F478836

General Info

Members Datasets Scaffolds Average Seq Length
746 535 535 401

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1015733|JGI25160J50197_10157332
Length 454
Sequence MAYAATADGVNVAVPAAPGVLALQRALVWLVGASGAVVFIEPSPYEITTLLAAIIFFATGLRLRLALMLLNVGYTISAIPLFXQSEVVSWIATSWYMAVTVVFFALVTSEDTAARLDMLRRGLVVGAMVASLLAVAGYFHLVPGGNDLLTLYGRARGTFKDPNVLGAFLILPALFALQSVVSDXFRKAFRNVIAFGIMSLAILLAFSRAAWGGLVLTSAFMLALMVLTSRTNAQRSRIIVMAIVAAVLGLALIAVLLSFDSTAEMFKQRASFDQSYDEGRFGRFGRHILGAEMALDLPFGIGPLQFHRFFPEDTHNSYLNAFMSGGWLSGVCYPALVFTTVIMGFRHIFVPVPWQRAYLAVFSAFVGTVGESFVIDTDHWRHFWMMLGAMWGMIAAAQIYKIRXSRGRVVSLSSELRSRTSTPHYLAAAXXACASTGRAEHRAHRAAGRPRIRR

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
29 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
30 2791355199
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
34 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
35 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
38 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
39 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
40 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
41 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
42 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
43 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
46 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
53 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
54 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
55 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
56 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
57 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
58 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
59 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
60 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
61 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
62 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
63 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
64 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
65 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
66 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
67 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
68 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
69 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
70 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
76 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
77 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
78 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
79 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
80 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
81 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
82 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
83 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
84 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
85 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
86 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
87 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
88 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
89 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
90 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
91 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
92 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
93 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
94 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
95 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
96 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
97 2904699407
98 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
99 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
100 2906610324
101 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
102 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
103 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
104 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
105 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
106 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
107 2922368715
108 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
109 2922425934
110 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
111 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
112 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
113 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
114 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
115 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
116 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
117 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
118 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
119 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
120 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
121 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
122 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
123 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
124 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
125 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
126 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
127 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
128 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
129 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
130 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
131 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
132 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
133 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
134 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
135 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
136 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
137 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
138 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
139 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
140 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
141 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
142 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
143 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
144 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
145 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
146 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
147 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
148 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
149 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
150 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
151 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
152 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
153 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
154 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
155 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
156 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
157 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
158 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
159 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
160 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
161 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
162 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
163 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
164 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
165 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
166 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
167 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
168 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
169 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
170 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
171 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
172 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
173 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
174 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
175 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
176 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
177 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
178 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
179 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
180 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
181 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
182 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
183 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
184 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
185 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
186 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
187 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
188 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
189 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
192 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
193 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
194 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
195 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
196 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
197 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
198 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
199 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
200 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
201 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
202 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
205 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
206 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
207 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
208 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
209 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
210 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
211 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
212 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
213 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
214 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
215 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
216 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
217 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
218 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
219 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
220 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
221 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
222 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
223 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
224 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
225 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
226 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
227 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
228 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
229 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
230 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
231 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
232 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
233 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
234 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
235 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
236 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
237 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
238 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
239 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
240 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
241 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
242 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
243 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
244 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
245 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
246 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
247 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
248 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
249 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
250 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
251 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
252 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
253 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
254 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
255 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
256 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
257 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
258 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
259 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
260 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
261 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
262 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
263 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
264 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
267 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
270 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
272 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
316 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
317 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
318 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
320 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
324 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
325 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
326 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
327 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
328 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
329 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
330 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
331 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
332 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
333 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
334 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
335 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
336 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
337 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
338 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
339 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
340 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
342 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
343 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
344 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
345 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
346 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
352 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
353 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
354 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
355 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
356 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
357 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
358 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
359 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
360 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
361 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
364 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
365 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
366 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
367 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
368 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
369 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
370 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
371 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
372 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
373 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
374 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
375 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
376 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
377 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
378 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
379 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
380 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
384 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
385 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
393 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
394 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
399 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
407 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
408 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
409 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
412 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
413 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
418 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
419 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
420 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
423 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
424 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
425 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
426 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
427 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
434 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
435 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
440 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
446 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
447 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
448 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
452 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
453 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
466 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
467 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
471 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
472 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
473 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
474 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
475 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
476 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
477 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
478 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
479 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
480 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
481 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
482 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
483 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
484 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
485 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
486 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
487 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
488 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
489 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
490 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
491 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
492 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
493 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
494 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
495 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
496 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
497 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
498 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
499 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
500 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
501 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
502 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
503 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
504 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
505 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
506 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
507 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
508 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
509 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
510 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
511 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
512 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
513 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
514 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
515 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
516 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
517 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
518 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
519 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
520 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
521 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
522 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
523 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
524 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
525 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
526 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
527 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
528 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
529 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
530 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
531 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
532 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
533 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
534 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
535 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.2
Metatranscriptomes 0
Isolates 27.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 22.25
Rhizoplane 6.3
Rhizosphere 46.25
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007113 3300001979 Bacteria 4576
2 JGI24739J22299_10014275 3300001989 Bacteria 2891
3 JGI25406J46586_10000006 3300003203 Bacteria 114937
4 JGI25165J46597_1004542 3300003214 Bacteria 2939
5 JGI25153J46596_10000832 3300003215 Bacteria 18852
6 JGI25153J46596_10004981 3300003215 Bacteria 7050
7 JGI25153J46596_10007866 3300003215 Bacteria 5175
8 JGI25153J46596_10009451 3300003215 Bacteria 4529
9 JGI25160J50197_1015733 3300003354 Bacteria 2470
10 JGI25404J52841_10006230 3300003659 Bacteria 2489
11 Ga0055531_10007934 3300003794 Bacteria 5693
12 Ga0055543_1002527 3300004625 Bacteria 5979
13 Ga0065165_1001088 3300005262 Bacteria 32379
14 Ga0065165_1003720 3300005262 Bacteria 10302
15 Ga0065165_1008580 3300005262 Bacteria 4751
16 Ga0070676_10081874 3300005328 Bacteria 1960
17 Ga0070670_100151518 3300005331 Bacteria 2007
18 Ga0068869_100067971 3300005334 Bacteria 2630
19 Ga0070680_100006371 3300005336 Bacteria 8962
20 Ga0070682_100091527 3300005337 Bacteria 1991
21 Ga0068868_100044104 3300005338 Bacteria 3486
22 Ga0070660_100141044 3300005339 Bacteria 1933
23 Ga0070660_100217104 3300005339 Bacteria 1554
24 Ga0070668_100056652 3300005347 Bacteria 3027
25 Ga0070669_100115748 3300005353 Bacteria 2040
26 Ga0070674_100036328 3300005356 Bacteria 3306
27 Ga0070709_10000337 3300005434 Bacteria 29157
28 Ga0070709_10007626 3300005434 Bacteria 5940
29 Ga0070714_100041601 3300005435 Bacteria 3879
30 Ga0070713_100011441 3300005436 Bacteria 6463
31 Ga0070713_100036868 3300005436 Bacteria 3949
32 Ga0070713_100065467 3300005436 Bacteria 3053
33 Ga0070713_100158020 3300005436 Bacteria 2022
34 Ga0070710_10000508 3300005437 Bacteria 18304
35 Ga0070710_10028669 3300005437 Bacteria 2980
36 Ga0070711_100001466 3300005439 Bacteria 12962
37 Ga0070663_100134461 3300005455 Bacteria 1881
38 Ga0070663_100142760 3300005455 Bacteria 1829
39 Ga0070678_100070226 3300005456 Bacteria 2617
40 Ga0070678_100195051 3300005456 Bacteria 1667
41 Ga0070681_10021753 3300005458 Bacteria 6431
42 Ga0070681_10053305 3300005458 Bacteria 4030
43 Ga0070699_100059665 3300005518 Bacteria 3305
44 Ga0070679_100007739 3300005530 Bacteria 10062
45 Ga0070684_100001878 3300005535 Bacteria 15380
46 Ga0068853_100047529 3300005539 Bacteria 3682
47 Ga0068853_100171773 3300005539 Bacteria 1961
48 Ga0068853_100227066 3300005539 Bacteria 1707
49 Ga0070672_100062511 3300005543 Bacteria 2938
50 Ga0070672_100216165 3300005543 Bacteria 1607
51 Ga0070686_100098222 3300005544 Bacteria 1973
52 Ga0070695_100054541 3300005545 Bacteria 2573
53 Ga0070665_100013576 3300005548 Bacteria 8194
54 Ga0070665_100079277 3300005548 Bacteria 3290
55 Ga0070665_100207409 3300005548 Bacteria 1960
56 Ga0070665_100208365 3300005548 Bacteria 1955
57 Ga0070665_100298880 3300005548 Bacteria 1612
58 Ga0068855_100031483 3300005563 Bacteria 6334
59 Ga0068857_100010572 3300005577 Bacteria 8024
60 Ga0068857_100044041 3300005577 Bacteria 3958
61 Ga0068856_100001022 3300005614 Bacteria 29775
62 Ga0068856_100048071 3300005614 Bacteria 4203
63 Ga0068856_100171227 3300005614 Bacteria 2183
64 Ga0068856_100215452 3300005614 Bacteria 1935
65 Ga0068852_100096896 3300005616 Bacteria 2652
66 Ga0068861_100181881 3300005719 Bacteria 1751
67 Ga0068858_100079138 3300005842 Bacteria 3054
68 Ga0068860_100061824 3300005843 Bacteria 3558
69 Ga0068862_100068496 3300005844 Bacteria 3061
70 Ga0081455_10001781 3300005937 Bacteria 26018
71 Ga0081455_10189678 3300005937 Bacteria 1549
72 Ga0081540_1002370 3300005983 Bacteria 15392
73 Ga0081540_1004255 3300005983 Bacteria 10988
74 Ga0081540_1004483 3300005983 Bacteria 10622
75 Ga0081540_1017300 3300005983 Bacteria 4468
76 Ga0081540_1019199 3300005983 Bacteria 4165
77 Ga0081540_1022051 3300005983 Bacteria 3769
78 Ga0081540_1024880 3300005983 Bacteria 3462
79 Ga0081539_10000176 3300005985 Bacteria 150292
80 Ga0075365_10000847 3300006038 Bacteria 12688
81 Ga0075365_10005922 3300006038 Bacteria 6657
82 Ga0075365_10129373 3300006038 Bacteria 1746
83 Ga0075365_10183177 3300006038 Bacteria 1465
84 Ga0075363_100008360 3300006048 Bacteria 4815
85 Ga0075363_100022810 3300006048 Bacteria 3167
86 Ga0075363_100060556 3300006048 Bacteria 2038
87 Ga0075364_10001659 3300006051 Bacteria 12217
88 Ga0075364_10052047 3300006051 Bacteria 2675
89 Ga0070716_100003986 3300006173 Bacteria 7009
90 Ga0075367_10011928 3300006178 Bacteria 4616
91 Ga0075366_10010275 3300006195 Bacteria 5251
92 Ga0075370_10013657 3300006353 Bacteria 4322
93 Ga0075370_10047080 3300006353 Bacteria 2441
94 Ga0075370_10066385 3300006353 Bacteria 2058
95 Ga0068871_100068833 3300006358 Bacteria 2906
96 Ga0068871_100204876 3300006358 Bacteria 1704
97 Ga0068865_100092587 3300006881 Bacteria 2196
98 Ga0099825_1029178 3300006941 Bacteria 2593
99 Ga0099824_1025534 3300006942 Bacteria 3217
100 Ga0099823_1053954 3300006944 Bacteria 2336
101 Ga0099794_10015790 3300007265 Bacteria 3339
102 Ga0099795_10030979 3300007788 Bacteria 1839
103 Ga0105240_10043962 3300009093 Bacteria 5680
104 Ga0105240_10410751 3300009093 Bacteria 1523
105 Ga0111539_10306833 3300009094 Bacteria 1847
106 Ga0105245_10076910 3300009098 Bacteria 3042
107 Ga0105245_10142434 3300009098 Bacteria 2259
108 Ga0105247_10088097 3300009101 Bacteria 1967
109 Ga0105243_10194159 3300009148 Bacteria 1775
110 Ga0105241_10022028 3300009174 Bacteria 4716
111 Ga0105241_10029082 3300009174 Bacteria 4120
112 Ga0105242_10119826 3300009176 Bacteria 2256
113 Ga0105242_10234703 3300009176 Bacteria 1646
114 Ga0105248_10049122 3300009177 Bacteria 4732
115 Ga0105248_10381639 3300009177 Bacteria 1587
116 Ga0105237_10009523 3300009545 Bacteria 10402
117 Ga0105237_10051435 3300009545 Bacteria 4138
118 Ga0105237_10084683 3300009545 Bacteria 3160
119 Ga0105237_10214473 3300009545 Bacteria 1925
120 Ga0105237_10334664 3300009545 Bacteria 1518
121 Ga0105238_10022350 3300009551 Bacteria 6448
122 Ga0105238_10028683 3300009551 Bacteria 5669
123 Ga0105238_10083711 3300009551 Bacteria 3179
124 Ga0105238_10102172 3300009551 Bacteria 2849
125 Ga0105238_10125187 3300009551 Bacteria 2549
126 Ga0105238_10193511 3300009551 Bacteria 2009
127 Ga0105249_10047992 3300009553 Bacteria 3893
128 Ga0105249_10095720 3300009553 Bacteria 2784
129 Ga0105239_10110112 3300010375 Bacteria 3053
130 Ga0105239_10213532 3300010375 Bacteria 2163
131 Ga0105239_10443900 3300010375 Bacteria 1471
132 Ga0105246_10030068 3300011119 Bacteria 3584
133 Ga0105246_10185390 3300011119 Bacteria 1606
134 Ga0157369_10313617 3300013105 Bacteria 1631
135 Ga0157374_10162704 3300013296 Bacteria 2174
136 Ga0157374_10168298 3300013296 Bacteria 2137
137 Ga0157374_10406198 3300013296 Bacteria 1359
138 Ga0157378_10194076 3300013297 Bacteria 1917
139 Ga0157378_10254541 3300013297 Bacteria 1682
140 Ga0163162_10210807 3300013306 Bacteria 2072
141 Ga0163162_10443706 3300013306 Bacteria 1430
142 Ga0157375_10066235 3300013308 Bacteria 3605
143 Ga0157377_10161823 3300014745 Bacteria 1393
144 Ga0214544_1000009 3300021320 Bacteria 285865
145 Ga0214542_1000002 3300021321 Bacteria 720798
146 Ga0214545_1000002 3300021324 Bacteria 727485
147 Ga0214543_1000013 3300021327 Bacteria 329117
148 Ga0213872_10054255 3300021361 Bacteria 1818
149 Ga0209677_100918 3300025253 Bacteria 14404
150 Ga0209148_1000446 3300025254 Bacteria 45354
151 Ga0209233_1005840 3300025261 Bacteria 4041
152 Ga0209455_1001699 3300025272 Bacteria 9434
153 Ga0209564_1003387 3300025295 Bacteria 10992
154 Ga0209758_1000100 3300025297 Bacteria 227948
155 Ga0209758_1001008 3300025297 Bacteria 37348
156 Ga0209758_1001125 3300025297 Bacteria 34352
157 Ga0209758_1002793 3300025297 Bacteria 17073
158 Ga0209758_1003783 3300025297 Bacteria 13341
159 Ga0209758_1005742 3300025297 Bacteria 9346
160 Ga0209256_1001740 3300025299 Bacteria 20811
161 Ga0209256_1021489 3300025299 Bacteria 1978
162 Ga0207426_1001526 3300025302 Bacteria 18870
163 Ga0207426_1004042 3300025302 Bacteria 7425
164 Ga0207426_1009873 3300025302 Bacteria 3741
165 Ga0209257_1006404 3300025304 Bacteria 7602
166 Ga0207697_10032285 3300025315 Bacteria 2143
167 Ga0207696_1037947 3300025711 Bacteria 1424
168 Ga0207692_10001906 3300025898 Bacteria 7932
169 Ga0207692_10013021 3300025898 Bacteria 3595
170 Ga0207692_10025365 3300025898 Bacteria 2768
171 Ga0207710_10005054 3300025900 Bacteria 5716
172 Ga0207710_10024168 3300025900 Bacteria 2615
173 Ga0207680_10082220 3300025903 Bacteria 2026
174 Ga0207647_10002042 3300025904 Bacteria 15435
175 Ga0207647_10009252 3300025904 Bacteria 7006
176 Ga0207699_10000604 3300025906 Bacteria 17559
177 Ga0207699_10094344 3300025906 Bacteria 1885
178 Ga0207645_10025440 3300025907 Bacteria 3830
179 Ga0207654_10015889 3300025911 Bacteria 3914
180 Ga0207654_10020055 3300025911 Bacteria 3537
181 Ga0207707_10000494 3300025912 Bacteria 40531
182 Ga0207707_10035695 3300025912 Bacteria 4347
183 Ga0207707_10049975 3300025912 Bacteria 3643
184 Ga0207695_10001915 3300025913 Bacteria 32381
185 Ga0207695_10047612 3300025913 Bacteria 4535
186 Ga0207671_10008450 3300025914 Bacteria 8728
187 Ga0207671_10047686 3300025914 Bacteria 3171
188 Ga0207693_10003576 3300025915 Bacteria 13283
189 Ga0207663_10004391 3300025916 Bacteria 7001
190 Ga0207652_10085185 3300025921 Bacteria 2770
191 Ga0207694_10001639 3300025924 Bacteria 18837
192 Ga0207694_10143171 3300025924 Bacteria 1923
193 Ga0207687_10060165 3300025927 Bacteria 2678
194 Ga0207664_10006080 3300025929 Bacteria 8268
195 Ga0207690_10044054 3300025932 Bacteria 2940
196 Ga0207706_10017328 3300025933 Bacteria 6489
197 Ga0207706_10204557 3300025933 Bacteria 1731
198 Ga0207706_10219411 3300025933 Bacteria 1665
199 Ga0207704_10133782 3300025938 Bacteria 1722
200 Ga0207665_10001395 3300025939 Bacteria 16252
201 Ga0207665_10048653 3300025939 Bacteria 2847
202 Ga0207691_10232214 3300025940 Bacteria 1597
203 Ga0207711_10165321 3300025941 Bacteria 2005
204 Ga0207711_10257946 3300025941 Bacteria 1602
205 Ga0207661_10001198 3300025944 Bacteria 17338
206 Ga0207667_10045424 3300025949 Bacteria 4652
207 Ga0207667_10110572 3300025949 Bacteria 2834
208 Ga0207651_10161569 3300025960 Bacteria 1757
209 Ga0207651_10188298 3300025960 Bacteria 1644
210 Ga0207712_10025690 3300025961 Bacteria 3916
211 Ga0207668_10045686 3300025972 Bacteria 2988
212 Ga0207668_10049546 3300025972 Bacteria 2888
213 Ga0207640_10006337 3300025981 Bacteria 6489
214 Ga0207677_10241143 3300026023 Bacteria 1462
215 Ga0207703_10097429 3300026035 Bacteria 2485
216 Ga0207639_10026484 3300026041 Bacteria 4214
217 Ga0207639_10139229 3300026041 Bacteria 2020
218 Ga0207678_10003850 3300026067 Bacteria 13493
219 Ga0207678_10029189 3300026067 Bacteria 4814
220 Ga0207678_10048914 3300026067 Bacteria 3653
221 Ga0207708_10086818 3300026075 Bacteria 2408
222 Ga0207702_10000005 3300026078 Bacteria 420296
223 Ga0207702_10056441 3300026078 Bacteria 3334
224 Ga0207702_10234090 3300026078 Bacteria 1718
225 Ga0207648_10090287 3300026089 Bacteria 2677
226 Ga0207674_10016313 3300026116 Bacteria 8136
227 Ga0207674_10022053 3300026116 Bacteria 6846
228 Ga0207674_10068635 3300026116 Bacteria 3567
229 Ga0207675_100131542 3300026118 Bacteria 2373
230 Ga0207675_100196523 3300026118 Bacteria 1936
231 Ga0207683_10039306 3300026121 Bacteria 4127
232 Ga0207683_10041843 3300026121 Bacteria 4001
233 Ga0207698_10098663 3300026142 Bacteria 2414
234 Ga0207698_10168600 3300026142 Bacteria 1925
235 Ga0209389_1000084 3300027296 Bacteria 85267
236 Ga0209389_1000113 3300027296 Bacteria 72242
237 Ga0209589_1000023 3300027357 Bacteria 177856
238 Ga0209589_1000041 3300027357 Bacteria 125191
239 Ga0209489_100032 3300027361 Bacteria 177856
240 Ga0209489_100070 3300027361 Bacteria 138580
241 Ga0209489_107143 3300027361 Bacteria 17020
242 Ga0209700_100021 3300027363 Bacteria 230859
243 Ga0209700_100040 3300027363 Bacteria 177856
244 Ga0209588_1029210 3300027671 Bacteria 1758
245 Ga0209813_10009226 3300027866 Bacteria 2516
246 Ga0268266_10003050 3300028379 Bacteria 17142
247 Ga0268266_10028409 3300028379 Bacteria 4755
248 Ga0268266_10130458 3300028379 Bacteria 2247
249 Ga0268266_10213379 3300028379 Bacteria 1771
250 Ga0268265_10060234 3300028380 Bacteria 2908
251 Ga0268265_10133591 3300028380 Bacteria 2066
252 Ga0268264_10110958 3300028381 Bacteria 2402
253 Ga0265326_10009117 3300028558 Bacteria 2970
254 Ga0265319_1002888 3300028563 Bacteria 9172
255 Ga0265318_10005626 3300028577 Bacteria 5870
256 Ga0265323_10000846 3300028653 Bacteria 16302
257 Ga0265336_10001639 3300028666 Bacteria 9920
258 Ga0265338_10004452 3300028800 Bacteria 18916
259 Ga0265324_10003894 3300029957 Bacteria 6954
260 Ga0265339_10007490 3300031249 Bacteria 7047
261 Ga0265331_10013580 3300031250 Bacteria 4373
262 Ga0265316_10065111 3300031344 Bacteria 2823
263 Ga0307509_10008409 3300031507 Bacteria 13174
264 Ga0307509_10137414 3300031507 Bacteria 2387
265 Ga0307509_10237115 3300031507 Bacteria 1621
266 Ga0265313_10060349 3300031595 Bacteria 1779
267 Ga0265314_10003315 3300031711 Bacteria 15703
268 Ga0265342_10067263 3300031712 Bacteria 2097
269 Ga0307405_10240717 3300031731 Bacteria 1340
270 Ga0307414_10200150 3300032004 Bacteria 1624
271 Ga0307411_10060224 3300032005 Bacteria 2520
272 Ga0373923_0001732 3300035111 Bacteria 6425
273 Ga0373943_0005419 3300035170 Bacteria 5740
274 Ga0373943_0007871 3300035170 Bacteria 4783
275 Ga0373946_0004494 3300035171 Bacteria 4995
276 Ga0373946_0027008 3300035171 Bacteria 2268
277 Ga0373935_0001387 3300035692 Bacteria 13389
278 Ga0373935_0014832 3300035692 Bacteria 4704
279 Ga0373927_0000225 3300035695 Bacteria 44840
280 Ga0373927_0010994 3300035695 Bacteria 6028
281 Ga0373927_0099346 3300035695 Bacteria 1892
282 Ga0373933_0000922 3300035724 Bacteria 17934
283 Ga0373937_0013344 3300036401 Bacteria 7240
284 Ga0373925_0008511 3300037068 Bacteria 7477
285 Ga0373925_0037184 3300037068 Bacteria 3593
286 Ga0395900_0000860 3300037418 Bacteria 40028
287 Ga0395900_0041406 3300037418 Bacteria 4749
288 Ga0395898_0011543 3300037466 Bacteria 9176
289 Ga0395905_0321400 3300037471 Bacteria 1437
290 Ga0436364_1494800 3300037853 Bacteria 1579
291 Ga0436365_1449287 3300039437 Bacteria 1803
292 Ga0436365_1727745 3300039437 Bacteria 22987
293 Ga0436360_0240726 3300039438 Bacteria 2184
294 Ga0436363_0115681 3300039450 Bacteria 8292
295 Ga0436362_1281101 3300039453 Bacteria 2976
296 Ga0466972_0000660 3300044658 Bacteria 16624
297 Ga0466965_0067839 3300044683 Bacteria 1790
298 Ga0466966_0006259 3300044684 Bacteria 7875
299 Ga0466966_0034102 3300044684 Bacteria 3294
300 Ga0466961_0000488 3300044693 Bacteria 25223
301 Ga0466971_0075956 3300044719 Bacteria 1528
302 Ga0466959_0001793 3300045049 Bacteria 13423
303 Ga0466967_0269766 3300045976 Bacteria 1630
304 Ga0466967_0300897 3300045976 Bacteria 1543
305 Ga0495617_008236 3300046452 Bacteria 3598
306 Ga0495617_015187 3300046452 Bacteria 2613
307 Ga0495592_0016560 3300046454 Bacteria 5595
308 Ga0495603_0000960 3300046455 Bacteria 16606
309 Ga0495603_0016385 3300046455 Bacteria 4483
310 Ga0495590_0005096 3300046457 Bacteria 5239
311 Ga0495629_0000179 3300046459 Bacteria 56885
312 Ga0495629_0012947 3300046459 Bacteria 6032
313 Ga0495638_0018157 3300046460 Bacteria 4674
314 Ga0495638_0092123 3300046460 Bacteria 1824
315 Ga0495641_0004740 3300046461 Bacteria 9474
316 Ga0495651_0005780 3300046462 Bacteria 9439
317 Ga0495651_0049679 3300046462 Bacteria 3238
318 Ga0495580_0000280 3300046472 Bacteria 41385
319 Ga0495582_0000061 3300046473 Bacteria 55522
320 Ga0495605_0033525 3300046474 Bacteria 2606
321 Ga0495639_0000102 3300046475 Bacteria 42249
322 Ga0495662_0000746 3300046476 Bacteria 15602
323 Ga0495664_0060531 3300046477 Bacteria 2254
324 Ga0495584_0006929 3300046491 Bacteria 5923
325 Ga0495585_0010422 3300046492 Bacteria 5533
326 Ga0495594_0063753 3300046499 Bacteria 2042
327 Ga0495596_0043580 3300046500 Bacteria 1768
328 Ga0495583_0032341 3300046506 Bacteria 2526
329 Ga0495606_0016261 3300046507 Bacteria 5681
330 Ga0495606_0020685 3300046507 Bacteria 4843
331 Ga0495606_0097073 3300046507 Bacteria 1801
332 Ga0495608_0017694 3300046511 Bacteria 4928
333 Ga0495608_0038700 3300046511 Bacteria 3201
334 Ga0495610_0014018 3300046512 Bacteria 4734
335 Ga0495616_0021776 3300046513 Bacteria 3466
336 Ga0495616_0078080 3300046513 Bacteria 1588
337 Ga0495628_0018385 3300046516 Bacteria 5791
338 Ga0495630_0010364 3300046517 Bacteria 6725
339 Ga0495630_0019175 3300046517 Bacteria 5027
340 Ga0495631_0015648 3300046518 Bacteria 3629
341 Ga0495643_0005874 3300046522 Bacteria 8209
342 Ga0495643_0049338 3300046522 Bacteria 2270
343 Ga0495644_0012092 3300046523 Bacteria 3319
344 Ga0495644_0040724 3300046523 Bacteria 1751
345 Ga0495648_0001196 3300046524 Bacteria 25992
346 Ga0495648_0016227 3300046524 Bacteria 5373
347 Ga0495648_0039175 3300046524 Bacteria 3019
348 Ga0495648_0058592 3300046524 Bacteria 2302
349 Ga0495642_0040847 3300046528 Bacteria 1885
350 Ga0495652_0130932 3300046529 Bacteria 1986
351 Ga0495654_0026916 3300046530 Bacteria 2952
352 Ga0495665_0000261 3300046531 Bacteria 26625
353 Ga0495640_0002042 3300046533 Bacteria 16096
354 Ga0495640_0047051 3300046533 Bacteria 2986
355 Ga0495609_0011640 3300046538 Bacteria 4187
356 Ga0495597_0025045 3300046542 Bacteria 2749
357 Ga0495597_0025816 3300046542 Bacteria 2703
358 Ga0495645_0011286 3300046543 Bacteria 6282
359 Ga0495622_0006847 3300046557 Bacteria 5290
360 Ga0495622_0012581 3300046557 Bacteria 3921
361 Ga0495622_0038836 3300046557 Bacteria 2216
362 Ga0495668_0017190 3300046616 Bacteria 4200
363 Ga0495634_0000161 3300046642 Bacteria 60925
364 Ga0495611_0003326 3300046648 Bacteria 7104
365 Ga0495625_0061484 3300046660 Bacteria 2657
366 Ga0495635_0001102 3300046663 Bacteria 17952
367 Ga0495635_0028637 3300046663 Bacteria 3871
368 Ga0495588_0038099 3300046674 Bacteria 2445
369 Ga0495657_0024206 3300046675 Bacteria 4327
370 Ga0495647_0000205 3300046681 Bacteria 15996
371 Ga0495658_0001114 3300046683 Bacteria 14225
372 Ga0495658_0128394 3300046683 Bacteria 1541
373 Ga0495669_0029399 3300046684 Bacteria 2409
374 Ga0495669_0045802 3300046684 Bacteria 1951
375 Ga0495669_0100740 3300046684 Bacteria 1341
376 Ga0495613_0181071 3300046689 Bacteria 1492
377 Ga0495670_0006173 3300046691 Bacteria 5886
378 Ga0495671_0042294 3300046692 Bacteria 2290
379 Ga0495671_0091687 3300046692 Bacteria 1487
380 Ga0495649_0009550 3300046694 Bacteria 5754
381 Ga0495589_0087965 3300046794 Bacteria 1508
382 Ga0495600_0033984 3300046809 Bacteria 3311
383 Ga0495660_0041481 3300046810 Bacteria 2548
384 Ga0495581_0000255 3300047315 Bacteria 25578
385 Ga0495604_0062628 3300047317 Bacteria 2840
386 Ga0495674_0000117 3300047319 Bacteria 60130
387 Ga0495674_0043351 3300047319 Bacteria 4004
388 Ga0495672_0021739 3300047320 Bacteria 4180
389 Ga0495676_0021084 3300047321 Bacteria 5703
390 Ga0495683_0060157 3300047323 Bacteria 1883
391 Ga0495687_009368 3300047443 Bacteria 5480
392 Ga0495673_0018952 3300047469 Bacteria 3457
393 Ga0495686_0077424 3300047472 Bacteria 2036
394 Ga0495593_0000297 3300047673 Bacteria 27089
395 Ga0495602_0004737 3300048088 Bacteria 14223
396 Ga0495602_0099531 3300048088 Bacteria 2390
397 Ga0496101_0063980 3300048904 Bacteria 2679
398 Ga0496101_0098923 3300048904 Bacteria 2180
399 Ga0496101_0119178 3300048904 Bacteria 1994
400 Ga0496101_0125707 3300048904 Bacteria 1943
401 Ga0496101_0151344 3300048904 Bacteria 1775
402 Ga0496102_0002395 3300048905 Bacteria 16005
403 Ga0496102_0004565 3300048905 Bacteria 11700
404 Ga0496102_0206226 3300048905 Bacteria 1853
405 Ga0496102_0255730 3300048905 Bacteria 1651
406 Ga0496103_0027863 3300048906 Bacteria 3426
407 Ga0496103_0044664 3300048906 Bacteria 2731
408 Ga0496103_0078549 3300048906 Bacteria 2073
409 Ga0496104_0006852 3300048907 Bacteria 10044
410 Ga0496104_0007850 3300048907 Bacteria 9459
411 Ga0496104_0009000 3300048907 Bacteria 8880
412 Ga0496104_0098726 3300048907 Bacteria 2795
413 Ga0496105_0001479 3300048908 Bacteria 16579
414 Ga0496105_0033294 3300048908 Bacteria 4230
415 Ga0496105_0042728 3300048908 Bacteria 3738
416 Ga0496105_0126000 3300048908 Bacteria 2111
417 Ga0496106_0002635 3300048909 Bacteria 13341
418 Ga0496106_0217297 3300048909 Bacteria 1524
419 Ga0496106_0256167 3300048909 Bacteria 1400
420 Ga0496107_0097357 3300048910 Bacteria 2154
421 Ga0496109_0051497 3300048912 Bacteria 3750
422 Ga0496109_0071573 3300048912 Bacteria 3184
423 Ga0496109_0096842 3300048912 Bacteria 2734
424 Ga0496110_0013153 3300048913 Bacteria 6833
425 Ga0496110_0035199 3300048913 Bacteria 4343
426 Ga0496110_0116905 3300048913 Bacteria 2401
427 Ga0496110_0159691 3300048913 Bacteria 2043
428 Ga0496111_0039659 3300048914 Bacteria 3378
429 Ga0496111_0106731 3300048914 Bacteria 2061
430 Ga0496112_0000079 3300048915 Bacteria 64101
431 Ga0496112_0007179 3300048915 Bacteria 9867
432 Ga0496112_0080337 3300048915 Bacteria 3224
433 Ga0496112_0138203 3300048915 Bacteria 2406
434 Ga0496112_0313256 3300048915 Bacteria 1514
435 Ga0496113_0222488 3300048916 Bacteria 1504
436 Ga0496115_0000788 3300048918 Bacteria 23274
437 Ga0496115_0019388 3300048918 Bacteria 5232
438 Ga0496115_0032521 3300048918 Bacteria 4115
439 Ga0496115_0033839 3300048918 Bacteria 4037
440 Ga0496115_0048744 3300048918 Bacteria 3389
441 Ga0496115_0152605 3300048918 Bacteria 1908
442 Ga0496116_0003700 3300048919 Bacteria 14963
443 Ga0496118_0052365 3300048921 Bacteria 3114
444 Ga0496118_0106754 3300048921 Bacteria 1872
445 Ga0496119_0002628 3300048922 Bacteria 19497
446 Ga0496119_0085938 3300048922 Bacteria 1799
447 Ga0496120_0057056 3300048923 Bacteria 2200
448 Ga0496120_0101493 3300048923 Bacteria 1519
449 Ga0496121_0000495 3300048924 Bacteria 75339
450 Ga0496121_0000576 3300048924 Bacteria 69005
451 Ga0496121_0008638 3300048924 Bacteria 11913
452 Ga0496121_0023134 3300048924 Bacteria 5999
453 Ga0496121_0122404 3300048924 Bacteria 1962
454 Ga0496121_0139948 3300048924 Bacteria 1797
455 Ga0496123_0041130 3300048926 Bacteria 3208
456 Ga0496124_0001976 3300048927 Bacteria 27960
457 Ga0496125_0003570 3300048928 Bacteria 18732
458 Ga0496125_0049182 3300048928 Bacteria 3506
459 Ga0496125_0064009 3300048928 Bacteria 2927
460 Ga0496126_0004361 3300048929 Bacteria 16967
461 Ga0496126_0006416 3300048929 Bacteria 13114
462 Ga0496126_0008627 3300048929 Bacteria 10960
463 Ga0496126_0008851 3300048929 Bacteria 10787
464 Ga0496126_0026942 3300048929 Bacteria 5501
465 Ga0496126_0064977 3300048929 Bacteria 3266
466 Ga0496126_0072428 3300048929 Bacteria 3065
467 Ga0496126_0090183 3300048929 Bacteria 2697
468 Ga0495678_061540 3300049459 Bacteria 1408
469 Ga0495682_0024957 3300049460 Bacteria 2225
470 Ga0501031_0016299 3300049568 Bacteria 4825
471 Ga0501033_0001956 3300049570 Bacteria 17932
472 Ga0501034_0176108 3300049571 Bacteria 2105
473 Ga0501037_0009384 3300049573 Bacteria 7180
474 Ga0501042_0073733 3300049578 Bacteria 2441
475 Ga0501043_0013496 3300049579 Bacteria 6391
476 Ga0501046_0017167 3300049580 Bacteria 6048
477 Ga0501035_0014167 3300049822 Bacteria 7357
478 Ga0501044_0024228 3300049823 Bacteria 6448
479 nmdc:mga03n38_29755_c1 3300050490 Bacteria 2289
480 nmdc:mga00v17_40014_c1 3300050491 Bacteria 2810
481 nmdc:mga00v17_47444_c1 3300050491 Bacteria 2602
482 nmdc:mga0yw44_38512_c1 3300050492 Bacteria 2830
483 nmdc:mga0yw44_8504_c1 3300050492 Bacteria 3826
484 nmdc:mga0k408_11091_c2 3300050493 Bacteria 3859
485 nmdc:mga06z11_1148_c1 3300050494 Bacteria 9678
486 nmdc:mga06z11_59150_c1 3300050494 Bacteria 1991
487 nmdc:mga06z11_61440_c1 3300050494 Bacteria 1960
488 nmdc:mga07m45_1819_c1 3300050496 Bacteria 9835
489 nmdc:mga07m45_49250_c1 3300050496 Bacteria 2371
490 nmdc:mga07m45_8560_c1 3300050496 Bacteria 5266
491 nmdc:mga08y16_455660_c1 3300050511 Bacteria 1304
492 nmdc:mga0sz30_51540_c1 3300050516 Bacteria 1746
493 Ga0500635_0001234 3300053080 Bacteria 6111
494 Ga0495619_0115244 3300053085 Bacteria 1839
495 Ga0495619_0161015 3300053085 Bacteria 1550
496 Ga0500643_000025 3300053087 Bacteria 259605
497 Ga0500581_070348 3300053089 Bacteria 1762
498 Ga0500566_0000038 3300053094 Bacteria 66925
499 Ga0500566_0000596 3300053094 Bacteria 20245
500 Ga0500566_0001582 3300053094 Bacteria 13395
501 Ga0500640_016393 3300053095 Bacteria 3124
502 Ga0500650_0014328 3300053098 Bacteria 3350
503 Ga0500650_0023619 3300053098 Bacteria 2734
504 Ga0500556_0000002 3300053104 Bacteria 773626
505 Ga0500557_000001 3300053105 Bacteria 241298
506 Ga0500562_013757 3300053108 Bacteria 2069
507 Ga0500572_000010 3300053111 Bacteria 67071
508 Ga0500608_000953 3300053122 Bacteria 10349
509 Ga0500614_002202 3300053123 Bacteria 4416
510 Ga0500642_0000058 3300053130 Bacteria 66200
511 Ga0500652_000957 3300053131 Bacteria 9539
512 Ga0500658_0026598 3300053134 Bacteria 2230
513 Ga0500559_0000366 3300053136 Bacteria 33251
514 Ga0500559_0004231 3300053136 Bacteria 6870
515 Ga0500559_0013854 3300053136 Bacteria 3410
516 Ga0500559_0030710 3300053136 Bacteria 2304
517 Ga0500568_0000603 3300053139 Bacteria 26129
518 Ga0500573_0018767 3300053140 Bacteria 3948
519 Ga0500577_0004693 3300053142 Bacteria 3633
520 Ga0500586_001528 3300053145 Bacteria 4914
521 Ga0500590_025895 3300053148 Bacteria 3046
522 Ga0500603_006887 3300053150 Bacteria 2479
523 Ga0500616_0000069 3300053153 Bacteria 234334
524 Ga0500627_0075016 3300053158 Bacteria 1502
525 Ga0500630_071401 3300053159 Bacteria 1641
526 Ga0500638_043036 3300053162 Bacteria 2193
527 Ga0500639_000034 3300053163 Bacteria 66994
528 Ga0500636_0000502 3300053177 Bacteria 21286
529 Ga0500636_0062664 3300053177 Bacteria 2168
530 Ga0500636_0105586 3300053177 Bacteria 1596
531 Ga0500645_005871 3300053730 Bacteria 4454
532 Ga0500596_000264 3300053735 Bacteria 9238
533 Ga0500596_006110 3300053735 Bacteria 2063
534 Ga0500599_001348 3300053736 Bacteria 2803
535 Ga0500601_003178 3300053737 Bacteria 1776

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0126000 Ga0496105_0126000_353_1522 328
2 3300048904 Ga0496101_0098923 Ga0496101_0098923_1036_2148 337
3 3300053737 Ga0500601_003178 Ga0500601_003178_27_1121 342
4 3300039450 Ga0436363_0115681 Ga0436363_0115681_1171_2481 345
5 3300048907 Ga0496104_0009000 Ga0496104_0009000_6937_8166 349
6 3300048918 Ga0496115_0032521 Ga0496115_0032521_863_2092 349
7 3300009545 Ga0105237_10214473 Ga0105237_102144732 353
8 3300046810 Ga0495660_0041481 Ga0495660_0041481_773_1990 356
9 3300053730 Ga0500645_005871 Ga0500645_005871_60_1289 356
10 3300046523 Ga0495644_0012092 Ga0495644_0012092_802_2031 358
11 3300046684 Ga0495669_0045802 Ga0495669_0045802_314_1543 358
12 3300046692 Ga0495671_0091687 Ga0495671_0091687_97_1326 358
13 3300009545 Ga0105237_10051435 Ga0105237_100514352 359
14 3300050516 nmdc:mga0sz30_51540_c1 nmdc:mga0sz30_51540_c1_130_1359 359
15 3300048904 Ga0496101_0125707 Ga0496101_0125707_600_1832 360
16 3300048918 Ga0496115_0152605 Ga0496115_0152605_178_1407 360
17 3300048924 Ga0496121_0122404 Ga0496121_0122404_699_1928 360
18 3300048929 Ga0496126_0090183 Ga0496126_0090183_1419_2648 360
19 3300050491 nmdc:mga00v17_40014_c1 nmdc:mga00v17_40014_c1_399_1631 360
20 3300050496 nmdc:mga07m45_1819_c1 nmdc:mga07m45_1819_c1_2123_3355 360
21 3300009098 Ga0105245_10076910 Ga0105245_100769102 361
22 3300009101 Ga0105247_10088097 Ga0105247_100880972 361
23 3300009177 Ga0105248_10049122 Ga0105248_100491222 361
24 3300013296 Ga0157374_10406198 Ga0157374_104061981 361
25 3300014745 Ga0157377_10161823 Ga0157377_101618231 361
26 3300025315 Ga0207697_10032285 Ga0207697_100322852 361
27 3300048912 Ga0496109_0096842 Ga0496109_0096842_1053_2282 361
28 3300048913 Ga0496110_0159691 Ga0496110_0159691_744_1973 361
29 3300048915 Ga0496112_0313256 Ga0496112_0313256_193_1422 361
30 3300005983 Ga0081540_1024880 Ga0081540_10248802 362
31 3300044684 Ga0466966_0034102 Ga0466966_0034102_1475_2746 362
32 3300003215 JGI25153J46596_10007866 JGI25153J46596_100078662 363
33 3300025297 Ga0209758_1002793 Ga0209758_10027934 363
34 3300039437 Ga0436365_1727745 Ga0436365_1727745_14758_16029 364
35 3300005937 Ga0081455_10189678 Ga0081455_101896781 365
36 3300009551 Ga0105238_10102172 Ga0105238_101021721 365
37 3300039453 Ga0436362_1281101 Ga0436362_1281101_1490_2761 366
38 3300006038 Ga0075365_10183177 Ga0075365_101831772 367
39 3300009177 Ga0105248_10381639 Ga0105248_103816392 367
40 3300010375 Ga0105239_10443900 Ga0105239_104439001 367
41 3300013297 Ga0157378_10194076 Ga0157378_101940761 367
42 3300028379 Ga0268266_10130458 Ga0268266_101304581 367
43 3300032004 Ga0307414_10200150 Ga0307414_102001502 367
44 3300005544 Ga0070686_100098222 Ga0070686_1000982222 368
45 3300053136 Ga0500559_0030710 Ga0500559_0030710_1034_2293 368
46 3300053140 Ga0500573_0018767 Ga0500573_0018767_1786_3045 368
47 3300053148 Ga0500590_025895 Ga0500590_025895_1444_2703 368
48 3300053177 Ga0500636_0105586 Ga0500636_0105586_153_1412 368
49 3300053735 Ga0500596_006110 Ga0500596_006110_656_1915 368
50 3300005983 Ga0081540_1019199 Ga0081540_10191992 369
51 3300031731 Ga0307405_10240717 Ga0307405_102407171 369
52 3300037853 Ga0436364_1494800 Ga0436364_1494800_93_1337 369
53 3300053087 Ga0500643_000025 Ga0500643_000025_233689_234909 369
54 3300009176 Ga0105242_10234703 Ga0105242_102347032 370
55 3300009545 Ga0105237_10334664 Ga0105237_103346642 370
56 3300009553 Ga0105249_10095720 Ga0105249_100957202 370
57 3300046452 Ga0495617_008236 Ga0495617_008236_2113_3342 370
58 3300046455 Ga0495603_0016385 Ga0495603_0016385_3185_4414 370
59 3300046457 Ga0495590_0005096 Ga0495590_0005096_3424_4653 370
60 3300046474 Ga0495605_0033525 Ga0495605_0033525_302_1531 370
61 3300046491 Ga0495584_0006929 Ga0495584_0006929_1254_2483 370
62 3300046492 Ga0495585_0010422 Ga0495585_0010422_3217_4446 370
63 3300046499 Ga0495594_0063753 Ga0495594_0063753_793_2022 370
64 3300046500 Ga0495596_0043580 Ga0495596_0043580_186_1415 370
65 3300046506 Ga0495583_0032341 Ga0495583_0032341_998_2227 370
66 3300046507 Ga0495606_0016261 Ga0495606_0016261_1029_2258 370
67 3300046512 Ga0495610_0014018 Ga0495610_0014018_1113_2342 370
68 3300046513 Ga0495616_0078080 Ga0495616_0078080_139_1368 370
69 3300046518 Ga0495631_0015648 Ga0495631_0015648_2313_3542 370
70 3300046522 Ga0495643_0049338 Ga0495643_0049338_531_1760 370
71 3300046524 Ga0495648_0016227 Ga0495648_0016227_973_2205 370
72 3300046528 Ga0495642_0040847 Ga0495642_0040847_48_1277 370
73 3300046538 Ga0495609_0011640 Ga0495609_0011640_1795_3024 370
74 3300046542 Ga0495597_0025816 Ga0495597_0025816_148_1377 370
75 3300046648 Ga0495611_0003326 Ga0495611_0003326_1025_2254 370
76 3300046660 Ga0495625_0061484 Ga0495625_0061484_960_2189 370
77 3300046684 Ga0495669_0029399 Ga0495669_0029399_330_1559 370
78 3300046692 Ga0495671_0042294 Ga0495671_0042294_364_1593 370
79 3300046694 Ga0495649_0009550 Ga0495649_0009550_195_1424 370
80 3300046794 Ga0495589_0087965 Ga0495589_0087965_268_1497 370
81 3300047323 Ga0495683_0060157 Ga0495683_0060157_226_1455 370
82 3300047469 Ga0495673_0018952 Ga0495673_0018952_1264_2493 370
83 3300047472 Ga0495686_0077424 Ga0495686_0077424_766_1995 370
84 3300048905 Ga0496102_0206226 Ga0496102_0206226_604_1833 370
85 3300048906 Ga0496103_0044664 Ga0496103_0044664_392_1621 370
86 3300048921 Ga0496118_0052365 Ga0496118_0052365_1824_3053 370
87 3300049459 Ga0495678_061540 Ga0495678_061540_97_1326 370
88 3300049460 Ga0495682_0024957 Ga0495682_0024957_456_1685 370
89 3300053098 Ga0500650_0023619 Ga0500650_0023619_1110_2339 370
90 3300053108 Ga0500562_013757 Ga0500562_013757_330_1559 370
91 3300053134 Ga0500658_0026598 Ga0500658_0026598_89_1318 370
92 3300053142 Ga0500577_0004693 Ga0500577_0004693_369_1640 370
93 3300046452 Ga0495617_015187 Ga0495617_015187_1003_2271 371
94 iso_pu_bacteria 8016603502 8016611544 371
95 3300005548 Ga0070665_100207409 Ga0070665_1002074092 372
96 3300013306 Ga0163162_10443706 Ga0163162_104437061 372
97 3300028379 Ga0268266_10213379 Ga0268266_102133792 372
98 3300003659 JGI25404J52841_10006230 JGI25404J52841_100062302 373
99 3300005548 Ga0070665_100013576 Ga0070665_1000135763 373
100 3300006048 Ga0075363_100008360 Ga0075363_1000083602 373
101 3300006353 Ga0075370_10013657 Ga0075370_100136574 373
102 3300009094 Ga0111539_10306833 Ga0111539_103068332 373
103 3300026067 Ga0207678_10003850 Ga0207678_100038505 373
104 3300026118 Ga0207675_100196523 Ga0207675_1001965232 373
105 3300028379 Ga0268266_10003050 Ga0268266_100030508 373
106 3300031507 Ga0307509_10237115 Ga0307509_102371151 373
107 3300035170 Ga0373943_0005419 Ga0373943_0005419_3737_4999 373
108 3300035171 Ga0373946_0004494 Ga0373946_0004494_210_1472 373
109 3300035692 Ga0373935_0001387 Ga0373935_0001387_11617_12879 373
110 3300035695 Ga0373927_0000225 Ga0373927_0000225_38925_40187 373
111 3300046454 Ga0495592_0016560 Ga0495592_0016560_1154_2416 373
112 3300046459 Ga0495629_0000179 Ga0495629_0000179_4917_6179 373
113 3300046460 Ga0495638_0018157 Ga0495638_0018157_374_1642 373
114 3300046460 Ga0495638_0092123 Ga0495638_0092123_251_1519 373
115 3300046461 Ga0495641_0004740 Ga0495641_0004740_5380_6642 373
116 3300046472 Ga0495580_0000280 Ga0495580_0000280_3565_4827 373
117 3300046473 Ga0495582_0000061 Ga0495582_0000061_3566_4828 373
118 3300046475 Ga0495639_0000102 Ga0495639_0000102_37439_38701 373
119 3300046476 Ga0495662_0000746 Ga0495662_0000746_10089_11351 373
120 3300046517 Ga0495630_0010364 Ga0495630_0010364_3566_4828 373
121 3300046529 Ga0495652_0130932 Ga0495652_0130932_173_1435 373
122 3300046530 Ga0495654_0026916 Ga0495654_0026916_241_1509 373
123 3300046531 Ga0495665_0000261 Ga0495665_0000261_21798_23060 373
124 3300046533 Ga0495640_0002042 Ga0495640_0002042_3954_5216 373
125 3300046557 Ga0495622_0006847 Ga0495622_0006847_1528_2790 373
126 3300046557 Ga0495622_0012581 Ga0495622_0012581_2575_3849 373
127 3300046642 Ga0495634_0000161 Ga0495634_0000161_19620_20882 373
128 3300046663 Ga0495635_0001102 Ga0495635_0001102_13128_14390 373
129 3300046681 Ga0495647_0000205 Ga0495647_0000205_11197_12459 373
130 3300046683 Ga0495658_0001114 Ga0495658_0001114_3005_4267 373
131 3300046691 Ga0495670_0006173 Ga0495670_0006173_1909_3162 373
132 3300047315 Ga0495581_0000255 Ga0495581_0000255_1076_2338 373
133 3300047319 Ga0495674_0000117 Ga0495674_0000117_19896_21158 373
134 3300047673 Ga0495593_0000297 Ga0495593_0000297_24789_26051 373
135 3300048904 Ga0496101_0151344 Ga0496101_0151344_85_1410 373
136 3300048909 Ga0496106_0217297 Ga0496106_0217297_44_1312 373
137 3300048919 Ga0496116_0003700 Ga0496116_0003700_8267_9535 373
138 3300048923 Ga0496120_0057056 Ga0496120_0057056_42_1310 373
139 3300048924 Ga0496121_0008638 Ga0496121_0008638_5152_6420 373
140 3300048924 Ga0496121_0023134 Ga0496121_0023134_3802_5073 373
141 3300048926 Ga0496123_0041130 Ga0496123_0041130_302_1570 373
142 3300048928 Ga0496125_0003570 Ga0496125_0003570_3419_4687 373
143 3300048929 Ga0496126_0006416 Ga0496126_0006416_4089_5357 373
144 3300048929 Ga0496126_0064977 Ga0496126_0064977_123_1391 373
145 3300050492 nmdc:mga0yw44_38512_c1 nmdc:mga0yw44_38512_c1_1294_2562 373
146 3300050511 nmdc:mga08y16_455660_c1 nmdc:mga08y16_455660_c1_10_1245 373
147 3300053085 Ga0495619_0115244 Ga0495619_0115244_123_1385 373
148 3300053089 Ga0500581_070348 Ga0500581_070348_140_1393 373
149 3300053094 Ga0500566_0001582 Ga0500566_0001582_6270_7544 373
150 3300053098 Ga0500650_0014328 Ga0500650_0014328_334_1602 373
151 3300053104 Ga0500556_0000002 Ga0500556_0000002_527123_528391 373
152 3300053122 Ga0500608_000953 Ga0500608_000953_5553_6827 373
153 3300053130 Ga0500642_0000058 Ga0500642_0000058_10537_11805 373
154 3300053131 Ga0500652_000957 Ga0500652_000957_3231_4499 373
155 3300053136 Ga0500559_0000366 Ga0500559_0000366_27486_28760 373
156 3300053139 Ga0500568_0000603 Ga0500568_0000603_10849_12117 373
157 3300053153 Ga0500616_0000069 Ga0500616_0000069_10679_11947 373
158 3300053158 Ga0500627_0075016 Ga0500627_0075016_52_1320 373
159 iso_pu_bacteria 2824773399 2824780658 373
160 iso_pu_bacteria 2841949485 2841950715 373
161 3300005334 Ga0068869_100067971 Ga0068869_1000679712 374
162 3300005338 Ga0068868_100044104 Ga0068868_1000441042 374
163 3300005347 Ga0070668_100056652 Ga0070668_1000566523 374
164 3300005456 Ga0070678_100070226 Ga0070678_1000702262 374
165 3300005844 Ga0068862_100068496 Ga0068862_1000684962 374
166 3300006038 Ga0075365_10129373 Ga0075365_101293732 374
167 3300006048 Ga0075363_100022810 Ga0075363_1000228103 374
168 3300006051 Ga0075364_10052047 Ga0075364_100520472 374
169 3300006358 Ga0068871_100068833 Ga0068871_1000688333 374
170 3300025900 Ga0207710_10005054 Ga0207710_100050542 374
171 3300025900 Ga0207710_10024168 Ga0207710_100241681 374
172 3300025927 Ga0207687_10060165 Ga0207687_100601652 374
173 3300025941 Ga0207711_10165321 Ga0207711_101653211 374
174 3300025972 Ga0207668_10049546 Ga0207668_100495462 374
175 3300026116 Ga0207674_10068635 Ga0207674_100686352 374
176 3300026121 Ga0207683_10039306 Ga0207683_100393064 374
177 3300035724 Ga0373933_0000922 Ga0373933_0000922_8236_9504 374
178 3300048905 Ga0496102_0255730 Ga0496102_0255730_78_1346 374
179 iso_pu_bacteria 2517093001 2517102074 374
180 iso_pu_bacteria 2879110137 2879115686 374
181 3300005336 Ga0070680_100006371 Ga0070680_1000063714 375
182 3300005337 Ga0070682_100091527 Ga0070682_1000915272 375
183 3300005356 Ga0070674_100036328 Ga0070674_1000363282 375
184 3300005455 Ga0070663_100142760 Ga0070663_1001427602 375
185 3300005458 Ga0070681_10021753 Ga0070681_100217534 375
186 3300005530 Ga0070679_100007739 Ga0070679_1000077394 375
187 3300005539 Ga0068853_100171773 Ga0068853_1001717732 375
188 3300005548 Ga0070665_100208365 Ga0070665_1002083652 375
189 3300006881 Ga0068865_100092587 Ga0068865_1000925872 375
190 3300009148 Ga0105243_10194159 Ga0105243_101941592 375
191 3300009176 Ga0105242_10119826 Ga0105242_101198262 375
192 3300009551 Ga0105238_10125187 Ga0105238_101251873 375
193 3300009551 Ga0105238_10193511 Ga0105238_101935112 375
194 3300025912 Ga0207707_10000494 Ga0207707_1000049415 375
195 3300025921 Ga0207652_10085185 Ga0207652_100851852 375
196 3300025924 Ga0207694_10143171 Ga0207694_101431711 375
197 3300025932 Ga0207690_10044054 Ga0207690_100440542 375
198 3300025933 Ga0207706_10204557 Ga0207706_102045571 375
199 3300025960 Ga0207651_10188298 Ga0207651_101882982 375
200 3300026041 Ga0207639_10139229 Ga0207639_101392292 375
201 3300032005 Ga0307411_10060224 Ga0307411_100602242 375
202 3300046524 Ga0495648_0001196 Ga0495648_0001196_9132_10418 375
203 3300046684 Ga0495669_0100740 Ga0495669_0100740_15_1283 375
204 3300005434 Ga0070709_10000337 Ga0070709_1000033711 376
205 3300005435 Ga0070714_100041601 Ga0070714_1000416013 376
206 3300005437 Ga0070710_10000508 Ga0070710_100005085 376
207 3300005439 Ga0070711_100001466 Ga0070711_1000014668 376
208 3300005539 Ga0068853_100227066 Ga0068853_1002270662 376
209 3300006173 Ga0070716_100003986 Ga0070716_1000039866 376
210 3300025898 Ga0207692_10001906 Ga0207692_100019065 376
211 3300025906 Ga0207699_10000604 Ga0207699_100006048 376
212 3300025916 Ga0207663_10004391 Ga0207663_100043914 376
213 3300025929 Ga0207664_10006080 Ga0207664_100060803 376
214 3300025938 Ga0207704_10133782 Ga0207704_101337822 376
215 3300025939 Ga0207665_10001395 Ga0207665_100013958 376
216 3300028380 Ga0268265_10133591 Ga0268265_101335912 376
217 3300046455 Ga0495603_0000960 Ga0495603_0000960_7832_9094 376
218 3300053094 Ga0500566_0000596 Ga0500566_0000596_7379_8632 376
219 iso_pu_bacteria 2824679649 2824683722 376
220 3300005436 Ga0070713_100158020 Ga0070713_1001580202 377
221 3300005983 Ga0081540_1022051 Ga0081540_10220512 377
222 3300028558 Ga0265326_10009117 Ga0265326_100091172 377
223 3300028563 Ga0265319_1002888 Ga0265319_10028882 377
224 3300028577 Ga0265318_10005626 Ga0265318_100056263 377
225 3300028653 Ga0265323_10000846 Ga0265323_100008467 377
226 3300028666 Ga0265336_10001639 Ga0265336_100016393 377
227 3300028800 Ga0265338_10004452 Ga0265338_100044528 377
228 3300029957 Ga0265324_10003894 Ga0265324_100038944 377
229 3300031250 Ga0265331_10013580 Ga0265331_100135802 377
230 3300031344 Ga0265316_10065111 Ga0265316_100651112 377
231 3300031712 Ga0265342_10067263 Ga0265342_100672632 377
232 3300044684 Ga0466966_0006259 Ga0466966_0006259_630_1859 377
233 3300044693 Ga0466961_0000488 Ga0466961_0000488_19524_20753 377
234 3300045049 Ga0466959_0001793 Ga0466959_0001793_11690_12919 377
235 3300046523 Ga0495644_0040724 Ga0495644_0040724_170_1438 377
236 3300048929 Ga0496126_0004361 Ga0496126_0004361_7693_8988 377
237 iso_pu_bacteria 2824671348 2824674704 377
238 iso_pu_bacteria 2824687955 2824692883 377
239 iso_pu_bacteria 2841957949 2841964402 377
240 iso_pu_bacteria 2841966195 2841967031 377
241 iso_pu_bacteria 2841974524 2841975776 377
242 iso_pu_bacteria 2849076700 2849080067 377
243 iso_pu_bacteria 2874620515 2874627097 377
244 iso_pu_bacteria 2904666416 2904669798 377
245 iso_pu_bacteria 8016530956 8016535723 377
246 3300005937 Ga0081455_10001781 Ga0081455_100017814 378
247 3300025302 Ga0207426_1001526 Ga0207426_100152620 378
248 3300046507 Ga0495606_0020685 Ga0495606_0020685_428_1690 378
249 iso_pu_bacteria 2888388044 2888394657 378
250 3300005339 Ga0070660_100217104 Ga0070660_1002171042 379
251 3300005983 Ga0081540_1002370 Ga0081540_100237015 379
252 3300006038 Ga0075365_10005922 Ga0075365_100059222 379
253 3300026142 Ga0207698_10098663 Ga0207698_100986632 379
254 3300046524 Ga0495648_0058592 Ga0495648_0058592_734_1990 379
255 3300048923 Ga0496120_0101493 Ga0496120_0101493_37_1293 379
256 3300053105 Ga0500557_000001 Ga0500557_000001_15398_16654 379
257 3300053145 Ga0500586_001528 Ga0500586_001528_1888_3162 379
258 3300053736 Ga0500599_001348 Ga0500599_001348_553_1809 379
259 iso_pu_bacteria 2824617872 2824619763 379
260 iso_pu_bacteria 2824661429 2824666650 379
261 iso_pu_bacteria 2824696289 2824699181 379
262 iso_pu_bacteria 2824732956 2824739975 379
263 iso_pu_bacteria 2842038055 2842039824 379
264 iso_pu_bacteria 2842045827 2842047230 379
265 iso_pu_bacteria 2847939898 2847945792 379
266 iso_pu_bacteria 2874628541 2874636326 379
267 iso_pu_bacteria 2876761206 2876770807 379
268 iso_pu_bacteria 2876818435 2876822548 379
269 iso_pu_bacteria 2879074833 2879078101 379
270 iso_pu_bacteria 2879099564 2879102942 379
271 iso_pu_bacteria 2888378607 2888383253 379
272 iso_pu_bacteria 2922393267 2922395567 379
273 iso_pu_bacteria 2929615660 2929617163 379
274 iso_pu_bacteria 2929624759 2929626867 379
275 3300003215 JGI25153J46596_10000832 JGI25153J46596_100008322 380
276 3300003794 Ga0055531_10007934 Ga0055531_100079343 380
277 3300005262 Ga0065165_1008580 Ga0065165_10085803 380
278 3300005328 Ga0070676_10081874 Ga0070676_100818742 380
279 3300005458 Ga0070681_10053305 Ga0070681_100533052 380
280 3300005548 Ga0070665_100079277 Ga0070665_1000792773 380
281 3300005616 Ga0068852_100096896 Ga0068852_1000968962 380
282 3300005842 Ga0068858_100079138 Ga0068858_1000791382 380
283 3300006942 Ga0099824_1025534 Ga0099824_10255343 380
284 3300021320 Ga0214544_1000009 Ga0214544_1000009134 380
285 3300021321 Ga0214542_1000002 Ga0214542_1000002576 380
286 3300021324 Ga0214545_1000002 Ga0214545_1000002144 380
287 3300021327 Ga0214543_1000013 Ga0214543_1000013178 380
288 3300025295 Ga0209564_1003387 Ga0209564_10033874 380
289 3300025297 Ga0209758_1000100 Ga0209758_100010037 380
290 3300025297 Ga0209758_1001008 Ga0209758_10010088 380
291 3300025299 Ga0209256_1001740 Ga0209256_100174022 380
292 3300025304 Ga0209257_1006404 Ga0209257_10064044 380
293 3300025911 Ga0207654_10020055 Ga0207654_100200553 380
294 3300027296 Ga0209389_1000084 Ga0209389_100008416 380
295 3300027357 Ga0209589_1000041 Ga0209589_100004155 380
296 3300027361 Ga0209489_100070 Ga0209489_10007073 380
297 3300028379 Ga0268266_10028409 Ga0268266_100284092 380
298 3300031249 Ga0265339_10007490 Ga0265339_100074903 380
299 3300031507 Ga0307509_10008409 Ga0307509_100084097 380
300 3300036401 Ga0373937_0013344 Ga0373937_0013344_4349_5662 380
301 3300048912 Ga0496109_0071573 Ga0496109_0071573_63_1301 380
302 3300048913 Ga0496110_0116905 Ga0496110_0116905_545_1786 380
303 3300048915 Ga0496112_0000079 Ga0496112_0000079_31814_33082 380
304 3300005339 Ga0070660_100141044 Ga0070660_1001410442 381
305 3300005543 Ga0070672_100062511 Ga0070672_1000625112 381
306 3300009553 Ga0105249_10047992 Ga0105249_100479921 381
307 3300010375 Ga0105239_10213532 Ga0105239_102135323 381
308 3300025907 Ga0207645_10025440 Ga0207645_100254402 381
309 3300025961 Ga0207712_10025690 Ga0207712_100256904 381
310 3300026089 Ga0207648_10090287 Ga0207648_100902871 381
311 3300031595 Ga0265313_10060349 Ga0265313_100603492 381
312 3300037471 Ga0395905_0321400 Ga0395905_0321400_185_1408 381
313 3300044658 Ga0466972_0000660 Ga0466972_0000660_13563_14819 381
314 3300003215 JGI25153J46596_10009451 JGI25153J46596_100094513 382
315 3300005983 Ga0081540_1004255 Ga0081540_10042556 382
316 3300006038 Ga0075365_10000847 Ga0075365_100008476 382
317 3300006051 Ga0075364_10001659 Ga0075364_100016597 382
318 3300006178 Ga0075367_10011928 Ga0075367_100119283 382
319 3300007265 Ga0099794_10015790 Ga0099794_100157903 382
320 3300025297 Ga0209758_1005742 Ga0209758_10057426 382
321 3300026078 Ga0207702_10234090 Ga0207702_102340901 382
322 3300026142 Ga0207698_10168600 Ga0207698_101686001 382
323 3300027671 Ga0209588_1029210 Ga0209588_10292102 382
324 3300048907 Ga0496104_0007850 Ga0496104_0007850_3002_4312 382
325 3300048908 Ga0496105_0042728 Ga0496105_0042728_1424_2734 382
326 3300048912 Ga0496109_0051497 Ga0496109_0051497_663_1973 382
327 3300048914 Ga0496111_0039659 Ga0496111_0039659_29_1339 382
328 3300048915 Ga0496112_0007179 Ga0496112_0007179_1519_2829 382
329 3300048918 Ga0496115_0048744 Ga0496115_0048744_2009_3319 382
330 3300049568 Ga0501031_0016299 Ga0501031_0016299_3081_4346 382
331 3300049570 Ga0501033_0001956 Ga0501033_0001956_13645_14910 382
332 3300049573 Ga0501037_0009384 Ga0501037_0009384_3023_4288 382
333 3300049578 Ga0501042_0073733 Ga0501042_0073733_1048_2313 382
334 3300049579 Ga0501043_0013496 Ga0501043_0013496_3691_4956 382
335 3300049580 Ga0501046_0017167 Ga0501046_0017167_3023_4288 382
336 3300049822 Ga0501035_0014167 Ga0501035_0014167_3070_4335 382
337 3300049823 Ga0501044_0024228 Ga0501044_0024228_1334_2599 382
338 3300050494 nmdc:mga06z11_59150_c1 nmdc:mga06z11_59150_c1_227_1549 382
339 3300005353 Ga0070669_100115748 Ga0070669_1001157482 383
340 3300005518 Ga0070699_100059665 Ga0070699_1000596652 383
341 3300005543 Ga0070672_100216165 Ga0070672_1002161651 383
342 3300005545 Ga0070695_100054541 Ga0070695_1000545413 383
343 3300005614 Ga0068856_100001022 Ga0068856_10000102222 383
344 3300005843 Ga0068860_100061824 Ga0068860_1000618242 383
345 3300006048 Ga0075363_100060556 Ga0075363_1000605562 383
346 3300013297 Ga0157378_10254541 Ga0157378_102545412 383
347 3300021361 Ga0213872_10054255 Ga0213872_100542551 383
348 3300025711 Ga0207696_1037947 Ga0207696_10379471 383
349 3300025939 Ga0207665_10048653 Ga0207665_100486532 383
350 3300025972 Ga0207668_10045686 Ga0207668_100456862 383
351 3300026075 Ga0207708_10086818 Ga0207708_100868182 383
352 3300026118 Ga0207675_100131542 Ga0207675_1001315422 383
353 3300027357 Ga0209589_1000023 Ga0209589_100002356 383
354 3300027361 Ga0209489_100032 Ga0209489_10003256 383
355 3300027363 Ga0209700_100040 Ga0209700_10004056 383
356 3300028380 Ga0268265_10060234 Ga0268265_100602343 383
357 3300028381 Ga0268264_10110958 Ga0268264_101109582 383
358 3300039438 Ga0436360_0240726 Ga0436360_0240726_533_1807 383
359 3300046459 Ga0495629_0012947 Ga0495629_0012947_1437_2666 383
360 3300046462 Ga0495651_0049679 Ga0495651_0049679_607_1836 383
361 3300046507 Ga0495606_0097073 Ga0495606_0097073_348_1577 383
362 3300046511 Ga0495608_0038700 Ga0495608_0038700_65_1294 383
363 3300046533 Ga0495640_0047051 Ga0495640_0047051_311_1540 383
364 3300046557 Ga0495622_0038836 Ga0495622_0038836_182_1411 383
365 3300046663 Ga0495635_0028637 Ga0495635_0028637_529_1758 383
366 3300046674 Ga0495588_0038099 Ga0495588_0038099_1186_2415 383
367 3300046683 Ga0495658_0128394 Ga0495658_0128394_154_1383 383
368 3300046809 Ga0495600_0033984 Ga0495600_0033984_188_1417 383
369 3300047317 Ga0495604_0062628 Ga0495604_0062628_519_1748 383
370 3300047321 Ga0495676_0021084 Ga0495676_0021084_3286_4515 383
371 3300048088 Ga0495602_0099531 Ga0495602_0099531_868_2097 383
372 3300048907 Ga0496104_0006852 Ga0496104_0006852_7721_8950 383
373 3300048908 Ga0496105_0001479 Ga0496105_0001479_1236_2465 383
374 3300048916 Ga0496113_0222488 Ga0496113_0222488_187_1416 383
375 3300048918 Ga0496115_0033839 Ga0496115_0033839_1965_3194 383
376 3300048922 Ga0496119_0002628 Ga0496119_0002628_8826_10055 383
377 3300048922 Ga0496119_0085938 Ga0496119_0085938_545_1774 383
378 3300048924 Ga0496121_0139948 Ga0496121_0139948_455_1684 383
379 3300048928 Ga0496125_0049182 Ga0496125_0049182_1460_2689 383
380 3300048929 Ga0496126_0008627 Ga0496126_0008627_3046_4275 383
381 3300053136 Ga0500559_0013854 Ga0500559_0013854_378_1607 383
382 3300001989 JGI24739J22299_10014275 JGI24739J22299_100142751 384
383 3300005331 Ga0070670_100151518 Ga0070670_1001515182 384
384 3300005548 Ga0070665_100298880 Ga0070665_1002988802 384
385 3300005563 Ga0068855_100031483 Ga0068855_1000314833 384
386 3300005577 Ga0068857_100010572 Ga0068857_1000105726 384
387 3300005614 Ga0068856_100171227 Ga0068856_1001712272 384
388 3300005719 Ga0068861_100181881 Ga0068861_1001818812 384
389 3300006195 Ga0075366_10010275 Ga0075366_100102752 384
390 3300006353 Ga0075370_10066385 Ga0075370_100663852 384
391 3300009093 Ga0105240_10043962 Ga0105240_100439624 384
392 3300009093 Ga0105240_10410751 Ga0105240_104107511 384
393 3300009174 Ga0105241_10029082 Ga0105241_100290822 384
394 3300009545 Ga0105237_10009523 Ga0105237_100095234 384
395 3300009545 Ga0105237_10084683 Ga0105237_100846832 384
396 3300009551 Ga0105238_10028683 Ga0105238_100286834 384
397 3300013296 Ga0157374_10168298 Ga0157374_101682982 384
398 3300013306 Ga0163162_10210807 Ga0163162_102108072 384
399 3300025299 Ga0209256_1021489 Ga0209256_10214892 384
400 3300025302 Ga0207426_1009873 Ga0207426_10098732 384
401 3300025903 Ga0207680_10082220 Ga0207680_100822201 384
402 3300025904 Ga0207647_10002042 Ga0207647_1000204218 384
403 3300025904 Ga0207647_10009252 Ga0207647_100092524 384
404 3300025912 Ga0207707_10035695 Ga0207707_100356952 384
405 3300025913 Ga0207695_10047612 Ga0207695_100476123 384
406 3300025933 Ga0207706_10017328 Ga0207706_100173283 384
407 3300025941 Ga0207711_10257946 Ga0207711_102579462 384
408 3300025949 Ga0207667_10110572 Ga0207667_101105721 384
409 3300025960 Ga0207651_10161569 Ga0207651_101615692 384
410 3300025981 Ga0207640_10006337 Ga0207640_100063375 384
411 3300026023 Ga0207677_10241143 Ga0207677_102411431 384
412 3300026035 Ga0207703_10097429 Ga0207703_100974292 384
413 3300026067 Ga0207678_10048914 Ga0207678_100489143 384
414 3300026078 Ga0207702_10056441 Ga0207702_100564413 384
415 3300026116 Ga0207674_10022053 Ga0207674_100220536 384
416 3300027866 Ga0209813_10009226 Ga0209813_100092261 384
417 3300035695 Ga0373927_0010994 Ga0373927_0010994_1235_2548 384
418 3300035695 Ga0373927_0099346 Ga0373927_0099346_481_1740 384
419 3300046513 Ga0495616_0021776 Ga0495616_0021776_32_1288 384
420 3300046522 Ga0495643_0005874 Ga0495643_0005874_5025_6284 384
421 3300046616 Ga0495668_0017190 Ga0495668_0017190_250_1509 384
422 3300047443 Ga0495687_009368 Ga0495687_009368_4116_5375 384
423 3300048904 Ga0496101_0119178 Ga0496101_0119178_465_1724 384
424 3300048905 Ga0496102_0004565 Ga0496102_0004565_8981_10240 384
425 3300048906 Ga0496103_0027863 Ga0496103_0027863_34_1293 384
426 3300048909 Ga0496106_0256167 Ga0496106_0256167_62_1303 384
427 3300048910 Ga0496107_0097357 Ga0496107_0097357_857_2122 384
428 3300048913 Ga0496110_0013153 Ga0496110_0013153_1461_2717 384
429 3300048914 Ga0496111_0106731 Ga0496111_0106731_615_1874 384
430 3300048915 Ga0496112_0138203 Ga0496112_0138203_647_1906 384
431 3300048921 Ga0496118_0106754 Ga0496118_0106754_159_1418 384
432 3300050490 nmdc:mga03n38_29755_c1 nmdc:mga03n38_29755_c1_878_2137 384
433 3300050491 nmdc:mga00v17_47444_c1 nmdc:mga00v17_47444_c1_1106_2365 384
434 3300050492 nmdc:mga0yw44_8504_c1 nmdc:mga0yw44_8504_c1_2460_3719 384
435 3300050493 nmdc:mga0k408_11091_c2 nmdc:mga0k408_11091_c2_2560_3819 384
436 3300050494 nmdc:mga06z11_61440_c1 nmdc:mga06z11_61440_c1_121_1380 384
437 3300050496 nmdc:mga07m45_8560_c1 nmdc:mga07m45_8560_c1_255_1514 384
438 iso_pu_bacteria 2513237141 2513889242 384
439 3300003354 JGI25160J50197_1015733 JGI25160J50197_10157332 385
440 3300005983 Ga0081540_1017300 Ga0081540_10173001 385
441 3300011119 Ga0105246_10185390 Ga0105246_101853902 385
442 3300025914 Ga0207671_10008450 Ga0207671_100084504 385
443 3300039437 Ga0436365_1449287 Ga0436365_1449287_261_1523 385
444 3300046542 Ga0495597_0025045 Ga0495597_0025045_1351_2607 385
445 iso_pu_bacteria 2885366525 2885373297 385
446 iso_pu_bacteria 2903768456 2903774563 385
447 iso_pu_bacteria 3005474847 3005479509 385
448 iso_pu_bacteria 3005718088 3005721574 385
449 3300003214 JGI25165J46597_1004542 JGI25165J46597_10045422 386
450 3300004625 Ga0055543_1002527 Ga0055543_10025275 386
451 3300005262 Ga0065165_1001088 Ga0065165_100108829 386
452 3300010375 Ga0105239_10110112 Ga0105239_101101123 386
453 3300025261 Ga0209233_1005840 Ga0209233_10058402 386
454 3300037068 Ga0373925_0008511 Ga0373925_0008511_4389_5663 386
455 3300053080 Ga0500635_0001234 Ga0500635_0001234_1737_3011 386
456 iso_pu_bacteria 2513237092 2513628267 386
457 iso_pu_bacteria 2513237161 2514010728 386
458 iso_pu_bacteria 2838122688 2838126616 386
459 iso_pu_bacteria 2841941048 2841947269 386
460 iso_pu_bacteria 2841983080 2841990144 386
461 iso_pu_bacteria 8006984368 8006990351 386
462 3300013105 Ga0157369_10313617 Ga0157369_103136172 387
463 3300048918 Ga0496115_0019388 Ga0496115_0019388_1953_3224 387
464 iso_pu_bacteria 2513237096 2513656620 387
465 iso_pu_bacteria 2513237137 2513858590 387
466 iso_pu_bacteria 2513237145 2513917805 387
467 iso_pu_bacteria 2517572143 2517893147 387
468 iso_pu_bacteria 2524023210 2524466862 387
469 iso_pu_bacteria 2524023228 2524539329 387
470 iso_pu_bacteria 2602042107 2603858826 387
471 iso_pu_bacteria 2667528175 2671117781 387
472 iso_pu_bacteria 2728368998 2728754618 387
473 iso_pu_bacteria 2791355197 2793069985 387
474 iso_pu_bacteria 2791355199 2793077195 387
475 iso_pu_bacteria 2847930680 2847935193 387
476 iso_pu_bacteria 2857524615 2857528070 387
477 iso_pu_bacteria 2874604998 2874609538 387
478 iso_pu_bacteria 2879083081 2879090157 387
479 iso_pu_bacteria 2885374607 2885374740 387
480 iso_pu_bacteria 2889033259 2889040654 387
481 iso_pu_bacteria 2893066018 2893068489 387
482 iso_pu_bacteria 2903748898 2903750903 387
483 iso_pu_bacteria 2904690495 2904696519 387
484 iso_pu_bacteria 2906610324 2906617644 387
485 iso_pu_bacteria 2906635258 2906640861 387
486 iso_pu_bacteria 2906660503 2906661341 387
487 iso_pu_bacteria 2908739725 2908743538 387
488 iso_pu_bacteria 2908756301 2908760373 387
489 iso_pu_bacteria 2919073203 2919075467 387
490 iso_pu_bacteria 2922425934 2922429341 387
491 iso_pu_bacteria 2935630451 2935634084 387
492 iso_pu_bacteria 2941507105 2941510975 387
493 iso_pu_bacteria 2941515067 2941518359 387
494 iso_pu_bacteria 2941523033 2941527378 387
495 iso_pu_bacteria 8006926726 8006930859 387
496 iso_pu_bacteria 8006933436 8006941631 387
497 iso_pu_bacteria 8006973647 8006981341 387
498 iso_pu_bacteria 8019555841 8019557552 387
499 iso_pu_bacteria 8019565922 8019567745 387
500 iso_pu_bacteria 8056673599 8056674572 387
501 3300005983 Ga0081540_1004483 Ga0081540_10044838 388
502 3300025933 Ga0207706_10219411 Ga0207706_102194112 388
503 3300035111 Ga0373923_0001732 Ga0373923_0001732_1435_2694 388
504 3300035170 Ga0373943_0007871 Ga0373943_0007871_3494_4753 388
505 3300035171 Ga0373946_0027008 Ga0373946_0027008_60_1319 388
506 3300035692 Ga0373935_0014832 Ga0373935_0014832_855_2114 388
507 3300037068 Ga0373925_0037184 Ga0373925_0037184_642_1901 388
508 3300046517 Ga0495630_0019175 Ga0495630_0019175_1694_2953 388
509 3300047319 Ga0495674_0043351 Ga0495674_0043351_703_1962 388
510 iso_pu_bacteria 2508501009 2508543458 388
511 iso_pu_bacteria 2508501042 2508698765 388
512 iso_pu_bacteria 2511231028 2511398428 388
513 iso_pu_bacteria 2513237094 2513637980 388
514 iso_pu_bacteria 2513237095 2513646581 388
515 iso_pu_bacteria 2513237102 2513702025 388
516 iso_pu_bacteria 2513237104 2513717501 388
517 iso_pu_bacteria 2513237139 2513876388 388
518 iso_pu_bacteria 2515154112 2515628994 388
519 iso_pu_bacteria 2524023205 2524436484 388
520 iso_pu_bacteria 2528768022 2528855971 388
521 iso_pu_bacteria 2617270735 2617352239 388
522 iso_pu_bacteria 2744054633 2745077143 388
523 iso_pu_bacteria 2791355196 2793064838 388
524 iso_pu_bacteria 2802429603 2805920134 388
525 iso_pu_bacteria 2816332527 2818240226 388
526 iso_pu_bacteria 2824600985 2824604213 388
527 iso_pu_bacteria 2824609381 2824613202 388
528 iso_pu_bacteria 2824626560 2824629371 388
529 iso_pu_bacteria 2824635225 2824641173 388
530 iso_pu_bacteria 2824644064 2824647132 388
531 iso_pu_bacteria 2824653114 2824657539 388
532 iso_pu_bacteria 2824704595 2824710507 388
533 iso_pu_bacteria 2824714736 2824717264 388
534 iso_pu_bacteria 2824723954 2824727518 388
535 iso_pu_bacteria 2824753945 2824760202 388
536 iso_pu_bacteria 2824763712 2824767191 388
537 iso_pu_bacteria 2844315083 2844318315 388
538 iso_pu_bacteria 2857509624 2857510557 388
539 iso_pu_bacteria 2874590934 2874597510 388
540 iso_pu_bacteria 2874612657 2874612778 388
541 iso_pu_bacteria 2874645413 2874648586 388
542 iso_pu_bacteria 2876771140 2876777693 388
543 iso_pu_bacteria 2879127579 2879134558 388
544 iso_pu_bacteria 2879142872 2879149907 388
545 iso_pu_bacteria 2881364244 2881366639 388
546 iso_pu_bacteria 2881665667 2881669607 388
547 iso_pu_bacteria 2885409591 2885417414 388
548 iso_pu_bacteria 2888419890 2888423635 388
549 iso_pu_bacteria 2903727486 2903729262 388
550 iso_pu_bacteria 2904711408 2904717092 388
551 iso_pu_bacteria 2906602504 2906605208 388
552 iso_pu_bacteria 2906643746 2906645896 388
553 iso_pu_bacteria 2922368715 2922373416 388
554 iso_pu_bacteria 2932784394 2932793187 388
555 iso_pu_bacteria 2932794094 2932796434 388
556 iso_pu_bacteria 2932801729 2932808945 388
557 iso_pu_bacteria 2932809354 2932813026 388
558 iso_pu_bacteria 2932818245 2932821124 388
559 iso_pu_bacteria 2932828146 2932836769 388
560 iso_pu_bacteria 2933577622 2933579120 388
561 iso_pu_bacteria 2935608549 2935611699 388
562 iso_pu_bacteria 2935616580 2935621534 388
563 iso_pu_bacteria 2935638405 2935645466 388
564 iso_pu_bacteria 2935648319 2935651776 388
565 iso_pu_bacteria 2935656913 2935660586 388
566 iso_pu_bacteria 2935665750 2935667584 388
567 iso_pu_bacteria 2935675223 2935681747 388
568 iso_pu_bacteria 2935684952 2935688333 388
569 iso_pu_bacteria 2935694250 2935699016 388
570 iso_pu_bacteria 2935703347 2935706396 388
571 iso_pu_bacteria 2935713505 2935715352 388
572 iso_pu_bacteria 2935722832 2935726084 388
573 iso_pu_bacteria 2935732158 2935734171 388
574 iso_pu_bacteria 2935741537 2935743550 388
575 iso_pu_bacteria 2935750917 2935754413 388
576 iso_pu_bacteria 2935760218 2935768470 388
577 iso_pu_bacteria 2935769743 2935774089 388
578 iso_pu_bacteria 2935777560 2935780611 388
579 iso_pu_bacteria 2935785616 2935789541 388
580 iso_pu_bacteria 2935793552 2935797318 388
581 iso_pu_bacteria 2935801545 2935806608 388
582 iso_pu_bacteria 2935810662 2935813201 388
583 iso_pu_bacteria 2935819856 2935821177 388
584 iso_pu_bacteria 2935827899 2935830854 388
585 iso_pu_bacteria 2935837841 2935840879 388
586 iso_pu_bacteria 2935847175 2935850563 388
587 iso_pu_bacteria 2935855204 2935859781 388
588 iso_pu_bacteria 2935864058 2935869146 388
589 iso_pu_bacteria 2935873716 2935880661 388
590 iso_pu_bacteria 2935883170 2935886657 388
591 iso_pu_bacteria 2935908558 2935914163 388
592 iso_pu_bacteria 2935916978 2935921333 388
593 iso_pu_bacteria 2935926038 2935931648 388
594 iso_pu_bacteria 2935934488 2935940417 388
595 iso_pu_bacteria 2935942939 2935947758 388
596 iso_pu_bacteria 2935951376 2935956701 388
597 iso_pu_bacteria 2935967501 2935973494 388
598 iso_pu_bacteria 2935975950 2935980897 388
599 iso_pu_bacteria 2935984226 2935990385 388
600 iso_pu_bacteria 2935992306 2936000937 388
601 iso_pu_bacteria 2936002035 2936010200 388
602 iso_pu_bacteria 2936011229 2936014642 388
603 iso_pu_bacteria 2936019824 2936023561 388
604 iso_pu_bacteria 2936028420 2936032589 388
605 iso_pu_bacteria 2936037263 2936043753 388
606 iso_pu_bacteria 2936046547 2936050383 388
607 iso_pu_bacteria 2936055302 2936059125 388
608 iso_pu_bacteria 2940556831 2940560211 388
609 iso_pu_bacteria 2941531003 2941534072 388
610 iso_pu_bacteria 2941538514 2941540990 388
611 iso_pu_bacteria 3005506211 3005511818 388
612 iso_pu_bacteria 3005587118 3005588535 388
613 iso_pu_bacteria 3005594810 3005598408 388
614 iso_pu_bacteria 3005710791 3005714099 388
615 iso_pu_bacteria 8016511872 8016514262 388
616 iso_pu_bacteria 8016539877 8016540006 388
617 iso_pu_bacteria 8016548790 8016553229 388
618 iso_pu_bacteria 8016557553 8016561604 388
619 iso_pu_bacteria 8016566248 8016574061 388
620 iso_pu_bacteria 8016575299 8016578176 388
621 iso_pu_bacteria 8016595262 8016599445 388
622 iso_pu_bacteria 8016622563 8016627641 388
623 iso_pu_bacteria 8016630954 8016631858 388
624 iso_pu_bacteria 8017057580 8017062161 388
625 iso_pu_bacteria 8019530166 8019535450 388
626 iso_pu_bacteria 8019538911 8019544057 388
627 iso_pu_bacteria 8019576017 8019581611 388
628 iso_pu_bacteria 8019586578 8019589245 388
629 iso_pu_bacteria 8019608314 8019616564 388
630 iso_pu_bacteria 8019629233 8019635291 388
631 iso_pu_bacteria 8019638758 8019644408 388
632 iso_pu_bacteria 8019648815 8019657445 388
633 iso_pu_bacteria 8019659431 8019663130 388
634 iso_pu_bacteria 8019668869 8019672729 388
635 iso_pu_bacteria 8019678201 8019683431 388
636 iso_pu_bacteria 8055742211 8055747223 388
637 iso_pu_bacteria 8056967851 8056972675 388
638 3300003215 JGI25153J46596_10004981 JGI25153J46596_100049813 389
639 3300005434 Ga0070709_10007626 Ga0070709_100076262 389
640 3300005436 Ga0070713_100036868 Ga0070713_1000368682 389
641 3300009551 Ga0105238_10083711 Ga0105238_100837112 389
642 3300025297 Ga0209758_1001125 Ga0209758_10011258 389
643 3300025915 Ga0207693_10003576 Ga0207693_100035763 389
644 3300045976 Ga0466967_0300897 Ga0466967_0300897_74_1339 389
645 3300046511 Ga0495608_0017694 Ga0495608_0017694_2876_4132 389
646 3300047320 Ga0495672_0021739 Ga0495672_0021739_67_1332 389
647 iso_pu_bacteria 2508501128 2509147222 389
648 3300005436 Ga0070713_100011441 Ga0070713_1000114412 390
649 3300005437 Ga0070710_10028669 Ga0070710_100286691 390
650 3300005455 Ga0070663_100134461 Ga0070663_1001344612 390
651 3300005456 Ga0070678_100195051 Ga0070678_1001950512 390
652 3300005535 Ga0070684_100001878 Ga0070684_1000018788 390
653 3300005614 Ga0068856_100215452 Ga0068856_1002154522 390
654 3300006353 Ga0075370_10047080 Ga0075370_100470803 390
655 3300006358 Ga0068871_100204876 Ga0068871_1002048762 390
656 3300011119 Ga0105246_10030068 Ga0105246_100300683 390
657 3300013296 Ga0157374_10162704 Ga0157374_101627042 390
658 3300013308 Ga0157375_10066235 Ga0157375_100662352 390
659 3300025253 Ga0209677_100918 Ga0209677_10091812 390
660 3300025254 Ga0209148_1000446 Ga0209148_10004469 390
661 3300025272 Ga0209455_1001699 Ga0209455_10016995 390
662 3300025898 Ga0207692_10013021 Ga0207692_100130212 390
663 3300025912 Ga0207707_10049975 Ga0207707_100499752 390
664 3300025940 Ga0207691_10232214 Ga0207691_102322141 390
665 3300025944 Ga0207661_10001198 Ga0207661_100011984 390
666 3300026067 Ga0207678_10029189 Ga0207678_100291895 390
667 3300026121 Ga0207683_10041843 Ga0207683_100418434 390
668 3300031507 Ga0307509_10137414 Ga0307509_101374142 390
669 3300037418 Ga0395900_0000860 Ga0395900_0000860_19491_20753 390
670 3300037466 Ga0395898_0011543 Ga0395898_0011543_3627_4889 390
671 3300044719 Ga0466971_0075956 Ga0466971_0075956_21_1286 390
672 3300045976 Ga0466967_0269766 Ga0466967_0269766_347_1603 390
673 3300048905 Ga0496102_0002395 Ga0496102_0002395_6015_7361 390
674 3300048906 Ga0496103_0078549 Ga0496103_0078549_194_1540 390
675 3300048908 Ga0496105_0033294 Ga0496105_0033294_90_1361 390
676 3300048909 Ga0496106_0002635 Ga0496106_0002635_9733_10992 390
677 3300048915 Ga0496112_0080337 Ga0496112_0080337_1035_2381 390
678 3300048918 Ga0496115_0000788 Ga0496115_0000788_4981_6327 390
679 3300048924 Ga0496121_0000495 Ga0496121_0000495_20486_21754 390
680 3300048924 Ga0496121_0000576 Ga0496121_0000576_10103_11362 390
681 3300048927 Ga0496124_0001976 Ga0496124_0001976_15701_16960 390
682 3300048928 Ga0496125_0064009 Ga0496125_0064009_429_1688 390
683 3300048929 Ga0496126_0008851 Ga0496126_0008851_7458_8717 390
684 3300048929 Ga0496126_0026942 Ga0496126_0026942_3811_5079 390
685 3300048929 Ga0496126_0072428 Ga0496126_0072428_687_1952 390
686 3300050494 nmdc:mga06z11_1148_c1 nmdc:mga06z11_1148_c1_3365_4633 390
687 3300050496 nmdc:mga07m45_49250_c1 nmdc:mga07m45_49250_c1_763_2031 390
688 3300053094 Ga0500566_0000038 Ga0500566_0000038_38741_40009 390
689 3300053095 Ga0500640_016393 Ga0500640_016393_1012_2280 390
690 3300053111 Ga0500572_000010 Ga0500572_000010_27399_28667 390
691 3300053123 Ga0500614_002202 Ga0500614_002202_259_1527 390
692 3300053136 Ga0500559_0004231 Ga0500559_0004231_1067_2335 390
693 3300053150 Ga0500603_006887 Ga0500603_006887_173_1441 390
694 3300053159 Ga0500630_071401 Ga0500630_071401_54_1322 390
695 3300053163 Ga0500639_000034 Ga0500639_000034_38424_39692 390
696 3300053177 Ga0500636_0062664 Ga0500636_0062664_619_1899 390
697 3300053735 Ga0500596_000264 Ga0500596_000264_3047_4315 390
698 3300005436 Ga0070713_100065467 Ga0070713_1000654671 391
699 3300006941 Ga0099825_1029178 Ga0099825_10291782 391
700 3300006944 Ga0099823_1053954 Ga0099823_10539541 391
701 3300007788 Ga0099795_10030979 Ga0099795_100309791 391
702 3300025898 Ga0207692_10025365 Ga0207692_100253652 391
703 3300025906 Ga0207699_10094344 Ga0207699_100943442 391
704 3300027296 Ga0209389_1000113 Ga0209389_10001134 391
705 3300027361 Ga0209489_107143 Ga0209489_10714317 391
706 3300027363 Ga0209700_100021 Ga0209700_100021152 391
707 3300031711 Ga0265314_10003315 Ga0265314_100033154 391
708 3300037418 Ga0395900_0041406 Ga0395900_0041406_950_2221 391
709 3300048904 Ga0496101_0063980 Ga0496101_0063980_785_2071 391
710 iso_pu_bacteria 2904699407 2904704007 391
711 iso_pu_bacteria 8056689827 8056690227 391
712 3300005262 Ga0065165_1003720 Ga0065165_100372010 392
713 3300009098 Ga0105245_10142434 Ga0105245_101424341 392
714 3300025297 Ga0209758_1003783 Ga0209758_10037834 392
715 3300025302 Ga0207426_1004042 Ga0207426_10040427 392
716 3300044683 Ga0466965_0067839 Ga0466965_0067839_284_1540 392
717 3300046462 Ga0495651_0005780 Ga0495651_0005780_827_2083 392
718 3300046477 Ga0495664_0060531 Ga0495664_0060531_488_1744 392
719 3300046516 Ga0495628_0018385 Ga0495628_0018385_392_1648 392
720 3300046524 Ga0495648_0039175 Ga0495648_0039175_1402_2658 392
721 3300046543 Ga0495645_0011286 Ga0495645_0011286_598_1854 392
722 3300046675 Ga0495657_0024206 Ga0495657_0024206_1937_3193 392
723 3300046689 Ga0495613_0181071 Ga0495613_0181071_115_1371 392
724 3300048088 Ga0495602_0004737 Ga0495602_0004737_11916_13172 392
725 3300048907 Ga0496104_0098726 Ga0496104_0098726_294_1550 392
726 3300048913 Ga0496110_0035199 Ga0496110_0035199_2408_3664 392
727 3300053085 Ga0495619_0161015 Ga0495619_0161015_98_1354 392
728 3300053162 Ga0500638_043036 Ga0500638_043036_646_1902 392
729 3300053177 Ga0500636_0000502 Ga0500636_0000502_11757_13013 392
730 3300003203 JGI25406J46586_10000006 JGI25406J46586_10000006117 393
731 3300005985 Ga0081539_10000176 Ga0081539_100001764 393
732 3300001979 JGI24740J21852_10007113 JGI24740J21852_100071132 394
733 3300005539 Ga0068853_100047529 Ga0068853_1000475292 394
734 3300005577 Ga0068857_100044041 Ga0068857_1000440413 394
735 3300005614 Ga0068856_100048071 Ga0068856_1000480712 394
736 3300009174 Ga0105241_10022028 Ga0105241_100220284 394
737 3300009551 Ga0105238_10022350 Ga0105238_100223504 394
738 3300025911 Ga0207654_10015889 Ga0207654_100158892 394
739 3300025913 Ga0207695_10001915 Ga0207695_1000191530 394
740 3300025914 Ga0207671_10047686 Ga0207671_100476862 394
741 3300025924 Ga0207694_10001639 Ga0207694_100016394 394
742 3300025949 Ga0207667_10045424 Ga0207667_100454244 394
743 3300026041 Ga0207639_10026484 Ga0207639_100264843 394
744 3300026078 Ga0207702_10000005 Ga0207702_100000054 394
745 3300026116 Ga0207674_10016313 Ga0207674_100163134 394
746 3300049571 Ga0501034_0176108 Ga0501034_0176108_653_1918 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04932

Wzy_C

O-Antigen ligase

193

333

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tpj-assembly1.cif.gz_B single-particle cryo-em structure of the waal o-antigen ligase in its apo state 0.6176 19 387
7tpj-assembly1.cif.gz_B single-particle cryo-em structure of the waal o-antigen ligase in its apo state 0.5832 19 387
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.4639 73 386
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.4606 73 387
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.4399 73 386
ID Description Score Start End Superfamily
af_I1MS24_1173_1306_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.476 108 239 1.25.10.10
af_I1MS24_1173_1306_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4425 108 239 1.25.10.10
af_A0A1D6EHA9_477_585_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.3749 123 219 1.20.58.390
af_P50596_22_167_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.3612 119 216 1.20.1250.10
af_F4K786_323_434_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3609 106 259 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A840HBV8-F1-model_v4 O-antigen ligase-related domain-containing protein 0.8902 17 394 GO:0016020
AF-A0A6F8NP52-F1-model_v4 deleted 0.888 21 392
AF-A0A840G657-F1-model_v4 O-antigen ligase-related domain-containing protein 0.8865 17 394 GO:0016020
AF-A5EKE2-F1-model_v4 deleted 0.8857 9 393
AF-A0A7S7T433-F1-model_v4 O-antigen ligase domain-containing protein 0.8808 1 391 GO:0016020
GO:0016874

Feature Viewer

pLDDT pTM Quality
76.74 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map