F478836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 535 | 535 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300003354|JGI25160J50197_1015733|JGI25160J50197_10157332 |
| Length | 454 |
| Sequence | MAYAATADGVNVAVPAAPGVLALQRALVWLVGASGAVVFIEPSPYEITTLLAAIIFFATGLRLRLALMLLNVGYTISAIPLFXQSEVVSWIATSWYMAVTVVFFALVTSEDTAARLDMLRRGLVVGAMVASLLAVAGYFHLVPGGNDLLTLYGRARGTFKDPNVLGAFLILPALFALQSVVSDXFRKAFRNVIAFGIMSLAILLAFSRAAWGGLVLTSAFMLALMVLTSRTNAQRSRIIVMAIVAAVLGLALIAVLLSFDSTAEMFKQRASFDQSYDEGRFGRFGRHILGAEMALDLPFGIGPLQFHRFFPEDTHNSYLNAFMSGGWLSGVCYPALVFTTVIMGFRHIFVPVPWQRAYLAVFSAFVGTVGESFVIDTDHWRHFWMMLGAMWGMIAAAQIYKIRXSRGRVVSLSSELRSRTSTPHYLAAAXXACASTGRAEHRAHRAAGRPRIRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 27 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 28 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 29 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 30 | 2791355199 | |||
| 31 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 34 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 35 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 36 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 37 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 38 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 39 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 40 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 41 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 42 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 43 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 44 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 45 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 46 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 47 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 48 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 49 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 50 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 51 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 52 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 53 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 54 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 55 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 56 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 57 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 58 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 59 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 60 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 61 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 62 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 63 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 64 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 65 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 66 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 67 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 68 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 69 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 70 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 71 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 72 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 73 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 74 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 75 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 76 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 77 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 78 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 79 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 80 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 81 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 82 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 83 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 84 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 85 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 86 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 87 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 88 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 89 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 90 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 91 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 92 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 93 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 94 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 95 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 96 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 97 | 2904699407 | |||
| 98 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 99 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 100 | 2906610324 | |||
| 101 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 102 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 103 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 104 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 105 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 106 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 107 | 2922368715 | |||
| 108 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 109 | 2922425934 | |||
| 110 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 111 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 112 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 113 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 114 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 115 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 116 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 117 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 118 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 119 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 120 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 121 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 122 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 123 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 124 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 125 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 126 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 127 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 128 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 129 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 130 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 131 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 132 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 133 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 134 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 135 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 136 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 137 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 138 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 139 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 140 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 141 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 142 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 143 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 144 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 145 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 146 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 147 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 148 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 149 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 150 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 151 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 152 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 153 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 154 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 155 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 156 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 157 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 158 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 159 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 160 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 161 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 162 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 163 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 164 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 165 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 166 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 167 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 168 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 169 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 170 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 171 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 172 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 173 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 174 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 175 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 176 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 177 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 178 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 179 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 180 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 181 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 182 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 183 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 184 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 185 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 186 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 187 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 188 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 189 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 192 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 194 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 195 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 207 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 211 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 213 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 216 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 217 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 218 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 219 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 220 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 221 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 222 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 223 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 224 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 225 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 226 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 227 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 228 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 229 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 231 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 232 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 233 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 234 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 235 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 236 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 237 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 238 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 239 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 240 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 260 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 261 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 262 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 263 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 264 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 269 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 271 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 315 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 316 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 317 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 318 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 324 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 325 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 326 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 327 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 328 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 329 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 330 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 331 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 332 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 333 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 334 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 335 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 336 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 337 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 338 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 339 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 340 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 342 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 343 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 344 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 345 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 346 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 347 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 348 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 349 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 350 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 351 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 352 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 353 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 354 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 355 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 356 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 357 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 358 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 359 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 360 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 361 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 431 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 432 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 433 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 434 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 435 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 436 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 438 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 439 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 440 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 446 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 447 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 448 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 449 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 450 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 451 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 473 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 477 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 479 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 480 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 483 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 484 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 485 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 489 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 490 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 491 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 492 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 493 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 494 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 496 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 497 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 498 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 499 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 503 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 504 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 505 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 506 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 507 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 508 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 509 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 510 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 511 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 512 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 513 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 514 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 515 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 516 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 517 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 518 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 519 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 520 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 521 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 522 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 523 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 524 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 525 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 526 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 527 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 528 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 529 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 530 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 531 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 532 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 533 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 534 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 535 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.2 |
| Metatranscriptomes | 0 |
| Isolates | 27.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13 |
| Nodule | 22.25 |
| Rhizoplane | 6.3 |
| Rhizosphere | 46.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007113 | 3300001979 | Bacteria | 4576 |
| 2 | JGI24739J22299_10014275 | 3300001989 | Bacteria | 2891 |
| 3 | JGI25406J46586_10000006 | 3300003203 | Bacteria | 114937 |
| 4 | JGI25165J46597_1004542 | 3300003214 | Bacteria | 2939 |
| 5 | JGI25153J46596_10000832 | 3300003215 | Bacteria | 18852 |
| 6 | JGI25153J46596_10004981 | 3300003215 | Bacteria | 7050 |
| 7 | JGI25153J46596_10007866 | 3300003215 | Bacteria | 5175 |
| 8 | JGI25153J46596_10009451 | 3300003215 | Bacteria | 4529 |
| 9 | JGI25160J50197_1015733 | 3300003354 | Bacteria | 2470 |
| 10 | JGI25404J52841_10006230 | 3300003659 | Bacteria | 2489 |
| 11 | Ga0055531_10007934 | 3300003794 | Bacteria | 5693 |
| 12 | Ga0055543_1002527 | 3300004625 | Bacteria | 5979 |
| 13 | Ga0065165_1001088 | 3300005262 | Bacteria | 32379 |
| 14 | Ga0065165_1003720 | 3300005262 | Bacteria | 10302 |
| 15 | Ga0065165_1008580 | 3300005262 | Bacteria | 4751 |
| 16 | Ga0070676_10081874 | 3300005328 | Bacteria | 1960 |
| 17 | Ga0070670_100151518 | 3300005331 | Bacteria | 2007 |
| 18 | Ga0068869_100067971 | 3300005334 | Bacteria | 2630 |
| 19 | Ga0070680_100006371 | 3300005336 | Bacteria | 8962 |
| 20 | Ga0070682_100091527 | 3300005337 | Bacteria | 1991 |
| 21 | Ga0068868_100044104 | 3300005338 | Bacteria | 3486 |
| 22 | Ga0070660_100141044 | 3300005339 | Bacteria | 1933 |
| 23 | Ga0070660_100217104 | 3300005339 | Bacteria | 1554 |
| 24 | Ga0070668_100056652 | 3300005347 | Bacteria | 3027 |
| 25 | Ga0070669_100115748 | 3300005353 | Bacteria | 2040 |
| 26 | Ga0070674_100036328 | 3300005356 | Bacteria | 3306 |
| 27 | Ga0070709_10000337 | 3300005434 | Bacteria | 29157 |
| 28 | Ga0070709_10007626 | 3300005434 | Bacteria | 5940 |
| 29 | Ga0070714_100041601 | 3300005435 | Bacteria | 3879 |
| 30 | Ga0070713_100011441 | 3300005436 | Bacteria | 6463 |
| 31 | Ga0070713_100036868 | 3300005436 | Bacteria | 3949 |
| 32 | Ga0070713_100065467 | 3300005436 | Bacteria | 3053 |
| 33 | Ga0070713_100158020 | 3300005436 | Bacteria | 2022 |
| 34 | Ga0070710_10000508 | 3300005437 | Bacteria | 18304 |
| 35 | Ga0070710_10028669 | 3300005437 | Bacteria | 2980 |
| 36 | Ga0070711_100001466 | 3300005439 | Bacteria | 12962 |
| 37 | Ga0070663_100134461 | 3300005455 | Bacteria | 1881 |
| 38 | Ga0070663_100142760 | 3300005455 | Bacteria | 1829 |
| 39 | Ga0070678_100070226 | 3300005456 | Bacteria | 2617 |
| 40 | Ga0070678_100195051 | 3300005456 | Bacteria | 1667 |
| 41 | Ga0070681_10021753 | 3300005458 | Bacteria | 6431 |
| 42 | Ga0070681_10053305 | 3300005458 | Bacteria | 4030 |
| 43 | Ga0070699_100059665 | 3300005518 | Bacteria | 3305 |
| 44 | Ga0070679_100007739 | 3300005530 | Bacteria | 10062 |
| 45 | Ga0070684_100001878 | 3300005535 | Bacteria | 15380 |
| 46 | Ga0068853_100047529 | 3300005539 | Bacteria | 3682 |
| 47 | Ga0068853_100171773 | 3300005539 | Bacteria | 1961 |
| 48 | Ga0068853_100227066 | 3300005539 | Bacteria | 1707 |
| 49 | Ga0070672_100062511 | 3300005543 | Bacteria | 2938 |
| 50 | Ga0070672_100216165 | 3300005543 | Bacteria | 1607 |
| 51 | Ga0070686_100098222 | 3300005544 | Bacteria | 1973 |
| 52 | Ga0070695_100054541 | 3300005545 | Bacteria | 2573 |
| 53 | Ga0070665_100013576 | 3300005548 | Bacteria | 8194 |
| 54 | Ga0070665_100079277 | 3300005548 | Bacteria | 3290 |
| 55 | Ga0070665_100207409 | 3300005548 | Bacteria | 1960 |
| 56 | Ga0070665_100208365 | 3300005548 | Bacteria | 1955 |
| 57 | Ga0070665_100298880 | 3300005548 | Bacteria | 1612 |
| 58 | Ga0068855_100031483 | 3300005563 | Bacteria | 6334 |
| 59 | Ga0068857_100010572 | 3300005577 | Bacteria | 8024 |
| 60 | Ga0068857_100044041 | 3300005577 | Bacteria | 3958 |
| 61 | Ga0068856_100001022 | 3300005614 | Bacteria | 29775 |
| 62 | Ga0068856_100048071 | 3300005614 | Bacteria | 4203 |
| 63 | Ga0068856_100171227 | 3300005614 | Bacteria | 2183 |
| 64 | Ga0068856_100215452 | 3300005614 | Bacteria | 1935 |
| 65 | Ga0068852_100096896 | 3300005616 | Bacteria | 2652 |
| 66 | Ga0068861_100181881 | 3300005719 | Bacteria | 1751 |
| 67 | Ga0068858_100079138 | 3300005842 | Bacteria | 3054 |
| 68 | Ga0068860_100061824 | 3300005843 | Bacteria | 3558 |
| 69 | Ga0068862_100068496 | 3300005844 | Bacteria | 3061 |
| 70 | Ga0081455_10001781 | 3300005937 | Bacteria | 26018 |
| 71 | Ga0081455_10189678 | 3300005937 | Bacteria | 1549 |
| 72 | Ga0081540_1002370 | 3300005983 | Bacteria | 15392 |
| 73 | Ga0081540_1004255 | 3300005983 | Bacteria | 10988 |
| 74 | Ga0081540_1004483 | 3300005983 | Bacteria | 10622 |
| 75 | Ga0081540_1017300 | 3300005983 | Bacteria | 4468 |
| 76 | Ga0081540_1019199 | 3300005983 | Bacteria | 4165 |
| 77 | Ga0081540_1022051 | 3300005983 | Bacteria | 3769 |
| 78 | Ga0081540_1024880 | 3300005983 | Bacteria | 3462 |
| 79 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 80 | Ga0075365_10000847 | 3300006038 | Bacteria | 12688 |
| 81 | Ga0075365_10005922 | 3300006038 | Bacteria | 6657 |
| 82 | Ga0075365_10129373 | 3300006038 | Bacteria | 1746 |
| 83 | Ga0075365_10183177 | 3300006038 | Bacteria | 1465 |
| 84 | Ga0075363_100008360 | 3300006048 | Bacteria | 4815 |
| 85 | Ga0075363_100022810 | 3300006048 | Bacteria | 3167 |
| 86 | Ga0075363_100060556 | 3300006048 | Bacteria | 2038 |
| 87 | Ga0075364_10001659 | 3300006051 | Bacteria | 12217 |
| 88 | Ga0075364_10052047 | 3300006051 | Bacteria | 2675 |
| 89 | Ga0070716_100003986 | 3300006173 | Bacteria | 7009 |
| 90 | Ga0075367_10011928 | 3300006178 | Bacteria | 4616 |
| 91 | Ga0075366_10010275 | 3300006195 | Bacteria | 5251 |
| 92 | Ga0075370_10013657 | 3300006353 | Bacteria | 4322 |
| 93 | Ga0075370_10047080 | 3300006353 | Bacteria | 2441 |
| 94 | Ga0075370_10066385 | 3300006353 | Bacteria | 2058 |
| 95 | Ga0068871_100068833 | 3300006358 | Bacteria | 2906 |
| 96 | Ga0068871_100204876 | 3300006358 | Bacteria | 1704 |
| 97 | Ga0068865_100092587 | 3300006881 | Bacteria | 2196 |
| 98 | Ga0099825_1029178 | 3300006941 | Bacteria | 2593 |
| 99 | Ga0099824_1025534 | 3300006942 | Bacteria | 3217 |
| 100 | Ga0099823_1053954 | 3300006944 | Bacteria | 2336 |
| 101 | Ga0099794_10015790 | 3300007265 | Bacteria | 3339 |
| 102 | Ga0099795_10030979 | 3300007788 | Bacteria | 1839 |
| 103 | Ga0105240_10043962 | 3300009093 | Bacteria | 5680 |
| 104 | Ga0105240_10410751 | 3300009093 | Bacteria | 1523 |
| 105 | Ga0111539_10306833 | 3300009094 | Bacteria | 1847 |
| 106 | Ga0105245_10076910 | 3300009098 | Bacteria | 3042 |
| 107 | Ga0105245_10142434 | 3300009098 | Bacteria | 2259 |
| 108 | Ga0105247_10088097 | 3300009101 | Bacteria | 1967 |
| 109 | Ga0105243_10194159 | 3300009148 | Bacteria | 1775 |
| 110 | Ga0105241_10022028 | 3300009174 | Bacteria | 4716 |
| 111 | Ga0105241_10029082 | 3300009174 | Bacteria | 4120 |
| 112 | Ga0105242_10119826 | 3300009176 | Bacteria | 2256 |
| 113 | Ga0105242_10234703 | 3300009176 | Bacteria | 1646 |
| 114 | Ga0105248_10049122 | 3300009177 | Bacteria | 4732 |
| 115 | Ga0105248_10381639 | 3300009177 | Bacteria | 1587 |
| 116 | Ga0105237_10009523 | 3300009545 | Bacteria | 10402 |
| 117 | Ga0105237_10051435 | 3300009545 | Bacteria | 4138 |
| 118 | Ga0105237_10084683 | 3300009545 | Bacteria | 3160 |
| 119 | Ga0105237_10214473 | 3300009545 | Bacteria | 1925 |
| 120 | Ga0105237_10334664 | 3300009545 | Bacteria | 1518 |
| 121 | Ga0105238_10022350 | 3300009551 | Bacteria | 6448 |
| 122 | Ga0105238_10028683 | 3300009551 | Bacteria | 5669 |
| 123 | Ga0105238_10083711 | 3300009551 | Bacteria | 3179 |
| 124 | Ga0105238_10102172 | 3300009551 | Bacteria | 2849 |
| 125 | Ga0105238_10125187 | 3300009551 | Bacteria | 2549 |
| 126 | Ga0105238_10193511 | 3300009551 | Bacteria | 2009 |
| 127 | Ga0105249_10047992 | 3300009553 | Bacteria | 3893 |
| 128 | Ga0105249_10095720 | 3300009553 | Bacteria | 2784 |
| 129 | Ga0105239_10110112 | 3300010375 | Bacteria | 3053 |
| 130 | Ga0105239_10213532 | 3300010375 | Bacteria | 2163 |
| 131 | Ga0105239_10443900 | 3300010375 | Bacteria | 1471 |
| 132 | Ga0105246_10030068 | 3300011119 | Bacteria | 3584 |
| 133 | Ga0105246_10185390 | 3300011119 | Bacteria | 1606 |
| 134 | Ga0157369_10313617 | 3300013105 | Bacteria | 1631 |
| 135 | Ga0157374_10162704 | 3300013296 | Bacteria | 2174 |
| 136 | Ga0157374_10168298 | 3300013296 | Bacteria | 2137 |
| 137 | Ga0157374_10406198 | 3300013296 | Bacteria | 1359 |
| 138 | Ga0157378_10194076 | 3300013297 | Bacteria | 1917 |
| 139 | Ga0157378_10254541 | 3300013297 | Bacteria | 1682 |
| 140 | Ga0163162_10210807 | 3300013306 | Bacteria | 2072 |
| 141 | Ga0163162_10443706 | 3300013306 | Bacteria | 1430 |
| 142 | Ga0157375_10066235 | 3300013308 | Bacteria | 3605 |
| 143 | Ga0157377_10161823 | 3300014745 | Bacteria | 1393 |
| 144 | Ga0214544_1000009 | 3300021320 | Bacteria | 285865 |
| 145 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 146 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 147 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 148 | Ga0213872_10054255 | 3300021361 | Bacteria | 1818 |
| 149 | Ga0209677_100918 | 3300025253 | Bacteria | 14404 |
| 150 | Ga0209148_1000446 | 3300025254 | Bacteria | 45354 |
| 151 | Ga0209233_1005840 | 3300025261 | Bacteria | 4041 |
| 152 | Ga0209455_1001699 | 3300025272 | Bacteria | 9434 |
| 153 | Ga0209564_1003387 | 3300025295 | Bacteria | 10992 |
| 154 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 155 | Ga0209758_1001008 | 3300025297 | Bacteria | 37348 |
| 156 | Ga0209758_1001125 | 3300025297 | Bacteria | 34352 |
| 157 | Ga0209758_1002793 | 3300025297 | Bacteria | 17073 |
| 158 | Ga0209758_1003783 | 3300025297 | Bacteria | 13341 |
| 159 | Ga0209758_1005742 | 3300025297 | Bacteria | 9346 |
| 160 | Ga0209256_1001740 | 3300025299 | Bacteria | 20811 |
| 161 | Ga0209256_1021489 | 3300025299 | Bacteria | 1978 |
| 162 | Ga0207426_1001526 | 3300025302 | Bacteria | 18870 |
| 163 | Ga0207426_1004042 | 3300025302 | Bacteria | 7425 |
| 164 | Ga0207426_1009873 | 3300025302 | Bacteria | 3741 |
| 165 | Ga0209257_1006404 | 3300025304 | Bacteria | 7602 |
| 166 | Ga0207697_10032285 | 3300025315 | Bacteria | 2143 |
| 167 | Ga0207696_1037947 | 3300025711 | Bacteria | 1424 |
| 168 | Ga0207692_10001906 | 3300025898 | Bacteria | 7932 |
| 169 | Ga0207692_10013021 | 3300025898 | Bacteria | 3595 |
| 170 | Ga0207692_10025365 | 3300025898 | Bacteria | 2768 |
| 171 | Ga0207710_10005054 | 3300025900 | Bacteria | 5716 |
| 172 | Ga0207710_10024168 | 3300025900 | Bacteria | 2615 |
| 173 | Ga0207680_10082220 | 3300025903 | Bacteria | 2026 |
| 174 | Ga0207647_10002042 | 3300025904 | Bacteria | 15435 |
| 175 | Ga0207647_10009252 | 3300025904 | Bacteria | 7006 |
| 176 | Ga0207699_10000604 | 3300025906 | Bacteria | 17559 |
| 177 | Ga0207699_10094344 | 3300025906 | Bacteria | 1885 |
| 178 | Ga0207645_10025440 | 3300025907 | Bacteria | 3830 |
| 179 | Ga0207654_10015889 | 3300025911 | Bacteria | 3914 |
| 180 | Ga0207654_10020055 | 3300025911 | Bacteria | 3537 |
| 181 | Ga0207707_10000494 | 3300025912 | Bacteria | 40531 |
| 182 | Ga0207707_10035695 | 3300025912 | Bacteria | 4347 |
| 183 | Ga0207707_10049975 | 3300025912 | Bacteria | 3643 |
| 184 | Ga0207695_10001915 | 3300025913 | Bacteria | 32381 |
| 185 | Ga0207695_10047612 | 3300025913 | Bacteria | 4535 |
| 186 | Ga0207671_10008450 | 3300025914 | Bacteria | 8728 |
| 187 | Ga0207671_10047686 | 3300025914 | Bacteria | 3171 |
| 188 | Ga0207693_10003576 | 3300025915 | Bacteria | 13283 |
| 189 | Ga0207663_10004391 | 3300025916 | Bacteria | 7001 |
| 190 | Ga0207652_10085185 | 3300025921 | Bacteria | 2770 |
| 191 | Ga0207694_10001639 | 3300025924 | Bacteria | 18837 |
| 192 | Ga0207694_10143171 | 3300025924 | Bacteria | 1923 |
| 193 | Ga0207687_10060165 | 3300025927 | Bacteria | 2678 |
| 194 | Ga0207664_10006080 | 3300025929 | Bacteria | 8268 |
| 195 | Ga0207690_10044054 | 3300025932 | Bacteria | 2940 |
| 196 | Ga0207706_10017328 | 3300025933 | Bacteria | 6489 |
| 197 | Ga0207706_10204557 | 3300025933 | Bacteria | 1731 |
| 198 | Ga0207706_10219411 | 3300025933 | Bacteria | 1665 |
| 199 | Ga0207704_10133782 | 3300025938 | Bacteria | 1722 |
| 200 | Ga0207665_10001395 | 3300025939 | Bacteria | 16252 |
| 201 | Ga0207665_10048653 | 3300025939 | Bacteria | 2847 |
| 202 | Ga0207691_10232214 | 3300025940 | Bacteria | 1597 |
| 203 | Ga0207711_10165321 | 3300025941 | Bacteria | 2005 |
| 204 | Ga0207711_10257946 | 3300025941 | Bacteria | 1602 |
| 205 | Ga0207661_10001198 | 3300025944 | Bacteria | 17338 |
| 206 | Ga0207667_10045424 | 3300025949 | Bacteria | 4652 |
| 207 | Ga0207667_10110572 | 3300025949 | Bacteria | 2834 |
| 208 | Ga0207651_10161569 | 3300025960 | Bacteria | 1757 |
| 209 | Ga0207651_10188298 | 3300025960 | Bacteria | 1644 |
| 210 | Ga0207712_10025690 | 3300025961 | Bacteria | 3916 |
| 211 | Ga0207668_10045686 | 3300025972 | Bacteria | 2988 |
| 212 | Ga0207668_10049546 | 3300025972 | Bacteria | 2888 |
| 213 | Ga0207640_10006337 | 3300025981 | Bacteria | 6489 |
| 214 | Ga0207677_10241143 | 3300026023 | Bacteria | 1462 |
| 215 | Ga0207703_10097429 | 3300026035 | Bacteria | 2485 |
| 216 | Ga0207639_10026484 | 3300026041 | Bacteria | 4214 |
| 217 | Ga0207639_10139229 | 3300026041 | Bacteria | 2020 |
| 218 | Ga0207678_10003850 | 3300026067 | Bacteria | 13493 |
| 219 | Ga0207678_10029189 | 3300026067 | Bacteria | 4814 |
| 220 | Ga0207678_10048914 | 3300026067 | Bacteria | 3653 |
| 221 | Ga0207708_10086818 | 3300026075 | Bacteria | 2408 |
| 222 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 223 | Ga0207702_10056441 | 3300026078 | Bacteria | 3334 |
| 224 | Ga0207702_10234090 | 3300026078 | Bacteria | 1718 |
| 225 | Ga0207648_10090287 | 3300026089 | Bacteria | 2677 |
| 226 | Ga0207674_10016313 | 3300026116 | Bacteria | 8136 |
| 227 | Ga0207674_10022053 | 3300026116 | Bacteria | 6846 |
| 228 | Ga0207674_10068635 | 3300026116 | Bacteria | 3567 |
| 229 | Ga0207675_100131542 | 3300026118 | Bacteria | 2373 |
| 230 | Ga0207675_100196523 | 3300026118 | Bacteria | 1936 |
| 231 | Ga0207683_10039306 | 3300026121 | Bacteria | 4127 |
| 232 | Ga0207683_10041843 | 3300026121 | Bacteria | 4001 |
| 233 | Ga0207698_10098663 | 3300026142 | Bacteria | 2414 |
| 234 | Ga0207698_10168600 | 3300026142 | Bacteria | 1925 |
| 235 | Ga0209389_1000084 | 3300027296 | Bacteria | 85267 |
| 236 | Ga0209389_1000113 | 3300027296 | Bacteria | 72242 |
| 237 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 238 | Ga0209589_1000041 | 3300027357 | Bacteria | 125191 |
| 239 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 240 | Ga0209489_100070 | 3300027361 | Bacteria | 138580 |
| 241 | Ga0209489_107143 | 3300027361 | Bacteria | 17020 |
| 242 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 243 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 244 | Ga0209588_1029210 | 3300027671 | Bacteria | 1758 |
| 245 | Ga0209813_10009226 | 3300027866 | Bacteria | 2516 |
| 246 | Ga0268266_10003050 | 3300028379 | Bacteria | 17142 |
| 247 | Ga0268266_10028409 | 3300028379 | Bacteria | 4755 |
| 248 | Ga0268266_10130458 | 3300028379 | Bacteria | 2247 |
| 249 | Ga0268266_10213379 | 3300028379 | Bacteria | 1771 |
| 250 | Ga0268265_10060234 | 3300028380 | Bacteria | 2908 |
| 251 | Ga0268265_10133591 | 3300028380 | Bacteria | 2066 |
| 252 | Ga0268264_10110958 | 3300028381 | Bacteria | 2402 |
| 253 | Ga0265326_10009117 | 3300028558 | Bacteria | 2970 |
| 254 | Ga0265319_1002888 | 3300028563 | Bacteria | 9172 |
| 255 | Ga0265318_10005626 | 3300028577 | Bacteria | 5870 |
| 256 | Ga0265323_10000846 | 3300028653 | Bacteria | 16302 |
| 257 | Ga0265336_10001639 | 3300028666 | Bacteria | 9920 |
| 258 | Ga0265338_10004452 | 3300028800 | Bacteria | 18916 |
| 259 | Ga0265324_10003894 | 3300029957 | Bacteria | 6954 |
| 260 | Ga0265339_10007490 | 3300031249 | Bacteria | 7047 |
| 261 | Ga0265331_10013580 | 3300031250 | Bacteria | 4373 |
| 262 | Ga0265316_10065111 | 3300031344 | Bacteria | 2823 |
| 263 | Ga0307509_10008409 | 3300031507 | Bacteria | 13174 |
| 264 | Ga0307509_10137414 | 3300031507 | Bacteria | 2387 |
| 265 | Ga0307509_10237115 | 3300031507 | Bacteria | 1621 |
| 266 | Ga0265313_10060349 | 3300031595 | Bacteria | 1779 |
| 267 | Ga0265314_10003315 | 3300031711 | Bacteria | 15703 |
| 268 | Ga0265342_10067263 | 3300031712 | Bacteria | 2097 |
| 269 | Ga0307405_10240717 | 3300031731 | Bacteria | 1340 |
| 270 | Ga0307414_10200150 | 3300032004 | Bacteria | 1624 |
| 271 | Ga0307411_10060224 | 3300032005 | Bacteria | 2520 |
| 272 | Ga0373923_0001732 | 3300035111 | Bacteria | 6425 |
| 273 | Ga0373943_0005419 | 3300035170 | Bacteria | 5740 |
| 274 | Ga0373943_0007871 | 3300035170 | Bacteria | 4783 |
| 275 | Ga0373946_0004494 | 3300035171 | Bacteria | 4995 |
| 276 | Ga0373946_0027008 | 3300035171 | Bacteria | 2268 |
| 277 | Ga0373935_0001387 | 3300035692 | Bacteria | 13389 |
| 278 | Ga0373935_0014832 | 3300035692 | Bacteria | 4704 |
| 279 | Ga0373927_0000225 | 3300035695 | Bacteria | 44840 |
| 280 | Ga0373927_0010994 | 3300035695 | Bacteria | 6028 |
| 281 | Ga0373927_0099346 | 3300035695 | Bacteria | 1892 |
| 282 | Ga0373933_0000922 | 3300035724 | Bacteria | 17934 |
| 283 | Ga0373937_0013344 | 3300036401 | Bacteria | 7240 |
| 284 | Ga0373925_0008511 | 3300037068 | Bacteria | 7477 |
| 285 | Ga0373925_0037184 | 3300037068 | Bacteria | 3593 |
| 286 | Ga0395900_0000860 | 3300037418 | Bacteria | 40028 |
| 287 | Ga0395900_0041406 | 3300037418 | Bacteria | 4749 |
| 288 | Ga0395898_0011543 | 3300037466 | Bacteria | 9176 |
| 289 | Ga0395905_0321400 | 3300037471 | Bacteria | 1437 |
| 290 | Ga0436364_1494800 | 3300037853 | Bacteria | 1579 |
| 291 | Ga0436365_1449287 | 3300039437 | Bacteria | 1803 |
| 292 | Ga0436365_1727745 | 3300039437 | Bacteria | 22987 |
| 293 | Ga0436360_0240726 | 3300039438 | Bacteria | 2184 |
| 294 | Ga0436363_0115681 | 3300039450 | Bacteria | 8292 |
| 295 | Ga0436362_1281101 | 3300039453 | Bacteria | 2976 |
| 296 | Ga0466972_0000660 | 3300044658 | Bacteria | 16624 |
| 297 | Ga0466965_0067839 | 3300044683 | Bacteria | 1790 |
| 298 | Ga0466966_0006259 | 3300044684 | Bacteria | 7875 |
| 299 | Ga0466966_0034102 | 3300044684 | Bacteria | 3294 |
| 300 | Ga0466961_0000488 | 3300044693 | Bacteria | 25223 |
| 301 | Ga0466971_0075956 | 3300044719 | Bacteria | 1528 |
| 302 | Ga0466959_0001793 | 3300045049 | Bacteria | 13423 |
| 303 | Ga0466967_0269766 | 3300045976 | Bacteria | 1630 |
| 304 | Ga0466967_0300897 | 3300045976 | Bacteria | 1543 |
| 305 | Ga0495617_008236 | 3300046452 | Bacteria | 3598 |
| 306 | Ga0495617_015187 | 3300046452 | Bacteria | 2613 |
| 307 | Ga0495592_0016560 | 3300046454 | Bacteria | 5595 |
| 308 | Ga0495603_0000960 | 3300046455 | Bacteria | 16606 |
| 309 | Ga0495603_0016385 | 3300046455 | Bacteria | 4483 |
| 310 | Ga0495590_0005096 | 3300046457 | Bacteria | 5239 |
| 311 | Ga0495629_0000179 | 3300046459 | Bacteria | 56885 |
| 312 | Ga0495629_0012947 | 3300046459 | Bacteria | 6032 |
| 313 | Ga0495638_0018157 | 3300046460 | Bacteria | 4674 |
| 314 | Ga0495638_0092123 | 3300046460 | Bacteria | 1824 |
| 315 | Ga0495641_0004740 | 3300046461 | Bacteria | 9474 |
| 316 | Ga0495651_0005780 | 3300046462 | Bacteria | 9439 |
| 317 | Ga0495651_0049679 | 3300046462 | Bacteria | 3238 |
| 318 | Ga0495580_0000280 | 3300046472 | Bacteria | 41385 |
| 319 | Ga0495582_0000061 | 3300046473 | Bacteria | 55522 |
| 320 | Ga0495605_0033525 | 3300046474 | Bacteria | 2606 |
| 321 | Ga0495639_0000102 | 3300046475 | Bacteria | 42249 |
| 322 | Ga0495662_0000746 | 3300046476 | Bacteria | 15602 |
| 323 | Ga0495664_0060531 | 3300046477 | Bacteria | 2254 |
| 324 | Ga0495584_0006929 | 3300046491 | Bacteria | 5923 |
| 325 | Ga0495585_0010422 | 3300046492 | Bacteria | 5533 |
| 326 | Ga0495594_0063753 | 3300046499 | Bacteria | 2042 |
| 327 | Ga0495596_0043580 | 3300046500 | Bacteria | 1768 |
| 328 | Ga0495583_0032341 | 3300046506 | Bacteria | 2526 |
| 329 | Ga0495606_0016261 | 3300046507 | Bacteria | 5681 |
| 330 | Ga0495606_0020685 | 3300046507 | Bacteria | 4843 |
| 331 | Ga0495606_0097073 | 3300046507 | Bacteria | 1801 |
| 332 | Ga0495608_0017694 | 3300046511 | Bacteria | 4928 |
| 333 | Ga0495608_0038700 | 3300046511 | Bacteria | 3201 |
| 334 | Ga0495610_0014018 | 3300046512 | Bacteria | 4734 |
| 335 | Ga0495616_0021776 | 3300046513 | Bacteria | 3466 |
| 336 | Ga0495616_0078080 | 3300046513 | Bacteria | 1588 |
| 337 | Ga0495628_0018385 | 3300046516 | Bacteria | 5791 |
| 338 | Ga0495630_0010364 | 3300046517 | Bacteria | 6725 |
| 339 | Ga0495630_0019175 | 3300046517 | Bacteria | 5027 |
| 340 | Ga0495631_0015648 | 3300046518 | Bacteria | 3629 |
| 341 | Ga0495643_0005874 | 3300046522 | Bacteria | 8209 |
| 342 | Ga0495643_0049338 | 3300046522 | Bacteria | 2270 |
| 343 | Ga0495644_0012092 | 3300046523 | Bacteria | 3319 |
| 344 | Ga0495644_0040724 | 3300046523 | Bacteria | 1751 |
| 345 | Ga0495648_0001196 | 3300046524 | Bacteria | 25992 |
| 346 | Ga0495648_0016227 | 3300046524 | Bacteria | 5373 |
| 347 | Ga0495648_0039175 | 3300046524 | Bacteria | 3019 |
| 348 | Ga0495648_0058592 | 3300046524 | Bacteria | 2302 |
| 349 | Ga0495642_0040847 | 3300046528 | Bacteria | 1885 |
| 350 | Ga0495652_0130932 | 3300046529 | Bacteria | 1986 |
| 351 | Ga0495654_0026916 | 3300046530 | Bacteria | 2952 |
| 352 | Ga0495665_0000261 | 3300046531 | Bacteria | 26625 |
| 353 | Ga0495640_0002042 | 3300046533 | Bacteria | 16096 |
| 354 | Ga0495640_0047051 | 3300046533 | Bacteria | 2986 |
| 355 | Ga0495609_0011640 | 3300046538 | Bacteria | 4187 |
| 356 | Ga0495597_0025045 | 3300046542 | Bacteria | 2749 |
| 357 | Ga0495597_0025816 | 3300046542 | Bacteria | 2703 |
| 358 | Ga0495645_0011286 | 3300046543 | Bacteria | 6282 |
| 359 | Ga0495622_0006847 | 3300046557 | Bacteria | 5290 |
| 360 | Ga0495622_0012581 | 3300046557 | Bacteria | 3921 |
| 361 | Ga0495622_0038836 | 3300046557 | Bacteria | 2216 |
| 362 | Ga0495668_0017190 | 3300046616 | Bacteria | 4200 |
| 363 | Ga0495634_0000161 | 3300046642 | Bacteria | 60925 |
| 364 | Ga0495611_0003326 | 3300046648 | Bacteria | 7104 |
| 365 | Ga0495625_0061484 | 3300046660 | Bacteria | 2657 |
| 366 | Ga0495635_0001102 | 3300046663 | Bacteria | 17952 |
| 367 | Ga0495635_0028637 | 3300046663 | Bacteria | 3871 |
| 368 | Ga0495588_0038099 | 3300046674 | Bacteria | 2445 |
| 369 | Ga0495657_0024206 | 3300046675 | Bacteria | 4327 |
| 370 | Ga0495647_0000205 | 3300046681 | Bacteria | 15996 |
| 371 | Ga0495658_0001114 | 3300046683 | Bacteria | 14225 |
| 372 | Ga0495658_0128394 | 3300046683 | Bacteria | 1541 |
| 373 | Ga0495669_0029399 | 3300046684 | Bacteria | 2409 |
| 374 | Ga0495669_0045802 | 3300046684 | Bacteria | 1951 |
| 375 | Ga0495669_0100740 | 3300046684 | Bacteria | 1341 |
| 376 | Ga0495613_0181071 | 3300046689 | Bacteria | 1492 |
| 377 | Ga0495670_0006173 | 3300046691 | Bacteria | 5886 |
| 378 | Ga0495671_0042294 | 3300046692 | Bacteria | 2290 |
| 379 | Ga0495671_0091687 | 3300046692 | Bacteria | 1487 |
| 380 | Ga0495649_0009550 | 3300046694 | Bacteria | 5754 |
| 381 | Ga0495589_0087965 | 3300046794 | Bacteria | 1508 |
| 382 | Ga0495600_0033984 | 3300046809 | Bacteria | 3311 |
| 383 | Ga0495660_0041481 | 3300046810 | Bacteria | 2548 |
| 384 | Ga0495581_0000255 | 3300047315 | Bacteria | 25578 |
| 385 | Ga0495604_0062628 | 3300047317 | Bacteria | 2840 |
| 386 | Ga0495674_0000117 | 3300047319 | Bacteria | 60130 |
| 387 | Ga0495674_0043351 | 3300047319 | Bacteria | 4004 |
| 388 | Ga0495672_0021739 | 3300047320 | Bacteria | 4180 |
| 389 | Ga0495676_0021084 | 3300047321 | Bacteria | 5703 |
| 390 | Ga0495683_0060157 | 3300047323 | Bacteria | 1883 |
| 391 | Ga0495687_009368 | 3300047443 | Bacteria | 5480 |
| 392 | Ga0495673_0018952 | 3300047469 | Bacteria | 3457 |
| 393 | Ga0495686_0077424 | 3300047472 | Bacteria | 2036 |
| 394 | Ga0495593_0000297 | 3300047673 | Bacteria | 27089 |
| 395 | Ga0495602_0004737 | 3300048088 | Bacteria | 14223 |
| 396 | Ga0495602_0099531 | 3300048088 | Bacteria | 2390 |
| 397 | Ga0496101_0063980 | 3300048904 | Bacteria | 2679 |
| 398 | Ga0496101_0098923 | 3300048904 | Bacteria | 2180 |
| 399 | Ga0496101_0119178 | 3300048904 | Bacteria | 1994 |
| 400 | Ga0496101_0125707 | 3300048904 | Bacteria | 1943 |
| 401 | Ga0496101_0151344 | 3300048904 | Bacteria | 1775 |
| 402 | Ga0496102_0002395 | 3300048905 | Bacteria | 16005 |
| 403 | Ga0496102_0004565 | 3300048905 | Bacteria | 11700 |
| 404 | Ga0496102_0206226 | 3300048905 | Bacteria | 1853 |
| 405 | Ga0496102_0255730 | 3300048905 | Bacteria | 1651 |
| 406 | Ga0496103_0027863 | 3300048906 | Bacteria | 3426 |
| 407 | Ga0496103_0044664 | 3300048906 | Bacteria | 2731 |
| 408 | Ga0496103_0078549 | 3300048906 | Bacteria | 2073 |
| 409 | Ga0496104_0006852 | 3300048907 | Bacteria | 10044 |
| 410 | Ga0496104_0007850 | 3300048907 | Bacteria | 9459 |
| 411 | Ga0496104_0009000 | 3300048907 | Bacteria | 8880 |
| 412 | Ga0496104_0098726 | 3300048907 | Bacteria | 2795 |
| 413 | Ga0496105_0001479 | 3300048908 | Bacteria | 16579 |
| 414 | Ga0496105_0033294 | 3300048908 | Bacteria | 4230 |
| 415 | Ga0496105_0042728 | 3300048908 | Bacteria | 3738 |
| 416 | Ga0496105_0126000 | 3300048908 | Bacteria | 2111 |
| 417 | Ga0496106_0002635 | 3300048909 | Bacteria | 13341 |
| 418 | Ga0496106_0217297 | 3300048909 | Bacteria | 1524 |
| 419 | Ga0496106_0256167 | 3300048909 | Bacteria | 1400 |
| 420 | Ga0496107_0097357 | 3300048910 | Bacteria | 2154 |
| 421 | Ga0496109_0051497 | 3300048912 | Bacteria | 3750 |
| 422 | Ga0496109_0071573 | 3300048912 | Bacteria | 3184 |
| 423 | Ga0496109_0096842 | 3300048912 | Bacteria | 2734 |
| 424 | Ga0496110_0013153 | 3300048913 | Bacteria | 6833 |
| 425 | Ga0496110_0035199 | 3300048913 | Bacteria | 4343 |
| 426 | Ga0496110_0116905 | 3300048913 | Bacteria | 2401 |
| 427 | Ga0496110_0159691 | 3300048913 | Bacteria | 2043 |
| 428 | Ga0496111_0039659 | 3300048914 | Bacteria | 3378 |
| 429 | Ga0496111_0106731 | 3300048914 | Bacteria | 2061 |
| 430 | Ga0496112_0000079 | 3300048915 | Bacteria | 64101 |
| 431 | Ga0496112_0007179 | 3300048915 | Bacteria | 9867 |
| 432 | Ga0496112_0080337 | 3300048915 | Bacteria | 3224 |
| 433 | Ga0496112_0138203 | 3300048915 | Bacteria | 2406 |
| 434 | Ga0496112_0313256 | 3300048915 | Bacteria | 1514 |
| 435 | Ga0496113_0222488 | 3300048916 | Bacteria | 1504 |
| 436 | Ga0496115_0000788 | 3300048918 | Bacteria | 23274 |
| 437 | Ga0496115_0019388 | 3300048918 | Bacteria | 5232 |
| 438 | Ga0496115_0032521 | 3300048918 | Bacteria | 4115 |
| 439 | Ga0496115_0033839 | 3300048918 | Bacteria | 4037 |
| 440 | Ga0496115_0048744 | 3300048918 | Bacteria | 3389 |
| 441 | Ga0496115_0152605 | 3300048918 | Bacteria | 1908 |
| 442 | Ga0496116_0003700 | 3300048919 | Bacteria | 14963 |
| 443 | Ga0496118_0052365 | 3300048921 | Bacteria | 3114 |
| 444 | Ga0496118_0106754 | 3300048921 | Bacteria | 1872 |
| 445 | Ga0496119_0002628 | 3300048922 | Bacteria | 19497 |
| 446 | Ga0496119_0085938 | 3300048922 | Bacteria | 1799 |
| 447 | Ga0496120_0057056 | 3300048923 | Bacteria | 2200 |
| 448 | Ga0496120_0101493 | 3300048923 | Bacteria | 1519 |
| 449 | Ga0496121_0000495 | 3300048924 | Bacteria | 75339 |
| 450 | Ga0496121_0000576 | 3300048924 | Bacteria | 69005 |
| 451 | Ga0496121_0008638 | 3300048924 | Bacteria | 11913 |
| 452 | Ga0496121_0023134 | 3300048924 | Bacteria | 5999 |
| 453 | Ga0496121_0122404 | 3300048924 | Bacteria | 1962 |
| 454 | Ga0496121_0139948 | 3300048924 | Bacteria | 1797 |
| 455 | Ga0496123_0041130 | 3300048926 | Bacteria | 3208 |
| 456 | Ga0496124_0001976 | 3300048927 | Bacteria | 27960 |
| 457 | Ga0496125_0003570 | 3300048928 | Bacteria | 18732 |
| 458 | Ga0496125_0049182 | 3300048928 | Bacteria | 3506 |
| 459 | Ga0496125_0064009 | 3300048928 | Bacteria | 2927 |
| 460 | Ga0496126_0004361 | 3300048929 | Bacteria | 16967 |
| 461 | Ga0496126_0006416 | 3300048929 | Bacteria | 13114 |
| 462 | Ga0496126_0008627 | 3300048929 | Bacteria | 10960 |
| 463 | Ga0496126_0008851 | 3300048929 | Bacteria | 10787 |
| 464 | Ga0496126_0026942 | 3300048929 | Bacteria | 5501 |
| 465 | Ga0496126_0064977 | 3300048929 | Bacteria | 3266 |
| 466 | Ga0496126_0072428 | 3300048929 | Bacteria | 3065 |
| 467 | Ga0496126_0090183 | 3300048929 | Bacteria | 2697 |
| 468 | Ga0495678_061540 | 3300049459 | Bacteria | 1408 |
| 469 | Ga0495682_0024957 | 3300049460 | Bacteria | 2225 |
| 470 | Ga0501031_0016299 | 3300049568 | Bacteria | 4825 |
| 471 | Ga0501033_0001956 | 3300049570 | Bacteria | 17932 |
| 472 | Ga0501034_0176108 | 3300049571 | Bacteria | 2105 |
| 473 | Ga0501037_0009384 | 3300049573 | Bacteria | 7180 |
| 474 | Ga0501042_0073733 | 3300049578 | Bacteria | 2441 |
| 475 | Ga0501043_0013496 | 3300049579 | Bacteria | 6391 |
| 476 | Ga0501046_0017167 | 3300049580 | Bacteria | 6048 |
| 477 | Ga0501035_0014167 | 3300049822 | Bacteria | 7357 |
| 478 | Ga0501044_0024228 | 3300049823 | Bacteria | 6448 |
| 479 | nmdc:mga03n38_29755_c1 | 3300050490 | Bacteria | 2289 |
| 480 | nmdc:mga00v17_40014_c1 | 3300050491 | Bacteria | 2810 |
| 481 | nmdc:mga00v17_47444_c1 | 3300050491 | Bacteria | 2602 |
| 482 | nmdc:mga0yw44_38512_c1 | 3300050492 | Bacteria | 2830 |
| 483 | nmdc:mga0yw44_8504_c1 | 3300050492 | Bacteria | 3826 |
| 484 | nmdc:mga0k408_11091_c2 | 3300050493 | Bacteria | 3859 |
| 485 | nmdc:mga06z11_1148_c1 | 3300050494 | Bacteria | 9678 |
| 486 | nmdc:mga06z11_59150_c1 | 3300050494 | Bacteria | 1991 |
| 487 | nmdc:mga06z11_61440_c1 | 3300050494 | Bacteria | 1960 |
| 488 | nmdc:mga07m45_1819_c1 | 3300050496 | Bacteria | 9835 |
| 489 | nmdc:mga07m45_49250_c1 | 3300050496 | Bacteria | 2371 |
| 490 | nmdc:mga07m45_8560_c1 | 3300050496 | Bacteria | 5266 |
| 491 | nmdc:mga08y16_455660_c1 | 3300050511 | Bacteria | 1304 |
| 492 | nmdc:mga0sz30_51540_c1 | 3300050516 | Bacteria | 1746 |
| 493 | Ga0500635_0001234 | 3300053080 | Bacteria | 6111 |
| 494 | Ga0495619_0115244 | 3300053085 | Bacteria | 1839 |
| 495 | Ga0495619_0161015 | 3300053085 | Bacteria | 1550 |
| 496 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 497 | Ga0500581_070348 | 3300053089 | Bacteria | 1762 |
| 498 | Ga0500566_0000038 | 3300053094 | Bacteria | 66925 |
| 499 | Ga0500566_0000596 | 3300053094 | Bacteria | 20245 |
| 500 | Ga0500566_0001582 | 3300053094 | Bacteria | 13395 |
| 501 | Ga0500640_016393 | 3300053095 | Bacteria | 3124 |
| 502 | Ga0500650_0014328 | 3300053098 | Bacteria | 3350 |
| 503 | Ga0500650_0023619 | 3300053098 | Bacteria | 2734 |
| 504 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 505 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 506 | Ga0500562_013757 | 3300053108 | Bacteria | 2069 |
| 507 | Ga0500572_000010 | 3300053111 | Bacteria | 67071 |
| 508 | Ga0500608_000953 | 3300053122 | Bacteria | 10349 |
| 509 | Ga0500614_002202 | 3300053123 | Bacteria | 4416 |
| 510 | Ga0500642_0000058 | 3300053130 | Bacteria | 66200 |
| 511 | Ga0500652_000957 | 3300053131 | Bacteria | 9539 |
| 512 | Ga0500658_0026598 | 3300053134 | Bacteria | 2230 |
| 513 | Ga0500559_0000366 | 3300053136 | Bacteria | 33251 |
| 514 | Ga0500559_0004231 | 3300053136 | Bacteria | 6870 |
| 515 | Ga0500559_0013854 | 3300053136 | Bacteria | 3410 |
| 516 | Ga0500559_0030710 | 3300053136 | Bacteria | 2304 |
| 517 | Ga0500568_0000603 | 3300053139 | Bacteria | 26129 |
| 518 | Ga0500573_0018767 | 3300053140 | Bacteria | 3948 |
| 519 | Ga0500577_0004693 | 3300053142 | Bacteria | 3633 |
| 520 | Ga0500586_001528 | 3300053145 | Bacteria | 4914 |
| 521 | Ga0500590_025895 | 3300053148 | Bacteria | 3046 |
| 522 | Ga0500603_006887 | 3300053150 | Bacteria | 2479 |
| 523 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 524 | Ga0500627_0075016 | 3300053158 | Bacteria | 1502 |
| 525 | Ga0500630_071401 | 3300053159 | Bacteria | 1641 |
| 526 | Ga0500638_043036 | 3300053162 | Bacteria | 2193 |
| 527 | Ga0500639_000034 | 3300053163 | Bacteria | 66994 |
| 528 | Ga0500636_0000502 | 3300053177 | Bacteria | 21286 |
| 529 | Ga0500636_0062664 | 3300053177 | Bacteria | 2168 |
| 530 | Ga0500636_0105586 | 3300053177 | Bacteria | 1596 |
| 531 | Ga0500645_005871 | 3300053730 | Bacteria | 4454 |
| 532 | Ga0500596_000264 | 3300053735 | Bacteria | 9238 |
| 533 | Ga0500596_006110 | 3300053735 | Bacteria | 2063 |
| 534 | Ga0500599_001348 | 3300053736 | Bacteria | 2803 |
| 535 | Ga0500601_003178 | 3300053737 | Bacteria | 1776 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0126000 | Ga0496105_0126000_353_1522 | 328 |
| 2 | 3300048904 | Ga0496101_0098923 | Ga0496101_0098923_1036_2148 | 337 |
| 3 | 3300053737 | Ga0500601_003178 | Ga0500601_003178_27_1121 | 342 |
| 4 | 3300039450 | Ga0436363_0115681 | Ga0436363_0115681_1171_2481 | 345 |
| 5 | 3300048907 | Ga0496104_0009000 | Ga0496104_0009000_6937_8166 | 349 |
| 6 | 3300048918 | Ga0496115_0032521 | Ga0496115_0032521_863_2092 | 349 |
| 7 | 3300009545 | Ga0105237_10214473 | Ga0105237_102144732 | 353 |
| 8 | 3300046810 | Ga0495660_0041481 | Ga0495660_0041481_773_1990 | 356 |
| 9 | 3300053730 | Ga0500645_005871 | Ga0500645_005871_60_1289 | 356 |
| 10 | 3300046523 | Ga0495644_0012092 | Ga0495644_0012092_802_2031 | 358 |
| 11 | 3300046684 | Ga0495669_0045802 | Ga0495669_0045802_314_1543 | 358 |
| 12 | 3300046692 | Ga0495671_0091687 | Ga0495671_0091687_97_1326 | 358 |
| 13 | 3300009545 | Ga0105237_10051435 | Ga0105237_100514352 | 359 |
| 14 | 3300050516 | nmdc:mga0sz30_51540_c1 | nmdc:mga0sz30_51540_c1_130_1359 | 359 |
| 15 | 3300048904 | Ga0496101_0125707 | Ga0496101_0125707_600_1832 | 360 |
| 16 | 3300048918 | Ga0496115_0152605 | Ga0496115_0152605_178_1407 | 360 |
| 17 | 3300048924 | Ga0496121_0122404 | Ga0496121_0122404_699_1928 | 360 |
| 18 | 3300048929 | Ga0496126_0090183 | Ga0496126_0090183_1419_2648 | 360 |
| 19 | 3300050491 | nmdc:mga00v17_40014_c1 | nmdc:mga00v17_40014_c1_399_1631 | 360 |
| 20 | 3300050496 | nmdc:mga07m45_1819_c1 | nmdc:mga07m45_1819_c1_2123_3355 | 360 |
| 21 | 3300009098 | Ga0105245_10076910 | Ga0105245_100769102 | 361 |
| 22 | 3300009101 | Ga0105247_10088097 | Ga0105247_100880972 | 361 |
| 23 | 3300009177 | Ga0105248_10049122 | Ga0105248_100491222 | 361 |
| 24 | 3300013296 | Ga0157374_10406198 | Ga0157374_104061981 | 361 |
| 25 | 3300014745 | Ga0157377_10161823 | Ga0157377_101618231 | 361 |
| 26 | 3300025315 | Ga0207697_10032285 | Ga0207697_100322852 | 361 |
| 27 | 3300048912 | Ga0496109_0096842 | Ga0496109_0096842_1053_2282 | 361 |
| 28 | 3300048913 | Ga0496110_0159691 | Ga0496110_0159691_744_1973 | 361 |
| 29 | 3300048915 | Ga0496112_0313256 | Ga0496112_0313256_193_1422 | 361 |
| 30 | 3300005983 | Ga0081540_1024880 | Ga0081540_10248802 | 362 |
| 31 | 3300044684 | Ga0466966_0034102 | Ga0466966_0034102_1475_2746 | 362 |
| 32 | 3300003215 | JGI25153J46596_10007866 | JGI25153J46596_100078662 | 363 |
| 33 | 3300025297 | Ga0209758_1002793 | Ga0209758_10027934 | 363 |
| 34 | 3300039437 | Ga0436365_1727745 | Ga0436365_1727745_14758_16029 | 364 |
| 35 | 3300005937 | Ga0081455_10189678 | Ga0081455_101896781 | 365 |
| 36 | 3300009551 | Ga0105238_10102172 | Ga0105238_101021721 | 365 |
| 37 | 3300039453 | Ga0436362_1281101 | Ga0436362_1281101_1490_2761 | 366 |
| 38 | 3300006038 | Ga0075365_10183177 | Ga0075365_101831772 | 367 |
| 39 | 3300009177 | Ga0105248_10381639 | Ga0105248_103816392 | 367 |
| 40 | 3300010375 | Ga0105239_10443900 | Ga0105239_104439001 | 367 |
| 41 | 3300013297 | Ga0157378_10194076 | Ga0157378_101940761 | 367 |
| 42 | 3300028379 | Ga0268266_10130458 | Ga0268266_101304581 | 367 |
| 43 | 3300032004 | Ga0307414_10200150 | Ga0307414_102001502 | 367 |
| 44 | 3300005544 | Ga0070686_100098222 | Ga0070686_1000982222 | 368 |
| 45 | 3300053136 | Ga0500559_0030710 | Ga0500559_0030710_1034_2293 | 368 |
| 46 | 3300053140 | Ga0500573_0018767 | Ga0500573_0018767_1786_3045 | 368 |
| 47 | 3300053148 | Ga0500590_025895 | Ga0500590_025895_1444_2703 | 368 |
| 48 | 3300053177 | Ga0500636_0105586 | Ga0500636_0105586_153_1412 | 368 |
| 49 | 3300053735 | Ga0500596_006110 | Ga0500596_006110_656_1915 | 368 |
| 50 | 3300005983 | Ga0081540_1019199 | Ga0081540_10191992 | 369 |
| 51 | 3300031731 | Ga0307405_10240717 | Ga0307405_102407171 | 369 |
| 52 | 3300037853 | Ga0436364_1494800 | Ga0436364_1494800_93_1337 | 369 |
| 53 | 3300053087 | Ga0500643_000025 | Ga0500643_000025_233689_234909 | 369 |
| 54 | 3300009176 | Ga0105242_10234703 | Ga0105242_102347032 | 370 |
| 55 | 3300009545 | Ga0105237_10334664 | Ga0105237_103346642 | 370 |
| 56 | 3300009553 | Ga0105249_10095720 | Ga0105249_100957202 | 370 |
| 57 | 3300046452 | Ga0495617_008236 | Ga0495617_008236_2113_3342 | 370 |
| 58 | 3300046455 | Ga0495603_0016385 | Ga0495603_0016385_3185_4414 | 370 |
| 59 | 3300046457 | Ga0495590_0005096 | Ga0495590_0005096_3424_4653 | 370 |
| 60 | 3300046474 | Ga0495605_0033525 | Ga0495605_0033525_302_1531 | 370 |
| 61 | 3300046491 | Ga0495584_0006929 | Ga0495584_0006929_1254_2483 | 370 |
| 62 | 3300046492 | Ga0495585_0010422 | Ga0495585_0010422_3217_4446 | 370 |
| 63 | 3300046499 | Ga0495594_0063753 | Ga0495594_0063753_793_2022 | 370 |
| 64 | 3300046500 | Ga0495596_0043580 | Ga0495596_0043580_186_1415 | 370 |
| 65 | 3300046506 | Ga0495583_0032341 | Ga0495583_0032341_998_2227 | 370 |
| 66 | 3300046507 | Ga0495606_0016261 | Ga0495606_0016261_1029_2258 | 370 |
| 67 | 3300046512 | Ga0495610_0014018 | Ga0495610_0014018_1113_2342 | 370 |
| 68 | 3300046513 | Ga0495616_0078080 | Ga0495616_0078080_139_1368 | 370 |
| 69 | 3300046518 | Ga0495631_0015648 | Ga0495631_0015648_2313_3542 | 370 |
| 70 | 3300046522 | Ga0495643_0049338 | Ga0495643_0049338_531_1760 | 370 |
| 71 | 3300046524 | Ga0495648_0016227 | Ga0495648_0016227_973_2205 | 370 |
| 72 | 3300046528 | Ga0495642_0040847 | Ga0495642_0040847_48_1277 | 370 |
| 73 | 3300046538 | Ga0495609_0011640 | Ga0495609_0011640_1795_3024 | 370 |
| 74 | 3300046542 | Ga0495597_0025816 | Ga0495597_0025816_148_1377 | 370 |
| 75 | 3300046648 | Ga0495611_0003326 | Ga0495611_0003326_1025_2254 | 370 |
| 76 | 3300046660 | Ga0495625_0061484 | Ga0495625_0061484_960_2189 | 370 |
| 77 | 3300046684 | Ga0495669_0029399 | Ga0495669_0029399_330_1559 | 370 |
| 78 | 3300046692 | Ga0495671_0042294 | Ga0495671_0042294_364_1593 | 370 |
| 79 | 3300046694 | Ga0495649_0009550 | Ga0495649_0009550_195_1424 | 370 |
| 80 | 3300046794 | Ga0495589_0087965 | Ga0495589_0087965_268_1497 | 370 |
| 81 | 3300047323 | Ga0495683_0060157 | Ga0495683_0060157_226_1455 | 370 |
| 82 | 3300047469 | Ga0495673_0018952 | Ga0495673_0018952_1264_2493 | 370 |
| 83 | 3300047472 | Ga0495686_0077424 | Ga0495686_0077424_766_1995 | 370 |
| 84 | 3300048905 | Ga0496102_0206226 | Ga0496102_0206226_604_1833 | 370 |
| 85 | 3300048906 | Ga0496103_0044664 | Ga0496103_0044664_392_1621 | 370 |
| 86 | 3300048921 | Ga0496118_0052365 | Ga0496118_0052365_1824_3053 | 370 |
| 87 | 3300049459 | Ga0495678_061540 | Ga0495678_061540_97_1326 | 370 |
| 88 | 3300049460 | Ga0495682_0024957 | Ga0495682_0024957_456_1685 | 370 |
| 89 | 3300053098 | Ga0500650_0023619 | Ga0500650_0023619_1110_2339 | 370 |
| 90 | 3300053108 | Ga0500562_013757 | Ga0500562_013757_330_1559 | 370 |
| 91 | 3300053134 | Ga0500658_0026598 | Ga0500658_0026598_89_1318 | 370 |
| 92 | 3300053142 | Ga0500577_0004693 | Ga0500577_0004693_369_1640 | 370 |
| 93 | 3300046452 | Ga0495617_015187 | Ga0495617_015187_1003_2271 | 371 |
| 94 | iso_pu_bacteria | 8016603502 | 8016611544 | 371 |
| 95 | 3300005548 | Ga0070665_100207409 | Ga0070665_1002074092 | 372 |
| 96 | 3300013306 | Ga0163162_10443706 | Ga0163162_104437061 | 372 |
| 97 | 3300028379 | Ga0268266_10213379 | Ga0268266_102133792 | 372 |
| 98 | 3300003659 | JGI25404J52841_10006230 | JGI25404J52841_100062302 | 373 |
| 99 | 3300005548 | Ga0070665_100013576 | Ga0070665_1000135763 | 373 |
| 100 | 3300006048 | Ga0075363_100008360 | Ga0075363_1000083602 | 373 |
| 101 | 3300006353 | Ga0075370_10013657 | Ga0075370_100136574 | 373 |
| 102 | 3300009094 | Ga0111539_10306833 | Ga0111539_103068332 | 373 |
| 103 | 3300026067 | Ga0207678_10003850 | Ga0207678_100038505 | 373 |
| 104 | 3300026118 | Ga0207675_100196523 | Ga0207675_1001965232 | 373 |
| 105 | 3300028379 | Ga0268266_10003050 | Ga0268266_100030508 | 373 |
| 106 | 3300031507 | Ga0307509_10237115 | Ga0307509_102371151 | 373 |
| 107 | 3300035170 | Ga0373943_0005419 | Ga0373943_0005419_3737_4999 | 373 |
| 108 | 3300035171 | Ga0373946_0004494 | Ga0373946_0004494_210_1472 | 373 |
| 109 | 3300035692 | Ga0373935_0001387 | Ga0373935_0001387_11617_12879 | 373 |
| 110 | 3300035695 | Ga0373927_0000225 | Ga0373927_0000225_38925_40187 | 373 |
| 111 | 3300046454 | Ga0495592_0016560 | Ga0495592_0016560_1154_2416 | 373 |
| 112 | 3300046459 | Ga0495629_0000179 | Ga0495629_0000179_4917_6179 | 373 |
| 113 | 3300046460 | Ga0495638_0018157 | Ga0495638_0018157_374_1642 | 373 |
| 114 | 3300046460 | Ga0495638_0092123 | Ga0495638_0092123_251_1519 | 373 |
| 115 | 3300046461 | Ga0495641_0004740 | Ga0495641_0004740_5380_6642 | 373 |
| 116 | 3300046472 | Ga0495580_0000280 | Ga0495580_0000280_3565_4827 | 373 |
| 117 | 3300046473 | Ga0495582_0000061 | Ga0495582_0000061_3566_4828 | 373 |
| 118 | 3300046475 | Ga0495639_0000102 | Ga0495639_0000102_37439_38701 | 373 |
| 119 | 3300046476 | Ga0495662_0000746 | Ga0495662_0000746_10089_11351 | 373 |
| 120 | 3300046517 | Ga0495630_0010364 | Ga0495630_0010364_3566_4828 | 373 |
| 121 | 3300046529 | Ga0495652_0130932 | Ga0495652_0130932_173_1435 | 373 |
| 122 | 3300046530 | Ga0495654_0026916 | Ga0495654_0026916_241_1509 | 373 |
| 123 | 3300046531 | Ga0495665_0000261 | Ga0495665_0000261_21798_23060 | 373 |
| 124 | 3300046533 | Ga0495640_0002042 | Ga0495640_0002042_3954_5216 | 373 |
| 125 | 3300046557 | Ga0495622_0006847 | Ga0495622_0006847_1528_2790 | 373 |
| 126 | 3300046557 | Ga0495622_0012581 | Ga0495622_0012581_2575_3849 | 373 |
| 127 | 3300046642 | Ga0495634_0000161 | Ga0495634_0000161_19620_20882 | 373 |
| 128 | 3300046663 | Ga0495635_0001102 | Ga0495635_0001102_13128_14390 | 373 |
| 129 | 3300046681 | Ga0495647_0000205 | Ga0495647_0000205_11197_12459 | 373 |
| 130 | 3300046683 | Ga0495658_0001114 | Ga0495658_0001114_3005_4267 | 373 |
| 131 | 3300046691 | Ga0495670_0006173 | Ga0495670_0006173_1909_3162 | 373 |
| 132 | 3300047315 | Ga0495581_0000255 | Ga0495581_0000255_1076_2338 | 373 |
| 133 | 3300047319 | Ga0495674_0000117 | Ga0495674_0000117_19896_21158 | 373 |
| 134 | 3300047673 | Ga0495593_0000297 | Ga0495593_0000297_24789_26051 | 373 |
| 135 | 3300048904 | Ga0496101_0151344 | Ga0496101_0151344_85_1410 | 373 |
| 136 | 3300048909 | Ga0496106_0217297 | Ga0496106_0217297_44_1312 | 373 |
| 137 | 3300048919 | Ga0496116_0003700 | Ga0496116_0003700_8267_9535 | 373 |
| 138 | 3300048923 | Ga0496120_0057056 | Ga0496120_0057056_42_1310 | 373 |
| 139 | 3300048924 | Ga0496121_0008638 | Ga0496121_0008638_5152_6420 | 373 |
| 140 | 3300048924 | Ga0496121_0023134 | Ga0496121_0023134_3802_5073 | 373 |
| 141 | 3300048926 | Ga0496123_0041130 | Ga0496123_0041130_302_1570 | 373 |
| 142 | 3300048928 | Ga0496125_0003570 | Ga0496125_0003570_3419_4687 | 373 |
| 143 | 3300048929 | Ga0496126_0006416 | Ga0496126_0006416_4089_5357 | 373 |
| 144 | 3300048929 | Ga0496126_0064977 | Ga0496126_0064977_123_1391 | 373 |
| 145 | 3300050492 | nmdc:mga0yw44_38512_c1 | nmdc:mga0yw44_38512_c1_1294_2562 | 373 |
| 146 | 3300050511 | nmdc:mga08y16_455660_c1 | nmdc:mga08y16_455660_c1_10_1245 | 373 |
| 147 | 3300053085 | Ga0495619_0115244 | Ga0495619_0115244_123_1385 | 373 |
| 148 | 3300053089 | Ga0500581_070348 | Ga0500581_070348_140_1393 | 373 |
| 149 | 3300053094 | Ga0500566_0001582 | Ga0500566_0001582_6270_7544 | 373 |
| 150 | 3300053098 | Ga0500650_0014328 | Ga0500650_0014328_334_1602 | 373 |
| 151 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_527123_528391 | 373 |
| 152 | 3300053122 | Ga0500608_000953 | Ga0500608_000953_5553_6827 | 373 |
| 153 | 3300053130 | Ga0500642_0000058 | Ga0500642_0000058_10537_11805 | 373 |
| 154 | 3300053131 | Ga0500652_000957 | Ga0500652_000957_3231_4499 | 373 |
| 155 | 3300053136 | Ga0500559_0000366 | Ga0500559_0000366_27486_28760 | 373 |
| 156 | 3300053139 | Ga0500568_0000603 | Ga0500568_0000603_10849_12117 | 373 |
| 157 | 3300053153 | Ga0500616_0000069 | Ga0500616_0000069_10679_11947 | 373 |
| 158 | 3300053158 | Ga0500627_0075016 | Ga0500627_0075016_52_1320 | 373 |
| 159 | iso_pu_bacteria | 2824773399 | 2824780658 | 373 |
| 160 | iso_pu_bacteria | 2841949485 | 2841950715 | 373 |
| 161 | 3300005334 | Ga0068869_100067971 | Ga0068869_1000679712 | 374 |
| 162 | 3300005338 | Ga0068868_100044104 | Ga0068868_1000441042 | 374 |
| 163 | 3300005347 | Ga0070668_100056652 | Ga0070668_1000566523 | 374 |
| 164 | 3300005456 | Ga0070678_100070226 | Ga0070678_1000702262 | 374 |
| 165 | 3300005844 | Ga0068862_100068496 | Ga0068862_1000684962 | 374 |
| 166 | 3300006038 | Ga0075365_10129373 | Ga0075365_101293732 | 374 |
| 167 | 3300006048 | Ga0075363_100022810 | Ga0075363_1000228103 | 374 |
| 168 | 3300006051 | Ga0075364_10052047 | Ga0075364_100520472 | 374 |
| 169 | 3300006358 | Ga0068871_100068833 | Ga0068871_1000688333 | 374 |
| 170 | 3300025900 | Ga0207710_10005054 | Ga0207710_100050542 | 374 |
| 171 | 3300025900 | Ga0207710_10024168 | Ga0207710_100241681 | 374 |
| 172 | 3300025927 | Ga0207687_10060165 | Ga0207687_100601652 | 374 |
| 173 | 3300025941 | Ga0207711_10165321 | Ga0207711_101653211 | 374 |
| 174 | 3300025972 | Ga0207668_10049546 | Ga0207668_100495462 | 374 |
| 175 | 3300026116 | Ga0207674_10068635 | Ga0207674_100686352 | 374 |
| 176 | 3300026121 | Ga0207683_10039306 | Ga0207683_100393064 | 374 |
| 177 | 3300035724 | Ga0373933_0000922 | Ga0373933_0000922_8236_9504 | 374 |
| 178 | 3300048905 | Ga0496102_0255730 | Ga0496102_0255730_78_1346 | 374 |
| 179 | iso_pu_bacteria | 2517093001 | 2517102074 | 374 |
| 180 | iso_pu_bacteria | 2879110137 | 2879115686 | 374 |
| 181 | 3300005336 | Ga0070680_100006371 | Ga0070680_1000063714 | 375 |
| 182 | 3300005337 | Ga0070682_100091527 | Ga0070682_1000915272 | 375 |
| 183 | 3300005356 | Ga0070674_100036328 | Ga0070674_1000363282 | 375 |
| 184 | 3300005455 | Ga0070663_100142760 | Ga0070663_1001427602 | 375 |
| 185 | 3300005458 | Ga0070681_10021753 | Ga0070681_100217534 | 375 |
| 186 | 3300005530 | Ga0070679_100007739 | Ga0070679_1000077394 | 375 |
| 187 | 3300005539 | Ga0068853_100171773 | Ga0068853_1001717732 | 375 |
| 188 | 3300005548 | Ga0070665_100208365 | Ga0070665_1002083652 | 375 |
| 189 | 3300006881 | Ga0068865_100092587 | Ga0068865_1000925872 | 375 |
| 190 | 3300009148 | Ga0105243_10194159 | Ga0105243_101941592 | 375 |
| 191 | 3300009176 | Ga0105242_10119826 | Ga0105242_101198262 | 375 |
| 192 | 3300009551 | Ga0105238_10125187 | Ga0105238_101251873 | 375 |
| 193 | 3300009551 | Ga0105238_10193511 | Ga0105238_101935112 | 375 |
| 194 | 3300025912 | Ga0207707_10000494 | Ga0207707_1000049415 | 375 |
| 195 | 3300025921 | Ga0207652_10085185 | Ga0207652_100851852 | 375 |
| 196 | 3300025924 | Ga0207694_10143171 | Ga0207694_101431711 | 375 |
| 197 | 3300025932 | Ga0207690_10044054 | Ga0207690_100440542 | 375 |
| 198 | 3300025933 | Ga0207706_10204557 | Ga0207706_102045571 | 375 |
| 199 | 3300025960 | Ga0207651_10188298 | Ga0207651_101882982 | 375 |
| 200 | 3300026041 | Ga0207639_10139229 | Ga0207639_101392292 | 375 |
| 201 | 3300032005 | Ga0307411_10060224 | Ga0307411_100602242 | 375 |
| 202 | 3300046524 | Ga0495648_0001196 | Ga0495648_0001196_9132_10418 | 375 |
| 203 | 3300046684 | Ga0495669_0100740 | Ga0495669_0100740_15_1283 | 375 |
| 204 | 3300005434 | Ga0070709_10000337 | Ga0070709_1000033711 | 376 |
| 205 | 3300005435 | Ga0070714_100041601 | Ga0070714_1000416013 | 376 |
| 206 | 3300005437 | Ga0070710_10000508 | Ga0070710_100005085 | 376 |
| 207 | 3300005439 | Ga0070711_100001466 | Ga0070711_1000014668 | 376 |
| 208 | 3300005539 | Ga0068853_100227066 | Ga0068853_1002270662 | 376 |
| 209 | 3300006173 | Ga0070716_100003986 | Ga0070716_1000039866 | 376 |
| 210 | 3300025898 | Ga0207692_10001906 | Ga0207692_100019065 | 376 |
| 211 | 3300025906 | Ga0207699_10000604 | Ga0207699_100006048 | 376 |
| 212 | 3300025916 | Ga0207663_10004391 | Ga0207663_100043914 | 376 |
| 213 | 3300025929 | Ga0207664_10006080 | Ga0207664_100060803 | 376 |
| 214 | 3300025938 | Ga0207704_10133782 | Ga0207704_101337822 | 376 |
| 215 | 3300025939 | Ga0207665_10001395 | Ga0207665_100013958 | 376 |
| 216 | 3300028380 | Ga0268265_10133591 | Ga0268265_101335912 | 376 |
| 217 | 3300046455 | Ga0495603_0000960 | Ga0495603_0000960_7832_9094 | 376 |
| 218 | 3300053094 | Ga0500566_0000596 | Ga0500566_0000596_7379_8632 | 376 |
| 219 | iso_pu_bacteria | 2824679649 | 2824683722 | 376 |
| 220 | 3300005436 | Ga0070713_100158020 | Ga0070713_1001580202 | 377 |
| 221 | 3300005983 | Ga0081540_1022051 | Ga0081540_10220512 | 377 |
| 222 | 3300028558 | Ga0265326_10009117 | Ga0265326_100091172 | 377 |
| 223 | 3300028563 | Ga0265319_1002888 | Ga0265319_10028882 | 377 |
| 224 | 3300028577 | Ga0265318_10005626 | Ga0265318_100056263 | 377 |
| 225 | 3300028653 | Ga0265323_10000846 | Ga0265323_100008467 | 377 |
| 226 | 3300028666 | Ga0265336_10001639 | Ga0265336_100016393 | 377 |
| 227 | 3300028800 | Ga0265338_10004452 | Ga0265338_100044528 | 377 |
| 228 | 3300029957 | Ga0265324_10003894 | Ga0265324_100038944 | 377 |
| 229 | 3300031250 | Ga0265331_10013580 | Ga0265331_100135802 | 377 |
| 230 | 3300031344 | Ga0265316_10065111 | Ga0265316_100651112 | 377 |
| 231 | 3300031712 | Ga0265342_10067263 | Ga0265342_100672632 | 377 |
| 232 | 3300044684 | Ga0466966_0006259 | Ga0466966_0006259_630_1859 | 377 |
| 233 | 3300044693 | Ga0466961_0000488 | Ga0466961_0000488_19524_20753 | 377 |
| 234 | 3300045049 | Ga0466959_0001793 | Ga0466959_0001793_11690_12919 | 377 |
| 235 | 3300046523 | Ga0495644_0040724 | Ga0495644_0040724_170_1438 | 377 |
| 236 | 3300048929 | Ga0496126_0004361 | Ga0496126_0004361_7693_8988 | 377 |
| 237 | iso_pu_bacteria | 2824671348 | 2824674704 | 377 |
| 238 | iso_pu_bacteria | 2824687955 | 2824692883 | 377 |
| 239 | iso_pu_bacteria | 2841957949 | 2841964402 | 377 |
| 240 | iso_pu_bacteria | 2841966195 | 2841967031 | 377 |
| 241 | iso_pu_bacteria | 2841974524 | 2841975776 | 377 |
| 242 | iso_pu_bacteria | 2849076700 | 2849080067 | 377 |
| 243 | iso_pu_bacteria | 2874620515 | 2874627097 | 377 |
| 244 | iso_pu_bacteria | 2904666416 | 2904669798 | 377 |
| 245 | iso_pu_bacteria | 8016530956 | 8016535723 | 377 |
| 246 | 3300005937 | Ga0081455_10001781 | Ga0081455_100017814 | 378 |
| 247 | 3300025302 | Ga0207426_1001526 | Ga0207426_100152620 | 378 |
| 248 | 3300046507 | Ga0495606_0020685 | Ga0495606_0020685_428_1690 | 378 |
| 249 | iso_pu_bacteria | 2888388044 | 2888394657 | 378 |
| 250 | 3300005339 | Ga0070660_100217104 | Ga0070660_1002171042 | 379 |
| 251 | 3300005983 | Ga0081540_1002370 | Ga0081540_100237015 | 379 |
| 252 | 3300006038 | Ga0075365_10005922 | Ga0075365_100059222 | 379 |
| 253 | 3300026142 | Ga0207698_10098663 | Ga0207698_100986632 | 379 |
| 254 | 3300046524 | Ga0495648_0058592 | Ga0495648_0058592_734_1990 | 379 |
| 255 | 3300048923 | Ga0496120_0101493 | Ga0496120_0101493_37_1293 | 379 |
| 256 | 3300053105 | Ga0500557_000001 | Ga0500557_000001_15398_16654 | 379 |
| 257 | 3300053145 | Ga0500586_001528 | Ga0500586_001528_1888_3162 | 379 |
| 258 | 3300053736 | Ga0500599_001348 | Ga0500599_001348_553_1809 | 379 |
| 259 | iso_pu_bacteria | 2824617872 | 2824619763 | 379 |
| 260 | iso_pu_bacteria | 2824661429 | 2824666650 | 379 |
| 261 | iso_pu_bacteria | 2824696289 | 2824699181 | 379 |
| 262 | iso_pu_bacteria | 2824732956 | 2824739975 | 379 |
| 263 | iso_pu_bacteria | 2842038055 | 2842039824 | 379 |
| 264 | iso_pu_bacteria | 2842045827 | 2842047230 | 379 |
| 265 | iso_pu_bacteria | 2847939898 | 2847945792 | 379 |
| 266 | iso_pu_bacteria | 2874628541 | 2874636326 | 379 |
| 267 | iso_pu_bacteria | 2876761206 | 2876770807 | 379 |
| 268 | iso_pu_bacteria | 2876818435 | 2876822548 | 379 |
| 269 | iso_pu_bacteria | 2879074833 | 2879078101 | 379 |
| 270 | iso_pu_bacteria | 2879099564 | 2879102942 | 379 |
| 271 | iso_pu_bacteria | 2888378607 | 2888383253 | 379 |
| 272 | iso_pu_bacteria | 2922393267 | 2922395567 | 379 |
| 273 | iso_pu_bacteria | 2929615660 | 2929617163 | 379 |
| 274 | iso_pu_bacteria | 2929624759 | 2929626867 | 379 |
| 275 | 3300003215 | JGI25153J46596_10000832 | JGI25153J46596_100008322 | 380 |
| 276 | 3300003794 | Ga0055531_10007934 | Ga0055531_100079343 | 380 |
| 277 | 3300005262 | Ga0065165_1008580 | Ga0065165_10085803 | 380 |
| 278 | 3300005328 | Ga0070676_10081874 | Ga0070676_100818742 | 380 |
| 279 | 3300005458 | Ga0070681_10053305 | Ga0070681_100533052 | 380 |
| 280 | 3300005548 | Ga0070665_100079277 | Ga0070665_1000792773 | 380 |
| 281 | 3300005616 | Ga0068852_100096896 | Ga0068852_1000968962 | 380 |
| 282 | 3300005842 | Ga0068858_100079138 | Ga0068858_1000791382 | 380 |
| 283 | 3300006942 | Ga0099824_1025534 | Ga0099824_10255343 | 380 |
| 284 | 3300021320 | Ga0214544_1000009 | Ga0214544_1000009134 | 380 |
| 285 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002576 | 380 |
| 286 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002144 | 380 |
| 287 | 3300021327 | Ga0214543_1000013 | Ga0214543_1000013178 | 380 |
| 288 | 3300025295 | Ga0209564_1003387 | Ga0209564_10033874 | 380 |
| 289 | 3300025297 | Ga0209758_1000100 | Ga0209758_100010037 | 380 |
| 290 | 3300025297 | Ga0209758_1001008 | Ga0209758_10010088 | 380 |
| 291 | 3300025299 | Ga0209256_1001740 | Ga0209256_100174022 | 380 |
| 292 | 3300025304 | Ga0209257_1006404 | Ga0209257_10064044 | 380 |
| 293 | 3300025911 | Ga0207654_10020055 | Ga0207654_100200553 | 380 |
| 294 | 3300027296 | Ga0209389_1000084 | Ga0209389_100008416 | 380 |
| 295 | 3300027357 | Ga0209589_1000041 | Ga0209589_100004155 | 380 |
| 296 | 3300027361 | Ga0209489_100070 | Ga0209489_10007073 | 380 |
| 297 | 3300028379 | Ga0268266_10028409 | Ga0268266_100284092 | 380 |
| 298 | 3300031249 | Ga0265339_10007490 | Ga0265339_100074903 | 380 |
| 299 | 3300031507 | Ga0307509_10008409 | Ga0307509_100084097 | 380 |
| 300 | 3300036401 | Ga0373937_0013344 | Ga0373937_0013344_4349_5662 | 380 |
| 301 | 3300048912 | Ga0496109_0071573 | Ga0496109_0071573_63_1301 | 380 |
| 302 | 3300048913 | Ga0496110_0116905 | Ga0496110_0116905_545_1786 | 380 |
| 303 | 3300048915 | Ga0496112_0000079 | Ga0496112_0000079_31814_33082 | 380 |
| 304 | 3300005339 | Ga0070660_100141044 | Ga0070660_1001410442 | 381 |
| 305 | 3300005543 | Ga0070672_100062511 | Ga0070672_1000625112 | 381 |
| 306 | 3300009553 | Ga0105249_10047992 | Ga0105249_100479921 | 381 |
| 307 | 3300010375 | Ga0105239_10213532 | Ga0105239_102135323 | 381 |
| 308 | 3300025907 | Ga0207645_10025440 | Ga0207645_100254402 | 381 |
| 309 | 3300025961 | Ga0207712_10025690 | Ga0207712_100256904 | 381 |
| 310 | 3300026089 | Ga0207648_10090287 | Ga0207648_100902871 | 381 |
| 311 | 3300031595 | Ga0265313_10060349 | Ga0265313_100603492 | 381 |
| 312 | 3300037471 | Ga0395905_0321400 | Ga0395905_0321400_185_1408 | 381 |
| 313 | 3300044658 | Ga0466972_0000660 | Ga0466972_0000660_13563_14819 | 381 |
| 314 | 3300003215 | JGI25153J46596_10009451 | JGI25153J46596_100094513 | 382 |
| 315 | 3300005983 | Ga0081540_1004255 | Ga0081540_10042556 | 382 |
| 316 | 3300006038 | Ga0075365_10000847 | Ga0075365_100008476 | 382 |
| 317 | 3300006051 | Ga0075364_10001659 | Ga0075364_100016597 | 382 |
| 318 | 3300006178 | Ga0075367_10011928 | Ga0075367_100119283 | 382 |
| 319 | 3300007265 | Ga0099794_10015790 | Ga0099794_100157903 | 382 |
| 320 | 3300025297 | Ga0209758_1005742 | Ga0209758_10057426 | 382 |
| 321 | 3300026078 | Ga0207702_10234090 | Ga0207702_102340901 | 382 |
| 322 | 3300026142 | Ga0207698_10168600 | Ga0207698_101686001 | 382 |
| 323 | 3300027671 | Ga0209588_1029210 | Ga0209588_10292102 | 382 |
| 324 | 3300048907 | Ga0496104_0007850 | Ga0496104_0007850_3002_4312 | 382 |
| 325 | 3300048908 | Ga0496105_0042728 | Ga0496105_0042728_1424_2734 | 382 |
| 326 | 3300048912 | Ga0496109_0051497 | Ga0496109_0051497_663_1973 | 382 |
| 327 | 3300048914 | Ga0496111_0039659 | Ga0496111_0039659_29_1339 | 382 |
| 328 | 3300048915 | Ga0496112_0007179 | Ga0496112_0007179_1519_2829 | 382 |
| 329 | 3300048918 | Ga0496115_0048744 | Ga0496115_0048744_2009_3319 | 382 |
| 330 | 3300049568 | Ga0501031_0016299 | Ga0501031_0016299_3081_4346 | 382 |
| 331 | 3300049570 | Ga0501033_0001956 | Ga0501033_0001956_13645_14910 | 382 |
| 332 | 3300049573 | Ga0501037_0009384 | Ga0501037_0009384_3023_4288 | 382 |
| 333 | 3300049578 | Ga0501042_0073733 | Ga0501042_0073733_1048_2313 | 382 |
| 334 | 3300049579 | Ga0501043_0013496 | Ga0501043_0013496_3691_4956 | 382 |
| 335 | 3300049580 | Ga0501046_0017167 | Ga0501046_0017167_3023_4288 | 382 |
| 336 | 3300049822 | Ga0501035_0014167 | Ga0501035_0014167_3070_4335 | 382 |
| 337 | 3300049823 | Ga0501044_0024228 | Ga0501044_0024228_1334_2599 | 382 |
| 338 | 3300050494 | nmdc:mga06z11_59150_c1 | nmdc:mga06z11_59150_c1_227_1549 | 382 |
| 339 | 3300005353 | Ga0070669_100115748 | Ga0070669_1001157482 | 383 |
| 340 | 3300005518 | Ga0070699_100059665 | Ga0070699_1000596652 | 383 |
| 341 | 3300005543 | Ga0070672_100216165 | Ga0070672_1002161651 | 383 |
| 342 | 3300005545 | Ga0070695_100054541 | Ga0070695_1000545413 | 383 |
| 343 | 3300005614 | Ga0068856_100001022 | Ga0068856_10000102222 | 383 |
| 344 | 3300005843 | Ga0068860_100061824 | Ga0068860_1000618242 | 383 |
| 345 | 3300006048 | Ga0075363_100060556 | Ga0075363_1000605562 | 383 |
| 346 | 3300013297 | Ga0157378_10254541 | Ga0157378_102545412 | 383 |
| 347 | 3300021361 | Ga0213872_10054255 | Ga0213872_100542551 | 383 |
| 348 | 3300025711 | Ga0207696_1037947 | Ga0207696_10379471 | 383 |
| 349 | 3300025939 | Ga0207665_10048653 | Ga0207665_100486532 | 383 |
| 350 | 3300025972 | Ga0207668_10045686 | Ga0207668_100456862 | 383 |
| 351 | 3300026075 | Ga0207708_10086818 | Ga0207708_100868182 | 383 |
| 352 | 3300026118 | Ga0207675_100131542 | Ga0207675_1001315422 | 383 |
| 353 | 3300027357 | Ga0209589_1000023 | Ga0209589_100002356 | 383 |
| 354 | 3300027361 | Ga0209489_100032 | Ga0209489_10003256 | 383 |
| 355 | 3300027363 | Ga0209700_100040 | Ga0209700_10004056 | 383 |
| 356 | 3300028380 | Ga0268265_10060234 | Ga0268265_100602343 | 383 |
| 357 | 3300028381 | Ga0268264_10110958 | Ga0268264_101109582 | 383 |
| 358 | 3300039438 | Ga0436360_0240726 | Ga0436360_0240726_533_1807 | 383 |
| 359 | 3300046459 | Ga0495629_0012947 | Ga0495629_0012947_1437_2666 | 383 |
| 360 | 3300046462 | Ga0495651_0049679 | Ga0495651_0049679_607_1836 | 383 |
| 361 | 3300046507 | Ga0495606_0097073 | Ga0495606_0097073_348_1577 | 383 |
| 362 | 3300046511 | Ga0495608_0038700 | Ga0495608_0038700_65_1294 | 383 |
| 363 | 3300046533 | Ga0495640_0047051 | Ga0495640_0047051_311_1540 | 383 |
| 364 | 3300046557 | Ga0495622_0038836 | Ga0495622_0038836_182_1411 | 383 |
| 365 | 3300046663 | Ga0495635_0028637 | Ga0495635_0028637_529_1758 | 383 |
| 366 | 3300046674 | Ga0495588_0038099 | Ga0495588_0038099_1186_2415 | 383 |
| 367 | 3300046683 | Ga0495658_0128394 | Ga0495658_0128394_154_1383 | 383 |
| 368 | 3300046809 | Ga0495600_0033984 | Ga0495600_0033984_188_1417 | 383 |
| 369 | 3300047317 | Ga0495604_0062628 | Ga0495604_0062628_519_1748 | 383 |
| 370 | 3300047321 | Ga0495676_0021084 | Ga0495676_0021084_3286_4515 | 383 |
| 371 | 3300048088 | Ga0495602_0099531 | Ga0495602_0099531_868_2097 | 383 |
| 372 | 3300048907 | Ga0496104_0006852 | Ga0496104_0006852_7721_8950 | 383 |
| 373 | 3300048908 | Ga0496105_0001479 | Ga0496105_0001479_1236_2465 | 383 |
| 374 | 3300048916 | Ga0496113_0222488 | Ga0496113_0222488_187_1416 | 383 |
| 375 | 3300048918 | Ga0496115_0033839 | Ga0496115_0033839_1965_3194 | 383 |
| 376 | 3300048922 | Ga0496119_0002628 | Ga0496119_0002628_8826_10055 | 383 |
| 377 | 3300048922 | Ga0496119_0085938 | Ga0496119_0085938_545_1774 | 383 |
| 378 | 3300048924 | Ga0496121_0139948 | Ga0496121_0139948_455_1684 | 383 |
| 379 | 3300048928 | Ga0496125_0049182 | Ga0496125_0049182_1460_2689 | 383 |
| 380 | 3300048929 | Ga0496126_0008627 | Ga0496126_0008627_3046_4275 | 383 |
| 381 | 3300053136 | Ga0500559_0013854 | Ga0500559_0013854_378_1607 | 383 |
| 382 | 3300001989 | JGI24739J22299_10014275 | JGI24739J22299_100142751 | 384 |
| 383 | 3300005331 | Ga0070670_100151518 | Ga0070670_1001515182 | 384 |
| 384 | 3300005548 | Ga0070665_100298880 | Ga0070665_1002988802 | 384 |
| 385 | 3300005563 | Ga0068855_100031483 | Ga0068855_1000314833 | 384 |
| 386 | 3300005577 | Ga0068857_100010572 | Ga0068857_1000105726 | 384 |
| 387 | 3300005614 | Ga0068856_100171227 | Ga0068856_1001712272 | 384 |
| 388 | 3300005719 | Ga0068861_100181881 | Ga0068861_1001818812 | 384 |
| 389 | 3300006195 | Ga0075366_10010275 | Ga0075366_100102752 | 384 |
| 390 | 3300006353 | Ga0075370_10066385 | Ga0075370_100663852 | 384 |
| 391 | 3300009093 | Ga0105240_10043962 | Ga0105240_100439624 | 384 |
| 392 | 3300009093 | Ga0105240_10410751 | Ga0105240_104107511 | 384 |
| 393 | 3300009174 | Ga0105241_10029082 | Ga0105241_100290822 | 384 |
| 394 | 3300009545 | Ga0105237_10009523 | Ga0105237_100095234 | 384 |
| 395 | 3300009545 | Ga0105237_10084683 | Ga0105237_100846832 | 384 |
| 396 | 3300009551 | Ga0105238_10028683 | Ga0105238_100286834 | 384 |
| 397 | 3300013296 | Ga0157374_10168298 | Ga0157374_101682982 | 384 |
| 398 | 3300013306 | Ga0163162_10210807 | Ga0163162_102108072 | 384 |
| 399 | 3300025299 | Ga0209256_1021489 | Ga0209256_10214892 | 384 |
| 400 | 3300025302 | Ga0207426_1009873 | Ga0207426_10098732 | 384 |
| 401 | 3300025903 | Ga0207680_10082220 | Ga0207680_100822201 | 384 |
| 402 | 3300025904 | Ga0207647_10002042 | Ga0207647_1000204218 | 384 |
| 403 | 3300025904 | Ga0207647_10009252 | Ga0207647_100092524 | 384 |
| 404 | 3300025912 | Ga0207707_10035695 | Ga0207707_100356952 | 384 |
| 405 | 3300025913 | Ga0207695_10047612 | Ga0207695_100476123 | 384 |
| 406 | 3300025933 | Ga0207706_10017328 | Ga0207706_100173283 | 384 |
| 407 | 3300025941 | Ga0207711_10257946 | Ga0207711_102579462 | 384 |
| 408 | 3300025949 | Ga0207667_10110572 | Ga0207667_101105721 | 384 |
| 409 | 3300025960 | Ga0207651_10161569 | Ga0207651_101615692 | 384 |
| 410 | 3300025981 | Ga0207640_10006337 | Ga0207640_100063375 | 384 |
| 411 | 3300026023 | Ga0207677_10241143 | Ga0207677_102411431 | 384 |
| 412 | 3300026035 | Ga0207703_10097429 | Ga0207703_100974292 | 384 |
| 413 | 3300026067 | Ga0207678_10048914 | Ga0207678_100489143 | 384 |
| 414 | 3300026078 | Ga0207702_10056441 | Ga0207702_100564413 | 384 |
| 415 | 3300026116 | Ga0207674_10022053 | Ga0207674_100220536 | 384 |
| 416 | 3300027866 | Ga0209813_10009226 | Ga0209813_100092261 | 384 |
| 417 | 3300035695 | Ga0373927_0010994 | Ga0373927_0010994_1235_2548 | 384 |
| 418 | 3300035695 | Ga0373927_0099346 | Ga0373927_0099346_481_1740 | 384 |
| 419 | 3300046513 | Ga0495616_0021776 | Ga0495616_0021776_32_1288 | 384 |
| 420 | 3300046522 | Ga0495643_0005874 | Ga0495643_0005874_5025_6284 | 384 |
| 421 | 3300046616 | Ga0495668_0017190 | Ga0495668_0017190_250_1509 | 384 |
| 422 | 3300047443 | Ga0495687_009368 | Ga0495687_009368_4116_5375 | 384 |
| 423 | 3300048904 | Ga0496101_0119178 | Ga0496101_0119178_465_1724 | 384 |
| 424 | 3300048905 | Ga0496102_0004565 | Ga0496102_0004565_8981_10240 | 384 |
| 425 | 3300048906 | Ga0496103_0027863 | Ga0496103_0027863_34_1293 | 384 |
| 426 | 3300048909 | Ga0496106_0256167 | Ga0496106_0256167_62_1303 | 384 |
| 427 | 3300048910 | Ga0496107_0097357 | Ga0496107_0097357_857_2122 | 384 |
| 428 | 3300048913 | Ga0496110_0013153 | Ga0496110_0013153_1461_2717 | 384 |
| 429 | 3300048914 | Ga0496111_0106731 | Ga0496111_0106731_615_1874 | 384 |
| 430 | 3300048915 | Ga0496112_0138203 | Ga0496112_0138203_647_1906 | 384 |
| 431 | 3300048921 | Ga0496118_0106754 | Ga0496118_0106754_159_1418 | 384 |
| 432 | 3300050490 | nmdc:mga03n38_29755_c1 | nmdc:mga03n38_29755_c1_878_2137 | 384 |
| 433 | 3300050491 | nmdc:mga00v17_47444_c1 | nmdc:mga00v17_47444_c1_1106_2365 | 384 |
| 434 | 3300050492 | nmdc:mga0yw44_8504_c1 | nmdc:mga0yw44_8504_c1_2460_3719 | 384 |
| 435 | 3300050493 | nmdc:mga0k408_11091_c2 | nmdc:mga0k408_11091_c2_2560_3819 | 384 |
| 436 | 3300050494 | nmdc:mga06z11_61440_c1 | nmdc:mga06z11_61440_c1_121_1380 | 384 |
| 437 | 3300050496 | nmdc:mga07m45_8560_c1 | nmdc:mga07m45_8560_c1_255_1514 | 384 |
| 438 | iso_pu_bacteria | 2513237141 | 2513889242 | 384 |
| 439 | 3300003354 | JGI25160J50197_1015733 | JGI25160J50197_10157332 | 385 |
| 440 | 3300005983 | Ga0081540_1017300 | Ga0081540_10173001 | 385 |
| 441 | 3300011119 | Ga0105246_10185390 | Ga0105246_101853902 | 385 |
| 442 | 3300025914 | Ga0207671_10008450 | Ga0207671_100084504 | 385 |
| 443 | 3300039437 | Ga0436365_1449287 | Ga0436365_1449287_261_1523 | 385 |
| 444 | 3300046542 | Ga0495597_0025045 | Ga0495597_0025045_1351_2607 | 385 |
| 445 | iso_pu_bacteria | 2885366525 | 2885373297 | 385 |
| 446 | iso_pu_bacteria | 2903768456 | 2903774563 | 385 |
| 447 | iso_pu_bacteria | 3005474847 | 3005479509 | 385 |
| 448 | iso_pu_bacteria | 3005718088 | 3005721574 | 385 |
| 449 | 3300003214 | JGI25165J46597_1004542 | JGI25165J46597_10045422 | 386 |
| 450 | 3300004625 | Ga0055543_1002527 | Ga0055543_10025275 | 386 |
| 451 | 3300005262 | Ga0065165_1001088 | Ga0065165_100108829 | 386 |
| 452 | 3300010375 | Ga0105239_10110112 | Ga0105239_101101123 | 386 |
| 453 | 3300025261 | Ga0209233_1005840 | Ga0209233_10058402 | 386 |
| 454 | 3300037068 | Ga0373925_0008511 | Ga0373925_0008511_4389_5663 | 386 |
| 455 | 3300053080 | Ga0500635_0001234 | Ga0500635_0001234_1737_3011 | 386 |
| 456 | iso_pu_bacteria | 2513237092 | 2513628267 | 386 |
| 457 | iso_pu_bacteria | 2513237161 | 2514010728 | 386 |
| 458 | iso_pu_bacteria | 2838122688 | 2838126616 | 386 |
| 459 | iso_pu_bacteria | 2841941048 | 2841947269 | 386 |
| 460 | iso_pu_bacteria | 2841983080 | 2841990144 | 386 |
| 461 | iso_pu_bacteria | 8006984368 | 8006990351 | 386 |
| 462 | 3300013105 | Ga0157369_10313617 | Ga0157369_103136172 | 387 |
| 463 | 3300048918 | Ga0496115_0019388 | Ga0496115_0019388_1953_3224 | 387 |
| 464 | iso_pu_bacteria | 2513237096 | 2513656620 | 387 |
| 465 | iso_pu_bacteria | 2513237137 | 2513858590 | 387 |
| 466 | iso_pu_bacteria | 2513237145 | 2513917805 | 387 |
| 467 | iso_pu_bacteria | 2517572143 | 2517893147 | 387 |
| 468 | iso_pu_bacteria | 2524023210 | 2524466862 | 387 |
| 469 | iso_pu_bacteria | 2524023228 | 2524539329 | 387 |
| 470 | iso_pu_bacteria | 2602042107 | 2603858826 | 387 |
| 471 | iso_pu_bacteria | 2667528175 | 2671117781 | 387 |
| 472 | iso_pu_bacteria | 2728368998 | 2728754618 | 387 |
| 473 | iso_pu_bacteria | 2791355197 | 2793069985 | 387 |
| 474 | iso_pu_bacteria | 2791355199 | 2793077195 | 387 |
| 475 | iso_pu_bacteria | 2847930680 | 2847935193 | 387 |
| 476 | iso_pu_bacteria | 2857524615 | 2857528070 | 387 |
| 477 | iso_pu_bacteria | 2874604998 | 2874609538 | 387 |
| 478 | iso_pu_bacteria | 2879083081 | 2879090157 | 387 |
| 479 | iso_pu_bacteria | 2885374607 | 2885374740 | 387 |
| 480 | iso_pu_bacteria | 2889033259 | 2889040654 | 387 |
| 481 | iso_pu_bacteria | 2893066018 | 2893068489 | 387 |
| 482 | iso_pu_bacteria | 2903748898 | 2903750903 | 387 |
| 483 | iso_pu_bacteria | 2904690495 | 2904696519 | 387 |
| 484 | iso_pu_bacteria | 2906610324 | 2906617644 | 387 |
| 485 | iso_pu_bacteria | 2906635258 | 2906640861 | 387 |
| 486 | iso_pu_bacteria | 2906660503 | 2906661341 | 387 |
| 487 | iso_pu_bacteria | 2908739725 | 2908743538 | 387 |
| 488 | iso_pu_bacteria | 2908756301 | 2908760373 | 387 |
| 489 | iso_pu_bacteria | 2919073203 | 2919075467 | 387 |
| 490 | iso_pu_bacteria | 2922425934 | 2922429341 | 387 |
| 491 | iso_pu_bacteria | 2935630451 | 2935634084 | 387 |
| 492 | iso_pu_bacteria | 2941507105 | 2941510975 | 387 |
| 493 | iso_pu_bacteria | 2941515067 | 2941518359 | 387 |
| 494 | iso_pu_bacteria | 2941523033 | 2941527378 | 387 |
| 495 | iso_pu_bacteria | 8006926726 | 8006930859 | 387 |
| 496 | iso_pu_bacteria | 8006933436 | 8006941631 | 387 |
| 497 | iso_pu_bacteria | 8006973647 | 8006981341 | 387 |
| 498 | iso_pu_bacteria | 8019555841 | 8019557552 | 387 |
| 499 | iso_pu_bacteria | 8019565922 | 8019567745 | 387 |
| 500 | iso_pu_bacteria | 8056673599 | 8056674572 | 387 |
| 501 | 3300005983 | Ga0081540_1004483 | Ga0081540_10044838 | 388 |
| 502 | 3300025933 | Ga0207706_10219411 | Ga0207706_102194112 | 388 |
| 503 | 3300035111 | Ga0373923_0001732 | Ga0373923_0001732_1435_2694 | 388 |
| 504 | 3300035170 | Ga0373943_0007871 | Ga0373943_0007871_3494_4753 | 388 |
| 505 | 3300035171 | Ga0373946_0027008 | Ga0373946_0027008_60_1319 | 388 |
| 506 | 3300035692 | Ga0373935_0014832 | Ga0373935_0014832_855_2114 | 388 |
| 507 | 3300037068 | Ga0373925_0037184 | Ga0373925_0037184_642_1901 | 388 |
| 508 | 3300046517 | Ga0495630_0019175 | Ga0495630_0019175_1694_2953 | 388 |
| 509 | 3300047319 | Ga0495674_0043351 | Ga0495674_0043351_703_1962 | 388 |
| 510 | iso_pu_bacteria | 2508501009 | 2508543458 | 388 |
| 511 | iso_pu_bacteria | 2508501042 | 2508698765 | 388 |
| 512 | iso_pu_bacteria | 2511231028 | 2511398428 | 388 |
| 513 | iso_pu_bacteria | 2513237094 | 2513637980 | 388 |
| 514 | iso_pu_bacteria | 2513237095 | 2513646581 | 388 |
| 515 | iso_pu_bacteria | 2513237102 | 2513702025 | 388 |
| 516 | iso_pu_bacteria | 2513237104 | 2513717501 | 388 |
| 517 | iso_pu_bacteria | 2513237139 | 2513876388 | 388 |
| 518 | iso_pu_bacteria | 2515154112 | 2515628994 | 388 |
| 519 | iso_pu_bacteria | 2524023205 | 2524436484 | 388 |
| 520 | iso_pu_bacteria | 2528768022 | 2528855971 | 388 |
| 521 | iso_pu_bacteria | 2617270735 | 2617352239 | 388 |
| 522 | iso_pu_bacteria | 2744054633 | 2745077143 | 388 |
| 523 | iso_pu_bacteria | 2791355196 | 2793064838 | 388 |
| 524 | iso_pu_bacteria | 2802429603 | 2805920134 | 388 |
| 525 | iso_pu_bacteria | 2816332527 | 2818240226 | 388 |
| 526 | iso_pu_bacteria | 2824600985 | 2824604213 | 388 |
| 527 | iso_pu_bacteria | 2824609381 | 2824613202 | 388 |
| 528 | iso_pu_bacteria | 2824626560 | 2824629371 | 388 |
| 529 | iso_pu_bacteria | 2824635225 | 2824641173 | 388 |
| 530 | iso_pu_bacteria | 2824644064 | 2824647132 | 388 |
| 531 | iso_pu_bacteria | 2824653114 | 2824657539 | 388 |
| 532 | iso_pu_bacteria | 2824704595 | 2824710507 | 388 |
| 533 | iso_pu_bacteria | 2824714736 | 2824717264 | 388 |
| 534 | iso_pu_bacteria | 2824723954 | 2824727518 | 388 |
| 535 | iso_pu_bacteria | 2824753945 | 2824760202 | 388 |
| 536 | iso_pu_bacteria | 2824763712 | 2824767191 | 388 |
| 537 | iso_pu_bacteria | 2844315083 | 2844318315 | 388 |
| 538 | iso_pu_bacteria | 2857509624 | 2857510557 | 388 |
| 539 | iso_pu_bacteria | 2874590934 | 2874597510 | 388 |
| 540 | iso_pu_bacteria | 2874612657 | 2874612778 | 388 |
| 541 | iso_pu_bacteria | 2874645413 | 2874648586 | 388 |
| 542 | iso_pu_bacteria | 2876771140 | 2876777693 | 388 |
| 543 | iso_pu_bacteria | 2879127579 | 2879134558 | 388 |
| 544 | iso_pu_bacteria | 2879142872 | 2879149907 | 388 |
| 545 | iso_pu_bacteria | 2881364244 | 2881366639 | 388 |
| 546 | iso_pu_bacteria | 2881665667 | 2881669607 | 388 |
| 547 | iso_pu_bacteria | 2885409591 | 2885417414 | 388 |
| 548 | iso_pu_bacteria | 2888419890 | 2888423635 | 388 |
| 549 | iso_pu_bacteria | 2903727486 | 2903729262 | 388 |
| 550 | iso_pu_bacteria | 2904711408 | 2904717092 | 388 |
| 551 | iso_pu_bacteria | 2906602504 | 2906605208 | 388 |
| 552 | iso_pu_bacteria | 2906643746 | 2906645896 | 388 |
| 553 | iso_pu_bacteria | 2922368715 | 2922373416 | 388 |
| 554 | iso_pu_bacteria | 2932784394 | 2932793187 | 388 |
| 555 | iso_pu_bacteria | 2932794094 | 2932796434 | 388 |
| 556 | iso_pu_bacteria | 2932801729 | 2932808945 | 388 |
| 557 | iso_pu_bacteria | 2932809354 | 2932813026 | 388 |
| 558 | iso_pu_bacteria | 2932818245 | 2932821124 | 388 |
| 559 | iso_pu_bacteria | 2932828146 | 2932836769 | 388 |
| 560 | iso_pu_bacteria | 2933577622 | 2933579120 | 388 |
| 561 | iso_pu_bacteria | 2935608549 | 2935611699 | 388 |
| 562 | iso_pu_bacteria | 2935616580 | 2935621534 | 388 |
| 563 | iso_pu_bacteria | 2935638405 | 2935645466 | 388 |
| 564 | iso_pu_bacteria | 2935648319 | 2935651776 | 388 |
| 565 | iso_pu_bacteria | 2935656913 | 2935660586 | 388 |
| 566 | iso_pu_bacteria | 2935665750 | 2935667584 | 388 |
| 567 | iso_pu_bacteria | 2935675223 | 2935681747 | 388 |
| 568 | iso_pu_bacteria | 2935684952 | 2935688333 | 388 |
| 569 | iso_pu_bacteria | 2935694250 | 2935699016 | 388 |
| 570 | iso_pu_bacteria | 2935703347 | 2935706396 | 388 |
| 571 | iso_pu_bacteria | 2935713505 | 2935715352 | 388 |
| 572 | iso_pu_bacteria | 2935722832 | 2935726084 | 388 |
| 573 | iso_pu_bacteria | 2935732158 | 2935734171 | 388 |
| 574 | iso_pu_bacteria | 2935741537 | 2935743550 | 388 |
| 575 | iso_pu_bacteria | 2935750917 | 2935754413 | 388 |
| 576 | iso_pu_bacteria | 2935760218 | 2935768470 | 388 |
| 577 | iso_pu_bacteria | 2935769743 | 2935774089 | 388 |
| 578 | iso_pu_bacteria | 2935777560 | 2935780611 | 388 |
| 579 | iso_pu_bacteria | 2935785616 | 2935789541 | 388 |
| 580 | iso_pu_bacteria | 2935793552 | 2935797318 | 388 |
| 581 | iso_pu_bacteria | 2935801545 | 2935806608 | 388 |
| 582 | iso_pu_bacteria | 2935810662 | 2935813201 | 388 |
| 583 | iso_pu_bacteria | 2935819856 | 2935821177 | 388 |
| 584 | iso_pu_bacteria | 2935827899 | 2935830854 | 388 |
| 585 | iso_pu_bacteria | 2935837841 | 2935840879 | 388 |
| 586 | iso_pu_bacteria | 2935847175 | 2935850563 | 388 |
| 587 | iso_pu_bacteria | 2935855204 | 2935859781 | 388 |
| 588 | iso_pu_bacteria | 2935864058 | 2935869146 | 388 |
| 589 | iso_pu_bacteria | 2935873716 | 2935880661 | 388 |
| 590 | iso_pu_bacteria | 2935883170 | 2935886657 | 388 |
| 591 | iso_pu_bacteria | 2935908558 | 2935914163 | 388 |
| 592 | iso_pu_bacteria | 2935916978 | 2935921333 | 388 |
| 593 | iso_pu_bacteria | 2935926038 | 2935931648 | 388 |
| 594 | iso_pu_bacteria | 2935934488 | 2935940417 | 388 |
| 595 | iso_pu_bacteria | 2935942939 | 2935947758 | 388 |
| 596 | iso_pu_bacteria | 2935951376 | 2935956701 | 388 |
| 597 | iso_pu_bacteria | 2935967501 | 2935973494 | 388 |
| 598 | iso_pu_bacteria | 2935975950 | 2935980897 | 388 |
| 599 | iso_pu_bacteria | 2935984226 | 2935990385 | 388 |
| 600 | iso_pu_bacteria | 2935992306 | 2936000937 | 388 |
| 601 | iso_pu_bacteria | 2936002035 | 2936010200 | 388 |
| 602 | iso_pu_bacteria | 2936011229 | 2936014642 | 388 |
| 603 | iso_pu_bacteria | 2936019824 | 2936023561 | 388 |
| 604 | iso_pu_bacteria | 2936028420 | 2936032589 | 388 |
| 605 | iso_pu_bacteria | 2936037263 | 2936043753 | 388 |
| 606 | iso_pu_bacteria | 2936046547 | 2936050383 | 388 |
| 607 | iso_pu_bacteria | 2936055302 | 2936059125 | 388 |
| 608 | iso_pu_bacteria | 2940556831 | 2940560211 | 388 |
| 609 | iso_pu_bacteria | 2941531003 | 2941534072 | 388 |
| 610 | iso_pu_bacteria | 2941538514 | 2941540990 | 388 |
| 611 | iso_pu_bacteria | 3005506211 | 3005511818 | 388 |
| 612 | iso_pu_bacteria | 3005587118 | 3005588535 | 388 |
| 613 | iso_pu_bacteria | 3005594810 | 3005598408 | 388 |
| 614 | iso_pu_bacteria | 3005710791 | 3005714099 | 388 |
| 615 | iso_pu_bacteria | 8016511872 | 8016514262 | 388 |
| 616 | iso_pu_bacteria | 8016539877 | 8016540006 | 388 |
| 617 | iso_pu_bacteria | 8016548790 | 8016553229 | 388 |
| 618 | iso_pu_bacteria | 8016557553 | 8016561604 | 388 |
| 619 | iso_pu_bacteria | 8016566248 | 8016574061 | 388 |
| 620 | iso_pu_bacteria | 8016575299 | 8016578176 | 388 |
| 621 | iso_pu_bacteria | 8016595262 | 8016599445 | 388 |
| 622 | iso_pu_bacteria | 8016622563 | 8016627641 | 388 |
| 623 | iso_pu_bacteria | 8016630954 | 8016631858 | 388 |
| 624 | iso_pu_bacteria | 8017057580 | 8017062161 | 388 |
| 625 | iso_pu_bacteria | 8019530166 | 8019535450 | 388 |
| 626 | iso_pu_bacteria | 8019538911 | 8019544057 | 388 |
| 627 | iso_pu_bacteria | 8019576017 | 8019581611 | 388 |
| 628 | iso_pu_bacteria | 8019586578 | 8019589245 | 388 |
| 629 | iso_pu_bacteria | 8019608314 | 8019616564 | 388 |
| 630 | iso_pu_bacteria | 8019629233 | 8019635291 | 388 |
| 631 | iso_pu_bacteria | 8019638758 | 8019644408 | 388 |
| 632 | iso_pu_bacteria | 8019648815 | 8019657445 | 388 |
| 633 | iso_pu_bacteria | 8019659431 | 8019663130 | 388 |
| 634 | iso_pu_bacteria | 8019668869 | 8019672729 | 388 |
| 635 | iso_pu_bacteria | 8019678201 | 8019683431 | 388 |
| 636 | iso_pu_bacteria | 8055742211 | 8055747223 | 388 |
| 637 | iso_pu_bacteria | 8056967851 | 8056972675 | 388 |
| 638 | 3300003215 | JGI25153J46596_10004981 | JGI25153J46596_100049813 | 389 |
| 639 | 3300005434 | Ga0070709_10007626 | Ga0070709_100076262 | 389 |
| 640 | 3300005436 | Ga0070713_100036868 | Ga0070713_1000368682 | 389 |
| 641 | 3300009551 | Ga0105238_10083711 | Ga0105238_100837112 | 389 |
| 642 | 3300025297 | Ga0209758_1001125 | Ga0209758_10011258 | 389 |
| 643 | 3300025915 | Ga0207693_10003576 | Ga0207693_100035763 | 389 |
| 644 | 3300045976 | Ga0466967_0300897 | Ga0466967_0300897_74_1339 | 389 |
| 645 | 3300046511 | Ga0495608_0017694 | Ga0495608_0017694_2876_4132 | 389 |
| 646 | 3300047320 | Ga0495672_0021739 | Ga0495672_0021739_67_1332 | 389 |
| 647 | iso_pu_bacteria | 2508501128 | 2509147222 | 389 |
| 648 | 3300005436 | Ga0070713_100011441 | Ga0070713_1000114412 | 390 |
| 649 | 3300005437 | Ga0070710_10028669 | Ga0070710_100286691 | 390 |
| 650 | 3300005455 | Ga0070663_100134461 | Ga0070663_1001344612 | 390 |
| 651 | 3300005456 | Ga0070678_100195051 | Ga0070678_1001950512 | 390 |
| 652 | 3300005535 | Ga0070684_100001878 | Ga0070684_1000018788 | 390 |
| 653 | 3300005614 | Ga0068856_100215452 | Ga0068856_1002154522 | 390 |
| 654 | 3300006353 | Ga0075370_10047080 | Ga0075370_100470803 | 390 |
| 655 | 3300006358 | Ga0068871_100204876 | Ga0068871_1002048762 | 390 |
| 656 | 3300011119 | Ga0105246_10030068 | Ga0105246_100300683 | 390 |
| 657 | 3300013296 | Ga0157374_10162704 | Ga0157374_101627042 | 390 |
| 658 | 3300013308 | Ga0157375_10066235 | Ga0157375_100662352 | 390 |
| 659 | 3300025253 | Ga0209677_100918 | Ga0209677_10091812 | 390 |
| 660 | 3300025254 | Ga0209148_1000446 | Ga0209148_10004469 | 390 |
| 661 | 3300025272 | Ga0209455_1001699 | Ga0209455_10016995 | 390 |
| 662 | 3300025898 | Ga0207692_10013021 | Ga0207692_100130212 | 390 |
| 663 | 3300025912 | Ga0207707_10049975 | Ga0207707_100499752 | 390 |
| 664 | 3300025940 | Ga0207691_10232214 | Ga0207691_102322141 | 390 |
| 665 | 3300025944 | Ga0207661_10001198 | Ga0207661_100011984 | 390 |
| 666 | 3300026067 | Ga0207678_10029189 | Ga0207678_100291895 | 390 |
| 667 | 3300026121 | Ga0207683_10041843 | Ga0207683_100418434 | 390 |
| 668 | 3300031507 | Ga0307509_10137414 | Ga0307509_101374142 | 390 |
| 669 | 3300037418 | Ga0395900_0000860 | Ga0395900_0000860_19491_20753 | 390 |
| 670 | 3300037466 | Ga0395898_0011543 | Ga0395898_0011543_3627_4889 | 390 |
| 671 | 3300044719 | Ga0466971_0075956 | Ga0466971_0075956_21_1286 | 390 |
| 672 | 3300045976 | Ga0466967_0269766 | Ga0466967_0269766_347_1603 | 390 |
| 673 | 3300048905 | Ga0496102_0002395 | Ga0496102_0002395_6015_7361 | 390 |
| 674 | 3300048906 | Ga0496103_0078549 | Ga0496103_0078549_194_1540 | 390 |
| 675 | 3300048908 | Ga0496105_0033294 | Ga0496105_0033294_90_1361 | 390 |
| 676 | 3300048909 | Ga0496106_0002635 | Ga0496106_0002635_9733_10992 | 390 |
| 677 | 3300048915 | Ga0496112_0080337 | Ga0496112_0080337_1035_2381 | 390 |
| 678 | 3300048918 | Ga0496115_0000788 | Ga0496115_0000788_4981_6327 | 390 |
| 679 | 3300048924 | Ga0496121_0000495 | Ga0496121_0000495_20486_21754 | 390 |
| 680 | 3300048924 | Ga0496121_0000576 | Ga0496121_0000576_10103_11362 | 390 |
| 681 | 3300048927 | Ga0496124_0001976 | Ga0496124_0001976_15701_16960 | 390 |
| 682 | 3300048928 | Ga0496125_0064009 | Ga0496125_0064009_429_1688 | 390 |
| 683 | 3300048929 | Ga0496126_0008851 | Ga0496126_0008851_7458_8717 | 390 |
| 684 | 3300048929 | Ga0496126_0026942 | Ga0496126_0026942_3811_5079 | 390 |
| 685 | 3300048929 | Ga0496126_0072428 | Ga0496126_0072428_687_1952 | 390 |
| 686 | 3300050494 | nmdc:mga06z11_1148_c1 | nmdc:mga06z11_1148_c1_3365_4633 | 390 |
| 687 | 3300050496 | nmdc:mga07m45_49250_c1 | nmdc:mga07m45_49250_c1_763_2031 | 390 |
| 688 | 3300053094 | Ga0500566_0000038 | Ga0500566_0000038_38741_40009 | 390 |
| 689 | 3300053095 | Ga0500640_016393 | Ga0500640_016393_1012_2280 | 390 |
| 690 | 3300053111 | Ga0500572_000010 | Ga0500572_000010_27399_28667 | 390 |
| 691 | 3300053123 | Ga0500614_002202 | Ga0500614_002202_259_1527 | 390 |
| 692 | 3300053136 | Ga0500559_0004231 | Ga0500559_0004231_1067_2335 | 390 |
| 693 | 3300053150 | Ga0500603_006887 | Ga0500603_006887_173_1441 | 390 |
| 694 | 3300053159 | Ga0500630_071401 | Ga0500630_071401_54_1322 | 390 |
| 695 | 3300053163 | Ga0500639_000034 | Ga0500639_000034_38424_39692 | 390 |
| 696 | 3300053177 | Ga0500636_0062664 | Ga0500636_0062664_619_1899 | 390 |
| 697 | 3300053735 | Ga0500596_000264 | Ga0500596_000264_3047_4315 | 390 |
| 698 | 3300005436 | Ga0070713_100065467 | Ga0070713_1000654671 | 391 |
| 699 | 3300006941 | Ga0099825_1029178 | Ga0099825_10291782 | 391 |
| 700 | 3300006944 | Ga0099823_1053954 | Ga0099823_10539541 | 391 |
| 701 | 3300007788 | Ga0099795_10030979 | Ga0099795_100309791 | 391 |
| 702 | 3300025898 | Ga0207692_10025365 | Ga0207692_100253652 | 391 |
| 703 | 3300025906 | Ga0207699_10094344 | Ga0207699_100943442 | 391 |
| 704 | 3300027296 | Ga0209389_1000113 | Ga0209389_10001134 | 391 |
| 705 | 3300027361 | Ga0209489_107143 | Ga0209489_10714317 | 391 |
| 706 | 3300027363 | Ga0209700_100021 | Ga0209700_100021152 | 391 |
| 707 | 3300031711 | Ga0265314_10003315 | Ga0265314_100033154 | 391 |
| 708 | 3300037418 | Ga0395900_0041406 | Ga0395900_0041406_950_2221 | 391 |
| 709 | 3300048904 | Ga0496101_0063980 | Ga0496101_0063980_785_2071 | 391 |
| 710 | iso_pu_bacteria | 2904699407 | 2904704007 | 391 |
| 711 | iso_pu_bacteria | 8056689827 | 8056690227 | 391 |
| 712 | 3300005262 | Ga0065165_1003720 | Ga0065165_100372010 | 392 |
| 713 | 3300009098 | Ga0105245_10142434 | Ga0105245_101424341 | 392 |
| 714 | 3300025297 | Ga0209758_1003783 | Ga0209758_10037834 | 392 |
| 715 | 3300025302 | Ga0207426_1004042 | Ga0207426_10040427 | 392 |
| 716 | 3300044683 | Ga0466965_0067839 | Ga0466965_0067839_284_1540 | 392 |
| 717 | 3300046462 | Ga0495651_0005780 | Ga0495651_0005780_827_2083 | 392 |
| 718 | 3300046477 | Ga0495664_0060531 | Ga0495664_0060531_488_1744 | 392 |
| 719 | 3300046516 | Ga0495628_0018385 | Ga0495628_0018385_392_1648 | 392 |
| 720 | 3300046524 | Ga0495648_0039175 | Ga0495648_0039175_1402_2658 | 392 |
| 721 | 3300046543 | Ga0495645_0011286 | Ga0495645_0011286_598_1854 | 392 |
| 722 | 3300046675 | Ga0495657_0024206 | Ga0495657_0024206_1937_3193 | 392 |
| 723 | 3300046689 | Ga0495613_0181071 | Ga0495613_0181071_115_1371 | 392 |
| 724 | 3300048088 | Ga0495602_0004737 | Ga0495602_0004737_11916_13172 | 392 |
| 725 | 3300048907 | Ga0496104_0098726 | Ga0496104_0098726_294_1550 | 392 |
| 726 | 3300048913 | Ga0496110_0035199 | Ga0496110_0035199_2408_3664 | 392 |
| 727 | 3300053085 | Ga0495619_0161015 | Ga0495619_0161015_98_1354 | 392 |
| 728 | 3300053162 | Ga0500638_043036 | Ga0500638_043036_646_1902 | 392 |
| 729 | 3300053177 | Ga0500636_0000502 | Ga0500636_0000502_11757_13013 | 392 |
| 730 | 3300003203 | JGI25406J46586_10000006 | JGI25406J46586_10000006117 | 393 |
| 731 | 3300005985 | Ga0081539_10000176 | Ga0081539_100001764 | 393 |
| 732 | 3300001979 | JGI24740J21852_10007113 | JGI24740J21852_100071132 | 394 |
| 733 | 3300005539 | Ga0068853_100047529 | Ga0068853_1000475292 | 394 |
| 734 | 3300005577 | Ga0068857_100044041 | Ga0068857_1000440413 | 394 |
| 735 | 3300005614 | Ga0068856_100048071 | Ga0068856_1000480712 | 394 |
| 736 | 3300009174 | Ga0105241_10022028 | Ga0105241_100220284 | 394 |
| 737 | 3300009551 | Ga0105238_10022350 | Ga0105238_100223504 | 394 |
| 738 | 3300025911 | Ga0207654_10015889 | Ga0207654_100158892 | 394 |
| 739 | 3300025913 | Ga0207695_10001915 | Ga0207695_1000191530 | 394 |
| 740 | 3300025914 | Ga0207671_10047686 | Ga0207671_100476862 | 394 |
| 741 | 3300025924 | Ga0207694_10001639 | Ga0207694_100016394 | 394 |
| 742 | 3300025949 | Ga0207667_10045424 | Ga0207667_100454244 | 394 |
| 743 | 3300026041 | Ga0207639_10026484 | Ga0207639_100264843 | 394 |
| 744 | 3300026078 | Ga0207702_10000005 | Ga0207702_100000054 | 394 |
| 745 | 3300026116 | Ga0207674_10016313 | Ga0207674_100163134 | 394 |
| 746 | 3300049571 | Ga0501034_0176108 | Ga0501034_0176108_653_1918 | 394 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tpj-assembly1.cif.gz_B | single-particle cryo-em structure of the waal o-antigen ligase in its apo state | 0.6176 | 19 | 387 |
| 7tpj-assembly1.cif.gz_B | single-particle cryo-em structure of the waal o-antigen ligase in its apo state | 0.5832 | 19 | 387 |
| 6pl5-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.4639 | 73 | 386 |
| 6pl6-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.4606 | 73 | 387 |
| 6pl5-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.4399 | 73 | 386 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MS24_1173_1306_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.476 | 108 | 239 | 1.25.10.10 |
| af_I1MS24_1173_1306_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.4425 | 108 | 239 | 1.25.10.10 |
| af_A0A1D6EHA9_477_585_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.3749 | 123 | 219 | 1.20.58.390 |
| af_P50596_22_167_1.20.1250.10 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; | 0.3612 | 119 | 216 | 1.20.1250.10 |
| af_F4K786_323_434_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3609 | 106 | 259 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840HBV8-F1-model_v4 | O-antigen ligase-related domain-containing protein | 0.8902 | 17 | 394 |
GO:0016020
|
| AF-A0A6F8NP52-F1-model_v4 | deleted | 0.888 | 21 | 392 |
|
| AF-A0A840G657-F1-model_v4 | O-antigen ligase-related domain-containing protein | 0.8865 | 17 | 394 |
GO:0016020
|
| AF-A5EKE2-F1-model_v4 | deleted | 0.8857 | 9 | 393 |
|
| AF-A0A7S7T433-F1-model_v4 | O-antigen ligase domain-containing protein | 0.8808 | 1 | 391 |
GO:0016020
GO:0016874 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar