F478787
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 745 | 464 | 601 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10055382|Ga0081455_100553823 |
| Length | 274 |
| Sequence | MAGATTVGVDMPRDGNFLLQDDLNAKIMEIIGAEPKMTSLSPADAERLKLAFQRCREMDGTLNEQLRAYADAGREIFPAYGEAVDRLVERVNQNGGGESAPRPGEVLPPFMLPDDQGRLVALRSLLPQGPVAVMFFRGHWCPYCRLNVRAVIQAQDRVRAMGAQIVAIMPETQEYTGRFKADSGAPFPVLTDLDNGYALSLNLAIWLGSEIQQLLSYQDMAKFHGNNGWLLPIPAVFVVGRDGVVKARFIDPDFRRRMEIDDLLEALEQASGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 19 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 20 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355199 | |||
| 23 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 32 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 33 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 34 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 35 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 36 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 37 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 38 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 39 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 40 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 41 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 57 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 58 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 59 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 60 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 61 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 62 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 63 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 64 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 65 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 66 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 67 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 68 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 71 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 72 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 73 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 74 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 75 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 76 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 77 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 78 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 79 | 2904699407 | |||
| 80 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 81 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 82 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 83 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 84 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 85 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 86 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 87 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 88 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 89 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 90 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 91 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 92 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 93 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 94 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 95 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 96 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 97 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 98 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 99 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 100 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 101 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 102 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 103 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 104 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 105 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 106 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 107 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 108 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 109 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 110 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 111 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 112 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 113 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 114 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 115 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 116 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 117 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 118 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 119 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 120 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 121 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 122 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 123 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 124 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 125 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 126 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 127 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 128 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 129 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 130 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 131 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 132 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 133 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 134 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 135 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 136 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 137 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 138 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 139 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 140 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 141 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 146 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 152 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 161 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 167 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 169 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 171 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 172 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 173 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 174 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 175 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 176 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 177 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 178 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 179 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 180 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 181 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 182 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 184 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 185 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 186 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 187 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 188 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 191 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 192 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 193 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 194 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 195 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 196 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 197 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 198 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 209 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 218 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 219 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 220 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 221 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 222 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 223 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 228 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 277 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 278 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 281 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 285 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 286 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 287 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 288 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 290 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 291 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 292 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 293 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 294 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 295 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 298 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 299 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 306 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 307 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 308 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 310 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 311 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 316 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 317 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 318 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 319 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 320 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 321 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 322 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 394 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 395 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 396 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 399 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 400 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 401 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 408 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 409 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 410 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 411 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 423 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 427 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 431 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 432 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 435 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 436 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 437 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 438 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 440 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 443 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 445 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 446 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 447 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 451 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 452 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 453 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 454 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 455 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 456 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 457 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 458 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 459 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 460 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 461 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 462 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 463 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 464 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.75 |
| Metatranscriptomes | 0 |
| Isolates | 19.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.47 |
| Nodule | 15.3 |
| Rhizoplane | 4.56 |
| Rhizosphere | 57.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10010714 | 3300001989 | Bacteria | 3399 |
| 2 | JGI24737J22298_10010651 | 3300001990 | Bacteria | 3030 |
| 3 | JGI24750J21931_1003951 | 3300002070 | Bacteria | 1786 |
| 4 | JGI25406J46586_10000021 | 3300003203 | Bacteria | 84514 |
| 5 | JGI25406J46586_10000269 | 3300003203 | Bacteria | 23146 |
| 6 | JGI25153J46596_10001525 | 3300003215 | Bacteria | 13779 |
| 7 | JGI25153J46596_10001551 | 3300003215 | Bacteria | 13650 |
| 8 | JGI25153J46596_10026118 | 3300003215 | Bacteria | 2074 |
| 9 | rootH1_10008730 | 3300003316 | Bacteria | 5409 |
| 10 | rootH1_10008730 | 3300003323 | Bacteria | 8891 |
| 11 | rootH1_10027468 | 3300003323 | Bacteria | 2698 |
| 12 | JGI25404J52841_10001159 | 3300003659 | Bacteria | 4478 |
| 13 | JGI25404J52841_10004692 | 3300003659 | Bacteria | 2787 |
| 14 | JGI25404J52841_10009992 | 3300003659 | Bacteria | 2036 |
| 15 | Ga0055531_10008605 | 3300003794 | Bacteria | 5349 |
| 16 | JGI25405J52794_10010473 | 3300003911 | Bacteria | 1764 |
| 17 | JGI25405J52794_10030572 | 3300003911 | Bacteria | 1117 |
| 18 | Ga0065165_1027919 | 3300005262 | Bacteria | 1831 |
| 19 | Ga0070658_10009981 | 3300005327 | Bacteria | 7627 |
| 20 | Ga0070658_10027153 | 3300005327 | Bacteria | 4596 |
| 21 | Ga0070676_10175575 | 3300005328 | Bacteria | 1389 |
| 22 | Ga0070666_10252952 | 3300005335 | Bacteria | 1248 |
| 23 | Ga0070682_100320941 | 3300005337 | Bacteria | 1144 |
| 24 | Ga0068868_100139564 | 3300005338 | Bacteria | 1989 |
| 25 | Ga0070661_100193985 | 3300005344 | Bacteria | 1550 |
| 26 | Ga0070668_100077671 | 3300005347 | Bacteria | 2595 |
| 27 | Ga0070668_100152240 | 3300005347 | Bacteria | 1871 |
| 28 | Ga0070668_100177116 | 3300005347 | Bacteria | 1740 |
| 29 | Ga0070668_100186368 | 3300005347 | Bacteria | 1697 |
| 30 | Ga0070668_100204400 | 3300005347 | Bacteria | 1622 |
| 31 | Ga0070671_100019458 | 3300005355 | Bacteria | 5526 |
| 32 | Ga0070659_100278573 | 3300005366 | Bacteria | 1391 |
| 33 | Ga0070667_100032145 | 3300005367 | Bacteria | 4376 |
| 34 | Ga0070667_100164618 | 3300005367 | Bacteria | 1955 |
| 35 | Ga0070667_100168955 | 3300005367 | Bacteria | 1930 |
| 36 | Ga0070709_10010400 | 3300005434 | Bacteria | 5154 |
| 37 | Ga0070714_100026833 | 3300005435 | Bacteria | 4763 |
| 38 | Ga0070714_100041215 | 3300005435 | Bacteria | 3895 |
| 39 | Ga0070714_100195010 | 3300005435 | Bacteria | 1850 |
| 40 | Ga0070714_100249135 | 3300005435 | Bacteria | 1642 |
| 41 | Ga0070714_100273461 | 3300005435 | Bacteria | 1567 |
| 42 | Ga0070713_100080662 | 3300005436 | Bacteria | 2775 |
| 43 | Ga0070710_10005542 | 3300005437 | Bacteria | 6006 |
| 44 | Ga0070710_10006619 | 3300005437 | Bacteria | 5571 |
| 45 | Ga0070710_10008953 | 3300005437 | Bacteria | 4889 |
| 46 | Ga0070711_100004924 | 3300005439 | Bacteria | 7928 |
| 47 | Ga0070711_100007381 | 3300005439 | Bacteria | 6687 |
| 48 | Ga0070711_100025201 | 3300005439 | Bacteria | 3888 |
| 49 | Ga0070711_100047340 | 3300005439 | Bacteria | 2935 |
| 50 | Ga0070711_100305415 | 3300005439 | Bacteria | 1266 |
| 51 | Ga0070700_100061796 | 3300005441 | Bacteria | 2364 |
| 52 | Ga0070663_100098063 | 3300005455 | Bacteria | 2183 |
| 53 | Ga0070663_100250325 | 3300005455 | Bacteria | 1402 |
| 54 | Ga0070663_100273948 | 3300005455 | Bacteria | 1343 |
| 55 | Ga0070678_100069834 | 3300005456 | Bacteria | 2624 |
| 56 | Ga0070678_100760885 | 3300005456 | Bacteria | 877 |
| 57 | Ga0070662_100033672 | 3300005457 | Bacteria | 3609 |
| 58 | Ga0070662_100117647 | 3300005457 | Bacteria | 2033 |
| 59 | Ga0070685_10124878 | 3300005466 | Bacteria | 1602 |
| 60 | Ga0070685_10299343 | 3300005466 | Bacteria | 1083 |
| 61 | Ga0070706_100107750 | 3300005467 | Bacteria | 2592 |
| 62 | Ga0070699_100059231 | 3300005518 | Bacteria | 3317 |
| 63 | Ga0070695_100086361 | 3300005545 | Bacteria | 2085 |
| 64 | Ga0070665_100027551 | 3300005548 | Bacteria | 5723 |
| 65 | Ga0070665_100047615 | 3300005548 | Bacteria | 4302 |
| 66 | Ga0070665_100049171 | 3300005548 | Bacteria | 4231 |
| 67 | Ga0070665_100342360 | 3300005548 | Bacteria | 1500 |
| 68 | Ga0070665_100385206 | 3300005548 | Bacteria | 1410 |
| 69 | Ga0070665_100772609 | 3300005548 | Bacteria | 974 |
| 70 | Ga0070704_100277837 | 3300005549 | Bacteria | 1386 |
| 71 | Ga0068855_100077572 | 3300005563 | Bacteria | 3855 |
| 72 | Ga0068855_100094658 | 3300005563 | Bacteria | 3444 |
| 73 | Ga0068855_100098046 | 3300005563 | Bacteria | 3377 |
| 74 | Ga0070664_100303959 | 3300005564 | Bacteria | 1442 |
| 75 | Ga0068856_100064579 | 3300005614 | Bacteria | 3617 |
| 76 | Ga0068856_100259313 | 3300005614 | Bacteria | 1754 |
| 77 | Ga0068856_100298782 | 3300005614 | Bacteria | 1627 |
| 78 | Ga0070702_100260042 | 3300005615 | Bacteria | 1181 |
| 79 | Ga0068852_100031085 | 3300005616 | Bacteria | 4401 |
| 80 | Ga0068852_100387754 | 3300005616 | Bacteria | 1372 |
| 81 | Ga0068864_100100993 | 3300005618 | Bacteria | 2558 |
| 82 | Ga0068864_100244910 | 3300005618 | Bacteria | 1662 |
| 83 | Ga0068861_100170706 | 3300005719 | Bacteria | 1802 |
| 84 | Ga0068861_100177348 | 3300005719 | Bacteria | 1771 |
| 85 | Ga0068851_10049407 | 3300005834 | Bacteria | 2133 |
| 86 | Ga0068851_10087762 | 3300005834 | Bacteria | 1634 |
| 87 | Ga0068870_10040916 | 3300005840 | Bacteria | 2405 |
| 88 | Ga0068858_100049906 | 3300005842 | Bacteria | 3874 |
| 89 | Ga0068858_100346851 | 3300005842 | Bacteria | 1422 |
| 90 | Ga0068860_100009016 | 3300005843 | Bacteria | 9928 |
| 91 | Ga0068860_100170432 | 3300005843 | Bacteria | 2102 |
| 92 | Ga0068860_100317679 | 3300005843 | Bacteria | 1528 |
| 93 | Ga0068860_100413602 | 3300005843 | Bacteria | 1336 |
| 94 | Ga0068862_100042845 | 3300005844 | Bacteria | 3857 |
| 95 | Ga0081455_10001988 | 3300005937 | Bacteria | 24413 |
| 96 | Ga0081455_10005841 | 3300005937 | Bacteria | 13387 |
| 97 | Ga0081455_10038376 | 3300005937 | Bacteria | 4242 |
| 98 | Ga0081455_10055382 | 3300005937 | Bacteria | 3373 |
| 99 | Ga0081455_10058701 | 3300005937 | Bacteria | 3253 |
| 100 | Ga0081455_10079868 | 3300005937 | Bacteria | 2684 |
| 101 | Ga0081455_10097670 | 3300005937 | Bacteria | 2366 |
| 102 | Ga0081538_10030597 | 3300005981 | Bacteria | 3650 |
| 103 | Ga0081540_1003663 | 3300005983 | Bacteria | 12049 |
| 104 | Ga0081540_1003793 | 3300005983 | Bacteria | 11827 |
| 105 | Ga0081540_1004411 | 3300005983 | Bacteria | 10740 |
| 106 | Ga0081540_1005364 | 3300005983 | Bacteria | 9592 |
| 107 | Ga0081540_1008398 | 3300005983 | Bacteria | 7218 |
| 108 | Ga0081540_1008775 | 3300005983 | Bacteria | 7026 |
| 109 | Ga0081540_1009060 | 3300005983 | Bacteria | 6877 |
| 110 | Ga0081540_1035407 | 3300005983 | Bacteria | 2677 |
| 111 | Ga0081540_1053193 | 3300005983 | Bacteria | 1988 |
| 112 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 113 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 114 | Ga0081539_10023291 | 3300005985 | Bacteria | 4062 |
| 115 | Ga0081539_10043452 | 3300005985 | Bacteria | 2605 |
| 116 | Ga0070717_10015891 | 3300006028 | Bacteria | 5824 |
| 117 | Ga0075365_10020288 | 3300006038 | Bacteria | 4118 |
| 118 | Ga0075365_10023353 | 3300006038 | Bacteria | 3889 |
| 119 | Ga0075368_10009838 | 3300006042 | Bacteria | 3447 |
| 120 | Ga0075363_100037179 | 3300006048 | Bacteria | 2556 |
| 121 | Ga0075364_10062504 | 3300006051 | Bacteria | 2443 |
| 122 | Ga0070715_10008826 | 3300006163 | Bacteria | 3528 |
| 123 | Ga0070716_100006238 | 3300006173 | Bacteria | 5817 |
| 124 | Ga0070716_100007573 | 3300006173 | Bacteria | 5355 |
| 125 | Ga0070716_100333820 | 3300006173 | Bacteria | 1067 |
| 126 | Ga0070716_100566287 | 3300006173 | Bacteria | 849 |
| 127 | Ga0070712_100015380 | 3300006175 | Bacteria | 4927 |
| 128 | Ga0070712_100030350 | 3300006175 | Bacteria | 3631 |
| 129 | Ga0070712_100135777 | 3300006175 | Bacteria | 1870 |
| 130 | Ga0075362_10043128 | 3300006177 | Bacteria | 1997 |
| 131 | Ga0075367_10176006 | 3300006178 | Bacteria | 1333 |
| 132 | Ga0075369_10005776 | 3300006186 | Bacteria | 4646 |
| 133 | Ga0075369_10074935 | 3300006186 | Bacteria | 1494 |
| 134 | Ga0075369_10108793 | 3300006186 | Bacteria | 1248 |
| 135 | Ga0075366_10008087 | 3300006195 | Bacteria | 5831 |
| 136 | Ga0075366_10018329 | 3300006195 | Bacteria | 4040 |
| 137 | Ga0075370_10218218 | 3300006353 | Bacteria | 1127 |
| 138 | Ga0068871_100301426 | 3300006358 | Bacteria | 1407 |
| 139 | Ga0068871_100410223 | 3300006358 | Bacteria | 1208 |
| 140 | Ga0075434_100361452 | 3300006871 | Bacteria | 1473 |
| 141 | Ga0099794_10064154 | 3300007265 | Bacteria | 1789 |
| 142 | Ga0099794_10067366 | 3300007265 | Bacteria | 1748 |
| 143 | Ga0105240_10762932 | 3300009093 | Bacteria | 1051 |
| 144 | Ga0105245_10182074 | 3300009098 | Bacteria | 2008 |
| 145 | Ga0105245_10242808 | 3300009098 | Bacteria | 1746 |
| 146 | Ga0105247_10010363 | 3300009101 | Bacteria | 5637 |
| 147 | Ga0105247_10100054 | 3300009101 | Bacteria | 1852 |
| 148 | Ga0114129_10482594 | 3300009147 | Bacteria | 1621 |
| 149 | Ga0105241_10002269 | 3300009174 | Bacteria | 14448 |
| 150 | Ga0105241_10011566 | 3300009174 | Bacteria | 6470 |
| 151 | Ga0105241_10013031 | 3300009174 | Bacteria | 6096 |
| 152 | Ga0105241_10105949 | 3300009174 | Bacteria | 2243 |
| 153 | Ga0105242_10054261 | 3300009176 | Bacteria | 3275 |
| 154 | Ga0105248_10027112 | 3300009177 | Bacteria | 6374 |
| 155 | Ga0105237_10008417 | 3300009545 | Bacteria | 11171 |
| 156 | Ga0105237_10037400 | 3300009545 | Bacteria | 4906 |
| 157 | Ga0105237_10075090 | 3300009545 | Bacteria | 3372 |
| 158 | Ga0105237_10254948 | 3300009545 | Bacteria | 1756 |
| 159 | Ga0105237_10381575 | 3300009545 | Bacteria | 1414 |
| 160 | Ga0105237_10666298 | 3300009545 | Bacteria | 1047 |
| 161 | Ga0105238_10036736 | 3300009551 | Bacteria | 4981 |
| 162 | Ga0105238_10051797 | 3300009551 | Bacteria | 4127 |
| 163 | Ga0105238_10137248 | 3300009551 | Bacteria | 2423 |
| 164 | Ga0105249_10101358 | 3300009553 | Bacteria | 2708 |
| 165 | Ga0099796_10047318 | 3300010159 | Bacteria | 1480 |
| 166 | Ga0105239_10014919 | 3300010375 | Bacteria | 8612 |
| 167 | Ga0105239_10019302 | 3300010375 | Bacteria | 7530 |
| 168 | Ga0105239_10064879 | 3300010375 | Bacteria | 4009 |
| 169 | Ga0105239_10147815 | 3300010375 | Bacteria | 2622 |
| 170 | Ga0105239_10198618 | 3300010375 | Bacteria | 2246 |
| 171 | Ga0105239_10435003 | 3300010375 | Bacteria | 1487 |
| 172 | Ga0105239_10818656 | 3300010375 | Bacteria | 1067 |
| 173 | Ga0105246_10082996 | 3300011119 | Bacteria | 2289 |
| 174 | Ga0157378_10136629 | 3300013297 | Bacteria | 2273 |
| 175 | Ga0163162_10018772 | 3300013306 | Bacteria | 6779 |
| 176 | Ga0163163_10081060 | 3300014325 | Bacteria | 3246 |
| 177 | Ga0163163_10083737 | 3300014325 | Bacteria | 3195 |
| 178 | Ga0157379_10204363 | 3300014968 | Bacteria | 1787 |
| 179 | Ga0157376_10156878 | 3300014969 | Bacteria | 2059 |
| 180 | Ga0163161_10284564 | 3300017792 | Bacteria | 1298 |
| 181 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 182 | Ga0214544_1026128 | 3300021320 | Bacteria | 2653 |
| 183 | Ga0214544_1030469 | 3300021320 | Bacteria | 1871 |
| 184 | Ga0214542_1000606 | 3300021321 | Bacteria | 66272 |
| 185 | Ga0214542_1026466 | 3300021321 | Bacteria | 2827 |
| 186 | Ga0214542_1027213 | 3300021321 | Bacteria | 2654 |
| 187 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 188 | Ga0214545_1028772 | 3300021324 | Bacteria | 2609 |
| 189 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 190 | Ga0214543_1028523 | 3300021327 | Bacteria | 2635 |
| 191 | Ga0213874_10074800 | 3300021377 | Bacteria | 1087 |
| 192 | Ga0213876_10002812 | 3300021384 | Bacteria | 10133 |
| 193 | Ga0209677_100746 | 3300025253 | Bacteria | 16488 |
| 194 | Ga0209677_111349 | 3300025253 | Bacteria | 1398 |
| 195 | Ga0209148_1001164 | 3300025254 | Bacteria | 15296 |
| 196 | Ga0209233_1010791 | 3300025261 | Bacteria | 2716 |
| 197 | Ga0209233_1016079 | 3300025261 | Bacteria | 2069 |
| 198 | Ga0209455_1002542 | 3300025272 | Bacteria | 6978 |
| 199 | Ga0209673_1020110 | 3300025273 | Bacteria | 2373 |
| 200 | Ga0209564_1019870 | 3300025295 | Bacteria | 2488 |
| 201 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 202 | Ga0209758_1000477 | 3300025297 | Bacteria | 66111 |
| 203 | Ga0209758_1002906 | 3300025297 | Bacteria | 16534 |
| 204 | Ga0209758_1004503 | 3300025297 | Bacteria | 11559 |
| 205 | Ga0209758_1005549 | 3300025297 | Bacteria | 9621 |
| 206 | Ga0209758_1015752 | 3300025297 | Bacteria | 3891 |
| 207 | Ga0209758_1016465 | 3300025297 | Bacteria | 3753 |
| 208 | Ga0209758_1072036 | 3300025297 | Bacteria | 1083 |
| 209 | Ga0207426_1000519 | 3300025302 | Bacteria | 56155 |
| 210 | Ga0207426_1002865 | 3300025302 | Bacteria | 10232 |
| 211 | Ga0207426_1034266 | 3300025302 | Bacteria | 1630 |
| 212 | Ga0209257_1012821 | 3300025304 | Bacteria | 3812 |
| 213 | Ga0209257_1055464 | 3300025304 | Bacteria | 1098 |
| 214 | Ga0207656_10005611 | 3300025321 | Bacteria | 4451 |
| 215 | Ga0207692_10000456 | 3300025898 | Bacteria | 14471 |
| 216 | Ga0207692_10074916 | 3300025898 | Bacteria | 1794 |
| 217 | Ga0207710_10040065 | 3300025900 | Bacteria | 2075 |
| 218 | Ga0207647_10010287 | 3300025904 | Bacteria | 6608 |
| 219 | Ga0207685_10020046 | 3300025905 | Bacteria | 2215 |
| 220 | Ga0207699_10001376 | 3300025906 | Bacteria | 11583 |
| 221 | Ga0207699_10012296 | 3300025906 | Bacteria | 4351 |
| 222 | Ga0207699_10020601 | 3300025906 | Bacteria | 3538 |
| 223 | Ga0207699_10021307 | 3300025906 | Bacteria | 3491 |
| 224 | Ga0207699_10144568 | 3300025906 | Bacteria | 1566 |
| 225 | Ga0207643_10065963 | 3300025908 | Bacteria | 2075 |
| 226 | Ga0207654_10000362 | 3300025911 | Bacteria | 26747 |
| 227 | Ga0207654_10028062 | 3300025911 | Bacteria | 3066 |
| 228 | Ga0207654_10047895 | 3300025911 | Bacteria | 2444 |
| 229 | Ga0207654_10414204 | 3300025911 | Bacteria | 939 |
| 230 | Ga0207695_10015065 | 3300025913 | Bacteria | 9121 |
| 231 | Ga0207671_10117645 | 3300025914 | Bacteria | 2029 |
| 232 | Ga0207671_10144685 | 3300025914 | Bacteria | 1833 |
| 233 | Ga0207693_10012329 | 3300025915 | Bacteria | 6906 |
| 234 | Ga0207693_10019038 | 3300025915 | Bacteria | 5464 |
| 235 | Ga0207693_10372301 | 3300025915 | Bacteria | 1117 |
| 236 | Ga0207663_10059679 | 3300025916 | Bacteria | 2414 |
| 237 | Ga0207663_10069094 | 3300025916 | Bacteria | 2271 |
| 238 | Ga0207663_10074157 | 3300025916 | Bacteria | 2204 |
| 239 | Ga0207649_10118855 | 3300025920 | Bacteria | 1779 |
| 240 | Ga0207681_10028626 | 3300025923 | Bacteria | 3610 |
| 241 | Ga0207694_10003423 | 3300025924 | Bacteria | 12628 |
| 242 | Ga0207694_10024272 | 3300025924 | Bacteria | 4603 |
| 243 | Ga0207694_10088906 | 3300025924 | Bacteria | 2435 |
| 244 | Ga0207694_10589064 | 3300025924 | Bacteria | 935 |
| 245 | Ga0207650_10059546 | 3300025925 | Bacteria | 2847 |
| 246 | Ga0207687_10010617 | 3300025927 | Bacteria | 6020 |
| 247 | Ga0207700_10017248 | 3300025928 | Bacteria | 4819 |
| 248 | Ga0207700_10070619 | 3300025928 | Bacteria | 2685 |
| 249 | Ga0207700_10088533 | 3300025928 | Bacteria | 2438 |
| 250 | Ga0207664_10034282 | 3300025929 | Bacteria | 3909 |
| 251 | Ga0207664_10208689 | 3300025929 | Bacteria | 1689 |
| 252 | Ga0207664_10498409 | 3300025929 | Bacteria | 1090 |
| 253 | Ga0207644_10313936 | 3300025931 | Bacteria | 1266 |
| 254 | Ga0207706_10025090 | 3300025933 | Bacteria | 5344 |
| 255 | Ga0207706_10109875 | 3300025933 | Bacteria | 2426 |
| 256 | Ga0207686_10098133 | 3300025934 | Bacteria | 1950 |
| 257 | Ga0207669_10317247 | 3300025937 | Bacteria | 1191 |
| 258 | Ga0207665_10004908 | 3300025939 | Bacteria | 8913 |
| 259 | Ga0207665_10012851 | 3300025939 | Bacteria | 5507 |
| 260 | Ga0207665_10322553 | 3300025939 | Bacteria | 1159 |
| 261 | Ga0207665_10396899 | 3300025939 | Bacteria | 1050 |
| 262 | Ga0207665_10616079 | 3300025939 | Bacteria | 848 |
| 263 | Ga0207711_10027092 | 3300025941 | Bacteria | 4812 |
| 264 | Ga0207689_10020163 | 3300025942 | Bacteria | 5615 |
| 265 | Ga0207689_10046467 | 3300025942 | Bacteria | 3588 |
| 266 | Ga0207679_10619415 | 3300025945 | Bacteria | 977 |
| 267 | Ga0207667_10095802 | 3300025949 | Bacteria | 3063 |
| 268 | Ga0207667_10247110 | 3300025949 | Bacteria | 1825 |
| 269 | Ga0207712_10098163 | 3300025961 | Bacteria | 2172 |
| 270 | Ga0207712_10347932 | 3300025961 | Bacteria | 1231 |
| 271 | Ga0207668_10010843 | 3300025972 | Bacteria | 5520 |
| 272 | Ga0207668_10168881 | 3300025972 | Bacteria | 1713 |
| 273 | Ga0207658_10188719 | 3300025986 | Bacteria | 1711 |
| 274 | Ga0207677_10249913 | 3300026023 | Bacteria | 1440 |
| 275 | Ga0207703_10243235 | 3300026035 | Bacteria | 1618 |
| 276 | Ga0207703_10707828 | 3300026035 | Bacteria | 958 |
| 277 | Ga0207639_10255784 | 3300026041 | Bacteria | 1529 |
| 278 | Ga0207678_10017220 | 3300026067 | Bacteria | 6344 |
| 279 | Ga0207678_10018566 | 3300026067 | Bacteria | 6107 |
| 280 | Ga0207678_10050635 | 3300026067 | Bacteria | 3588 |
| 281 | Ga0207678_10055824 | 3300026067 | Bacteria | 3402 |
| 282 | Ga0207678_10060281 | 3300026067 | Bacteria | 3264 |
| 283 | Ga0207678_10728869 | 3300026067 | Bacteria | 873 |
| 284 | Ga0207708_10049323 | 3300026075 | Bacteria | 3205 |
| 285 | Ga0207702_10006411 | 3300026078 | Bacteria | 10149 |
| 286 | Ga0207641_10087916 | 3300026088 | Bacteria | 2712 |
| 287 | Ga0207641_10517443 | 3300026088 | Bacteria | 1160 |
| 288 | Ga0207676_10249016 | 3300026095 | Bacteria | 1598 |
| 289 | Ga0207676_10335331 | 3300026095 | Bacteria | 1393 |
| 290 | Ga0207674_10051196 | 3300026116 | Bacteria | 4215 |
| 291 | Ga0207674_10640649 | 3300026116 | Bacteria | 1026 |
| 292 | Ga0207675_100004262 | 3300026118 | Bacteria | 13835 |
| 293 | Ga0207675_100455833 | 3300026118 | Bacteria | 1268 |
| 294 | Ga0207683_10039392 | 3300026121 | Bacteria | 4123 |
| 295 | Ga0207683_10385360 | 3300026121 | Bacteria | 1289 |
| 296 | Ga0207683_10759210 | 3300026121 | Bacteria | 900 |
| 297 | Ga0207698_10170657 | 3300026142 | Bacteria | 1915 |
| 298 | Ga0207698_10674402 | 3300026142 | Bacteria | 1026 |
| 299 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 300 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 301 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 302 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 303 | Ga0209489_102003 | 3300027361 | Bacteria | 41928 |
| 304 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 305 | Ga0209588_1001310 | 3300027671 | Bacteria | 6471 |
| 306 | Ga0207428_10252578 | 3300027907 | Bacteria | 1315 |
| 307 | Ga0268266_10036831 | 3300028379 | Bacteria | 4167 |
| 308 | Ga0268266_10039534 | 3300028379 | Bacteria | 4018 |
| 309 | Ga0268266_10051269 | 3300028379 | Bacteria | 3542 |
| 310 | Ga0268266_10144152 | 3300028379 | Bacteria | 2140 |
| 311 | Ga0268265_10024207 | 3300028380 | Bacteria | 4292 |
| 312 | Ga0268265_10075615 | 3300028380 | Bacteria | 2639 |
| 313 | Ga0268265_10236108 | 3300028380 | Bacteria | 1610 |
| 314 | Ga0268264_10353273 | 3300028381 | Bacteria | 1400 |
| 315 | Ga0307517_10000483 | 3300028786 | Bacteria | 68332 |
| 316 | Ga0307509_10000779 | 3300031507 | Bacteria | 54577 |
| 317 | Ga0307509_10105524 | 3300031507 | Bacteria | 2838 |
| 318 | Ga0307509_10223383 | 3300031507 | Bacteria | 1693 |
| 319 | Ga0307408_100355867 | 3300031548 | Bacteria | 1244 |
| 320 | Ga0307508_10012784 | 3300031616 | Bacteria | 7675 |
| 321 | Ga0265314_10031839 | 3300031711 | Bacteria | 3887 |
| 322 | Ga0265314_10222080 | 3300031711 | Bacteria | 1102 |
| 323 | Ga0265342_10043338 | 3300031712 | Bacteria | 2716 |
| 324 | Ga0307516_10009045 | 3300031730 | Bacteria | 11159 |
| 325 | Ga0307516_10015223 | 3300031730 | Bacteria | 8102 |
| 326 | Ga0307405_10051477 | 3300031731 | Bacteria | 2556 |
| 327 | Ga0307407_10196382 | 3300031903 | Bacteria | 1349 |
| 328 | Ga0307409_100374370 | 3300031995 | Bacteria | 1351 |
| 329 | Ga0307415_100559271 | 3300032126 | Bacteria | 1011 |
| 330 | Ga0307507_10130688 | 3300033179 | Bacteria | 1966 |
| 331 | Ga0307510_10001008 | 3300033180 | Bacteria | 29864 |
| 332 | Ga0307510_10031287 | 3300033180 | Bacteria | 6016 |
| 333 | Ga0373930_0022199 | 3300034816 | Bacteria | 1253 |
| 334 | Ga0373938_0039649 | 3300034957 | Bacteria | 1042 |
| 335 | Ga0373928_0036634 | 3300035084 | Bacteria | 1110 |
| 336 | Ga0373934_0004035 | 3300035086 | Bacteria | 5408 |
| 337 | Ga0373923_0164927 | 3300035111 | Bacteria | 1012 |
| 338 | Ga0373936_0084992 | 3300035113 | Bacteria | 1321 |
| 339 | Ga0373956_0017618 | 3300035119 | Bacteria | 3013 |
| 340 | Ga0373957_0006199 | 3300035120 | Bacteria | 3758 |
| 341 | Ga0373943_0000953 | 3300035170 | Bacteria | 12818 |
| 342 | Ga0373946_0010421 | 3300035171 | Bacteria | 3440 |
| 343 | Ga0373931_0004265 | 3300035691 | Bacteria | 6509 |
| 344 | Ga0373931_0070797 | 3300035691 | Bacteria | 1904 |
| 345 | Ga0373931_0196257 | 3300035691 | Bacteria | 1203 |
| 346 | Ga0373935_0013477 | 3300035692 | Bacteria | 4933 |
| 347 | Ga0373935_0181874 | 3300035692 | Bacteria | 1444 |
| 348 | Ga0373927_0004609 | 3300035695 | Bacteria | 9608 |
| 349 | Ga0373927_0006807 | 3300035695 | Bacteria | 7775 |
| 350 | Ga0373927_0010739 | 3300035695 | Bacteria | 6099 |
| 351 | Ga0373927_0015300 | 3300035695 | Bacteria | 5067 |
| 352 | Ga0373927_0379164 | 3300035695 | Bacteria | 932 |
| 353 | Ga0373933_0000259 | 3300035724 | Bacteria | 34812 |
| 354 | Ga0373933_0013342 | 3300035724 | Bacteria | 4553 |
| 355 | Ga0373933_0081286 | 3300035724 | Bacteria | 1988 |
| 356 | Ga0373947_0001734 | 3300035725 | Bacteria | 13338 |
| 357 | Ga0373947_0084431 | 3300035725 | Bacteria | 1971 |
| 358 | Ga0373947_0226871 | 3300035725 | Bacteria | 1229 |
| 359 | Ga0373937_0101332 | 3300036401 | Bacteria | 2672 |
| 360 | Ga0373937_0223605 | 3300036401 | Bacteria | 1772 |
| 361 | Ga0373925_0001112 | 3300037068 | Bacteria | 23957 |
| 362 | Ga0395900_0161423 | 3300037418 | Bacteria | 2286 |
| 363 | Ga0395898_0143981 | 3300037466 | Bacteria | 2282 |
| 364 | Ga0395905_0066394 | 3300037471 | Bacteria | 3379 |
| 365 | Ga0395905_0084719 | 3300037471 | Bacteria | 2970 |
| 366 | Ga0395905_0899763 | 3300037471 | Bacteria | 788 |
| 367 | Ga0395901_0700179 | 3300038443 | Bacteria | 1011 |
| 368 | Ga0436365_0160289 | 3300039437 | Bacteria | 39593 |
| 369 | Ga0436363_1301420 | 3300039450 | Bacteria | 3133 |
| 370 | Ga0436363_1525445 | 3300039450 | Bacteria | 1229 |
| 371 | Ga0466969_0021935 | 3300044656 | Bacteria | 3301 |
| 372 | Ga0466972_0000850 | 3300044658 | Bacteria | 14632 |
| 373 | Ga0466972_0008407 | 3300044658 | Bacteria | 5175 |
| 374 | Ga0466965_0019791 | 3300044683 | Bacteria | 3233 |
| 375 | Ga0466966_0000398 | 3300044684 | Bacteria | 28025 |
| 376 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 377 | Ga0466964_0022629 | 3300044706 | Bacteria | 2440 |
| 378 | Ga0466964_0193029 | 3300044706 | Bacteria | 973 |
| 379 | Ga0466968_0001684 | 3300044735 | Bacteria | 7962 |
| 380 | Ga0466968_0063925 | 3300044735 | Bacteria | 1591 |
| 381 | Ga0466959_0012763 | 3300045049 | Bacteria | 6079 |
| 382 | Ga0466967_0003126 | 3300045976 | Bacteria | 10658 |
| 383 | Ga0495592_0005289 | 3300046454 | Bacteria | 9514 |
| 384 | Ga0495592_0019337 | 3300046454 | Bacteria | 5181 |
| 385 | Ga0495592_0094382 | 3300046454 | Bacteria | 2141 |
| 386 | Ga0495603_0000003 | 3300046455 | Bacteria | 83533 |
| 387 | Ga0495603_0020698 | 3300046455 | Bacteria | 3985 |
| 388 | Ga0495629_0002300 | 3300046459 | Bacteria | 14742 |
| 389 | Ga0495629_0002388 | 3300046459 | Bacteria | 14446 |
| 390 | Ga0495638_0007340 | 3300046460 | Bacteria | 7912 |
| 391 | Ga0495641_0017124 | 3300046461 | Bacteria | 3789 |
| 392 | Ga0495651_0002716 | 3300046462 | Bacteria | 13730 |
| 393 | Ga0495653_0009161 | 3300046463 | Bacteria | 8094 |
| 394 | Ga0495653_0087384 | 3300046463 | Bacteria | 2290 |
| 395 | Ga0495580_0011056 | 3300046472 | Bacteria | 6998 |
| 396 | Ga0495580_0097636 | 3300046472 | Bacteria | 2043 |
| 397 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 398 | Ga0495582_0073967 | 3300046473 | Bacteria | 1886 |
| 399 | Ga0495605_0154494 | 3300046474 | Bacteria | 1022 |
| 400 | Ga0495639_0000075 | 3300046475 | Bacteria | 46617 |
| 401 | Ga0495662_0007611 | 3300046476 | Bacteria | 5345 |
| 402 | Ga0495664_0107857 | 3300046477 | Bacteria | 1680 |
| 403 | Ga0495594_0000120 | 3300046499 | Bacteria | 36823 |
| 404 | Ga0495594_0082632 | 3300046499 | Bacteria | 1795 |
| 405 | Ga0495608_0013892 | 3300046511 | Bacteria | 5589 |
| 406 | Ga0495608_0220873 | 3300046511 | Bacteria | 1189 |
| 407 | Ga0495616_0091027 | 3300046513 | Bacteria | 1444 |
| 408 | Ga0495616_0177972 | 3300046513 | Bacteria | 947 |
| 409 | Ga0495620_0108118 | 3300046515 | Bacteria | 1104 |
| 410 | Ga0495630_0028164 | 3300046517 | Bacteria | 4174 |
| 411 | Ga0495630_0254335 | 3300046517 | Bacteria | 1342 |
| 412 | Ga0495631_0020758 | 3300046518 | Bacteria | 3065 |
| 413 | Ga0495632_0084311 | 3300046519 | Bacteria | 1512 |
| 414 | Ga0495643_0030555 | 3300046522 | Bacteria | 3007 |
| 415 | Ga0495648_0117792 | 3300046524 | Bacteria | 1433 |
| 416 | Ga0495652_0078960 | 3300046529 | Bacteria | 2723 |
| 417 | Ga0495652_0109220 | 3300046529 | Bacteria | 2227 |
| 418 | Ga0495652_0116353 | 3300046529 | Bacteria | 2141 |
| 419 | Ga0495665_0000085 | 3300046531 | Bacteria | 41455 |
| 420 | Ga0495640_0000210 | 3300046533 | Bacteria | 38945 |
| 421 | Ga0495640_0010058 | 3300046533 | Bacteria | 7332 |
| 422 | Ga0495640_0101981 | 3300046533 | Bacteria | 1883 |
| 423 | Ga0495587_0026481 | 3300046536 | Bacteria | 3536 |
| 424 | Ga0495587_0060146 | 3300046536 | Bacteria | 2228 |
| 425 | Ga0495598_0010898 | 3300046537 | Bacteria | 2190 |
| 426 | Ga0495609_0077071 | 3300046538 | Bacteria | 1460 |
| 427 | Ga0495645_0020410 | 3300046543 | Bacteria | 4779 |
| 428 | Ga0495645_0057451 | 3300046543 | Bacteria | 2824 |
| 429 | Ga0495622_0042463 | 3300046557 | Bacteria | 2114 |
| 430 | Ga0495622_0095260 | 3300046557 | Bacteria | 1366 |
| 431 | Ga0495622_0223677 | 3300046557 | Bacteria | 833 |
| 432 | Ga0495667_0018048 | 3300046559 | Bacteria | 4767 |
| 433 | Ga0495634_0000064 | 3300046642 | Bacteria | 85710 |
| 434 | Ga0495634_0208421 | 3300046642 | Bacteria | 1211 |
| 435 | Ga0495611_0081154 | 3300046648 | Bacteria | 1491 |
| 436 | Ga0495625_0186698 | 3300046660 | Bacteria | 1375 |
| 437 | Ga0495635_0000316 | 3300046663 | Bacteria | 31407 |
| 438 | Ga0495635_0003249 | 3300046663 | Bacteria | 11213 |
| 439 | Ga0495635_0010884 | 3300046663 | Bacteria | 6376 |
| 440 | Ga0495659_0072596 | 3300046664 | Bacteria | 1292 |
| 441 | Ga0495588_0012912 | 3300046674 | Bacteria | 3963 |
| 442 | Ga0495588_0028614 | 3300046674 | Bacteria | 2790 |
| 443 | Ga0495657_0002292 | 3300046675 | Bacteria | 16171 |
| 444 | Ga0495657_0014085 | 3300046675 | Bacteria | 5874 |
| 445 | Ga0495599_0018009 | 3300046678 | Bacteria | 4399 |
| 446 | Ga0495623_0008931 | 3300046679 | Bacteria | 6506 |
| 447 | Ga0495623_0020342 | 3300046679 | Bacteria | 4289 |
| 448 | Ga0495646_0018497 | 3300046680 | Bacteria | 4412 |
| 449 | Ga0495646_0039598 | 3300046680 | Bacteria | 2905 |
| 450 | Ga0495646_0056170 | 3300046680 | Bacteria | 2361 |
| 451 | Ga0495647_0000458 | 3300046681 | Bacteria | 11752 |
| 452 | Ga0495658_0018062 | 3300046683 | Bacteria | 3659 |
| 453 | Ga0495658_0222876 | 3300046683 | Bacteria | 1181 |
| 454 | Ga0495613_0001871 | 3300046689 | Bacteria | 15980 |
| 455 | Ga0495613_0024647 | 3300046689 | Bacteria | 4483 |
| 456 | Ga0495613_0165154 | 3300046689 | Unclassified | 1573 |
| 457 | Ga0495624_0001019 | 3300046690 | Bacteria | 22166 |
| 458 | Ga0495624_0158537 | 3300046690 | Bacteria | 1383 |
| 459 | Ga0495624_0334257 | 3300046690 | Bacteria | 912 |
| 460 | Ga0495671_0097575 | 3300046692 | Bacteria | 1437 |
| 461 | Ga0495600_0002145 | 3300046809 | Bacteria | 11183 |
| 462 | Ga0495600_0011351 | 3300046809 | Bacteria | 5549 |
| 463 | Ga0495581_0000014 | 3300047315 | Bacteria | 60735 |
| 464 | Ga0495604_0014542 | 3300047317 | Bacteria | 6277 |
| 465 | Ga0495674_0001069 | 3300047319 | Bacteria | 26383 |
| 466 | Ga0495674_0009927 | 3300047319 | Bacteria | 9028 |
| 467 | Ga0495674_0017430 | 3300047319 | Bacteria | 6681 |
| 468 | Ga0495676_0035698 | 3300047321 | Bacteria | 4157 |
| 469 | Ga0495676_0133803 | 3300047321 | Bacteria | 1786 |
| 470 | Ga0495680_0000920 | 3300047322 | Bacteria | 32673 |
| 471 | Ga0495680_0013405 | 3300047322 | Bacteria | 7152 |
| 472 | Ga0495687_012531 | 3300047443 | Bacteria | 4475 |
| 473 | Ga0495675_0003133 | 3300047444 | Bacteria | 9927 |
| 474 | Ga0495675_0073058 | 3300047444 | Bacteria | 2163 |
| 475 | Ga0495685_069500 | 3300047447 | Bacteria | 1181 |
| 476 | Ga0495673_0061120 | 3300047469 | Bacteria | 1614 |
| 477 | Ga0495684_0014478 | 3300047471 | Bacteria | 6069 |
| 478 | Ga0495684_0031025 | 3300047471 | Bacteria | 4103 |
| 479 | Ga0495684_0135403 | 3300047471 | Bacteria | 1849 |
| 480 | Ga0495686_0037828 | 3300047472 | Bacteria | 3090 |
| 481 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 482 | Ga0495593_0001206 | 3300047673 | Bacteria | 15113 |
| 483 | Ga0495593_0202992 | 3300047673 | Bacteria | 996 |
| 484 | Ga0495602_0003728 | 3300048088 | Bacteria | 15826 |
| 485 | Ga0495602_0105152 | 3300048088 | Bacteria | 2308 |
| 486 | Ga0495602_0116253 | 3300048088 | Bacteria | 2161 |
| 487 | Ga0495614_0022823 | 3300048089 | Bacteria | 2698 |
| 488 | Ga0496101_0220438 | 3300048904 | Bacteria | 1472 |
| 489 | Ga0496101_0283070 | 3300048904 | Bacteria | 1296 |
| 490 | Ga0496102_0012597 | 3300048905 | Bacteria | 7326 |
| 491 | Ga0496102_0361356 | 3300048905 | Bacteria | 1367 |
| 492 | Ga0496103_0021025 | 3300048906 | Bacteria | 3925 |
| 493 | Ga0496103_0031264 | 3300048906 | Bacteria | 3242 |
| 494 | Ga0496103_0037652 | 3300048906 | Bacteria | 2965 |
| 495 | Ga0496103_0126042 | 3300048906 | Bacteria | 1633 |
| 496 | Ga0496105_0092300 | 3300048908 | Bacteria | 2500 |
| 497 | Ga0496105_0135521 | 3300048908 | Bacteria | 2028 |
| 498 | Ga0496106_0002346 | 3300048909 | Bacteria | 14105 |
| 499 | Ga0496106_0035790 | 3300048909 | Bacteria | 3713 |
| 500 | Ga0496106_0042793 | 3300048909 | Bacteria | 3397 |
| 501 | Ga0496106_0054533 | 3300048909 | Bacteria | 3020 |
| 502 | Ga0496106_0204797 | 3300048909 | Bacteria | 1571 |
| 503 | Ga0496106_0478801 | 3300048909 | Bacteria | 1000 |
| 504 | Ga0496107_0027504 | 3300048910 | Bacteria | 4038 |
| 505 | Ga0496107_0129883 | 3300048910 | Bacteria | 1860 |
| 506 | Ga0496108_0031446 | 3300048911 | Bacteria | 4405 |
| 507 | Ga0496109_0055081 | 3300048912 | Bacteria | 3628 |
| 508 | Ga0496109_0080565 | 3300048912 | Bacteria | 3000 |
| 509 | Ga0496109_0223436 | 3300048912 | Bacteria | 1771 |
| 510 | Ga0496109_0471598 | 3300048912 | Bacteria | 1185 |
| 511 | Ga0496110_0137169 | 3300048913 | Bacteria | 2211 |
| 512 | Ga0496111_0229449 | 3300048914 | Bacteria | 1379 |
| 513 | Ga0496111_0421284 | 3300048914 | Bacteria | 986 |
| 514 | Ga0496111_0456657 | 3300048914 | Bacteria | 942 |
| 515 | Ga0496112_0264418 | 3300048915 | Bacteria | 1669 |
| 516 | Ga0496112_0328673 | 3300048915 | Bacteria | 1473 |
| 517 | Ga0496113_0086081 | 3300048916 | Bacteria | 2415 |
| 518 | Ga0496113_0172058 | 3300048916 | Bacteria | 1715 |
| 519 | Ga0496114_0144388 | 3300048917 | Bacteria | 2062 |
| 520 | Ga0496115_0163681 | 3300048918 | Bacteria | 1839 |
| 521 | Ga0496117_0015622 | 3300048920 | Bacteria | 6455 |
| 522 | Ga0496118_0003678 | 3300048921 | Bacteria | 19028 |
| 523 | Ga0496118_0042068 | 3300048921 | Bacteria | 3609 |
| 524 | Ga0496119_0040170 | 3300048922 | Bacteria | 2997 |
| 525 | Ga0496119_0070280 | 3300048922 | Bacteria | 2054 |
| 526 | Ga0496119_0102835 | 3300048922 | Bacteria | 1601 |
| 527 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 528 | Ga0496121_0041207 | 3300048924 | Bacteria | 4039 |
| 529 | Ga0496121_0062572 | 3300048924 | Bacteria | 3047 |
| 530 | Ga0496121_0088210 | 3300048924 | Bacteria | 2432 |
| 531 | Ga0496121_0110439 | 3300048924 | Bacteria | 2098 |
| 532 | Ga0496121_0148013 | 3300048924 | Bacteria | 1732 |
| 533 | Ga0496122_0030489 | 3300048925 | Bacteria | 4518 |
| 534 | Ga0496123_0153393 | 3300048926 | Bacteria | 1239 |
| 535 | Ga0496124_0000945 | 3300048927 | Bacteria | 46493 |
| 536 | Ga0496124_0078661 | 3300048927 | Bacteria | 2717 |
| 537 | Ga0496124_0166897 | 3300048927 | Bacteria | 1710 |
| 538 | Ga0496124_0183289 | 3300048927 | Bacteria | 1609 |
| 539 | Ga0496125_0029513 | 3300048928 | Bacteria | 4927 |
| 540 | Ga0496125_0092489 | 3300048928 | Bacteria | 2261 |
| 541 | Ga0496125_0114691 | 3300048928 | Bacteria | 1940 |
| 542 | Ga0496126_0003109 | 3300048929 | Bacteria | 21428 |
| 543 | Ga0496126_0003216 | 3300048929 | Bacteria | 20930 |
| 544 | Ga0496126_0007029 | 3300048929 | Bacteria | 12417 |
| 545 | Ga0496126_0025383 | 3300048929 | Bacteria | 5701 |
| 546 | Ga0496126_0075080 | 3300048929 | Bacteria | 3001 |
| 547 | Ga0496126_0078446 | 3300048929 | Bacteria | 2926 |
| 548 | Ga0496126_0137958 | 3300048929 | Bacteria | 2102 |
| 549 | Ga0501039_0214167 | 3300049575 | Bacteria | 1515 |
| 550 | Ga0501042_0394894 | 3300049578 | Bacteria | 1002 |
| 551 | Ga0501067_0307634 | 3300049583 | Bacteria | 883 |
| 552 | Ga0501069_0084162 | 3300049585 | Bacteria | 1794 |
| 553 | Ga0501079_0603553 | 3300049741 | Bacteria | 864 |
| 554 | Ga0501045_0411103 | 3300049824 | Bacteria | 1007 |
| 555 | nmdc:mga03n38_43845_c1 | 3300050490 | Bacteria | 1962 |
| 556 | nmdc:mga00v17_40681_c1 | 3300050491 | Bacteria | 2789 |
| 557 | nmdc:mga0yw44_11924_c1 | 3300050492 | Bacteria | 4511 |
| 558 | nmdc:mga0yw44_434127_c1 | 3300050492 | Bacteria | 890 |
| 559 | nmdc:mga0k408_168110_c1 | 3300050493 | Bacteria | 1307 |
| 560 | nmdc:mga05p37_1023959_c1 | 3300050507 | Bacteria | 874 |
| 561 | nmdc:mga0n895_173733_c1 | 3300050512 | Bacteria | 2186 |
| 562 | nmdc:mga0n895_359087_c1 | 3300050512 | Bacteria | 1475 |
| 563 | nmdc:mga0sz30_30132_c1 | 3300050516 | Bacteria | 2241 |
| 564 | nmdc:mga0sz30_75313_c1 | 3300050516 | Bacteria | 1456 |
| 565 | Ga0500635_0065956 | 3300053080 | Bacteria | 1274 |
| 566 | Ga0495595_0006814 | 3300053084 | Bacteria | 4664 |
| 567 | Ga0495595_0015829 | 3300053084 | Bacteria | 3220 |
| 568 | Ga0495619_0021729 | 3300053085 | Bacteria | 4099 |
| 569 | Ga0495619_0070102 | 3300053085 | Bacteria | 2344 |
| 570 | Ga0495619_0210028 | 3300053085 | Bacteria | 1348 |
| 571 | Ga0500643_000373 | 3300053087 | Bacteria | 35007 |
| 572 | Ga0500647_0017242 | 3300053091 | Bacteria | 3327 |
| 573 | Ga0500583_0065566 | 3300053092 | Bacteria | 1725 |
| 574 | Ga0500566_0090527 | 3300053094 | Bacteria | 1691 |
| 575 | Ga0500641_0004265 | 3300053096 | Bacteria | 5048 |
| 576 | Ga0500641_0142622 | 3300053096 | Bacteria | 1035 |
| 577 | Ga0500555_001336 | 3300053103 | Bacteria | 7741 |
| 578 | Ga0500555_052378 | 3300053103 | Bacteria | 1115 |
| 579 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 580 | Ga0500595_002820 | 3300053119 | Bacteria | 8360 |
| 581 | Ga0500595_008808 | 3300053119 | Bacteria | 4101 |
| 582 | Ga0500595_033221 | 3300053119 | Bacteria | 1713 |
| 583 | Ga0500595_039818 | 3300053119 | Bacteria | 1519 |
| 584 | Ga0500621_177525 | 3300053126 | Bacteria | 775 |
| 585 | Ga0500626_138529 | 3300053128 | Bacteria | 1024 |
| 586 | Ga0500642_0000138 | 3300053130 | Bacteria | 32489 |
| 587 | Ga0500642_0117171 | 3300053130 | Bacteria | 1245 |
| 588 | Ga0500658_0125163 | 3300053134 | Bacteria | 1142 |
| 589 | Ga0500568_0109897 | 3300053139 | Bacteria | 1031 |
| 590 | Ga0500590_070052 | 3300053148 | Bacteria | 1745 |
| 591 | Ga0500590_077517 | 3300053148 | Bacteria | 1640 |
| 592 | Ga0500603_000522 | 3300053150 | Bacteria | 9717 |
| 593 | Ga0500603_035685 | 3300053150 | Bacteria | 1305 |
| 594 | Ga0500604_0029028 | 3300053151 | Bacteria | 1610 |
| 595 | Ga0500619_094840 | 3300053154 | Bacteria | 1009 |
| 596 | Ga0500622_0000277 | 3300053156 | Bacteria | 52401 |
| 597 | Ga0500622_0167627 | 3300053156 | Bacteria | 1025 |
| 598 | Ga0500634_0101815 | 3300053161 | Bacteria | 1436 |
| 599 | Ga0500638_128751 | 3300053162 | Bacteria | 1150 |
| 600 | Ga0500636_0082459 | 3300053177 | Bacteria | 1851 |
| 601 | Ga0500611_072872 | 3300053727 | Bacteria | 841 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005618 | Ga0068864_100244910 | Ga0068864_1002449102 | 226 |
| 2 | 3300005843 | Ga0068860_100009016 | Ga0068860_1000090168 | 226 |
| 3 | 3300005563 | Ga0068855_100077572 | Ga0068855_1000775722 | 227 |
| 4 | 3300005327 | Ga0070658_10009981 | Ga0070658_100099816 | 228 |
| 5 | 3300026095 | Ga0207676_10335331 | Ga0207676_103353312 | 228 |
| 6 | 3300037471 | Ga0395905_0084719 | Ga0395905_0084719_391_1089 | 228 |
| 7 | 3300046689 | Ga0495613_0165154 | Ga0495613_0165154_646_1353 | 229 |
| 8 | 3300005435 | Ga0070714_100249135 | Ga0070714_1002491352 | 230 |
| 9 | iso_pu_bacteria | 2513237096 | 2513658609 | 231 |
| 10 | iso_pu_bacteria | 2513237145 | 2513920827 | 231 |
| 11 | iso_pu_bacteria | 2667528175 | 2671118977 | 231 |
| 12 | iso_pu_bacteria | 2824704595 | 2824707859 | 232 |
| 13 | iso_pu_bacteria | 2824753945 | 2824757952 | 232 |
| 14 | iso_pu_bacteria | 2824763712 | 2824766513 | 232 |
| 15 | iso_pu_bacteria | 2904711408 | 2904711789 | 232 |
| 16 | 3300053150 | Ga0500603_000522 | Ga0500603_000522_7741_8442 | 233 |
| 17 | iso_pu_bacteria | 8006964411 | 8006966897 | 233 |
| 18 | 3300003203 | JGI25406J46586_10000021 | JGI25406J46586_1000002137 | 234 |
| 19 | 3300005435 | Ga0070714_100041215 | Ga0070714_1000412155 | 234 |
| 20 | 3300005435 | Ga0070714_100195010 | Ga0070714_1001950102 | 234 |
| 21 | 3300005437 | Ga0070710_10005542 | Ga0070710_100055424 | 234 |
| 22 | 3300005439 | Ga0070711_100004924 | Ga0070711_1000049248 | 234 |
| 23 | 3300005439 | Ga0070711_100025201 | Ga0070711_1000252011 | 234 |
| 24 | 3300005842 | Ga0068858_100346851 | Ga0068858_1003468512 | 234 |
| 25 | 3300005985 | Ga0081539_10000051 | Ga0081539_10000051129 | 234 |
| 26 | 3300006028 | Ga0070717_10015891 | Ga0070717_100158914 | 234 |
| 27 | 3300006173 | Ga0070716_100006238 | Ga0070716_1000062386 | 234 |
| 28 | 3300006173 | Ga0070716_100566287 | Ga0070716_1005662871 | 234 |
| 29 | 3300006175 | Ga0070712_100135777 | Ga0070712_1001357771 | 234 |
| 30 | 3300009551 | Ga0105238_10137248 | Ga0105238_101372482 | 234 |
| 31 | 3300010375 | Ga0105239_10019302 | Ga0105239_100193022 | 234 |
| 32 | 3300021377 | Ga0213874_10074800 | Ga0213874_100748002 | 234 |
| 33 | 3300021384 | Ga0213876_10002812 | Ga0213876_1000281210 | 234 |
| 34 | 3300025898 | Ga0207692_10000456 | Ga0207692_100004566 | 234 |
| 35 | 3300025906 | Ga0207699_10001376 | Ga0207699_100013767 | 234 |
| 36 | 3300025906 | Ga0207699_10020601 | Ga0207699_100206012 | 234 |
| 37 | 3300025915 | Ga0207693_10372301 | Ga0207693_103723011 | 234 |
| 38 | 3300025916 | Ga0207663_10059679 | Ga0207663_100596791 | 234 |
| 39 | 3300025924 | Ga0207694_10088906 | Ga0207694_100889062 | 234 |
| 40 | 3300025928 | Ga0207700_10017248 | Ga0207700_100172484 | 234 |
| 41 | 3300025929 | Ga0207664_10034282 | Ga0207664_100342825 | 234 |
| 42 | 3300025929 | Ga0207664_10208689 | Ga0207664_102086891 | 234 |
| 43 | 3300025939 | Ga0207665_10004908 | Ga0207665_100049081 | 234 |
| 44 | 3300025939 | Ga0207665_10616079 | Ga0207665_106160791 | 234 |
| 45 | 3300025945 | Ga0207679_10619415 | Ga0207679_106194152 | 234 |
| 46 | 3300026035 | Ga0207703_10707828 | Ga0207703_107078281 | 234 |
| 47 | 3300031711 | Ga0265314_10222080 | Ga0265314_102220801 | 234 |
| 48 | 3300039437 | Ga0436365_0160289 | Ga0436365_0160289_38199_38915 | 234 |
| 49 | 3300039450 | Ga0436363_1525445 | Ga0436363_1525445_167_883 | 234 |
| 50 | 3300048924 | Ga0496121_0062572 | Ga0496121_0062572_1950_2666 | 234 |
| 51 | 3300048926 | Ga0496123_0153393 | Ga0496123_0153393_20_736 | 234 |
| 52 | 3300048927 | Ga0496124_0078661 | Ga0496124_0078661_458_1174 | 234 |
| 53 | 3300048929 | Ga0496126_0137958 | Ga0496126_0137958_930_1634 | 234 |
| 54 | iso_pu_bacteria | 2507262055 | 2507507498 | 234 |
| 55 | iso_pu_bacteria | 2508501009 | 2508541616 | 234 |
| 56 | iso_pu_bacteria | 2511231028 | 2511398124 | 234 |
| 57 | iso_pu_bacteria | 2513237092 | 2513621691 | 234 |
| 58 | iso_pu_bacteria | 2513237094 | 2513636860 | 234 |
| 59 | iso_pu_bacteria | 2513237095 | 2513651195 | 234 |
| 60 | iso_pu_bacteria | 2513237102 | 2513703437 | 234 |
| 61 | iso_pu_bacteria | 2513237104 | 2513721474 | 234 |
| 62 | iso_pu_bacteria | 2513237139 | 2513878316 | 234 |
| 63 | iso_pu_bacteria | 2513237161 | 2514011756 | 234 |
| 64 | iso_pu_bacteria | 2515154112 | 2515626237 | 234 |
| 65 | iso_pu_bacteria | 2517093001 | 2517104346 | 234 |
| 66 | iso_pu_bacteria | 2524023205 | 2524436118 | 234 |
| 67 | iso_pu_bacteria | 2617270735 | 2617352757 | 234 |
| 68 | iso_pu_bacteria | 2617270741 | 2617372901 | 234 |
| 69 | iso_pu_bacteria | 2744054633 | 2745080926 | 234 |
| 70 | iso_pu_bacteria | 2802429603 | 2805920539 | 234 |
| 71 | iso_pu_bacteria | 2816332527 | 2818236727 | 234 |
| 72 | iso_pu_bacteria | 2824600985 | 2824602955 | 234 |
| 73 | iso_pu_bacteria | 2824609381 | 2824611822 | 234 |
| 74 | iso_pu_bacteria | 2824617872 | 2824621544 | 234 |
| 75 | iso_pu_bacteria | 2824626560 | 2824630656 | 234 |
| 76 | iso_pu_bacteria | 2824635225 | 2824641092 | 234 |
| 77 | iso_pu_bacteria | 2824644064 | 2824650952 | 234 |
| 78 | iso_pu_bacteria | 2824671348 | 2824672282 | 234 |
| 79 | iso_pu_bacteria | 2824679649 | 2824682309 | 234 |
| 80 | iso_pu_bacteria | 2824687955 | 2824688835 | 234 |
| 81 | iso_pu_bacteria | 2824696289 | 2824697676 | 234 |
| 82 | iso_pu_bacteria | 2824714736 | 2824720804 | 234 |
| 83 | iso_pu_bacteria | 2824723954 | 2824730983 | 234 |
| 84 | iso_pu_bacteria | 2824732956 | 2824733986 | 234 |
| 85 | iso_pu_bacteria | 2824746037 | 2824748418 | 234 |
| 86 | iso_pu_bacteria | 2824773399 | 2824776636 | 234 |
| 87 | iso_pu_bacteria | 2838122688 | 2838129392 | 234 |
| 88 | iso_pu_bacteria | 2841941048 | 2841946436 | 234 |
| 89 | iso_pu_bacteria | 2841949485 | 2841953650 | 234 |
| 90 | iso_pu_bacteria | 2841957949 | 2841962745 | 234 |
| 91 | iso_pu_bacteria | 2841966195 | 2841972945 | 234 |
| 92 | iso_pu_bacteria | 2841974524 | 2841978383 | 234 |
| 93 | iso_pu_bacteria | 2841983080 | 2841990597 | 234 |
| 94 | iso_pu_bacteria | 2842038055 | 2842040816 | 234 |
| 95 | iso_pu_bacteria | 2842045827 | 2842046239 | 234 |
| 96 | iso_pu_bacteria | 2844315083 | 2844318699 | 234 |
| 97 | iso_pu_bacteria | 2847930680 | 2847937497 | 234 |
| 98 | iso_pu_bacteria | 2847939898 | 2847947920 | 234 |
| 99 | iso_pu_bacteria | 2849076700 | 2849078233 | 234 |
| 100 | iso_pu_bacteria | 2874590934 | 2874598613 | 234 |
| 101 | iso_pu_bacteria | 2874612657 | 2874619234 | 234 |
| 102 | iso_pu_bacteria | 2874620515 | 2874628243 | 234 |
| 103 | iso_pu_bacteria | 2874645413 | 2874652067 | 234 |
| 104 | iso_pu_bacteria | 2876761206 | 2876768256 | 234 |
| 105 | iso_pu_bacteria | 2876771140 | 2876778652 | 234 |
| 106 | iso_pu_bacteria | 2876818435 | 2876823456 | 234 |
| 107 | iso_pu_bacteria | 2879074833 | 2879082445 | 234 |
| 108 | iso_pu_bacteria | 2879083081 | 2879084910 | 234 |
| 109 | iso_pu_bacteria | 2879127579 | 2879131774 | 234 |
| 110 | iso_pu_bacteria | 2879142872 | 2879150110 | 234 |
| 111 | iso_pu_bacteria | 2881364244 | 2881370074 | 234 |
| 112 | iso_pu_bacteria | 2881665667 | 2881670090 | 234 |
| 113 | iso_pu_bacteria | 2885366525 | 2885370135 | 234 |
| 114 | iso_pu_bacteria | 2888378607 | 2888385649 | 234 |
| 115 | iso_pu_bacteria | 2888388044 | 2888392619 | 234 |
| 116 | iso_pu_bacteria | 2888419890 | 2888425768 | 234 |
| 117 | iso_pu_bacteria | 2903727486 | 2903728830 | 234 |
| 118 | iso_pu_bacteria | 2904666416 | 2904674138 | 234 |
| 119 | iso_pu_bacteria | 2904690495 | 2904698909 | 234 |
| 120 | iso_pu_bacteria | 2906602504 | 2906604472 | 234 |
| 121 | iso_pu_bacteria | 2906626472 | 2906627765 | 234 |
| 122 | iso_pu_bacteria | 2906643746 | 2906645548 | 234 |
| 123 | iso_pu_bacteria | 2908756301 | 2908758705 | 234 |
| 124 | iso_pu_bacteria | 2908775508 | 2908781350 | 234 |
| 125 | iso_pu_bacteria | 2922393267 | 2922396901 | 234 |
| 126 | iso_pu_bacteria | 2929615660 | 2929621209 | 234 |
| 127 | iso_pu_bacteria | 2929624759 | 2929625960 | 234 |
| 128 | iso_pu_bacteria | 2933577622 | 2933582922 | 234 |
| 129 | iso_pu_bacteria | 2935608549 | 2935609995 | 234 |
| 130 | iso_pu_bacteria | 2935630451 | 2935634878 | 234 |
| 131 | iso_pu_bacteria | 2935648319 | 2935651976 | 234 |
| 132 | iso_pu_bacteria | 2935656913 | 2935660051 | 234 |
| 133 | iso_pu_bacteria | 2935675223 | 2935680074 | 234 |
| 134 | iso_pu_bacteria | 2935675223 | 2935680139 | 234 |
| 135 | iso_pu_bacteria | 2935684952 | 2935693845 | 234 |
| 136 | iso_pu_bacteria | 2935694250 | 2935700714 | 234 |
| 137 | iso_pu_bacteria | 2935713505 | 2935721967 | 234 |
| 138 | iso_pu_bacteria | 2935722832 | 2935731388 | 234 |
| 139 | iso_pu_bacteria | 2935732158 | 2935741088 | 234 |
| 140 | iso_pu_bacteria | 2935741537 | 2935750464 | 234 |
| 141 | iso_pu_bacteria | 2935750917 | 2935759719 | 234 |
| 142 | iso_pu_bacteria | 2935760218 | 2935768661 | 234 |
| 143 | iso_pu_bacteria | 2935819856 | 2935823155 | 234 |
| 144 | iso_pu_bacteria | 2935847175 | 2935848737 | 234 |
| 145 | iso_pu_bacteria | 2935908558 | 2935909457 | 234 |
| 146 | iso_pu_bacteria | 2935916978 | 2935917181 | 234 |
| 147 | iso_pu_bacteria | 2935926038 | 2935926938 | 234 |
| 148 | iso_pu_bacteria | 2935934488 | 2935937218 | 234 |
| 149 | iso_pu_bacteria | 2935942939 | 2935944479 | 234 |
| 150 | iso_pu_bacteria | 2935951376 | 2935952916 | 234 |
| 151 | iso_pu_bacteria | 2935967501 | 2935969756 | 234 |
| 152 | iso_pu_bacteria | 2935975950 | 2935976355 | 234 |
| 153 | iso_pu_bacteria | 2935984226 | 2935987196 | 234 |
| 154 | iso_pu_bacteria | 2936011229 | 2936014467 | 234 |
| 155 | iso_pu_bacteria | 2936019824 | 2936023693 | 234 |
| 156 | iso_pu_bacteria | 2936028420 | 2936031336 | 234 |
| 157 | iso_pu_bacteria | 2936046547 | 2936049573 | 234 |
| 158 | iso_pu_bacteria | 2936055302 | 2936061212 | 234 |
| 159 | iso_pu_bacteria | 2940556831 | 2940565624 | 234 |
| 160 | iso_pu_bacteria | 2941507105 | 2941511791 | 234 |
| 161 | iso_pu_bacteria | 2941515067 | 2941519493 | 234 |
| 162 | iso_pu_bacteria | 2941523033 | 2941527814 | 234 |
| 163 | iso_pu_bacteria | 3005483717 | 3005485568 | 234 |
| 164 | iso_pu_bacteria | 3005506211 | 3005508266 | 234 |
| 165 | iso_pu_bacteria | 3005587118 | 3005588231 | 234 |
| 166 | iso_pu_bacteria | 3005594810 | 3005600490 | 234 |
| 167 | iso_pu_bacteria | 3005710791 | 3005715965 | 234 |
| 168 | iso_pu_bacteria | 3005718088 | 3005720201 | 234 |
| 169 | iso_pu_bacteria | 8006926726 | 8006928601 | 234 |
| 170 | iso_pu_bacteria | 8016583857 | 8016594548 | 234 |
| 171 | iso_pu_bacteria | 8016630954 | 8016638991 | 234 |
| 172 | iso_pu_bacteria | 8019619141 | 8019619986 | 234 |
| 173 | iso_pu_bacteria | 8019638758 | 8019646779 | 234 |
| 174 | iso_pu_bacteria | 8019648815 | 8019649549 | 234 |
| 175 | iso_pu_bacteria | 8019668869 | 8019670562 | 234 |
| 176 | iso_pu_bacteria | 8019678201 | 8019685672 | 234 |
| 177 | iso_pu_bacteria | 8019687851 | 8019691249 | 234 |
| 178 | iso_pu_bacteria | 8055742211 | 8055744929 | 234 |
| 179 | iso_pu_bacteria | 8056967851 | 8056973109 | 234 |
| 180 | 3300003215 | JGI25153J46596_10001525 | JGI25153J46596_100015257 | 235 |
| 181 | 3300005434 | Ga0070709_10010400 | Ga0070709_100104003 | 235 |
| 182 | 3300005435 | Ga0070714_100026833 | Ga0070714_1000268333 | 235 |
| 183 | 3300005435 | Ga0070714_100273461 | Ga0070714_1002734613 | 235 |
| 184 | 3300005437 | Ga0070710_10008953 | Ga0070710_100089534 | 235 |
| 185 | 3300005439 | Ga0070711_100047340 | Ga0070711_1000473403 | 235 |
| 186 | 3300005439 | Ga0070711_100305415 | Ga0070711_1003054152 | 235 |
| 187 | 3300005466 | Ga0070685_10299343 | Ga0070685_102993431 | 235 |
| 188 | 3300005548 | Ga0070665_100027551 | Ga0070665_1000275515 | 235 |
| 189 | 3300005548 | Ga0070665_100342360 | Ga0070665_1003423601 | 235 |
| 190 | 3300005564 | Ga0070664_100303959 | Ga0070664_1003039592 | 235 |
| 191 | 3300005615 | Ga0070702_100260042 | Ga0070702_1002600422 | 235 |
| 192 | 3300005843 | Ga0068860_100317679 | Ga0068860_1003176792 | 235 |
| 193 | 3300005937 | Ga0081455_10005841 | Ga0081455_1000584112 | 235 |
| 194 | 3300005937 | Ga0081455_10038376 | Ga0081455_100383764 | 235 |
| 195 | 3300005983 | Ga0081540_1003663 | Ga0081540_10036631 | 235 |
| 196 | 3300006163 | Ga0070715_10008826 | Ga0070715_100088262 | 235 |
| 197 | 3300006173 | Ga0070716_100007573 | Ga0070716_1000075735 | 235 |
| 198 | 3300006175 | Ga0070712_100030350 | Ga0070712_1000303501 | 235 |
| 199 | 3300007265 | Ga0099794_10064154 | Ga0099794_100641542 | 235 |
| 200 | 3300007265 | Ga0099794_10067366 | Ga0099794_100673662 | 235 |
| 201 | 3300014325 | Ga0163163_10083737 | Ga0163163_100837374 | 235 |
| 202 | 3300025253 | Ga0209677_100746 | Ga0209677_1007464 | 235 |
| 203 | 3300025297 | Ga0209758_1002906 | Ga0209758_100290610 | 235 |
| 204 | 3300025297 | Ga0209758_1016465 | Ga0209758_10164655 | 235 |
| 205 | 3300025898 | Ga0207692_10074916 | Ga0207692_100749161 | 235 |
| 206 | 3300025905 | Ga0207685_10020046 | Ga0207685_100200461 | 235 |
| 207 | 3300025906 | Ga0207699_10021307 | Ga0207699_100213072 | 235 |
| 208 | 3300025906 | Ga0207699_10144568 | Ga0207699_101445682 | 235 |
| 209 | 3300025915 | Ga0207693_10019038 | Ga0207693_100190384 | 235 |
| 210 | 3300025916 | Ga0207663_10074157 | Ga0207663_100741572 | 235 |
| 211 | 3300025928 | Ga0207700_10070619 | Ga0207700_100706192 | 235 |
| 212 | 3300025929 | Ga0207664_10498409 | Ga0207664_104984091 | 235 |
| 213 | 3300025939 | Ga0207665_10012851 | Ga0207665_100128513 | 235 |
| 214 | 3300027671 | Ga0209588_1001310 | Ga0209588_10013102 | 235 |
| 215 | 3300028379 | Ga0268266_10051269 | Ga0268266_100512694 | 235 |
| 216 | 3300028379 | Ga0268266_10144152 | Ga0268266_101441522 | 235 |
| 217 | 3300031507 | Ga0307509_10000779 | Ga0307509_1000077915 | 235 |
| 218 | 3300031616 | Ga0307508_10012784 | Ga0307508_100127846 | 235 |
| 219 | 3300031711 | Ga0265314_10031839 | Ga0265314_100318391 | 235 |
| 220 | 3300031712 | Ga0265342_10043338 | Ga0265342_100433383 | 235 |
| 221 | 3300031730 | Ga0307516_10015223 | Ga0307516_100152236 | 235 |
| 222 | 3300035084 | Ga0373928_0036634 | Ga0373928_0036634_258_965 | 235 |
| 223 | 3300035113 | Ga0373936_0084992 | Ga0373936_0084992_249_959 | 235 |
| 224 | 3300035691 | Ga0373931_0070797 | Ga0373931_0070797_406_1113 | 235 |
| 225 | 3300035691 | Ga0373931_0196257 | Ga0373931_0196257_408_1133 | 235 |
| 226 | 3300035695 | Ga0373927_0006807 | Ga0373927_0006807_2671_3381 | 235 |
| 227 | 3300036401 | Ga0373937_0223605 | Ga0373937_0223605_750_1460 | 235 |
| 228 | 3300039450 | Ga0436363_1301420 | Ga0436363_1301420_25_816 | 235 |
| 229 | 3300045976 | Ga0466967_0003126 | Ga0466967_0003126_4696_5418 | 235 |
| 230 | 3300046477 | Ga0495664_0107857 | Ga0495664_0107857_294_1004 | 235 |
| 231 | 3300046513 | Ga0495616_0177972 | Ga0495616_0177972_190_897 | 235 |
| 232 | 3300046517 | Ga0495630_0254335 | Ga0495630_0254335_422_1132 | 235 |
| 233 | 3300046642 | Ga0495634_0208421 | Ga0495634_0208421_446_1156 | 235 |
| 234 | 3300046690 | Ga0495624_0158537 | Ga0495624_0158537_164_874 | 235 |
| 235 | 3300048905 | Ga0496102_0012597 | Ga0496102_0012597_4969_5694 | 235 |
| 236 | 3300048906 | Ga0496103_0126042 | Ga0496103_0126042_104_829 | 235 |
| 237 | 3300048908 | Ga0496105_0092300 | Ga0496105_0092300_685_1410 | 235 |
| 238 | 3300048909 | Ga0496106_0042793 | Ga0496106_0042793_1931_2656 | 235 |
| 239 | 3300048911 | Ga0496108_0031446 | Ga0496108_0031446_944_1669 | 235 |
| 240 | 3300048912 | Ga0496109_0055081 | Ga0496109_0055081_832_1557 | 235 |
| 241 | 3300048914 | Ga0496111_0229449 | Ga0496111_0229449_559_1284 | 235 |
| 242 | 3300048914 | Ga0496111_0456657 | Ga0496111_0456657_51_773 | 235 |
| 243 | 3300048915 | Ga0496112_0264418 | Ga0496112_0264418_547_1269 | 235 |
| 244 | 3300048916 | Ga0496113_0086081 | Ga0496113_0086081_14_721 | 235 |
| 245 | 3300048921 | Ga0496118_0042068 | Ga0496118_0042068_2174_2881 | 235 |
| 246 | 3300048922 | Ga0496119_0102835 | Ga0496119_0102835_545_1252 | 235 |
| 247 | 3300048924 | Ga0496121_0088210 | Ga0496121_0088210_1673_2380 | 235 |
| 248 | 3300048928 | Ga0496125_0114691 | Ga0496125_0114691_1128_1835 | 235 |
| 249 | 3300048929 | Ga0496126_0003216 | Ga0496126_0003216_18779_19501 | 235 |
| 250 | 3300049585 | Ga0501069_0084162 | Ga0501069_0084162_1025_1750 | 235 |
| 251 | iso_pu_bacteria | 2513237101 | 2513693698 | 235 |
| 252 | iso_pu_bacteria | 2721755755 | 2723843530 | 235 |
| 253 | iso_pu_bacteria | 2791355199 | 2793083937 | 235 |
| 254 | iso_pu_bacteria | 2874604998 | 2874611560 | 235 |
| 255 | iso_pu_bacteria | 2879110137 | 2879117413 | 235 |
| 256 | iso_pu_bacteria | 2889033259 | 2889037838 | 235 |
| 257 | iso_pu_bacteria | 2904699407 | 2904707262 | 235 |
| 258 | iso_pu_bacteria | 2922361189 | 2922361785 | 235 |
| 259 | iso_pu_bacteria | 2922386360 | 2922386973 | 235 |
| 260 | iso_pu_bacteria | 8006994254 | 8006994593 | 235 |
| 261 | iso_pu_bacteria | 8056673599 | 8056680941 | 235 |
| 262 | 3300003203 | JGI25406J46586_10000269 | JGI25406J46586_1000026920 | 236 |
| 263 | 3300003659 | JGI25404J52841_10001159 | JGI25404J52841_100011592 | 236 |
| 264 | 3300003659 | JGI25404J52841_10004692 | JGI25404J52841_100046922 | 236 |
| 265 | 3300005335 | Ga0070666_10252952 | Ga0070666_102529521 | 236 |
| 266 | 3300005937 | Ga0081455_10058701 | Ga0081455_100587013 | 236 |
| 267 | 3300005983 | Ga0081540_1003793 | Ga0081540_10037939 | 236 |
| 268 | 3300005983 | Ga0081540_1004411 | Ga0081540_10044114 | 236 |
| 269 | 3300005983 | Ga0081540_1035407 | Ga0081540_10354072 | 236 |
| 270 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022076 | 236 |
| 271 | 3300010375 | Ga0105239_10818656 | Ga0105239_108186562 | 236 |
| 272 | 3300037471 | Ga0395905_0899763 | Ga0395905_0899763_27_737 | 236 |
| 273 | 3300048922 | Ga0496119_0040170 | Ga0496119_0040170_987_1697 | 236 |
| 274 | 3300005337 | Ga0070682_100320941 | Ga0070682_1003209411 | 237 |
| 275 | 3300005347 | Ga0070668_100152240 | Ga0070668_1001522402 | 237 |
| 276 | 3300005347 | Ga0070668_100186368 | Ga0070668_1001863683 | 237 |
| 277 | 3300005367 | Ga0070667_100168955 | Ga0070667_1001689552 | 237 |
| 278 | 3300005456 | Ga0070678_100069834 | Ga0070678_1000698342 | 237 |
| 279 | 3300005466 | Ga0070685_10124878 | Ga0070685_101248782 | 237 |
| 280 | 3300005467 | Ga0070706_100107750 | Ga0070706_1001077501 | 237 |
| 281 | 3300005548 | Ga0070665_100047615 | Ga0070665_1000476152 | 237 |
| 282 | 3300005548 | Ga0070665_100049171 | Ga0070665_1000491714 | 237 |
| 283 | 3300005548 | Ga0070665_100772609 | Ga0070665_1007726092 | 237 |
| 284 | 3300005563 | Ga0068855_100094658 | Ga0068855_1000946583 | 237 |
| 285 | 3300005614 | Ga0068856_100064579 | Ga0068856_1000645794 | 237 |
| 286 | 3300005618 | Ga0068864_100100993 | Ga0068864_1001009934 | 237 |
| 287 | 3300005719 | Ga0068861_100177348 | Ga0068861_1001773482 | 237 |
| 288 | 3300005834 | Ga0068851_10087762 | Ga0068851_100877622 | 237 |
| 289 | 3300005840 | Ga0068870_10040916 | Ga0068870_100409162 | 237 |
| 290 | 3300005842 | Ga0068858_100049906 | Ga0068858_1000499063 | 237 |
| 291 | 3300005844 | Ga0068862_100042845 | Ga0068862_1000428453 | 237 |
| 292 | 3300006173 | Ga0070716_100333820 | Ga0070716_1003338202 | 237 |
| 293 | 3300006186 | Ga0075369_10005776 | Ga0075369_100057764 | 237 |
| 294 | 3300006353 | Ga0075370_10218218 | Ga0075370_102182181 | 237 |
| 295 | 3300006358 | Ga0068871_100410223 | Ga0068871_1004102232 | 237 |
| 296 | 3300006871 | Ga0075434_100361452 | Ga0075434_1003614522 | 237 |
| 297 | 3300009098 | Ga0105245_10182074 | Ga0105245_101820742 | 237 |
| 298 | 3300009101 | Ga0105247_10100054 | Ga0105247_101000543 | 237 |
| 299 | 3300009174 | Ga0105241_10105949 | Ga0105241_101059492 | 237 |
| 300 | 3300009545 | Ga0105237_10037400 | Ga0105237_100374002 | 237 |
| 301 | 3300009551 | Ga0105238_10036736 | Ga0105238_100367365 | 237 |
| 302 | 3300010159 | Ga0099796_10047318 | Ga0099796_100473181 | 237 |
| 303 | 3300010375 | Ga0105239_10064879 | Ga0105239_100648794 | 237 |
| 304 | 3300013297 | Ga0157378_10136629 | Ga0157378_101366293 | 237 |
| 305 | 3300014969 | Ga0157376_10156878 | Ga0157376_101568782 | 237 |
| 306 | 3300017792 | Ga0163161_10284564 | Ga0163161_102845641 | 237 |
| 307 | 3300025900 | Ga0207710_10040065 | Ga0207710_100400652 | 237 |
| 308 | 3300025908 | Ga0207643_10065963 | Ga0207643_100659632 | 237 |
| 309 | 3300025911 | Ga0207654_10028062 | Ga0207654_100280621 | 237 |
| 310 | 3300025924 | Ga0207694_10024272 | Ga0207694_100242725 | 237 |
| 311 | 3300025927 | Ga0207687_10010617 | Ga0207687_100106176 | 237 |
| 312 | 3300025941 | Ga0207711_10027092 | Ga0207711_100270924 | 237 |
| 313 | 3300025942 | Ga0207689_10046467 | Ga0207689_100464672 | 237 |
| 314 | 3300025949 | Ga0207667_10095802 | Ga0207667_100958023 | 237 |
| 315 | 3300025972 | Ga0207668_10168881 | Ga0207668_101688813 | 237 |
| 316 | 3300026035 | Ga0207703_10243235 | Ga0207703_102432351 | 237 |
| 317 | 3300026041 | Ga0207639_10255784 | Ga0207639_102557842 | 237 |
| 318 | 3300026067 | Ga0207678_10017220 | Ga0207678_100172205 | 237 |
| 319 | 3300026067 | Ga0207678_10060281 | Ga0207678_100602812 | 237 |
| 320 | 3300026067 | Ga0207678_10728869 | Ga0207678_107288691 | 237 |
| 321 | 3300026088 | Ga0207641_10517443 | Ga0207641_105174432 | 237 |
| 322 | 3300026095 | Ga0207676_10249016 | Ga0207676_102490162 | 237 |
| 323 | 3300026116 | Ga0207674_10051196 | Ga0207674_100511964 | 237 |
| 324 | 3300026118 | Ga0207675_100455833 | Ga0207675_1004558332 | 237 |
| 325 | 3300026121 | Ga0207683_10039392 | Ga0207683_100393922 | 237 |
| 326 | 3300026121 | Ga0207683_10759210 | Ga0207683_107592101 | 237 |
| 327 | 3300026142 | Ga0207698_10170657 | Ga0207698_101706572 | 237 |
| 328 | 3300028379 | Ga0268266_10036831 | Ga0268266_100368313 | 237 |
| 329 | 3300028379 | Ga0268266_10039534 | Ga0268266_100395345 | 237 |
| 330 | 3300028380 | Ga0268265_10075615 | Ga0268265_100756151 | 237 |
| 331 | 3300028380 | Ga0268265_10236108 | Ga0268265_102361081 | 237 |
| 332 | 3300028786 | Ga0307517_10000483 | Ga0307517_1000048325 | 237 |
| 333 | 3300031548 | Ga0307408_100355867 | Ga0307408_1003558672 | 237 |
| 334 | 3300031730 | Ga0307516_10009045 | Ga0307516_100090459 | 237 |
| 335 | 3300031731 | Ga0307405_10051477 | Ga0307405_100514772 | 237 |
| 336 | 3300031903 | Ga0307407_10196382 | Ga0307407_101963822 | 237 |
| 337 | 3300031995 | Ga0307409_100374370 | Ga0307409_1003743702 | 237 |
| 338 | 3300033180 | Ga0307510_10031287 | Ga0307510_100312876 | 237 |
| 339 | 3300034816 | Ga0373930_0022199 | Ga0373930_0022199_326_1039 | 237 |
| 340 | 3300034957 | Ga0373938_0039649 | Ga0373938_0039649_205_918 | 237 |
| 341 | 3300035691 | Ga0373931_0004265 | Ga0373931_0004265_5216_5929 | 237 |
| 342 | 3300035692 | Ga0373935_0181874 | Ga0373935_0181874_436_1149 | 237 |
| 343 | 3300046515 | Ga0495620_0108118 | Ga0495620_0108118_142_855 | 237 |
| 344 | 3300046518 | Ga0495631_0020758 | Ga0495631_0020758_804_1517 | 237 |
| 345 | 3300046524 | Ga0495648_0117792 | Ga0495648_0117792_619_1332 | 237 |
| 346 | 3300047447 | Ga0495685_069500 | Ga0495685_069500_405_1118 | 237 |
| 347 | 3300047472 | Ga0495686_0037828 | Ga0495686_0037828_1705_2418 | 237 |
| 348 | 3300048904 | Ga0496101_0283070 | Ga0496101_0283070_547_1260 | 237 |
| 349 | 3300048906 | Ga0496103_0037652 | Ga0496103_0037652_278_991 | 237 |
| 350 | 3300048908 | Ga0496105_0135521 | Ga0496105_0135521_444_1157 | 237 |
| 351 | 3300048909 | Ga0496106_0035790 | Ga0496106_0035790_2853_3566 | 237 |
| 352 | 3300048909 | Ga0496106_0054533 | Ga0496106_0054533_1692_2405 | 237 |
| 353 | 3300048910 | Ga0496107_0027504 | Ga0496107_0027504_621_1334 | 237 |
| 354 | 3300048912 | Ga0496109_0471598 | Ga0496109_0471598_299_1012 | 237 |
| 355 | 3300048916 | Ga0496113_0172058 | Ga0496113_0172058_649_1362 | 237 |
| 356 | 3300048917 | Ga0496114_0144388 | Ga0496114_0144388_156_869 | 237 |
| 357 | 3300048918 | Ga0496115_0163681 | Ga0496115_0163681_177_890 | 237 |
| 358 | 3300048924 | Ga0496121_0110439 | Ga0496121_0110439_193_906 | 237 |
| 359 | 3300048925 | Ga0496122_0030489 | Ga0496122_0030489_2511_3224 | 237 |
| 360 | 3300048929 | Ga0496126_0003109 | Ga0496126_0003109_4528_5241 | 237 |
| 361 | 3300050512 | nmdc:mga0n895_173733_c1 | nmdc:mga0n895_173733_c1_1100_1813 | 237 |
| 362 | 3300053085 | Ga0495619_0070102 | Ga0495619_0070102_495_1208 | 237 |
| 363 | 3300001989 | JGI24739J22299_10010714 | JGI24739J22299_100107143 | 238 |
| 364 | 3300001990 | JGI24737J22298_10010651 | JGI24737J22298_100106513 | 238 |
| 365 | 3300002070 | JGI24750J21931_1003951 | JGI24750J21931_10039512 | 238 |
| 366 | 3300003215 | JGI25153J46596_10001551 | JGI25153J46596_100015511 | 238 |
| 367 | 3300003215 | JGI25153J46596_10026118 | JGI25153J46596_100261183 | 238 |
| 368 | 3300003323 | rootH1_10008730 | rootH1_100087301 | 238 |
| 369 | 3300003323 | rootH1_10027468 | rootH1_100274683 | 238 |
| 370 | 3300003659 | JGI25404J52841_10009992 | JGI25404J52841_100099923 | 238 |
| 371 | 3300003794 | Ga0055531_10008605 | Ga0055531_100086053 | 238 |
| 372 | 3300003911 | JGI25405J52794_10010473 | JGI25405J52794_100104732 | 238 |
| 373 | 3300003911 | JGI25405J52794_10030572 | JGI25405J52794_100305721 | 238 |
| 374 | 3300005262 | Ga0065165_1027919 | Ga0065165_10279194 | 238 |
| 375 | 3300005327 | Ga0070658_10027153 | Ga0070658_100271535 | 238 |
| 376 | 3300005328 | Ga0070676_10175575 | Ga0070676_101755752 | 238 |
| 377 | 3300005338 | Ga0068868_100139564 | Ga0068868_1001395643 | 238 |
| 378 | 3300005344 | Ga0070661_100193985 | Ga0070661_1001939852 | 238 |
| 379 | 3300005347 | Ga0070668_100077671 | Ga0070668_1000776711 | 238 |
| 380 | 3300005347 | Ga0070668_100177116 | Ga0070668_1001771162 | 238 |
| 381 | 3300005347 | Ga0070668_100204400 | Ga0070668_1002044002 | 238 |
| 382 | 3300005355 | Ga0070671_100019458 | Ga0070671_1000194583 | 238 |
| 383 | 3300005366 | Ga0070659_100278573 | Ga0070659_1002785732 | 238 |
| 384 | 3300005367 | Ga0070667_100032145 | Ga0070667_1000321454 | 238 |
| 385 | 3300005367 | Ga0070667_100164618 | Ga0070667_1001646181 | 238 |
| 386 | 3300005436 | Ga0070713_100080662 | Ga0070713_1000806622 | 238 |
| 387 | 3300005437 | Ga0070710_10006619 | Ga0070710_100066193 | 238 |
| 388 | 3300005439 | Ga0070711_100007381 | Ga0070711_1000073815 | 238 |
| 389 | 3300005441 | Ga0070700_100061796 | Ga0070700_1000617962 | 238 |
| 390 | 3300005455 | Ga0070663_100098063 | Ga0070663_1000980632 | 238 |
| 391 | 3300005455 | Ga0070663_100250325 | Ga0070663_1002503252 | 238 |
| 392 | 3300005455 | Ga0070663_100273948 | Ga0070663_1002739481 | 238 |
| 393 | 3300005456 | Ga0070678_100760885 | Ga0070678_1007608851 | 238 |
| 394 | 3300005457 | Ga0070662_100033672 | Ga0070662_1000336723 | 238 |
| 395 | 3300005457 | Ga0070662_100117647 | Ga0070662_1001176472 | 238 |
| 396 | 3300005518 | Ga0070699_100059231 | Ga0070699_1000592314 | 238 |
| 397 | 3300005545 | Ga0070695_100086361 | Ga0070695_1000863611 | 238 |
| 398 | 3300005548 | Ga0070665_100385206 | Ga0070665_1003852062 | 238 |
| 399 | 3300005549 | Ga0070704_100277837 | Ga0070704_1002778373 | 238 |
| 400 | 3300005563 | Ga0068855_100098046 | Ga0068855_1000980462 | 238 |
| 401 | 3300005614 | Ga0068856_100259313 | Ga0068856_1002593132 | 238 |
| 402 | 3300005614 | Ga0068856_100298782 | Ga0068856_1002987822 | 238 |
| 403 | 3300005616 | Ga0068852_100031085 | Ga0068852_1000310853 | 238 |
| 404 | 3300005616 | Ga0068852_100387754 | Ga0068852_1003877542 | 238 |
| 405 | 3300005719 | Ga0068861_100170706 | Ga0068861_1001707063 | 238 |
| 406 | 3300005834 | Ga0068851_10049407 | Ga0068851_100494072 | 238 |
| 407 | 3300005843 | Ga0068860_100170432 | Ga0068860_1001704323 | 238 |
| 408 | 3300005843 | Ga0068860_100413602 | Ga0068860_1004136022 | 238 |
| 409 | 3300005937 | Ga0081455_10001988 | Ga0081455_100019888 | 238 |
| 410 | 3300005937 | Ga0081455_10055382 | Ga0081455_100553823 | 238 |
| 411 | 3300005937 | Ga0081455_10079868 | Ga0081455_100798682 | 238 |
| 412 | 3300005937 | Ga0081455_10097670 | Ga0081455_100976703 | 238 |
| 413 | 3300005981 | Ga0081538_10030597 | Ga0081538_100305974 | 238 |
| 414 | 3300005983 | Ga0081540_1005364 | Ga0081540_10053644 | 238 |
| 415 | 3300005983 | Ga0081540_1008398 | Ga0081540_10083982 | 238 |
| 416 | 3300005983 | Ga0081540_1008775 | Ga0081540_10087752 | 238 |
| 417 | 3300005983 | Ga0081540_1009060 | Ga0081540_10090603 | 238 |
| 418 | 3300005983 | Ga0081540_1053193 | Ga0081540_10531932 | 238 |
| 419 | 3300005985 | Ga0081539_10023291 | Ga0081539_100232914 | 238 |
| 420 | 3300005985 | Ga0081539_10043452 | Ga0081539_100434522 | 238 |
| 421 | 3300006038 | Ga0075365_10020288 | Ga0075365_100202884 | 238 |
| 422 | 3300006038 | Ga0075365_10023353 | Ga0075365_100233534 | 238 |
| 423 | 3300006042 | Ga0075368_10009838 | Ga0075368_100098384 | 238 |
| 424 | 3300006048 | Ga0075363_100037179 | Ga0075363_1000371792 | 238 |
| 425 | 3300006051 | Ga0075364_10062504 | Ga0075364_100625042 | 238 |
| 426 | 3300006175 | Ga0070712_100015380 | Ga0070712_1000153803 | 238 |
| 427 | 3300006177 | Ga0075362_10043128 | Ga0075362_100431282 | 238 |
| 428 | 3300006178 | Ga0075367_10176006 | Ga0075367_101760062 | 238 |
| 429 | 3300006186 | Ga0075369_10074935 | Ga0075369_100749352 | 238 |
| 430 | 3300006186 | Ga0075369_10108793 | Ga0075369_101087932 | 238 |
| 431 | 3300006195 | Ga0075366_10008087 | Ga0075366_100080874 | 238 |
| 432 | 3300006195 | Ga0075366_10018329 | Ga0075366_100183293 | 238 |
| 433 | 3300006358 | Ga0068871_100301426 | Ga0068871_1003014262 | 238 |
| 434 | 3300009093 | Ga0105240_10762932 | Ga0105240_107629321 | 238 |
| 435 | 3300009098 | Ga0105245_10242808 | Ga0105245_102428082 | 238 |
| 436 | 3300009101 | Ga0105247_10010363 | Ga0105247_100103633 | 238 |
| 437 | 3300009147 | Ga0114129_10482594 | Ga0114129_104825942 | 238 |
| 438 | 3300009174 | Ga0105241_10002269 | Ga0105241_100022696 | 238 |
| 439 | 3300009174 | Ga0105241_10011566 | Ga0105241_100115661 | 238 |
| 440 | 3300009174 | Ga0105241_10013031 | Ga0105241_100130314 | 238 |
| 441 | 3300009176 | Ga0105242_10054261 | Ga0105242_100542613 | 238 |
| 442 | 3300009177 | Ga0105248_10027112 | Ga0105248_100271124 | 238 |
| 443 | 3300009545 | Ga0105237_10008417 | Ga0105237_100084173 | 238 |
| 444 | 3300009545 | Ga0105237_10075090 | Ga0105237_100750904 | 238 |
| 445 | 3300009545 | Ga0105237_10254948 | Ga0105237_102549484 | 238 |
| 446 | 3300009545 | Ga0105237_10381575 | Ga0105237_103815752 | 238 |
| 447 | 3300009545 | Ga0105237_10666298 | Ga0105237_106662982 | 238 |
| 448 | 3300009551 | Ga0105238_10051797 | Ga0105238_100517974 | 238 |
| 449 | 3300009553 | Ga0105249_10101358 | Ga0105249_101013583 | 238 |
| 450 | 3300010375 | Ga0105239_10014919 | Ga0105239_100149193 | 238 |
| 451 | 3300010375 | Ga0105239_10147815 | Ga0105239_101478154 | 238 |
| 452 | 3300010375 | Ga0105239_10198618 | Ga0105239_101986183 | 238 |
| 453 | 3300010375 | Ga0105239_10435003 | Ga0105239_104350033 | 238 |
| 454 | 3300011119 | Ga0105246_10082996 | Ga0105246_100829961 | 238 |
| 455 | 3300013306 | Ga0163162_10018772 | Ga0163162_100187726 | 238 |
| 456 | 3300014325 | Ga0163163_10081060 | Ga0163163_100810603 | 238 |
| 457 | 3300014968 | Ga0157379_10204363 | Ga0157379_102043632 | 238 |
| 458 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001587 | 238 |
| 459 | 3300021320 | Ga0214544_1026128 | Ga0214544_10261283 | 238 |
| 460 | 3300021320 | Ga0214544_1030469 | Ga0214544_10304692 | 238 |
| 461 | 3300021321 | Ga0214542_1000606 | Ga0214542_100060635 | 238 |
| 462 | 3300021321 | Ga0214542_1026466 | Ga0214542_10264663 | 238 |
| 463 | 3300021321 | Ga0214542_1027213 | Ga0214542_10272133 | 238 |
| 464 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003174 | 238 |
| 465 | 3300021324 | Ga0214545_1028772 | Ga0214545_10287723 | 238 |
| 466 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002591 | 238 |
| 467 | 3300021327 | Ga0214543_1028523 | Ga0214543_10285233 | 238 |
| 468 | 3300025253 | Ga0209677_111349 | Ga0209677_1113492 | 238 |
| 469 | 3300025254 | Ga0209148_1001164 | Ga0209148_10011647 | 238 |
| 470 | 3300025261 | Ga0209233_1010791 | Ga0209233_10107914 | 238 |
| 471 | 3300025261 | Ga0209233_1016079 | Ga0209233_10160792 | 238 |
| 472 | 3300025272 | Ga0209455_1002542 | Ga0209455_10025422 | 238 |
| 473 | 3300025273 | Ga0209673_1020110 | Ga0209673_10201102 | 238 |
| 474 | 3300025295 | Ga0209564_1019870 | Ga0209564_10198705 | 238 |
| 475 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011489 | 238 |
| 476 | 3300025297 | Ga0209758_1000477 | Ga0209758_100047712 | 238 |
| 477 | 3300025297 | Ga0209758_1004503 | Ga0209758_10045036 | 238 |
| 478 | 3300025297 | Ga0209758_1005549 | Ga0209758_10055494 | 238 |
| 479 | 3300025297 | Ga0209758_1015752 | Ga0209758_10157521 | 238 |
| 480 | 3300025297 | Ga0209758_1072036 | Ga0209758_10720361 | 238 |
| 481 | 3300025302 | Ga0207426_1000519 | Ga0207426_100051947 | 238 |
| 482 | 3300025302 | Ga0207426_1002865 | Ga0207426_10028655 | 238 |
| 483 | 3300025302 | Ga0207426_1034266 | Ga0207426_10342662 | 238 |
| 484 | 3300025304 | Ga0209257_1012821 | Ga0209257_10128214 | 238 |
| 485 | 3300025304 | Ga0209257_1055464 | Ga0209257_10554641 | 238 |
| 486 | 3300025321 | Ga0207656_10005611 | Ga0207656_100056113 | 238 |
| 487 | 3300025904 | Ga0207647_10010287 | Ga0207647_100102874 | 238 |
| 488 | 3300025906 | Ga0207699_10012296 | Ga0207699_100122964 | 238 |
| 489 | 3300025911 | Ga0207654_10000362 | Ga0207654_1000036223 | 238 |
| 490 | 3300025911 | Ga0207654_10047895 | Ga0207654_100478952 | 238 |
| 491 | 3300025911 | Ga0207654_10414204 | Ga0207654_104142041 | 238 |
| 492 | 3300025913 | Ga0207695_10015065 | Ga0207695_100150659 | 238 |
| 493 | 3300025914 | Ga0207671_10117645 | Ga0207671_101176452 | 238 |
| 494 | 3300025914 | Ga0207671_10144685 | Ga0207671_101446852 | 238 |
| 495 | 3300025915 | Ga0207693_10012329 | Ga0207693_100123292 | 238 |
| 496 | 3300025916 | Ga0207663_10069094 | Ga0207663_100690942 | 238 |
| 497 | 3300025920 | Ga0207649_10118855 | Ga0207649_101188551 | 238 |
| 498 | 3300025923 | Ga0207681_10028626 | Ga0207681_100286263 | 238 |
| 499 | 3300025924 | Ga0207694_10003423 | Ga0207694_100034237 | 238 |
| 500 | 3300025924 | Ga0207694_10589064 | Ga0207694_105890641 | 238 |
| 501 | 3300025925 | Ga0207650_10059546 | Ga0207650_100595462 | 238 |
| 502 | 3300025928 | Ga0207700_10088533 | Ga0207700_100885332 | 238 |
| 503 | 3300025931 | Ga0207644_10313936 | Ga0207644_103139362 | 238 |
| 504 | 3300025933 | Ga0207706_10025090 | Ga0207706_100250902 | 238 |
| 505 | 3300025933 | Ga0207706_10109875 | Ga0207706_101098752 | 238 |
| 506 | 3300025934 | Ga0207686_10098133 | Ga0207686_100981332 | 238 |
| 507 | 3300025937 | Ga0207669_10317247 | Ga0207669_103172471 | 238 |
| 508 | 3300025939 | Ga0207665_10322553 | Ga0207665_103225532 | 238 |
| 509 | 3300025939 | Ga0207665_10396899 | Ga0207665_103968991 | 238 |
| 510 | 3300025942 | Ga0207689_10020163 | Ga0207689_100201635 | 238 |
| 511 | 3300025949 | Ga0207667_10247110 | Ga0207667_102471103 | 238 |
| 512 | 3300025961 | Ga0207712_10098163 | Ga0207712_100981632 | 238 |
| 513 | 3300025961 | Ga0207712_10347932 | Ga0207712_103479322 | 238 |
| 514 | 3300025972 | Ga0207668_10010843 | Ga0207668_100108433 | 238 |
| 515 | 3300025986 | Ga0207658_10188719 | Ga0207658_101887192 | 238 |
| 516 | 3300026023 | Ga0207677_10249913 | Ga0207677_102499132 | 238 |
| 517 | 3300026067 | Ga0207678_10018566 | Ga0207678_100185665 | 238 |
| 518 | 3300026067 | Ga0207678_10050635 | Ga0207678_100506352 | 238 |
| 519 | 3300026067 | Ga0207678_10055824 | Ga0207678_100558241 | 238 |
| 520 | 3300026075 | Ga0207708_10049323 | Ga0207708_100493232 | 238 |
| 521 | 3300026078 | Ga0207702_10006411 | Ga0207702_100064114 | 238 |
| 522 | 3300026088 | Ga0207641_10087916 | Ga0207641_100879161 | 238 |
| 523 | 3300026116 | Ga0207674_10640649 | Ga0207674_106406491 | 238 |
| 524 | 3300026118 | Ga0207675_100004262 | Ga0207675_10000426210 | 238 |
| 525 | 3300026121 | Ga0207683_10385360 | Ga0207683_103853602 | 238 |
| 526 | 3300026142 | Ga0207698_10674402 | Ga0207698_106744021 | 238 |
| 527 | 3300027296 | Ga0209389_1000014 | Ga0209389_100001412 | 238 |
| 528 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007744 | 238 |
| 529 | 3300027357 | Ga0209589_1000020 | Ga0209589_100002012 | 238 |
| 530 | 3300027361 | Ga0209489_100251 | Ga0209489_10025144 | 238 |
| 531 | 3300027361 | Ga0209489_102003 | Ga0209489_10200332 | 238 |
| 532 | 3300027363 | Ga0209700_100271 | Ga0209700_10027143 | 238 |
| 533 | 3300027907 | Ga0207428_10252578 | Ga0207428_102525782 | 238 |
| 534 | 3300028380 | Ga0268265_10024207 | Ga0268265_100242074 | 238 |
| 535 | 3300028381 | Ga0268264_10353273 | Ga0268264_103532731 | 238 |
| 536 | 3300031507 | Ga0307509_10105524 | Ga0307509_101055242 | 238 |
| 537 | 3300031507 | Ga0307509_10223383 | Ga0307509_102233833 | 238 |
| 538 | 3300032126 | Ga0307415_100559271 | Ga0307415_1005592711 | 238 |
| 539 | 3300033179 | Ga0307507_10130688 | Ga0307507_101306882 | 238 |
| 540 | 3300033180 | Ga0307510_10001008 | Ga0307510_100010083 | 238 |
| 541 | 3300035086 | Ga0373934_0004035 | Ga0373934_0004035_143_883 | 238 |
| 542 | 3300035111 | Ga0373923_0164927 | Ga0373923_0164927_141_881 | 238 |
| 543 | 3300035119 | Ga0373956_0017618 | Ga0373956_0017618_2258_2998 | 238 |
| 544 | 3300035120 | Ga0373957_0006199 | Ga0373957_0006199_1552_2268 | 238 |
| 545 | 3300035170 | Ga0373943_0000953 | Ga0373943_0000953_10821_11594 | 238 |
| 546 | 3300035171 | Ga0373946_0010421 | Ga0373946_0010421_2483_3256 | 238 |
| 547 | 3300035692 | Ga0373935_0013477 | Ga0373935_0013477_1272_2045 | 238 |
| 548 | 3300035695 | Ga0373927_0004609 | Ga0373927_0004609_4293_5009 | 238 |
| 549 | 3300035695 | Ga0373927_0010739 | Ga0373927_0010739_2500_3273 | 238 |
| 550 | 3300035695 | Ga0373927_0015300 | Ga0373927_0015300_1791_2513 | 238 |
| 551 | 3300035695 | Ga0373927_0379164 | Ga0373927_0379164_154_903 | 238 |
| 552 | 3300035724 | Ga0373933_0000259 | Ga0373933_0000259_30044_30769 | 238 |
| 553 | 3300035724 | Ga0373933_0013342 | Ga0373933_0013342_1248_1964 | 238 |
| 554 | 3300035724 | Ga0373933_0081286 | Ga0373933_0081286_560_1333 | 238 |
| 555 | 3300035725 | Ga0373947_0001734 | Ga0373947_0001734_10710_11483 | 238 |
| 556 | 3300035725 | Ga0373947_0084431 | Ga0373947_0084431_742_1464 | 238 |
| 557 | 3300035725 | Ga0373947_0226871 | Ga0373947_0226871_69_785 | 238 |
| 558 | 3300036401 | Ga0373937_0101332 | Ga0373937_0101332_1253_1969 | 238 |
| 559 | 3300037068 | Ga0373925_0001112 | Ga0373925_0001112_2086_2859 | 238 |
| 560 | 3300037418 | Ga0395900_0161423 | Ga0395900_0161423_277_993 | 238 |
| 561 | 3300037466 | Ga0395898_0143981 | Ga0395898_0143981_453_1169 | 238 |
| 562 | 3300037471 | Ga0395905_0066394 | Ga0395905_0066394_114_830 | 238 |
| 563 | 3300038443 | Ga0395901_0700179 | Ga0395901_0700179_197_913 | 238 |
| 564 | 3300044656 | Ga0466969_0021935 | Ga0466969_0021935_106_822 | 238 |
| 565 | 3300044658 | Ga0466972_0000850 | Ga0466972_0000850_9128_9874 | 238 |
| 566 | 3300044658 | Ga0466972_0008407 | Ga0466972_0008407_394_1110 | 238 |
| 567 | 3300044683 | Ga0466965_0019791 | Ga0466965_0019791_844_1560 | 238 |
| 568 | 3300044684 | Ga0466966_0000398 | Ga0466966_0000398_10658_11374 | 238 |
| 569 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_26433_27149 | 238 |
| 570 | 3300044706 | Ga0466964_0022629 | Ga0466964_0022629_969_1685 | 238 |
| 571 | 3300044706 | Ga0466964_0193029 | Ga0466964_0193029_142_888 | 238 |
| 572 | 3300044735 | Ga0466968_0001684 | Ga0466968_0001684_6050_6766 | 238 |
| 573 | 3300044735 | Ga0466968_0063925 | Ga0466968_0063925_788_1519 | 238 |
| 574 | 3300045049 | Ga0466959_0012763 | Ga0466959_0012763_4078_4794 | 238 |
| 575 | 3300046454 | Ga0495592_0005289 | Ga0495592_0005289_118_891 | 238 |
| 576 | 3300046454 | Ga0495592_0019337 | Ga0495592_0019337_1420_2136 | 238 |
| 577 | 3300046454 | Ga0495592_0094382 | Ga0495592_0094382_167_898 | 238 |
| 578 | 3300046455 | Ga0495603_0000003 | Ga0495603_0000003_4124_4897 | 238 |
| 579 | 3300046455 | Ga0495603_0020698 | Ga0495603_0020698_688_1410 | 238 |
| 580 | 3300046459 | Ga0495629_0002300 | Ga0495629_0002300_2943_3659 | 238 |
| 581 | 3300046459 | Ga0495629_0002388 | Ga0495629_0002388_1010_1783 | 238 |
| 582 | 3300046460 | Ga0495638_0007340 | Ga0495638_0007340_1207_1935 | 238 |
| 583 | 3300046461 | Ga0495641_0017124 | Ga0495641_0017124_2209_2982 | 238 |
| 584 | 3300046462 | Ga0495651_0002716 | Ga0495651_0002716_654_1385 | 238 |
| 585 | 3300046463 | Ga0495653_0009161 | Ga0495653_0009161_4796_5512 | 238 |
| 586 | 3300046463 | Ga0495653_0087384 | Ga0495653_0087384_846_1577 | 238 |
| 587 | 3300046472 | Ga0495580_0011056 | Ga0495580_0011056_4124_4897 | 238 |
| 588 | 3300046472 | Ga0495580_0097636 | Ga0495580_0097636_878_1600 | 238 |
| 589 | 3300046473 | Ga0495582_0000016 | Ga0495582_0000016_2935_3708 | 238 |
| 590 | 3300046473 | Ga0495582_0073967 | Ga0495582_0073967_335_1069 | 238 |
| 591 | 3300046474 | Ga0495605_0154494 | Ga0495605_0154494_232_948 | 238 |
| 592 | 3300046475 | Ga0495639_0000075 | Ga0495639_0000075_21619_22392 | 238 |
| 593 | 3300046476 | Ga0495662_0007611 | Ga0495662_0007611_3256_4029 | 238 |
| 594 | 3300046499 | Ga0495594_0000120 | Ga0495594_0000120_14512_15285 | 238 |
| 595 | 3300046499 | Ga0495594_0082632 | Ga0495594_0082632_594_1328 | 238 |
| 596 | 3300046511 | Ga0495608_0013892 | Ga0495608_0013892_4130_4846 | 238 |
| 597 | 3300046511 | Ga0495608_0220873 | Ga0495608_0220873_146_919 | 238 |
| 598 | 3300046513 | Ga0495616_0091027 | Ga0495616_0091027_600_1334 | 238 |
| 599 | 3300046517 | Ga0495630_0028164 | Ga0495630_0028164_193_966 | 238 |
| 600 | 3300046519 | Ga0495632_0084311 | Ga0495632_0084311_113_847 | 238 |
| 601 | 3300046522 | Ga0495643_0030555 | Ga0495643_0030555_2211_2927 | 238 |
| 602 | 3300046529 | Ga0495652_0078960 | Ga0495652_0078960_330_1061 | 238 |
| 603 | 3300046529 | Ga0495652_0109220 | Ga0495652_0109220_881_1654 | 238 |
| 604 | 3300046529 | Ga0495652_0116353 | Ga0495652_0116353_1050_1781 | 238 |
| 605 | 3300046531 | Ga0495665_0000085 | Ga0495665_0000085_30619_31392 | 238 |
| 606 | 3300046533 | Ga0495640_0000210 | Ga0495640_0000210_26004_26777 | 238 |
| 607 | 3300046533 | Ga0495640_0010058 | Ga0495640_0010058_6580_7320 | 238 |
| 608 | 3300046533 | Ga0495640_0101981 | Ga0495640_0101981_148_879 | 238 |
| 609 | 3300046536 | Ga0495587_0026481 | Ga0495587_0026481_1195_1926 | 238 |
| 610 | 3300046536 | Ga0495587_0060146 | Ga0495587_0060146_613_1329 | 238 |
| 611 | 3300046537 | Ga0495598_0010898 | Ga0495598_0010898_786_1520 | 238 |
| 612 | 3300046538 | Ga0495609_0077071 | Ga0495609_0077071_130_858 | 238 |
| 613 | 3300046543 | Ga0495645_0020410 | Ga0495645_0020410_1676_2392 | 238 |
| 614 | 3300046543 | Ga0495645_0057451 | Ga0495645_0057451_1802_2533 | 238 |
| 615 | 3300046557 | Ga0495622_0042463 | Ga0495622_0042463_876_1592 | 238 |
| 616 | 3300046557 | Ga0495622_0095260 | Ga0495622_0095260_229_1002 | 238 |
| 617 | 3300046557 | Ga0495622_0223677 | Ga0495622_0223677_37_786 | 238 |
| 618 | 3300046559 | Ga0495667_0018048 | Ga0495667_0018048_2069_2842 | 238 |
| 619 | 3300046642 | Ga0495634_0000064 | Ga0495634_0000064_73460_74233 | 238 |
| 620 | 3300046648 | Ga0495611_0081154 | Ga0495611_0081154_103_837 | 238 |
| 621 | 3300046660 | Ga0495625_0186698 | Ga0495625_0186698_510_1244 | 238 |
| 622 | 3300046663 | Ga0495635_0000316 | Ga0495635_0000316_22833_23606 | 238 |
| 623 | 3300046663 | Ga0495635_0003249 | Ga0495635_0003249_7039_7770 | 238 |
| 624 | 3300046663 | Ga0495635_0010884 | Ga0495635_0010884_2729_3445 | 238 |
| 625 | 3300046664 | Ga0495659_0072596 | Ga0495659_0072596_521_1255 | 238 |
| 626 | 3300046674 | Ga0495588_0012912 | Ga0495588_0012912_154_927 | 238 |
| 627 | 3300046674 | Ga0495588_0028614 | Ga0495588_0028614_1614_2348 | 238 |
| 628 | 3300046675 | Ga0495657_0002292 | Ga0495657_0002292_14151_14882 | 238 |
| 629 | 3300046675 | Ga0495657_0014085 | Ga0495657_0014085_3046_3762 | 238 |
| 630 | 3300046678 | Ga0495599_0018009 | Ga0495599_0018009_2226_2942 | 238 |
| 631 | 3300046679 | Ga0495623_0008931 | Ga0495623_0008931_2538_3254 | 238 |
| 632 | 3300046679 | Ga0495623_0020342 | Ga0495623_0020342_1505_2236 | 238 |
| 633 | 3300046680 | Ga0495646_0018497 | Ga0495646_0018497_1207_1923 | 238 |
| 634 | 3300046680 | Ga0495646_0039598 | Ga0495646_0039598_2004_2735 | 238 |
| 635 | 3300046680 | Ga0495646_0056170 | Ga0495646_0056170_16_789 | 238 |
| 636 | 3300046681 | Ga0495647_0000458 | Ga0495647_0000458_2181_2954 | 238 |
| 637 | 3300046683 | Ga0495658_0018062 | Ga0495658_0018062_1750_2523 | 238 |
| 638 | 3300046683 | Ga0495658_0222876 | Ga0495658_0222876_32_760 | 238 |
| 639 | 3300046689 | Ga0495613_0001871 | Ga0495613_0001871_3269_4042 | 238 |
| 640 | 3300046689 | Ga0495613_0024647 | Ga0495613_0024647_2073_2789 | 238 |
| 641 | 3300046690 | Ga0495624_0001019 | Ga0495624_0001019_13701_14474 | 238 |
| 642 | 3300046690 | Ga0495624_0334257 | Ga0495624_0334257_61_795 | 238 |
| 643 | 3300046692 | Ga0495671_0097575 | Ga0495671_0097575_481_1209 | 238 |
| 644 | 3300046809 | Ga0495600_0002145 | Ga0495600_0002145_4469_5200 | 238 |
| 645 | 3300046809 | Ga0495600_0011351 | Ga0495600_0011351_939_1655 | 238 |
| 646 | 3300047315 | Ga0495581_0000014 | Ga0495581_0000014_11409_12182 | 238 |
| 647 | 3300047317 | Ga0495604_0014542 | Ga0495604_0014542_1113_1844 | 238 |
| 648 | 3300047319 | Ga0495674_0001069 | Ga0495674_0001069_23614_24387 | 238 |
| 649 | 3300047319 | Ga0495674_0009927 | Ga0495674_0009927_1944_2675 | 238 |
| 650 | 3300047319 | Ga0495674_0017430 | Ga0495674_0017430_5534_6250 | 238 |
| 651 | 3300047321 | Ga0495676_0035698 | Ga0495676_0035698_1540_2313 | 238 |
| 652 | 3300047321 | Ga0495676_0133803 | Ga0495676_0133803_246_980 | 238 |
| 653 | 3300047322 | Ga0495680_0000920 | Ga0495680_0000920_25570_26301 | 238 |
| 654 | 3300047322 | Ga0495680_0013405 | Ga0495680_0013405_4957_5673 | 238 |
| 655 | 3300047443 | Ga0495687_012531 | Ga0495687_012531_901_1617 | 238 |
| 656 | 3300047444 | Ga0495675_0003133 | Ga0495675_0003133_5334_6065 | 238 |
| 657 | 3300047444 | Ga0495675_0073058 | Ga0495675_0073058_744_1460 | 238 |
| 658 | 3300047469 | Ga0495673_0061120 | Ga0495673_0061120_697_1425 | 238 |
| 659 | 3300047471 | Ga0495684_0014478 | Ga0495684_0014478_4560_5276 | 238 |
| 660 | 3300047471 | Ga0495684_0031025 | Ga0495684_0031025_1464_2237 | 238 |
| 661 | 3300047471 | Ga0495684_0135403 | Ga0495684_0135403_394_1125 | 238 |
| 662 | 3300047673 | Ga0495593_0000003 | Ga0495593_0000003_40191_40964 | 238 |
| 663 | 3300047673 | Ga0495593_0001206 | Ga0495593_0001206_2111_2827 | 238 |
| 664 | 3300047673 | Ga0495593_0202992 | Ga0495593_0202992_176_910 | 238 |
| 665 | 3300048088 | Ga0495602_0003728 | Ga0495602_0003728_5893_6624 | 238 |
| 666 | 3300048088 | Ga0495602_0105152 | Ga0495602_0105152_921_1652 | 238 |
| 667 | 3300048088 | Ga0495602_0116253 | Ga0495602_0116253_1238_1978 | 238 |
| 668 | 3300048089 | Ga0495614_0022823 | Ga0495614_0022823_412_1185 | 238 |
| 669 | 3300048904 | Ga0496101_0220438 | Ga0496101_0220438_78_794 | 238 |
| 670 | 3300048905 | Ga0496102_0361356 | Ga0496102_0361356_68_802 | 238 |
| 671 | 3300048906 | Ga0496103_0021025 | Ga0496103_0021025_442_1176 | 238 |
| 672 | 3300048906 | Ga0496103_0031264 | Ga0496103_0031264_76_792 | 238 |
| 673 | 3300048909 | Ga0496106_0002346 | Ga0496106_0002346_5328_6077 | 238 |
| 674 | 3300048909 | Ga0496106_0204797 | Ga0496106_0204797_783_1520 | 238 |
| 675 | 3300048909 | Ga0496106_0478801 | Ga0496106_0478801_178_906 | 238 |
| 676 | 3300048910 | Ga0496107_0129883 | Ga0496107_0129883_458_1186 | 238 |
| 677 | 3300048912 | Ga0496109_0080565 | Ga0496109_0080565_563_1291 | 238 |
| 678 | 3300048912 | Ga0496109_0223436 | Ga0496109_0223436_105_833 | 238 |
| 679 | 3300048913 | Ga0496110_0137169 | Ga0496110_0137169_1430_2146 | 238 |
| 680 | 3300048914 | Ga0496111_0421284 | Ga0496111_0421284_12_728 | 238 |
| 681 | 3300048915 | Ga0496112_0328673 | Ga0496112_0328673_59_775 | 238 |
| 682 | 3300048920 | Ga0496117_0015622 | Ga0496117_0015622_4058_4807 | 238 |
| 683 | 3300048921 | Ga0496118_0003678 | Ga0496118_0003678_8493_9242 | 238 |
| 684 | 3300048922 | Ga0496119_0070280 | Ga0496119_0070280_1189_1905 | 238 |
| 685 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_25152_25901 | 238 |
| 686 | 3300048924 | Ga0496121_0041207 | Ga0496121_0041207_2716_3444 | 238 |
| 687 | 3300048924 | Ga0496121_0148013 | Ga0496121_0148013_174_893 | 238 |
| 688 | 3300048927 | Ga0496124_0000945 | Ga0496124_0000945_2434_3183 | 238 |
| 689 | 3300048927 | Ga0496124_0166897 | Ga0496124_0166897_188_916 | 238 |
| 690 | 3300048927 | Ga0496124_0183289 | Ga0496124_0183289_530_1246 | 238 |
| 691 | 3300048928 | Ga0496125_0029513 | Ga0496125_0029513_4158_4874 | 238 |
| 692 | 3300048928 | Ga0496125_0092489 | Ga0496125_0092489_880_1629 | 238 |
| 693 | 3300048929 | Ga0496126_0007029 | Ga0496126_0007029_240_968 | 238 |
| 694 | 3300048929 | Ga0496126_0025383 | Ga0496126_0025383_2515_3264 | 238 |
| 695 | 3300048929 | Ga0496126_0075080 | Ga0496126_0075080_2128_2859 | 238 |
| 696 | 3300048929 | Ga0496126_0078446 | Ga0496126_0078446_167_895 | 238 |
| 697 | 3300049575 | Ga0501039_0214167 | Ga0501039_0214167_562_1293 | 238 |
| 698 | 3300049578 | Ga0501042_0394894 | Ga0501042_0394894_24_758 | 238 |
| 699 | 3300049583 | Ga0501067_0307634 | Ga0501067_0307634_40_774 | 238 |
| 700 | 3300049741 | Ga0501079_0603553 | Ga0501079_0603553_49_780 | 238 |
| 701 | 3300049824 | Ga0501045_0411103 | Ga0501045_0411103_255_989 | 238 |
| 702 | 3300050490 | nmdc:mga03n38_43845_c1 | nmdc:mga03n38_43845_c1_88_804 | 238 |
| 703 | 3300050491 | nmdc:mga00v17_40681_c1 | nmdc:mga00v17_40681_c1_110_826 | 238 |
| 704 | 3300050492 | nmdc:mga0yw44_11924_c1 | nmdc:mga0yw44_11924_c1_2647_3381 | 238 |
| 705 | 3300050492 | nmdc:mga0yw44_434127_c1 | nmdc:mga0yw44_434127_c1_75_791 | 238 |
| 706 | 3300050493 | nmdc:mga0k408_168110_c1 | nmdc:mga0k408_168110_c1_266_985 | 238 |
| 707 | 3300050507 | nmdc:mga05p37_1023959_c1 | nmdc:mga05p37_1023959_c1_12_731 | 238 |
| 708 | 3300050512 | nmdc:mga0n895_359087_c1 | nmdc:mga0n895_359087_c1_509_1225 | 238 |
| 709 | 3300050516 | nmdc:mga0sz30_30132_c1 | nmdc:mga0sz30_30132_c1_865_1581 | 238 |
| 710 | 3300050516 | nmdc:mga0sz30_75313_c1 | nmdc:mga0sz30_75313_c1_562_1281 | 238 |
| 711 | 3300053080 | Ga0500635_0065956 | Ga0500635_0065956_343_1092 | 238 |
| 712 | 3300053084 | Ga0495595_0006814 | Ga0495595_0006814_1497_2225 | 238 |
| 713 | 3300053084 | Ga0495595_0015829 | Ga0495595_0015829_1385_2101 | 238 |
| 714 | 3300053085 | Ga0495619_0021729 | Ga0495619_0021729_122_838 | 238 |
| 715 | 3300053085 | Ga0495619_0210028 | Ga0495619_0210028_607_1338 | 238 |
| 716 | 3300053087 | Ga0500643_000373 | Ga0500643_000373_3512_4228 | 238 |
| 717 | 3300053091 | Ga0500647_0017242 | Ga0500647_0017242_2539_3270 | 238 |
| 718 | 3300053092 | Ga0500583_0065566 | Ga0500583_0065566_107_841 | 238 |
| 719 | 3300053094 | Ga0500566_0090527 | Ga0500566_0090527_390_1139 | 238 |
| 720 | 3300053096 | Ga0500641_0004265 | Ga0500641_0004265_2225_2953 | 238 |
| 721 | 3300053096 | Ga0500641_0142622 | Ga0500641_0142622_264_998 | 238 |
| 722 | 3300053103 | Ga0500555_001336 | Ga0500555_001336_452_1168 | 238 |
| 723 | 3300053103 | Ga0500555_052378 | Ga0500555_052378_234_962 | 238 |
| 724 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_218852_219583 | 238 |
| 725 | 3300053119 | Ga0500595_002820 | Ga0500595_002820_5284_6012 | 238 |
| 726 | 3300053119 | Ga0500595_008808 | Ga0500595_008808_1527_2243 | 238 |
| 727 | 3300053119 | Ga0500595_033221 | Ga0500595_033221_797_1513 | 238 |
| 728 | 3300053119 | Ga0500595_039818 | Ga0500595_039818_617_1366 | 238 |
| 729 | 3300053126 | Ga0500621_177525 | Ga0500621_177525_16_750 | 238 |
| 730 | 3300053128 | Ga0500626_138529 | Ga0500626_138529_42_758 | 238 |
| 731 | 3300053130 | Ga0500642_0000138 | Ga0500642_0000138_27003_27734 | 238 |
| 732 | 3300053130 | Ga0500642_0117171 | Ga0500642_0117171_14_748 | 238 |
| 733 | 3300053134 | Ga0500658_0125163 | Ga0500658_0125163_222_938 | 238 |
| 734 | 3300053139 | Ga0500568_0109897 | Ga0500568_0109897_217_936 | 238 |
| 735 | 3300053148 | Ga0500590_070052 | Ga0500590_070052_307_1035 | 238 |
| 736 | 3300053148 | Ga0500590_077517 | Ga0500590_077517_678_1427 | 238 |
| 737 | 3300053150 | Ga0500603_035685 | Ga0500603_035685_70_819 | 238 |
| 738 | 3300053151 | Ga0500604_0029028 | Ga0500604_0029028_583_1311 | 238 |
| 739 | 3300053154 | Ga0500619_094840 | Ga0500619_094840_159_902 | 238 |
| 740 | 3300053156 | Ga0500622_0000277 | Ga0500622_0000277_31813_32529 | 238 |
| 741 | 3300053156 | Ga0500622_0167627 | Ga0500622_0167627_116_844 | 238 |
| 742 | 3300053161 | Ga0500634_0101815 | Ga0500634_0101815_485_1219 | 238 |
| 743 | 3300053162 | Ga0500638_128751 | Ga0500638_128751_328_1056 | 238 |
| 744 | 3300053177 | Ga0500636_0082459 | Ga0500636_0082459_998_1729 | 238 |
| 745 | 3300053727 | Ga0500611_072872 | Ga0500611_072872_39_773 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.9217 | 65 | 235 |
| 2cx4-assembly4.cif.gz_H | crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) | 0.9111 | 66 | 237 |
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.8992 | 65 | 235 |
| 2yjh-assembly1.cif.gz_A-2 | thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s | 0.8869 | 63 | 226 |
| 5c04-assembly1.cif.gz_B | crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis | 0.8849 | 64 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cx4E00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9132 | 66 | 237 | 3.40.30.10 |
| af_I1MS47_66_213_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8864 | 66 | 233 | 3.40.30.10 |
| 2cx4E00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8807 | 66 | 237 | 3.40.30.10 |
| af_Q55E48_3_135_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8789 | 65 | 213 | 3.40.30.10 |
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8782 | 63 | 236 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J4E1C5-F1-model_v4 | Thiol-disulfide oxidoreductase ResA | 0.9762 | 16 | 234 |
GO:0016209
GO:0016491 |
| AF-A0A327KJE9-F1-model_v4 | Thioredoxin domain-containing protein | 0.9742 | 10 | 231 |
GO:0016209
GO:0016491 |
| AF-S5UB94-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9734 | 66 | 156 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A252E8U7-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9721 | 48 | 231 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A252DWE0-F1-model_v4 | deleted | 0.9719 | 48 | 231 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar