |
| 693 | 3300049742 | Ga0501080_0011059 | Ga0501080_0011059_4321_5028 | 223 |
| 694 | 3300049742 | Ga0501080_0676504 | Ga0501080_0676504_91_798 | 223 |
| 695 | 3300049744 | Ga0501083_0055234 | Ga0501083_0055234_1184_1888 | 223 |
| 696 | 3300049744 | Ga0501083_0114365 | Ga0501083_0114365_77_757 | 223 |
| 697 | 3300049822 | Ga0501035_0001546 | Ga0501035_0001546_5766_6473 | 223 |
| 698 | 3300049823 | Ga0501044_0003136 | Ga0501044_0003136_12276_12983 | 223 |
| 699 | 3300049823 | Ga0501044_0235132 | Ga0501044_0235132_168_872 | 223 |
| 700 | 3300049824 | Ga0501045_0051674 | Ga0501045_0051674_1995_2666 | 223 |
| 701 | 3300049824 | Ga0501045_0097324 | Ga0501045_0097324_850_1530 | 223 |
| 702 | 3300050490 | nmdc:mga03n38_169053_c1 | nmdc:mga03n38_169053_c1_91_771 | 223 |
| 703 | 3300050491 | nmdc:mga00v17_8565_c1 | nmdc:mga00v17_8565_c1_283_969 | 223 |
| 704 | 3300050492 | nmdc:mga0yw44_10477_c1 | nmdc:mga0yw44_10477_c1_3661_4341 | 223 |
| 705 | 3300050492 | nmdc:mga0yw44_175972_c1 | nmdc:mga0yw44_175972_c1_624_1304 | 223 |
| 706 | 3300050494 | nmdc:mga06z11_100731_c1 | nmdc:mga06z11_100731_c1_435_1115 | 223 |
| 707 | 3300050494 | nmdc:mga06z11_18188_c1 | nmdc:mga06z11_18188_c1_2452_3138 | 223 |
| 708 | 3300050507 | nmdc:mga05p37_135351_c1 | nmdc:mga05p37_135351_c1_839_1519 | 223 |
| 709 | 3300050509 | nmdc:mga0qj67_47502_c1 | nmdc:mga0qj67_47502_c1_2457_3158 | 223 |
| 710 | 3300050510 | nmdc:mga06r32_380009_c1 | nmdc:mga06r32_380009_c1_532_1212 | 223 |
| 711 | 3300050510 | nmdc:mga06r32_477478_c1 | nmdc:mga06r32_477478_c1_125_808 | 223 |
| 712 | 3300050511 | nmdc:mga08y16_173595_c1 | nmdc:mga08y16_173595_c1_1386_2063 | 223 |
| 713 | 3300050511 | nmdc:mga08y16_62734_c1 | nmdc:mga08y16_62734_c1_2676_3362 | 223 |
| 714 | 3300050511 | nmdc:mga08y16_7851_c1 | nmdc:mga08y16_7851_c1_1384_2064 | 223 |
| 715 | 3300050512 | nmdc:mga0n895_21750_c1 | nmdc:mga0n895_21750_c1_2508_3188 | 223 |
| 716 | 3300050513 | nmdc:mga0rr50_114078_c1 | nmdc:mga0rr50_114078_c1_1057_1737 | 223 |
| 717 | 3300050514 | nmdc:mga08x19_311158_c1 | nmdc:mga08x19_311158_c1_178_858 | 223 |
| 718 | 3300050515 | nmdc:mga0a205_15_c1 | nmdc:mga0a205_15_c1_26070_26741 | 223 |
| 719 | 3300050515 | nmdc:mga0a205_51329_c1 | nmdc:mga0a205_51329_c1_1293_1973 | 223 |
| 720 | 3300053077 | Ga0495601_0000019 | Ga0495601_0000019_154483_155154 | 223 |
| 721 | 3300053077 | Ga0495601_0000059 | Ga0495601_0000059_35637_36314 | 223 |
| 722 | 3300053077 | Ga0495601_0003867 | Ga0495601_0003867_2459_3130 | 223 |
| 723 | 3300053077 | Ga0495601_0145749 | Ga0495601_0145749_402_1073 | 223 |
| 724 | 3300053078 | Ga0495612_0000122 | Ga0495612_0000122_20707_21378 | 223 |
| 725 | 3300053078 | Ga0495612_0000221 | Ga0495612_0000221_14148_14819 | 223 |
| 726 | 3300053078 | Ga0495612_0012321 | Ga0495612_0012321_2323_3006 | 223 |
| 727 | 3300053083 | Ga0495655_0000013 | Ga0495655_0000013_6543_7214 | 223 |
| 728 | 3300053083 | Ga0495655_0051083 | Ga0495655_0051083_37_708 | 223 |
| 729 | 3300053084 | Ga0495595_0000276 | Ga0495595_0000276_7122_7802 | 223 |
| 730 | 3300053084 | Ga0495595_0001135 | Ga0495595_0001135_9554_10231 | 223 |
| 731 | 3300053084 | Ga0495595_0005273 | Ga0495595_0005273_1834_2505 | 223 |
| 732 | 3300053084 | Ga0495595_0113188 | Ga0495595_0113188_618_1304 | 223 |
| 733 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_897_1586 | 223 |
| 734 | 3300053085 | Ga0495619_0000152 | Ga0495619_0000152_43291_43971 | 223 |
| 735 | 3300053085 | Ga0495619_0000564 | Ga0495619_0000564_4214_4888 | 223 |
| 736 | 3300053085 | Ga0495619_0001238 | Ga0495619_0001238_3554_4228 | 223 |
| 737 | 3300053085 | Ga0495619_0022300 | Ga0495619_0022300_935_1606 | 223 |
| 738 | 3300053085 | Ga0495619_0349213 | Ga0495619_0349213_268_951 | 223 |
| 739 | 3300053094 | Ga0500566_0003812 | Ga0500566_0003812_7715_8386 | 223 |
| 740 | 3300053096 | Ga0500641_0008094 | Ga0500641_0008094_572_1249 | 223 |
| 741 | 3300053123 | Ga0500614_000791 | Ga0500614_000791_2988_3659 | 223 |
| 742 | 3300053129 | Ga0500628_000045 | Ga0500628_000045_35267_35938 | 223 |
| 743 | 3300053134 | Ga0500658_0009977 | Ga0500658_0009977_1806_2516 | 223 |
| 744 | 3300053139 | Ga0500568_0057781 | Ga0500568_0057781_648_1358 | 223 |
| 745 | 3300054114 | Ga0501084_0135644 | Ga0501084_0135644_1015_1695 | 223 |
| 746 | 3300060353 | Ga0501082_0718478 | Ga0501082_0718478_58_738 | 223 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a72-assembly1.cif.gz_A | crystal structure of the omega transaminase from chromobacterium violaceum in a mixture of apo and plp-bound states | 0.7135 | 166 | 206 |
| 4a6r-assembly1.cif.gz_B | crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid | 0.7053 | 166 | 206 |
| 4a6u-assembly1.cif.gz_B | crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from peg 3350 | 0.6894 | 161 | 206 |
| 4a6u-assembly1.cif.gz_A | crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from peg 3350 | 0.6867 | 161 | 206 |
| 6t84-assembly1.cif.gz_A | crystal structure of the mycobacterial trehalose monomycolate transport factor a, ttfa | 0.672 | 10 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LKK8_3_90_3.30.310.50 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.6667 | 161 | 204 | 3.30.310.50 |
| af_Q2G0R8_1016_1167_3.90.1150.50 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Transcription-repair-coupling factor, D7 domain | 0.6592 | 159 | 187 | 3.90.1150.50 |
| 1l5aB03 | Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Nonribosomal peptide synthetase, condensation domain | 0.6475 | 167 | 204 | 3.30.559.30 |
| af_Q5JSP0_362_483_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6468 | 159 | 204 | 2.30.29.30 |
| af_O08816_6_147_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6303 | 159 | 204 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538A327-F1-model_v4 | Uncharacterized protein | 0.9511 | 1 | 223 |
|
| AF-A0A538A327-F1-model_v4 | Uncharacterized protein | 0.9468 | 1 | 223 |
|
| AF-A0A535HG65-F1-model_v4 | Uncharacterized protein | 0.8259 | 80 | 199 |
|
| AF-A0A0M0BZR0-F1-model_v4 | Uncharacterized protein | 0.7735 | 158 | 204 |
|
| AF-D2R360-F1-model_v4 | RING-type domain-containing protein | 0.7719 | 10 | 199 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar