F478821

General Info

Members Datasets Scaffolds Average Seq Length
745 222 1490 328

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_005096|Ga0500595_005096_1957_2988
Length 343
Sequence LNAIGIEIEFLKKEPEKNMTELRPPVQEKPLDRSFALEAVRVTEAAAIAAFAQIGRGNEHDADQAAVEAMRAAFNVLPIDGTVVIGEGERDEAPMLFIGEKVGQGGLAVDIALDPLEGTTLTAKAMANALAVMAMAEPGTMLNAPDTYMDKITIGPGYKDGLVDLDATPADNINALAKAKGCKPGEITVLVMDRPRHESLIAKIRKAGAKVKLITDGDVAGVIETTDPLTGVDLYLGTGGAPEGVLAAAALRCVGGQMQGRLVFRNDDERARAARWGIKDLNRKYQLHELVAGDVVFSATGVTDGSMLRGVHREGNFITTESVVMRAATGTVRWIKTRHRRGA

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
165 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 5.5
Rhizosphere 93.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_005096 3300053119 Bacteria 5769
2 JGI24752J21851_1005017 3300001976 Bacteria 1731
3 JGI24735J21928_10003572 3300002067 Bacteria 5285
4 JGI24749J21850_1002049 3300002076 Bacteria 2849
5 JGI25165J46597_1000003 3300003214 Bacteria 694080
6 Ga0065715_10097189 3300005293 Bacteria 3741
7 Ga0065715_10136892 3300005293 Bacteria 1915
8 Ga0070658_10016856 3300005327 Bacteria 5848
9 Ga0070658_10022615 3300005327 Bacteria 5045
10 Ga0070658_10100510 3300005327 Bacteria 2391
11 Ga0070658_10191051 3300005327 Bacteria 1726
12 Ga0070676_10003354 3300005328 Bacteria 8333
13 Ga0070676_10051880 3300005328 Bacteria 2410
14 Ga0070676_10088159 3300005328 Bacteria 1895
15 Ga0070676_10169202 3300005328 Bacteria 1412
16 Ga0070683_100003711 3300005329 Bacteria 12452
17 Ga0070683_100093785 3300005329 Bacteria 2821
18 Ga0070690_100141185 3300005330 Bacteria 1635
19 Ga0070670_100000492 3300005331 Bacteria 31595
20 Ga0070670_100001441 3300005331 Bacteria 19096
21 Ga0070670_100003018 3300005331 Bacteria 13921
22 Ga0070670_100004806 3300005331 Bacteria 11343
23 Ga0070670_100008814 3300005331 Bacteria 8610
24 Ga0070670_100015950 3300005331 Bacteria 6446
25 Ga0070670_100018218 3300005331 Bacteria 6026
26 Ga0070670_100061783 3300005331 Bacteria 3216
27 Ga0070670_100067648 3300005331 Bacteria 3065
28 Ga0070670_100248627 3300005331 Bacteria 1549
29 Ga0070670_100280139 3300005331 Bacteria 1456
30 Ga0070670_100373470 3300005331 Bacteria 1255
31 Ga0070677_10032419 3300005333 Bacteria 2004
32 Ga0068869_100031002 3300005334 Bacteria 3760
33 Ga0070666_10007440 3300005335 Bacteria 6751
34 Ga0070680_100005269 3300005336 Bacteria 9779
35 Ga0070680_100005833 3300005336 Bacteria 9350
36 Ga0070680_100094855 3300005336 Bacteria 2473
37 Ga0070680_100098552 3300005336 Bacteria 2424
38 Ga0070682_100148835 3300005337 Bacteria 1604
39 Ga0068868_100029593 3300005338 Bacteria 4195
40 Ga0068868_100049524 3300005338 Bacteria 3297
41 Ga0070660_100006181 3300005339 Bacteria 8285
42 Ga0070660_100008394 3300005339 Bacteria 7220
43 Ga0070660_100010501 3300005339 Bacteria 6542
44 Ga0070660_100011805 3300005339 Bacteria 6223
45 Ga0070660_100014928 3300005339 Bacteria 5604
46 Ga0070660_100033757 3300005339 Bacteria 3860
47 Ga0070660_100042663 3300005339 Bacteria 3463
48 Ga0070660_100048836 3300005339 Bacteria 3251
49 Ga0070660_100064193 3300005339 Bacteria 2856
50 Ga0070660_100215100 3300005339 Bacteria 1561
51 Ga0070687_100036271 3300005343 Bacteria 2456
52 Ga0070687_100125592 3300005343 Bacteria 1474
53 Ga0070661_100008300 3300005344 Bacteria 7173
54 Ga0070661_100017390 3300005344 Bacteria 5100
55 Ga0070661_100038082 3300005344 Bacteria 3500
56 Ga0070661_100039984 3300005344 Bacteria 3419
57 Ga0070661_100043821 3300005344 Bacteria 3269
58 Ga0070661_100060418 3300005344 Bacteria 2781
59 Ga0070692_10007468 3300005345 Bacteria 4814
60 Ga0070692_10214759 3300005345 Bacteria 1134
61 Ga0070668_100017784 3300005347 Bacteria 5331
62 Ga0070668_100027237 3300005347 Bacteria 4339
63 Ga0070668_100077807 3300005347 Bacteria 2593
64 Ga0070668_100131743 3300005347 Bacteria 2007
65 Ga0070669_100002850 3300005353 Bacteria 12493
66 Ga0070669_100011147 3300005353 Bacteria 6380
67 Ga0070669_100027526 3300005353 Bacteria 4091
68 Ga0070669_100139843 3300005353 Bacteria 1866
69 Ga0070675_100003002 3300005354 Bacteria 12732
70 Ga0070675_100007649 3300005354 Bacteria 8360
71 Ga0070675_100039637 3300005354 Bacteria 3845
72 Ga0070675_100114388 3300005354 Bacteria 2286
73 Ga0070675_100181979 3300005354 Bacteria 1817
74 Ga0070675_100193926 3300005354 Bacteria 1761
75 Ga0070671_100000181 3300005355 Bacteria 42003
76 Ga0070671_100000297 3300005355 Bacteria 33662
77 Ga0070671_100000902 3300005355 Bacteria 21648
78 Ga0070671_100054394 3300005355 Bacteria 3328
79 Ga0070671_100064858 3300005355 Bacteria 3042
80 Ga0070674_100001493 3300005356 Bacteria 12459
81 Ga0070674_100087324 3300005356 Bacteria 2242
82 Ga0070674_100111099 3300005356 Bacteria 2012
83 Ga0070673_100000935 3300005364 Bacteria 16541
84 Ga0070673_100005228 3300005364 Bacteria 8285
85 Ga0070673_100041936 3300005364 Bacteria 3524
86 Ga0070673_100044801 3300005364 Bacteria 3427
87 Ga0070673_100122945 3300005364 Bacteria 2168
88 Ga0070673_100132705 3300005364 Bacteria 2092
89 Ga0070659_100002134 3300005366 Bacteria 14084
90 Ga0070659_100012977 3300005366 Bacteria 6196
91 Ga0070659_100027376 3300005366 Bacteria 4392
92 Ga0070659_100054189 3300005366 Bacteria 3158
93 Ga0070659_100111132 3300005366 Bacteria 2212
94 Ga0070659_100149308 3300005366 Bacteria 1906
95 Ga0070659_100237875 3300005366 Bacteria 1506
96 Ga0070659_100411527 3300005366 Bacteria 1143
97 Ga0070667_100008263 3300005367 Bacteria 8626
98 Ga0070667_100022812 3300005367 Bacteria 5190
99 Ga0070667_100040708 3300005367 Bacteria 3897
100 Ga0070667_100084786 3300005367 Bacteria 2716
101 Ga0070667_100132638 3300005367 Bacteria 2175
102 Ga0070667_100163850 3300005367 Bacteria 1960
103 Ga0070667_100228790 3300005367 Bacteria 1657
104 Ga0070711_100093065 3300005439 Bacteria 2176
105 Ga0070700_100010959 3300005441 Bacteria 5015
106 Ga0070663_100017365 3300005455 Bacteria 4695
107 Ga0070663_100042837 3300005455 Bacteria 3183
108 Ga0070663_100104731 3300005455 Bacteria 2116
109 Ga0070663_100231658 3300005455 Bacteria 1455
110 Ga0070678_100006855 3300005456 Bacteria 6714
111 Ga0070678_100042299 3300005456 Bacteria 3237
112 Ga0070678_100045738 3300005456 Bacteria 3133
113 Ga0070662_100003042 3300005457 Bacteria 10419
114 Ga0070662_100010133 3300005457 Bacteria 6175
115 Ga0070662_100050582 3300005457 Bacteria 2998
116 Ga0070662_100076846 3300005457 Bacteria 2476
117 Ga0070662_100263715 3300005457 Bacteria 1389
118 Ga0070662_100271293 3300005457 Bacteria 1370
119 Ga0070681_10001736 3300005458 Bacteria 19525
120 Ga0068867_100026126 3300005459 Bacteria 4191
121 Ga0070679_100000015 3300005530 Bacteria 142672
122 Ga0070679_100024387 3300005530 Bacteria 5927
123 Ga0070679_100178801 3300005530 Bacteria 2094
124 Ga0070679_100233839 3300005530 Bacteria 1797
125 Ga0070684_100063717 3300005535 Bacteria 3232
126 Ga0068853_100002489 3300005539 Bacteria 13806
127 Ga0068853_100012864 3300005539 Bacteria 6819
128 Ga0068853_100026067 3300005539 Bacteria 4907
129 Ga0068853_100084898 3300005539 Bacteria 2775
130 Ga0070672_100003714 3300005543 Bacteria 9932
131 Ga0070672_100005390 3300005543 Bacteria 8470
132 Ga0070672_100021579 3300005543 Bacteria 4716
133 Ga0070672_100041239 3300005543 Bacteria 3548
134 Ga0070672_100152963 3300005543 Bacteria 1909
135 Ga0070672_100173703 3300005543 Bacteria 1793
136 Ga0070686_100000071 3300005544 Bacteria 76738
137 Ga0070696_100017998 3300005546 Bacteria 4772
138 Ga0070693_100039893 3300005547 Bacteria 2633
139 Ga0070665_100010035 3300005548 Bacteria 9580
140 Ga0070665_100016040 3300005548 Bacteria 7519
141 Ga0070665_100016219 3300005548 Bacteria 7474
142 Ga0070665_100017435 3300005548 Bacteria 7210
143 Ga0070665_100072655 3300005548 Bacteria 3447
144 Ga0070665_100074143 3300005548 Bacteria 3409
145 Ga0068855_100217188 3300005563 Bacteria 2146
146 Ga0070664_100002222 3300005564 Bacteria 15607
147 Ga0070664_100006300 3300005564 Bacteria 9572
148 Ga0070664_100006564 3300005564 Bacteria 9383
149 Ga0070664_100010543 3300005564 Bacteria 7491
150 Ga0070664_100013349 3300005564 Bacteria 6690
151 Ga0070664_100014996 3300005564 Bacteria 6325
152 Ga0070664_100016559 3300005564 Bacteria 6045
153 Ga0070664_100019981 3300005564 Bacteria 5514
154 Ga0070664_100053082 3300005564 Bacteria 3434
155 Ga0070664_100061836 3300005564 Bacteria 3192
156 Ga0070664_100141764 3300005564 Bacteria 2117
157 Ga0070664_100198244 3300005564 Bacteria 1790
158 Ga0068857_100002619 3300005577 Bacteria 14771
159 Ga0068857_100007876 3300005577 Bacteria 9191
160 Ga0068857_100011483 3300005577 Bacteria 7704
161 Ga0068857_100046457 3300005577 Bacteria 3853
162 Ga0068857_100078735 3300005577 Bacteria 2942
163 Ga0068854_100006270 3300005578 Bacteria 7557
164 Ga0068854_100114392 3300005578 Bacteria 2040
165 Ga0068854_100123924 3300005578 Bacteria 1966
166 Ga0068854_100157636 3300005578 Bacteria 1755
167 Ga0068854_100199548 3300005578 Bacteria 1572
168 Ga0068856_100004809 3300005614 Bacteria 13387
169 Ga0068856_100032950 3300005614 Bacteria 5074
170 Ga0068856_100034066 3300005614 Bacteria 4988
171 Ga0068852_100039270 3300005616 Bacteria 3984
172 Ga0068852_100515140 3300005616 Bacteria 1193
173 Ga0068859_100094552 3300005617 Bacteria 3041
174 Ga0068859_100119710 3300005617 Bacteria 2700
175 Ga0068859_100189877 3300005617 Bacteria 2139
176 Ga0068864_100001662 3300005618 Bacteria 18314
177 Ga0068864_100002927 3300005618 Bacteria 14117
178 Ga0068864_100012904 3300005618 Bacteria 6913
179 Ga0068864_100019553 3300005618 Bacteria 5665
180 Ga0068864_100021800 3300005618 Bacteria 5367
181 Ga0068864_100073737 3300005618 Bacteria 2976
182 Ga0068851_10022723 3300005834 Bacteria 3059
183 Ga0068851_10046464 3300005834 Bacteria 2196
184 Ga0068851_10082591 3300005834 Bacteria 1680
185 Ga0068870_10031704 3300005840 Bacteria 2680
186 Ga0068863_100001851 3300005841 Bacteria 21022
187 Ga0068863_100002605 3300005841 Bacteria 17885
188 Ga0068863_100036458 3300005841 Bacteria 4684
189 Ga0068863_100147662 3300005841 Bacteria 2249
190 Ga0068858_100016987 3300005842 Bacteria 6832
191 Ga0068858_100027637 3300005842 Bacteria 5270
192 Ga0068858_100031168 3300005842 Bacteria 4951
193 Ga0068858_100041100 3300005842 Bacteria 4289
194 Ga0068858_100266317 3300005842 Bacteria 1630
195 Ga0068860_100022293 3300005843 Bacteria 6129
196 Ga0068860_100033752 3300005843 Bacteria 4910
197 Ga0068860_100073738 3300005843 Bacteria 3245
198 Ga0068860_100314889 3300005843 Bacteria 1535
199 Ga0068862_100003421 3300005844 Bacteria 13670
200 Ga0068862_100005226 3300005844 Bacteria 10895
201 Ga0068862_100041895 3300005844 Bacteria 3898
202 Ga0068862_100057256 3300005844 Bacteria 3342
203 Ga0068862_100083152 3300005844 Bacteria 2780
204 Ga0068862_100097021 3300005844 Bacteria 2573
205 Ga0097621_100035652 3300006237 Bacteria 3977
206 Ga0097621_100087513 3300006237 Bacteria 2601
207 Ga0097621_100234817 3300006237 Bacteria 1601
208 Ga0097621_100315734 3300006237 Bacteria 1383
209 Ga0068871_100008815 3300006358 Bacteria 7265
210 Ga0068871_100095367 3300006358 Bacteria 2484
211 Ga0068865_100087552 3300006881 Bacteria 2251
212 Ga0097620_100094544 3300006931 Bacteria 3041
213 Ga0097620_100119710 3300006931 Bacteria 2700
214 Ga0097620_100189867 3300006931 Bacteria 2139
215 Ga0105240_10001968 3300009093 Bacteria 33951
216 Ga0105240_10033304 3300009093 Bacteria 6659
217 Ga0111539_10035865 3300009094 Bacteria 6003
218 Ga0105245_10021033 3300009098 Bacteria 5723
219 Ga0105245_10145445 3300009098 Bacteria 2236
220 Ga0114129_10335570 3300009147 Bacteria 2006
221 Ga0105243_10038514 3300009148 Bacteria 3723
222 Ga0105248_10000902 3300009177 Bacteria 33207
223 Ga0105248_10004414 3300009177 Bacteria 15570
224 Ga0105248_10006626 3300009177 Bacteria 12694
225 Ga0105248_10014641 3300009177 Bacteria 8630
226 Ga0105248_10068853 3300009177 Bacteria 3974
227 Ga0105248_10077899 3300009177 Bacteria 3727
228 Ga0105248_10218026 3300009177 Bacteria 2149
229 Ga0105248_10305875 3300009177 Bacteria 1790
230 Ga0105248_10331935 3300009177 Bacteria 1713
231 Ga0105248_10462864 3300009177 Bacteria 1429
232 Ga0105237_10018465 3300009545 Bacteria 7216
233 Ga0105237_10046349 3300009545 Bacteria 4373
234 Ga0105238_10003920 3300009551 Bacteria 14771
235 Ga0105249_10021992 3300009553 Bacteria 5711
236 Ga0105249_10063823 3300009553 Bacteria 3384
237 Ga0105239_10132875 3300010375 Bacteria 2769
238 Ga0157373_10016588 3300013100 Bacteria 5370
239 Ga0157373_10017136 3300013100 Bacteria 5275
240 Ga0157373_10076889 3300013100 Bacteria 2355
241 Ga0157373_10203947 3300013100 Bacteria 1394
242 Ga0157373_10250144 3300013100 Bacteria 1254
243 Ga0157371_10023484 3300013102 Bacteria 4509
244 Ga0157371_10079550 3300013102 Bacteria 2322
245 Ga0157371_10134240 3300013102 Bacteria 1762
246 Ga0157371_10239556 3300013102 Bacteria 1305
247 Ga0157370_10011741 3300013104 Bacteria 9147
248 Ga0157370_10039248 3300013104 Bacteria 4576
249 Ga0157370_10194600 3300013104 Bacteria 1882
250 Ga0157370_10307775 3300013104 Bacteria 1462
251 Ga0157369_10026931 3300013105 Bacteria 6376
252 Ga0157369_10197570 3300013105 Bacteria 2111
253 Ga0157374_10014254 3300013296 Bacteria 6952
254 Ga0157374_10088484 3300013296 Bacteria 2949
255 Ga0163162_10009924 3300013306 Bacteria 9261
256 Ga0163162_10263961 3300013306 Bacteria 1853
257 Ga0157372_10002914 3300013307 Bacteria 18510
258 Ga0157375_10005814 3300013308 Bacteria 10733
259 Ga0157375_10010645 3300013308 Bacteria 8099
260 Ga0157375_10261948 3300013308 Bacteria 1891
261 Ga0157375_10431672 3300013308 Bacteria 1483
262 Ga0163163_10000002 3300014325 Bacteria 609846
263 Ga0163163_10228465 3300014325 Bacteria 1910
264 Ga0157380_10013536 3300014326 Bacteria 5952
265 Ga0157380_10025147 3300014326 Bacteria 4513
266 Ga0157380_10166443 3300014326 Bacteria 1922
267 Ga0157380_10596787 3300014326 Bacteria 1092
268 Ga0157379_10001600 3300014968 Bacteria 18672
269 Ga0157379_10009530 3300014968 Bacteria 8455
270 Ga0157379_10112648 3300014968 Bacteria 2445
271 Ga0157379_10303207 3300014968 Bacteria 1456
272 Ga0213876_10004091 3300021384 Bacteria 8195
273 Ga0209233_1000015 3300025261 Bacteria 980563
274 Ga0207697_10010020 3300025315 Bacteria 4071
275 Ga0207656_10015666 3300025321 Bacteria 2938
276 Ga0207682_10001520 3300025893 Bacteria 10688
277 Ga0207682_10003937 3300025893 Bacteria 6338
278 Ga0207688_10034766 3300025901 Bacteria 2790
279 Ga0207680_10064542 3300025903 Bacteria 2245
280 Ga0207680_10092888 3300025903 Bacteria 1923
281 Ga0207680_10191858 3300025903 Bacteria 1387
282 Ga0207647_10001881 3300025904 Bacteria 16076
283 Ga0207647_10024517 3300025904 Bacteria 3977
284 Ga0207645_10022483 3300025907 Bacteria 4101
285 Ga0207643_10077695 3300025908 Bacteria 1919
286 Ga0207643_10111317 3300025908 Bacteria 1613
287 Ga0207705_10002417 3300025909 Bacteria 14410
288 Ga0207705_10003358 3300025909 Bacteria 12162
289 Ga0207705_10030897 3300025909 Bacteria 3823
290 Ga0207705_10065011 3300025909 Bacteria 2637
291 Ga0207705_10070256 3300025909 Bacteria 2537
292 Ga0207705_10140425 3300025909 Bacteria 1804
293 Ga0207705_10169313 3300025909 Bacteria 1644
294 Ga0207705_10259215 3300025909 Bacteria 1327
295 Ga0207705_10320336 3300025909 Bacteria 1191
296 Ga0207707_10008312 3300025912 Bacteria 9003
297 Ga0207707_10015550 3300025912 Bacteria 6628
298 Ga0207707_10104293 3300025912 Bacteria 2478
299 Ga0207695_10030606 3300025913 Bacteria 5922
300 Ga0207671_10011380 3300025914 Bacteria 7249
301 Ga0207693_10130803 3300025915 Bacteria 1973
302 Ga0207663_10060911 3300025916 Bacteria 2393
303 Ga0207660_10002614 3300025917 Bacteria 11818
304 Ga0207660_10025847 3300025917 Bacteria 3991
305 Ga0207662_10069621 3300025918 Bacteria 2126
306 Ga0207662_10071539 3300025918 Bacteria 2100
307 Ga0207657_10000120 3300025919 Bacteria 78496
308 Ga0207657_10000659 3300025919 Bacteria 36733
309 Ga0207657_10007080 3300025919 Bacteria 11524
310 Ga0207657_10012143 3300025919 Bacteria 8510
311 Ga0207657_10013429 3300025919 Bacteria 8036
312 Ga0207657_10014699 3300025919 Bacteria 7624
313 Ga0207657_10026690 3300025919 Bacteria 5301
314 Ga0207657_10046503 3300025919 Bacteria 3800
315 Ga0207657_10105684 3300025919 Bacteria 2330
316 Ga0207657_10159913 3300025919 Bacteria 1830
317 Ga0207657_10185241 3300025919 Bacteria 1681
318 Ga0207649_10029750 3300025920 Bacteria 3228
319 Ga0207649_10032237 3300025920 Bacteria 3122
320 Ga0207649_10041568 3300025920 Bacteria 2799
321 Ga0207649_10042927 3300025920 Bacteria 2761
322 Ga0207649_10094062 3300025920 Bacteria 1968
323 Ga0207652_10000021 3300025921 Bacteria 159712
324 Ga0207652_10009225 3300025921 Bacteria 7937
325 Ga0207652_10017682 3300025921 Bacteria 5838
326 Ga0207681_10002597 3300025923 Bacteria 11442
327 Ga0207681_10033612 3300025923 Bacteria 3364
328 Ga0207681_10107485 3300025923 Bacteria 2023
329 Ga0207681_10335094 3300025923 Bacteria 1207
330 Ga0207694_10001166 3300025924 Bacteria 22809
331 Ga0207650_10004169 3300025925 Bacteria 9879
332 Ga0207650_10006715 3300025925 Bacteria 7846
333 Ga0207650_10018164 3300025925 Bacteria 4932
334 Ga0207650_10020146 3300025925 Bacteria 4700
335 Ga0207650_10026256 3300025925 Bacteria 4153
336 Ga0207650_10030630 3300025925 Bacteria 3877
337 Ga0207650_10057328 3300025925 Bacteria 2897
338 Ga0207650_10060040 3300025925 Bacteria 2837
339 Ga0207650_10063415 3300025925 Bacteria 2763
340 Ga0207650_10067642 3300025925 Bacteria 2681
341 Ga0207659_10003938 3300025926 Bacteria 8961
342 Ga0207659_10041804 3300025926 Bacteria 3211
343 Ga0207659_10055732 3300025926 Bacteria 2828
344 Ga0207659_10157401 3300025926 Bacteria 1780
345 Ga0207687_10053714 3300025927 Bacteria 2816
346 Ga0207644_10000090 3300025931 Bacteria 65122
347 Ga0207644_10001642 3300025931 Bacteria 14417
348 Ga0207644_10001927 3300025931 Bacteria 13454
349 Ga0207644_10009103 3300025931 Bacteria 6509
350 Ga0207644_10026827 3300025931 Bacteria 3975
351 Ga0207644_10086214 3300025931 Bacteria 2331
352 Ga0207644_10092410 3300025931 Bacteria 2257
353 Ga0207644_10253938 3300025931 Bacteria 1404
354 Ga0207690_10008704 3300025932 Bacteria 6021
355 Ga0207690_10030405 3300025932 Bacteria 3445
356 Ga0207690_10042850 3300025932 Bacteria 2975
357 Ga0207690_10043636 3300025932 Bacteria 2952
358 Ga0207690_10064051 3300025932 Bacteria 2509
359 Ga0207690_10092132 3300025932 Bacteria 2144
360 Ga0207706_10012383 3300025933 Bacteria 7769
361 Ga0207706_10014167 3300025933 Bacteria 7229
362 Ga0207706_10021434 3300025933 Bacteria 5803
363 Ga0207706_10023938 3300025933 Bacteria 5478
364 Ga0207706_10024546 3300025933 Bacteria 5404
365 Ga0207706_10033564 3300025933 Bacteria 4567
366 Ga0207706_10088454 3300025933 Bacteria 2723
367 Ga0207706_10229923 3300025933 Bacteria 1623
368 Ga0207706_10267079 3300025933 Bacteria 1493
369 Ga0207706_10458186 3300025933 Bacteria 1103
370 Ga0207669_10006130 3300025937 Bacteria 5465
371 Ga0207669_10018415 3300025937 Bacteria 3610
372 Ga0207669_10023998 3300025937 Bacteria 3270
373 Ga0207669_10040073 3300025937 Bacteria 2714
374 Ga0207669_10305283 3300025937 Bacteria 1211
375 Ga0207704_10147621 3300025938 Bacteria 1654
376 Ga0207691_10003700 3300025940 Bacteria 14833
377 Ga0207691_10013017 3300025940 Bacteria 7966
378 Ga0207691_10020354 3300025940 Bacteria 6271
379 Ga0207691_10033170 3300025940 Bacteria 4808
380 Ga0207691_10035503 3300025940 Bacteria 4626
381 Ga0207691_10149869 3300025940 Bacteria 2051
382 Ga0207711_10000536 3300025941 Bacteria 38861
383 Ga0207711_10003022 3300025941 Bacteria 14705
384 Ga0207711_10008750 3300025941 Bacteria 8465
385 Ga0207711_10022701 3300025941 Bacteria 5249
386 Ga0207711_10031797 3300025941 Bacteria 4458
387 Ga0207711_10032201 3300025941 Bacteria 4432
388 Ga0207711_10291782 3300025941 Bacteria 1503
389 Ga0207689_10024248 3300025942 Bacteria 5090
390 Ga0207679_10004960 3300025945 Bacteria 8303
391 Ga0207679_10020187 3300025945 Bacteria 4493
392 Ga0207679_10061196 3300025945 Bacteria 2801
393 Ga0207679_10068956 3300025945 Bacteria 2659
394 Ga0207679_10121281 3300025945 Bacteria 2082
395 Ga0207667_10153490 3300025949 Bacteria 2369
396 Ga0207651_10001959 3300025960 Bacteria 9683
397 Ga0207651_10021431 3300025960 Bacteria 3928
398 Ga0207651_10040275 3300025960 Bacteria 3089
399 Ga0207651_10051235 3300025960 Bacteria 2807
400 Ga0207651_10098161 3300025960 Bacteria 2165
401 Ga0207651_10106318 3300025960 Bacteria 2095
402 Ga0207712_10022889 3300025961 Bacteria 4119
403 Ga0207668_10002917 3300025972 Bacteria 10035
404 Ga0207668_10004273 3300025972 Bacteria 8376
405 Ga0207668_10126678 3300025972 Bacteria 1943
406 Ga0207640_10114502 3300025981 Bacteria 1919
407 Ga0207658_10009236 3300025986 Bacteria 6685
408 Ga0207658_10010976 3300025986 Bacteria 6169
409 Ga0207658_10024872 3300025986 Bacteria 4189
410 Ga0207658_10034164 3300025986 Bacteria 3632
411 Ga0207658_10088905 3300025986 Bacteria 2390
412 Ga0207658_10158715 3300025986 Bacteria 1851
413 Ga0207677_10032223 3300026023 Bacteria 3367
414 Ga0207703_10014437 3300026035 Bacteria 6159
415 Ga0207703_10201173 3300026035 Bacteria 1770
416 Ga0207639_10000202 3300026041 Bacteria 44984
417 Ga0207639_10071984 3300026041 Bacteria 2706
418 Ga0207678_10008745 3300026067 Bacteria 8913
419 Ga0207678_10010180 3300026067 Bacteria 8256
420 Ga0207678_10020716 3300026067 Bacteria 5764
421 Ga0207678_10023372 3300026067 Bacteria 5406
422 Ga0207678_10024043 3300026067 Bacteria 5324
423 Ga0207678_10057791 3300026067 Bacteria 3338
424 Ga0207678_10069889 3300026067 Bacteria 3011
425 Ga0207708_10110966 3300026075 Bacteria 2129
426 Ga0207702_10039486 3300026078 Bacteria 3955
427 Ga0207702_10058768 3300026078 Bacteria 3273
428 Ga0207702_10264870 3300026078 Bacteria 1619
429 Ga0207641_10003439 3300026088 Bacteria 14020
430 Ga0207641_10007699 3300026088 Bacteria 8956
431 Ga0207641_10023313 3300026088 Bacteria 5101
432 Ga0207641_10023524 3300026088 Bacteria 5074
433 Ga0207641_10054524 3300026088 Bacteria 3392
434 Ga0207648_10028391 3300026089 Bacteria 4960
435 Ga0207676_10002566 3300026095 Bacteria 12965
436 Ga0207676_10013278 3300026095 Bacteria 5917
437 Ga0207676_10018287 3300026095 Bacteria 5092
438 Ga0207676_10018697 3300026095 Bacteria 5043
439 Ga0207676_10031485 3300026095 Bacteria 3990
440 Ga0207674_10000185 3300026116 Bacteria 76519
441 Ga0207674_10003237 3300026116 Bacteria 20044
442 Ga0207674_10003866 3300026116 Bacteria 18254
443 Ga0207674_10039850 3300026116 Bacteria 4867
444 Ga0207674_10049087 3300026116 Bacteria 4318
445 Ga0207674_10071276 3300026116 Bacteria 3492
446 Ga0207675_100146303 3300026118 Bacteria 2247
447 Ga0207683_10004810 3300026121 Bacteria 11628
448 Ga0207683_10010082 3300026121 Bacteria 8061
449 Ga0207683_10028553 3300026121 Bacteria 4824
450 Ga0207683_10051290 3300026121 Bacteria 3615
451 Ga0207683_10068670 3300026121 Bacteria 3129
452 Ga0207698_10003325 3300026142 Bacteria 9675
453 Ga0207698_10014308 3300026142 Bacteria 5270
454 Ga0207698_10040136 3300026142 Bacteria 3474
455 Ga0209983_1006663 3300027665 Bacteria 2371
456 Ga0268266_10021922 3300028379 Bacteria 5443
457 Ga0268266_10034303 3300028379 Bacteria 4316
458 Ga0268266_10387457 3300028379 Bacteria 1319
459 Ga0268265_10005941 3300028380 Bacteria 8311
460 Ga0268265_10012684 3300028380 Bacteria 5718
461 Ga0268265_10047879 3300028380 Bacteria 3206
462 Ga0268265_10050209 3300028380 Bacteria 3142
463 Ga0268265_10061651 3300028380 Bacteria 2879
464 Ga0268265_10070015 3300028380 Bacteria 2726
465 Ga0268264_10004725 3300028381 Bacteria 11569
466 Ga0268264_10055491 3300028381 Bacteria 3310
467 Ga0268264_10057815 3300028381 Bacteria 3245
468 Ga0268264_10067945 3300028381 Bacteria 3010
469 Ga0307408_100014016 3300031548 Bacteria 5325
470 Ga0307408_100023179 3300031548 Bacteria 4226
471 Ga0307408_100030763 3300031548 Bacteria 3731
472 Ga0307408_100034283 3300031548 Bacteria 3555
473 Ga0307408_100039031 3300031548 Bacteria 3353
474 Ga0307408_100273242 3300031548 Bacteria 1404
475 Ga0307516_10110537 3300031730 Bacteria 2552
476 Ga0307405_10047342 3300031731 Bacteria 2647
477 Ga0307405_10049397 3300031731 Bacteria 2600
478 Ga0307405_10054109 3300031731 Bacteria 2503
479 Ga0307405_10078700 3300031731 Bacteria 2146
480 Ga0307405_10117359 3300031731 Bacteria 1814
481 Ga0307405_10140585 3300031731 Bacteria 1682
482 Ga0307405_10150959 3300031731 Bacteria 1633
483 Ga0307413_10014599 3300031824 Bacteria 3995
484 Ga0307413_10017847 3300031824 Bacteria 3706
485 Ga0307413_10045951 3300031824 Bacteria 2592
486 Ga0307413_10056796 3300031824 Bacteria 2390
487 Ga0307413_10096558 3300031824 Bacteria 1940
488 Ga0307413_10215121 3300031824 Bacteria 1399
489 Ga0307413_10225340 3300031824 Bacteria 1372
490 Ga0307410_10000689 3300031852 Bacteria 14061
491 Ga0307410_10004405 3300031852 Bacteria 7276
492 Ga0307410_10013300 3300031852 Bacteria 4796
493 Ga0307410_10033534 3300031852 Bacteria 3316
494 Ga0307410_10040469 3300031852 Bacteria 3067
495 Ga0307410_10043331 3300031852 Bacteria 2981
496 Ga0307410_10069160 3300031852 Bacteria 2441
497 Ga0307410_10170946 3300031852 Bacteria 1637
498 Ga0307410_10433857 3300031852 Bacteria 1068
499 Ga0307406_10039140 3300031901 Bacteria 2940
500 Ga0307406_10074544 3300031901 Bacteria 2235
501 Ga0307406_10097673 3300031901 Bacteria 1993
502 Ga0307406_10185158 3300031901 Bacteria 1519
503 Ga0307406_10200896 3300031901 Bacteria 1467
504 Ga0307406_10269763 3300031901 Bacteria 1292
505 Ga0307407_10002048 3300031903 Bacteria 7705
506 Ga0307407_10008632 3300031903 Bacteria 4693
507 Ga0307407_10009464 3300031903 Bacteria 4540
508 Ga0307407_10229985 3300031903 Bacteria 1259
509 Ga0307412_10018735 3300031911 Bacteria 4174
510 Ga0307412_10046922 3300031911 Bacteria 2834
511 Ga0307412_10061051 3300031911 Bacteria 2532
512 Ga0307412_10082714 3300031911 Bacteria 2224
513 Ga0307412_10131286 3300031911 Bacteria 1820
514 Ga0307412_10246250 3300031911 Bacteria 1385
515 Ga0307409_100010048 3300031995 Bacteria 5854
516 Ga0307409_100017000 3300031995 Bacteria 4834
517 Ga0307409_100029260 3300031995 Bacteria 3939
518 Ga0307409_100035853 3300031995 Bacteria 3638
519 Ga0307409_100061743 3300031995 Bacteria 2930
520 Ga0307409_100064859 3300031995 Bacteria 2871
521 Ga0307409_100115106 3300031995 Bacteria 2263
522 Ga0307409_100117275 3300031995 Bacteria 2246
523 Ga0307409_100140100 3300031995 Bacteria 2082
524 Ga0307409_100155524 3300031995 Bacteria 1991
525 Ga0307409_100274937 3300031995 Bacteria 1553
526 Ga0307409_100284439 3300031995 Bacteria 1530
527 Ga0307409_100286324 3300031995 Bacteria 1526
528 Ga0307409_100460553 3300031995 Bacteria 1229
529 Ga0307416_100001237 3300032002 Bacteria 13783
530 Ga0307416_100061679 3300032002 Bacteria 3061
531 Ga0307416_100124632 3300032002 Bacteria 2305
532 Ga0307416_100133998 3300032002 Bacteria 2237
533 Ga0307416_100137187 3300032002 Bacteria 2215
534 Ga0307416_100344196 3300032002 Bacteria 1505
535 Ga0307414_10001648 3300032004 Bacteria 11613
536 Ga0307414_10006304 3300032004 Bacteria 6602
537 Ga0307414_10081431 3300032004 Bacteria 2370
538 Ga0307414_10100615 3300032004 Bacteria 2174
539 Ga0307414_10101591 3300032004 Bacteria 2165
540 Ga0307414_10122573 3300032004 Bacteria 2001
541 Ga0307414_10126778 3300032004 Bacteria 1974
542 Ga0307414_10193216 3300032004 Bacteria 1649
543 Ga0307414_10224206 3300032004 Bacteria 1545
544 Ga0307414_10253255 3300032004 Bacteria 1465
545 Ga0307414_10273848 3300032004 Bacteria 1415
546 Ga0307411_10001764 3300032005 Bacteria 9132
547 Ga0307411_10028886 3300032005 Bacteria 3378
548 Ga0307411_10034798 3300032005 Bacteria 3138
549 Ga0307411_10039484 3300032005 Bacteria 2986
550 Ga0307411_10039558 3300032005 Bacteria 2984
551 Ga0307411_10046153 3300032005 Bacteria 2807
552 Ga0307411_10063882 3300032005 Bacteria 2462
553 Ga0307411_10146909 3300032005 Bacteria 1746
554 Ga0307411_10157171 3300032005 Bacteria 1697
555 Ga0307411_10301794 3300032005 Bacteria 1284
556 Ga0307415_100001088 3300032126 Bacteria 12624
557 Ga0307415_100001833 3300032126 Bacteria 10420
558 Ga0307415_100063635 3300032126 Bacteria 2564
559 Ga0307415_100071511 3300032126 Bacteria 2440
560 Ga0307415_100080785 3300032126 Bacteria 2320
561 Ga0307415_100090179 3300032126 Bacteria 2216
562 Ga0395899_0000104 3300037312 Bacteria 147238
563 Ga0395899_0003872 3300037312 Bacteria 11801
564 Ga0395899_0009208 3300037312 Bacteria 7583
565 Ga0395899_0011636 3300037312 Bacteria 6733
566 Ga0395899_0015166 3300037312 Bacteria 5876
567 Ga0395899_0066499 3300037312 Bacteria 2646
568 Ga0395899_0190083 3300037312 Bacteria 1437
569 Ga0395899_0313538 3300037312 Bacteria 1058
570 Ga0395900_0000161 3300037418 Bacteria 110637
571 Ga0395900_0001038 3300037418 Bacteria 35617
572 Ga0395900_0001248 3300037418 Bacteria 31162
573 Ga0395900_0013853 3300037418 Bacteria 8228
574 Ga0395900_0022634 3300037418 Bacteria 6431
575 Ga0395900_0068126 3300037418 Bacteria 3656
576 Ga0395900_0096949 3300037418 Bacteria 3030
577 Ga0395900_0139855 3300037418 Bacteria 2479
578 Ga0395900_0147014 3300037418 Bacteria 2409
579 Ga0395900_0193386 3300037418 Bacteria 2062
580 Ga0395900_0200855 3300037418 Bacteria 2017
581 Ga0395900_0210654 3300037418 Bacteria 1962
582 Ga0395900_0255724 3300037418 Bacteria 1751
583 Ga0395900_0264765 3300037418 Bacteria 1715
584 Ga0395898_0000169 3300037466 Bacteria 168667
585 Ga0395898_0007591 3300037466 Bacteria 11514
586 Ga0395898_0029795 3300037466 Bacteria 5463
587 Ga0395898_0094455 3300037466 Bacteria 2874
588 Ga0395898_0150802 3300037466 Bacteria 2224
589 Ga0395898_0242340 3300037466 Bacteria 1719
590 Ga0395898_0255748 3300037466 Bacteria 1670
591 Ga0395898_0503914 3300037466 Bacteria 1151
592 Ga0395905_0000120 3300037471 Bacteria 130865
593 Ga0395905_0001314 3300037471 Bacteria 30557
594 Ga0395905_0015328 3300037471 Bacteria 7286
595 Ga0395905_0019193 3300037471 Bacteria 6483
596 Ga0395905_0024751 3300037471 Bacteria 5665
597 Ga0395905_0026087 3300037471 Bacteria 5511
598 Ga0395905_0039515 3300037471 Bacteria 4426
599 Ga0395905_0044024 3300037471 Bacteria 4188
600 Ga0395905_0060276 3300037471 Bacteria 3548
601 Ga0395905_0070774 3300037471 Bacteria 3269
602 Ga0395905_0113705 3300037471 Bacteria 2543
603 Ga0395905_0118657 3300037471 Bacteria 2486
604 Ga0395905_0125983 3300037471 Bacteria 2408
605 Ga0395905_0132690 3300037471 Bacteria 2342
606 Ga0395905_0143455 3300037471 Bacteria 2247
607 Ga0395905_0167013 3300037471 Bacteria 2068
608 Ga0395905_0178822 3300037471 Bacteria 1991
609 Ga0395905_0219690 3300037471 Bacteria 1778
610 Ga0395905_0276842 3300037471 Bacteria 1564
611 Ga0395905_0322417 3300037471 Bacteria 1435
612 Ga0395905_0332156 3300037471 Bacteria 1411
613 Ga0436364_0626569 3300037853 Bacteria 1589
614 Ga0395901_0000320 3300038443 Bacteria 59479
615 Ga0395901_0000871 3300038443 Bacteria 33284
616 Ga0395901_0006810 3300038443 Bacteria 11540
617 Ga0395901_0031516 3300038443 Bacteria 5467
618 Ga0395901_0050604 3300038443 Bacteria 4315
619 Ga0395901_0086403 3300038443 Bacteria 3279
620 Ga0395901_0107861 3300038443 Bacteria 2923
621 Ga0395901_0173954 3300038443 Bacteria 2258
622 Ga0395901_0180190 3300038443 Bacteria 2216
623 Ga0395901_0225122 3300038443 Bacteria 1959
624 Ga0395901_0253464 3300038443 Bacteria 1833
625 Ga0395901_0283507 3300038443 Bacteria 1721
626 Ga0395901_0395642 3300038443 Bacteria 1420
627 Ga0395901_0544412 3300038443 Bacteria 1177
628 Ga0395901_0555956 3300038443 Bacteria 1162
629 Ga0436365_0847903 3300039437 Bacteria 26153
630 Ga0439432_015987 3300042006 Bacteria 2528
631 Ga0439449_0028306 3300042007 Bacteria 2089
632 Ga0450914_001039 3300042118 Bacteria 1604
633 Ga0450905_004445 3300042142 Bacteria 1860
634 Ga0439458_0001420 3300042157 Bacteria 6046
635 Ga0439458_0001624 3300042157 Bacteria 5610
636 Ga0439464_0000927 3300042439 Bacteria 6585
637 Ga0466966_0021772 3300044684 Bacteria 4209
638 Ga0466964_0006782 3300044706 Bacteria 4269
639 Ga0466964_0017792 3300044706 Bacteria 2723
640 Ga0466970_0015353 3300044765 Bacteria 3937
641 Ga0466970_0067493 3300044765 Bacteria 1921
642 Ga0466970_0120299 3300044765 Bacteria 1438
643 Ga0466957_0094270 3300044842 Bacteria 1879
644 Ga0466959_0136966 3300045049 Bacteria 1732
645 Ga0466958_0011072 3300045836 Bacteria 5072
646 Ga0466967_0004308 3300045976 Bacteria 9568
647 Ga0466967_0017051 3300045976 Bacteria 5750
648 Ga0466967_0017534 3300045976 Bacteria 5689
649 Ga0466967_0060491 3300045976 Bacteria 3356
650 Ga0466967_0072379 3300045976 Bacteria 3089
651 Ga0466967_0097590 3300045976 Bacteria 2682
652 Ga0466967_0162406 3300045976 Bacteria 2098
653 Ga0466967_0177635 3300045976 Bacteria 2006
654 Ga0466967_0318435 3300045976 Bacteria 1499
655 Ga0495585_0056772 3300046492 Bacteria 2162
656 Ga0495596_0000153 3300046500 Bacteria 47822
657 Ga0495607_0065512 3300046501 Bacteria 2048
658 Ga0495606_0051920 3300046507 Bacteria 2671
659 Ga0495606_0105059 3300046507 Bacteria 1712
660 Ga0495631_0040508 3300046518 Bacteria 2064
661 Ga0495632_0016289 3300046519 Bacteria 4141
662 Ga0495643_0001635 3300046522 Bacteria 19778
663 Ga0495643_0005120 3300046522 Bacteria 8965
664 Ga0495663_0003048 3300046525 Bacteria 4906
665 Ga0495663_0008381 3300046525 Bacteria 2863
666 Ga0495663_0010796 3300046525 Bacteria 2541
667 Ga0495642_0035396 3300046528 Bacteria 2015
668 Ga0495598_0010789 3300046537 Bacteria 2198
669 Ga0495598_0023122 3300046537 Bacteria 1670
670 Ga0495609_0011353 3300046538 Bacteria 4243
671 Ga0495621_0000192 3300046539 Bacteria 14020
672 Ga0495621_0000663 3300046539 Bacteria 8695
673 Ga0495621_0101858 3300046539 Bacteria 1093
674 Ga0495633_0002129 3300046558 Bacteria 14182
675 Ga0495633_0062473 3300046558 Bacteria 1744
676 Ga0495633_0128959 3300046558 Bacteria 1170
677 Ga0495668_0120119 3300046616 Bacteria 1438
678 Ga0495625_0073487 3300046660 Bacteria 2396
679 Ga0495669_0001958 3300046684 Bacteria 8461
680 Ga0495669_0003544 3300046684 Bacteria 6434
681 Ga0495669_0007414 3300046684 Bacteria 4600
682 Ga0495669_0039318 3300046684 Bacteria 2095
683 Ga0495670_0005167 3300046691 Bacteria 6422
684 Ga0495670_0013909 3300046691 Bacteria 3958
685 Ga0495670_0029295 3300046691 Bacteria 2732
686 Ga0495671_0015649 3300046692 Bacteria 4059
687 Ga0495677_0026219 3300047445 Bacteria 2114
688 Ga0495681_0093239 3300047470 Bacteria 1326
689 Ga0495686_0057396 3300047472 Bacteria 2430
690 Ga0496101_0209230 3300048904 Bacteria 1511
691 Ga0496102_0011038 3300048905 Bacteria 7782
692 Ga0496103_0010207 3300048906 Bacteria 5553
693 Ga0496106_0004765 3300048909 Bacteria 10027
694 Ga0496106_0024921 3300048909 Bacteria 4448
695 Ga0496107_0006715 3300048910 Bacteria 7924
696 Ga0496107_0012294 3300048910 Bacteria 5975
697 Ga0496108_0003438 3300048911 Bacteria 12700
698 Ga0496108_0007935 3300048911 Bacteria 8605
699 Ga0496108_0022404 3300048911 Bacteria 5192
700 Ga0496108_0027121 3300048911 Bacteria 4726
701 Ga0496108_0100930 3300048911 Bacteria 2461
702 Ga0496108_0123132 3300048911 Bacteria 2225
703 Ga0496109_0002316 3300048912 Bacteria 15857
704 Ga0496109_0008851 3300048912 Bacteria 8569
705 Ga0496109_0023985 3300048912 Bacteria 5418
706 Ga0496109_0080284 3300048912 Bacteria 3005
707 Ga0496109_0124808 3300048912 Bacteria 2400
708 Ga0496109_0183990 3300048912 Bacteria 1963
709 Ga0496110_0001496 3300048913 Bacteria 16949
710 Ga0496110_0005189 3300048913 Bacteria 10191
711 Ga0496110_0069045 3300048913 Bacteria 3128
712 Ga0496111_0005686 3300048914 Bacteria 8033
713 Ga0496111_0007916 3300048914 Bacteria 7008
714 Ga0496111_0021949 3300048914 Bacteria 4464
715 Ga0496111_0025091 3300048914 Bacteria 4204
716 Ga0496111_0059432 3300048914 Bacteria 2770
717 Ga0496111_0102293 3300048914 Bacteria 2106
718 Ga0496112_0000496 3300048915 Bacteria 26529
719 Ga0496112_0001188 3300048915 Bacteria 19512
720 Ga0496112_0003660 3300048915 Bacteria 12811
721 Ga0496112_0141378 3300048915 Bacteria 2376
722 Ga0496112_0144153 3300048915 Bacteria 2350
723 Ga0496113_0001410 3300048916 Bacteria 13353
724 Ga0496113_0001623 3300048916 Bacteria 12663
725 Ga0496113_0005242 3300048916 Bacteria 8070
726 Ga0496113_0030802 3300048916 Bacteria 3887
727 Ga0496113_0036727 3300048916 Bacteria 3591
728 Ga0496113_0194319 3300048916 Bacteria 1611
729 Ga0496114_0270552 3300048917 Bacteria 1497
730 Ga0496115_0000861 3300048918 Bacteria 22039
731 Ga0501033_0088617 3300049570 Bacteria 2264
732 Ga0501037_0340781 3300049573 Bacteria 1035
733 Ga0501046_0022914 3300049580 Bacteria 5142
734 Ga0501047_0163863 3300049581 Bacteria 2094
735 Ga0501069_0126214 3300049585 Bacteria 1463
736 Ga0501074_0051129 3300049590 Bacteria 2983
737 Ga0501207_005482 3300049654 Bacteria 1759
738 Ga0501080_0007641 3300049742 Bacteria 9777
739 Ga0501080_0365367 3300049742 Bacteria 1302
740 Ga0501044_0014519 3300049823 Bacteria 8496
741 nmdc:mga08y16_52698_c1 3300050511 Bacteria 4256
742 Ga0500643_000003 3300053087 Bacteria 876659
743 Ga0500607_000070 3300053121 Bacteria 73162
744 Ga0500658_0000022 3300053134 Bacteria 129341
745 Ga0466962_0036720 3300061719 Bacteria 2346
746 Ga0500595_005096
747 JGI24752J21851_1005017
748 JGI24735J21928_10003572
749 JGI24749J21850_1002049
750 JGI25165J46597_1000003
751 Ga0065715_10097189
752 Ga0065715_10136892
753 Ga0070658_10016856
754 Ga0070658_10022615
755 Ga0070658_10100510
756 Ga0070658_10191051
757 Ga0070676_10003354
758 Ga0070676_10051880
759 Ga0070676_10088159
760 Ga0070676_10169202
761 Ga0070683_100003711
762 Ga0070683_100093785
763 Ga0070690_100141185
764 Ga0070670_100000492
765 Ga0070670_100001441
766 Ga0070670_100003018
767 Ga0070670_100004806
768 Ga0070670_100008814
769 Ga0070670_100015950
770 Ga0070670_100018218
771 Ga0070670_100061783
772 Ga0070670_100067648
773 Ga0070670_100248627
774 Ga0070670_100280139
775 Ga0070670_100373470
776 Ga0070677_10032419
777 Ga0068869_100031002
778 Ga0070666_10007440
779 Ga0070680_100005269
780 Ga0070680_100005833
781 Ga0070680_100094855
782 Ga0070680_100098552
783 Ga0070682_100148835
784 Ga0068868_100029593
785 Ga0068868_100049524
786 Ga0070660_100006181
787 Ga0070660_100008394
788 Ga0070660_100010501
789 Ga0070660_100011805
790 Ga0070660_100014928
791 Ga0070660_100033757
792 Ga0070660_100042663
793 Ga0070660_100048836
794 Ga0070660_100064193
795 Ga0070660_100215100
796 Ga0070687_100036271
797 Ga0070687_100125592
798 Ga0070661_100008300
799 Ga0070661_100017390
800 Ga0070661_100038082
801 Ga0070661_100039984
802 Ga0070661_100043821
803 Ga0070661_100060418
804 Ga0070692_10007468
805 Ga0070692_10214759
806 Ga0070668_100017784
807 Ga0070668_100027237
808 Ga0070668_100077807
809 Ga0070668_100131743
810 Ga0070669_100002850
811 Ga0070669_100011147
812 Ga0070669_100027526
813 Ga0070669_100139843
814 Ga0070675_100003002
815 Ga0070675_100007649
816 Ga0070675_100039637
817 Ga0070675_100114388
818 Ga0070675_100181979
819 Ga0070675_100193926
820 Ga0070671_100000181
821 Ga0070671_100000297
822 Ga0070671_100000902
823 Ga0070671_100054394
824 Ga0070671_100064858
825 Ga0070674_100001493
826 Ga0070674_100087324
827 Ga0070674_100111099
828 Ga0070673_100000935
829 Ga0070673_100005228
830 Ga0070673_100041936
831 Ga0070673_100044801
832 Ga0070673_100122945
833 Ga0070673_100132705
834 Ga0070659_100002134
835 Ga0070659_100012977
836 Ga0070659_100027376
837 Ga0070659_100054189
838 Ga0070659_100111132
839 Ga0070659_100149308
840 Ga0070659_100237875
841 Ga0070659_100411527
842 Ga0070667_100008263
843 Ga0070667_100022812
844 Ga0070667_100040708
845 Ga0070667_100084786
846 Ga0070667_100132638
847 Ga0070667_100163850
848 Ga0070667_100228790
849 Ga0070711_100093065
850 Ga0070700_100010959
851 Ga0070663_100017365
852 Ga0070663_100042837
853 Ga0070663_100104731
854 Ga0070663_100231658
855 Ga0070678_100006855
856 Ga0070678_100042299
857 Ga0070678_100045738
858 Ga0070662_100003042
859 Ga0070662_100010133
860 Ga0070662_100050582
861 Ga0070662_100076846
862 Ga0070662_100263715
863 Ga0070662_100271293
864 Ga0070681_10001736
865 Ga0068867_100026126
866 Ga0070679_100000015
867 Ga0070679_100024387
868 Ga0070679_100178801
869 Ga0070679_100233839
870 Ga0070684_100063717
871 Ga0068853_100002489
872 Ga0068853_100012864
873 Ga0068853_100026067
874 Ga0068853_100084898
875 Ga0070672_100003714
876 Ga0070672_100005390
877 Ga0070672_100021579
878 Ga0070672_100041239
879 Ga0070672_100152963
880 Ga0070672_100173703
881 Ga0070686_100000071
882 Ga0070696_100017998
883 Ga0070693_100039893
884 Ga0070665_100010035
885 Ga0070665_100016040
886 Ga0070665_100016219
887 Ga0070665_100017435
888 Ga0070665_100072655
889 Ga0070665_100074143
890 Ga0068855_100217188
891 Ga0070664_100002222
892 Ga0070664_100006300
893 Ga0070664_100006564
894 Ga0070664_100010543
895 Ga0070664_100013349
896 Ga0070664_100014996
897 Ga0070664_100016559
898 Ga0070664_100019981
899 Ga0070664_100053082
900 Ga0070664_100061836
901 Ga0070664_100141764
902 Ga0070664_100198244
903 Ga0068857_100002619
904 Ga0068857_100007876
905 Ga0068857_100011483
906 Ga0068857_100046457
907 Ga0068857_100078735
908 Ga0068854_100006270
909 Ga0068854_100114392
910 Ga0068854_100123924
911 Ga0068854_100157636
912 Ga0068854_100199548
913 Ga0068856_100004809
914 Ga0068856_100032950
915 Ga0068856_100034066
916 Ga0068852_100039270
917 Ga0068852_100515140
918 Ga0068859_100094552
919 Ga0068859_100119710
920 Ga0068859_100189877
921 Ga0068864_100001662
922 Ga0068864_100002927
923 Ga0068864_100012904
924 Ga0068864_100019553
925 Ga0068864_100021800
926 Ga0068864_100073737
927 Ga0068851_10022723
928 Ga0068851_10046464
929 Ga0068851_10082591
930 Ga0068870_10031704
931 Ga0068863_100001851
932 Ga0068863_100002605
933 Ga0068863_100036458
934 Ga0068863_100147662
935 Ga0068858_100016987
936 Ga0068858_100027637
937 Ga0068858_100031168
938 Ga0068858_100041100
939 Ga0068858_100266317
940 Ga0068860_100022293
941 Ga0068860_100033752
942 Ga0068860_100073738
943 Ga0068860_100314889
944 Ga0068862_100003421
945 Ga0068862_100005226
946 Ga0068862_100041895
947 Ga0068862_100057256
948 Ga0068862_100083152
949 Ga0068862_100097021
950 Ga0097621_100035652
951 Ga0097621_100087513
952 Ga0097621_100234817
953 Ga0097621_100315734
954 Ga0068871_100008815
955 Ga0068871_100095367
956 Ga0068865_100087552
957 Ga0097620_100094544
958 Ga0097620_100119710
959 Ga0097620_100189867
960 Ga0105240_10001968
961 Ga0105240_10033304
962 Ga0111539_10035865
963 Ga0105245_10021033
964 Ga0105245_10145445
965 Ga0114129_10335570
966 Ga0105243_10038514
967 Ga0105248_10000902
968 Ga0105248_10004414
969 Ga0105248_10006626
970 Ga0105248_10014641
971 Ga0105248_10068853
972 Ga0105248_10077899
973 Ga0105248_10218026
974 Ga0105248_10305875
975 Ga0105248_10331935
976 Ga0105248_10462864
977 Ga0105237_10018465
978 Ga0105237_10046349
979 Ga0105238_10003920
980 Ga0105249_10021992
981 Ga0105249_10063823
982 Ga0105239_10132875
983 Ga0157373_10016588
984 Ga0157373_10017136
985 Ga0157373_10076889
986 Ga0157373_10203947
987 Ga0157373_10250144
988 Ga0157371_10023484
989 Ga0157371_10079550
990 Ga0157371_10134240
991 Ga0157371_10239556
992 Ga0157370_10011741
993 Ga0157370_10039248
994 Ga0157370_10194600
995 Ga0157370_10307775
996 Ga0157369_10026931
997 Ga0157369_10197570
998 Ga0157374_10014254
999 Ga0157374_10088484
1000 Ga0163162_10009924
1001 Ga0163162_10263961
1002 Ga0157372_10002914
1003 Ga0157375_10005814
1004 Ga0157375_10010645
1005 Ga0157375_10261948
1006 Ga0157375_10431672
1007 Ga0163163_10000002
1008 Ga0163163_10228465
1009 Ga0157380_10013536
1010 Ga0157380_10025147
1011 Ga0157380_10166443
1012 Ga0157380_10596787
1013 Ga0157379_10001600
1014 Ga0157379_10009530
1015 Ga0157379_10112648
1016 Ga0157379_10303207
1017 Ga0213876_10004091
1018 Ga0209233_1000015
1019 Ga0207697_10010020
1020 Ga0207656_10015666
1021 Ga0207682_10001520
1022 Ga0207682_10003937
1023 Ga0207688_10034766
1024 Ga0207680_10064542
1025 Ga0207680_10092888
1026 Ga0207680_10191858
1027 Ga0207647_10001881
1028 Ga0207647_10024517
1029 Ga0207645_10022483
1030 Ga0207643_10077695
1031 Ga0207643_10111317
1032 Ga0207705_10002417
1033 Ga0207705_10003358
1034 Ga0207705_10030897
1035 Ga0207705_10065011
1036 Ga0207705_10070256
1037 Ga0207705_10140425
1038 Ga0207705_10169313
1039 Ga0207705_10259215
1040 Ga0207705_10320336
1041 Ga0207707_10008312
1042 Ga0207707_10015550
1043 Ga0207707_10104293
1044 Ga0207695_10030606
1045 Ga0207671_10011380
1046 Ga0207693_10130803
1047 Ga0207663_10060911
1048 Ga0207660_10002614
1049 Ga0207660_10025847
1050 Ga0207662_10069621
1051 Ga0207662_10071539
1052 Ga0207657_10000120
1053 Ga0207657_10000659
1054 Ga0207657_10007080
1055 Ga0207657_10012143
1056 Ga0207657_10013429
1057 Ga0207657_10014699
1058 Ga0207657_10026690
1059 Ga0207657_10046503
1060 Ga0207657_10105684
1061 Ga0207657_10159913
1062 Ga0207657_10185241
1063 Ga0207649_10029750
1064 Ga0207649_10032237
1065 Ga0207649_10041568
1066 Ga0207649_10042927
1067 Ga0207649_10094062
1068 Ga0207652_10000021
1069 Ga0207652_10009225
1070 Ga0207652_10017682
1071 Ga0207681_10002597
1072 Ga0207681_10033612
1073 Ga0207681_10107485
1074 Ga0207681_10335094
1075 Ga0207694_10001166
1076 Ga0207650_10004169
1077 Ga0207650_10006715
1078 Ga0207650_10018164
1079 Ga0207650_10020146
1080 Ga0207650_10026256
1081 Ga0207650_10030630
1082 Ga0207650_10057328
1083 Ga0207650_10060040
1084 Ga0207650_10063415
1085 Ga0207650_10067642
1086 Ga0207659_10003938
1087 Ga0207659_10041804
1088 Ga0207659_10055732
1089 Ga0207659_10157401
1090 Ga0207687_10053714
1091 Ga0207644_10000090
1092 Ga0207644_10001642
1093 Ga0207644_10001927
1094 Ga0207644_10009103
1095 Ga0207644_10026827
1096 Ga0207644_10086214
1097 Ga0207644_10092410
1098 Ga0207644_10253938
1099 Ga0207690_10008704
1100 Ga0207690_10030405
1101 Ga0207690_10042850
1102 Ga0207690_10043636
1103 Ga0207690_10064051
1104 Ga0207690_10092132
1105 Ga0207706_10012383
1106 Ga0207706_10014167
1107 Ga0207706_10021434
1108 Ga0207706_10023938
1109 Ga0207706_10024546
1110 Ga0207706_10033564
1111 Ga0207706_10088454
1112 Ga0207706_10229923
1113 Ga0207706_10267079
1114 Ga0207706_10458186
1115 Ga0207669_10006130
1116 Ga0207669_10018415
1117 Ga0207669_10023998
1118 Ga0207669_10040073
1119 Ga0207669_10305283
1120 Ga0207704_10147621
1121 Ga0207691_10003700
1122 Ga0207691_10013017
1123 Ga0207691_10020354
1124 Ga0207691_10033170
1125 Ga0207691_10035503
1126 Ga0207691_10149869
1127 Ga0207711_10000536
1128 Ga0207711_10003022
1129 Ga0207711_10008750
1130 Ga0207711_10022701
1131 Ga0207711_10031797
1132 Ga0207711_10032201
1133 Ga0207711_10291782
1134 Ga0207689_10024248
1135 Ga0207679_10004960
1136 Ga0207679_10020187
1137 Ga0207679_10061196
1138 Ga0207679_10068956
1139 Ga0207679_10121281
1140 Ga0207667_10153490
1141 Ga0207651_10001959
1142 Ga0207651_10021431
1143 Ga0207651_10040275
1144 Ga0207651_10051235
1145 Ga0207651_10098161
1146 Ga0207651_10106318
1147 Ga0207712_10022889
1148 Ga0207668_10002917
1149 Ga0207668_10004273
1150 Ga0207668_10126678
1151 Ga0207640_10114502
1152 Ga0207658_10009236
1153 Ga0207658_10010976
1154 Ga0207658_10024872
1155 Ga0207658_10034164
1156 Ga0207658_10088905
1157 Ga0207658_10158715
1158 Ga0207677_10032223
1159 Ga0207703_10014437
1160 Ga0207703_10201173
1161 Ga0207639_10000202
1162 Ga0207639_10071984
1163 Ga0207678_10008745
1164 Ga0207678_10010180
1165 Ga0207678_10020716
1166 Ga0207678_10023372
1167 Ga0207678_10024043
1168 Ga0207678_10057791
1169 Ga0207678_10069889
1170 Ga0207708_10110966
1171 Ga0207702_10039486
1172 Ga0207702_10058768
1173 Ga0207702_10264870
1174 Ga0207641_10003439
1175 Ga0207641_10007699
1176 Ga0207641_10023313
1177 Ga0207641_10023524
1178 Ga0207641_10054524
1179 Ga0207648_10028391
1180 Ga0207676_10002566
1181 Ga0207676_10013278
1182 Ga0207676_10018287
1183 Ga0207676_10018697
1184 Ga0207676_10031485
1185 Ga0207674_10000185
1186 Ga0207674_10003237
1187 Ga0207674_10003866
1188 Ga0207674_10039850
1189 Ga0207674_10049087
1190 Ga0207674_10071276
1191 Ga0207675_100146303
1192 Ga0207683_10004810
1193 Ga0207683_10010082
1194 Ga0207683_10028553
1195 Ga0207683_10051290
1196 Ga0207683_10068670
1197 Ga0207698_10003325
1198 Ga0207698_10014308
1199 Ga0207698_10040136
1200 Ga0209983_1006663
1201 Ga0268266_10021922
1202 Ga0268266_10034303
1203 Ga0268266_10387457
1204 Ga0268265_10005941
1205 Ga0268265_10012684
1206 Ga0268265_10047879
1207 Ga0268265_10050209
1208 Ga0268265_10061651
1209 Ga0268265_10070015
1210 Ga0268264_10004725
1211 Ga0268264_10055491
1212 Ga0268264_10057815
1213 Ga0268264_10067945
1214 Ga0307408_100014016
1215 Ga0307408_100023179
1216 Ga0307408_100030763
1217 Ga0307408_100034283
1218 Ga0307408_100039031
1219 Ga0307408_100273242
1220 Ga0307516_10110537
1221 Ga0307405_10047342
1222 Ga0307405_10049397
1223 Ga0307405_10054109
1224 Ga0307405_10078700
1225 Ga0307405_10117359
1226 Ga0307405_10140585
1227 Ga0307405_10150959
1228 Ga0307413_10014599
1229 Ga0307413_10017847
1230 Ga0307413_10045951
1231 Ga0307413_10056796
1232 Ga0307413_10096558
1233 Ga0307413_10215121
1234 Ga0307413_10225340
1235 Ga0307410_10000689
1236 Ga0307410_10004405
1237 Ga0307410_10013300
1238 Ga0307410_10033534
1239 Ga0307410_10040469
1240 Ga0307410_10043331
1241 Ga0307410_10069160
1242 Ga0307410_10170946
1243 Ga0307410_10433857
1244 Ga0307406_10039140
1245 Ga0307406_10074544
1246 Ga0307406_10097673
1247 Ga0307406_10185158
1248 Ga0307406_10200896
1249 Ga0307406_10269763
1250 Ga0307407_10002048
1251 Ga0307407_10008632
1252 Ga0307407_10009464
1253 Ga0307407_10229985
1254 Ga0307412_10018735
1255 Ga0307412_10046922
1256 Ga0307412_10061051
1257 Ga0307412_10082714
1258 Ga0307412_10131286
1259 Ga0307412_10246250
1260 Ga0307409_100010048
1261 Ga0307409_100017000
1262 Ga0307409_100029260
1263 Ga0307409_100035853
1264 Ga0307409_100061743
1265 Ga0307409_100064859
1266 Ga0307409_100115106
1267 Ga0307409_100117275
1268 Ga0307409_100140100
1269 Ga0307409_100155524
1270 Ga0307409_100274937
1271 Ga0307409_100284439
1272 Ga0307409_100286324
1273 Ga0307409_100460553
1274 Ga0307416_100001237
1275 Ga0307416_100061679
1276 Ga0307416_100124632
1277 Ga0307416_100133998
1278 Ga0307416_100137187
1279 Ga0307416_100344196
1280 Ga0307414_10001648
1281 Ga0307414_10006304
1282 Ga0307414_10081431
1283 Ga0307414_10100615
1284 Ga0307414_10101591
1285 Ga0307414_10122573
1286 Ga0307414_10126778
1287 Ga0307414_10193216
1288 Ga0307414_10224206
1289 Ga0307414_10253255
1290 Ga0307414_10273848
1291 Ga0307411_10001764
1292 Ga0307411_10028886
1293 Ga0307411_10034798
1294 Ga0307411_10039484
1295 Ga0307411_10039558
1296 Ga0307411_10046153
1297 Ga0307411_10063882
1298 Ga0307411_10146909
1299 Ga0307411_10157171
1300 Ga0307411_10301794
1301 Ga0307415_100001088
1302 Ga0307415_100001833
1303 Ga0307415_100063635
1304 Ga0307415_100071511
1305 Ga0307415_100080785
1306 Ga0307415_100090179
1307 Ga0395899_0000104
1308 Ga0395899_0003872
1309 Ga0395899_0009208
1310 Ga0395899_0011636
1311 Ga0395899_0015166
1312 Ga0395899_0066499
1313 Ga0395899_0190083
1314 Ga0395899_0313538
1315 Ga0395900_0000161
1316 Ga0395900_0001038
1317 Ga0395900_0001248
1318 Ga0395900_0013853
1319 Ga0395900_0022634
1320 Ga0395900_0068126
1321 Ga0395900_0096949
1322 Ga0395900_0139855
1323 Ga0395900_0147014
1324 Ga0395900_0193386
1325 Ga0395900_0200855
1326 Ga0395900_0210654
1327 Ga0395900_0255724
1328 Ga0395900_0264765
1329 Ga0395898_0000169
1330 Ga0395898_0007591
1331 Ga0395898_0029795
1332 Ga0395898_0094455
1333 Ga0395898_0150802
1334 Ga0395898_0242340
1335 Ga0395898_0255748
1336 Ga0395898_0503914
1337 Ga0395905_0000120
1338 Ga0395905_0001314
1339 Ga0395905_0015328
1340 Ga0395905_0019193
1341 Ga0395905_0024751
1342 Ga0395905_0026087
1343 Ga0395905_0039515
1344 Ga0395905_0044024
1345 Ga0395905_0060276
1346 Ga0395905_0070774
1347 Ga0395905_0113705
1348 Ga0395905_0118657
1349 Ga0395905_0125983
1350 Ga0395905_0132690
1351 Ga0395905_0143455
1352 Ga0395905_0167013
1353 Ga0395905_0178822
1354 Ga0395905_0219690
1355 Ga0395905_0276842
1356 Ga0395905_0322417
1357 Ga0395905_0332156
1358 Ga0436364_0626569
1359 Ga0395901_0000320
1360 Ga0395901_0000871
1361 Ga0395901_0006810
1362 Ga0395901_0031516
1363 Ga0395901_0050604
1364 Ga0395901_0086403
1365 Ga0395901_0107861
1366 Ga0395901_0173954
1367 Ga0395901_0180190
1368 Ga0395901_0225122
1369 Ga0395901_0253464
1370 Ga0395901_0283507
1371 Ga0395901_0395642
1372 Ga0395901_0544412
1373 Ga0395901_0555956
1374 Ga0436365_0847903
1375 Ga0439432_015987
1376 Ga0439449_0028306
1377 Ga0450914_001039
1378 Ga0450905_004445
1379 Ga0439458_0001420
1380 Ga0439458_0001624
1381 Ga0439464_0000927
1382 Ga0466966_0021772
1383 Ga0466964_0006782
1384 Ga0466964_0017792
1385 Ga0466970_0015353
1386 Ga0466970_0067493
1387 Ga0466970_0120299
1388 Ga0466957_0094270
1389 Ga0466959_0136966
1390 Ga0466958_0011072
1391 Ga0466967_0004308
1392 Ga0466967_0017051
1393 Ga0466967_0017534
1394 Ga0466967_0060491
1395 Ga0466967_0072379
1396 Ga0466967_0097590
1397 Ga0466967_0162406
1398 Ga0466967_0177635
1399 Ga0466967_0318435
1400 Ga0495585_0056772
1401 Ga0495596_0000153
1402 Ga0495607_0065512
1403 Ga0495606_0051920
1404 Ga0495606_0105059
1405 Ga0495631_0040508
1406 Ga0495632_0016289
1407 Ga0495643_0001635
1408 Ga0495643_0005120
1409 Ga0495663_0003048
1410 Ga0495663_0008381
1411 Ga0495663_0010796
1412 Ga0495642_0035396
1413 Ga0495598_0010789
1414 Ga0495598_0023122
1415 Ga0495609_0011353
1416 Ga0495621_0000192
1417 Ga0495621_0000663
1418 Ga0495621_0101858
1419 Ga0495633_0002129
1420 Ga0495633_0062473
1421 Ga0495633_0128959
1422 Ga0495668_0120119
1423 Ga0495625_0073487
1424 Ga0495669_0001958
1425 Ga0495669_0003544
1426 Ga0495669_0007414
1427 Ga0495669_0039318
1428 Ga0495670_0005167
1429 Ga0495670_0013909
1430 Ga0495670_0029295
1431 Ga0495671_0015649
1432 Ga0495677_0026219
1433 Ga0495681_0093239
1434 Ga0495686_0057396
1435 Ga0496101_0209230
1436 Ga0496102_0011038
1437 Ga0496103_0010207
1438 Ga0496106_0004765
1439 Ga0496106_0024921
1440 Ga0496107_0006715
1441 Ga0496107_0012294
1442 Ga0496108_0003438
1443 Ga0496108_0007935
1444 Ga0496108_0022404
1445 Ga0496108_0027121
1446 Ga0496108_0100930
1447 Ga0496108_0123132
1448 Ga0496109_0002316
1449 Ga0496109_0008851
1450 Ga0496109_0023985
1451 Ga0496109_0080284
1452 Ga0496109_0124808
1453 Ga0496109_0183990
1454 Ga0496110_0001496
1455 Ga0496110_0005189
1456 Ga0496110_0069045
1457 Ga0496111_0005686
1458 Ga0496111_0007916
1459 Ga0496111_0021949
1460 Ga0496111_0025091
1461 Ga0496111_0059432
1462 Ga0496111_0102293
1463 Ga0496112_0000496
1464 Ga0496112_0001188
1465 Ga0496112_0003660
1466 Ga0496112_0141378
1467 Ga0496112_0144153
1468 Ga0496113_0001410
1469 Ga0496113_0001623
1470 Ga0496113_0005242
1471 Ga0496113_0030802
1472 Ga0496113_0036727
1473 Ga0496113_0194319
1474 Ga0496114_0270552
1475 Ga0496115_0000861
1476 Ga0501033_0088617
1477 Ga0501037_0340781
1478 Ga0501046_0022914
1479 Ga0501047_0163863
1480 Ga0501069_0126214
1481 Ga0501074_0051129
1482 Ga0501207_005482
1483 Ga0501080_0007641
1484 Ga0501080_0365367
1485 Ga0501044_0014519
1486 nmdc:mga08y16_52698_c1
1487 Ga0500643_000003
1488 Ga0500607_000070
1489 Ga0500658_0000022
1490 Ga0466962_0036720

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03320

FBPase_glpX

Bacterial fructose-1,6-bisphosphatase, glpX-encoded

33

339

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r8t-assembly1.cif.gz_A crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate 0.9631 11 323
3bih-assembly1.cif.gz_A crystal structure of fructose-1,6-bisphosphatase from e.coli glpx 0.9592 12 323
3d1r-assembly1.cif.gz_A structure of e. coli glpx with its substrate fructose 1,6-bisphosphate 0.9584 12 322
7txb-assembly2.cif.gz_A structure of the class ii fructose-1,6-bisphophatase from mycobacterium tuberculosis complexed with substrate f1,6bp 0.9579 18 323
5a5l-assembly1.cif.gz_A structure of dual function fbpase sbpase from thermosynechococcus elongatus 0.956 11 323
ID Description Score Start End Superfamily
2r8tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9502 121 275 3.40.190.90
3rplA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9493 121 275 3.40.190.90
1ni9A01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9455 11 322 3.30.540.10
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9404 121 275 3.40.190.90
af_P9WN21_138_292_3.40.190.90 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9288 121 275 3.40.190.90
ID Description Score Start End GO Terms
AF-A0A328HF78-F1-model_v4 Fructose-1,6-bisphosphatase class 2 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 2) 1.002 276 322 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A378N851-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9969 278 322 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A2V6J3U7-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9964 278 322 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132
AF-A0A2N8EKR2-F1-model_v4 deleted 0.9961 14 90
AF-A0A2V6AHL6-F1-model_v4 fructose-bisphosphatase (EC 3.1.3.11) 0.9961 278 322 GO:0005829
GO:0006071
GO:0006094
GO:0030388
GO:0042132

Map