F478748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 744 | 317 | 1478 | 351 |
Family's Representative Sequence
| Representative Sequence | 3300035111|Ga0373923_0104027|Ga0373923_0104027_22_1071 |
| Length | 349 |
| Sequence | MPFTAEPLVLTLEERGELEEMSRSRTLPAGDVFRARLILLLAEGLPYRTIEEKLATTAPTIARWRARFEEGRVAGLLEVRHPGQQPTVITPALQAKVLSATRKKPSDGSTHWSCRKLAKHLHISKDAVQRIWHKAGLKPHRLERYMASDDPDFERKATDIIGLYLQPPQHAAIFCVDEKSAIQALDRLDPVLPMSPGRAERHGFEYYRHGTLSLYAALDVRTGKVHGKTAARHTSDEFVSFLGDVVGDCKPQQEIHIILDNLSAHKTAKVLGFLEQHPRVRLHFTPTYSSWLNQVEIWFSKIERDVIARGVFNSVRDLARKLMRYIRAYSKTAHPFKWKYSDVQRRLSC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 235 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 95.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373923_0104027 | 3300035111 | Bacteria | 1255 |
| 2 | CNBas_1000888 | 3300000531 | Unclassified | 1476 |
| 3 | rootH2_10072749 | 3300003320 | Unclassified | 2228 |
| 4 | Ga0065704_10124060 | 3300005289 | Bacteria | 1723 |
| 5 | Ga0065715_10100512 | 3300005293 | Bacteria | 3288 |
| 6 | Ga0070658_10217225 | 3300005327 | Bacteria | 1616 |
| 7 | Ga0070658_10221380 | 3300005327 | Bacteria | 1601 |
| 8 | Ga0070676_10195020 | 3300005328 | Bacteria | 1324 |
| 9 | Ga0070676_10221859 | 3300005328 | Bacteria | 1249 |
| 10 | Ga0070683_100293718 | 3300005329 | Bacteria | 1546 |
| 11 | Ga0070683_100405016 | 3300005329 | Unclassified | 1301 |
| 12 | Ga0070670_100309722 | 3300005331 | Viruses | 1382 |
| 13 | Ga0070670_100349885 | 3300005331 | Bacteria | 1298 |
| 14 | Ga0070677_10052024 | 3300005333 | Bacteria | 1660 |
| 15 | Ga0070677_10087358 | 3300005333 | Bacteria | 1349 |
| 16 | Ga0070666_10059473 | 3300005335 | Bacteria | 2584 |
| 17 | Ga0070666_10072384 | 3300005335 | Bacteria | 2346 |
| 18 | Ga0070666_10262828 | 3300005335 | Bacteria | 1224 |
| 19 | Ga0070680_100273344 | 3300005336 | Unclassified | 1431 |
| 20 | Ga0070682_100064572 | 3300005337 | Bacteria | 2324 |
| 21 | Ga0070682_100208351 | 3300005337 | Bacteria | 1384 |
| 22 | Ga0070682_100288175 | 3300005337 | Unclassified | 1200 |
| 23 | Ga0070682_100290809 | 3300005337 | Bacteria | 1195 |
| 24 | Ga0070660_100149233 | 3300005339 | Unclassified | 1879 |
| 25 | Ga0070660_100166793 | 3300005339 | Unclassified | 1777 |
| 26 | Ga0070660_100349452 | 3300005339 | Bacteria | 1217 |
| 27 | Ga0070689_100248269 | 3300005340 | Bacteria | 1468 |
| 28 | Ga0070687_100101611 | 3300005343 | Bacteria | 1611 |
| 29 | Ga0070661_100060820 | 3300005344 | Unclassified | 2771 |
| 30 | Ga0070661_100061648 | 3300005344 | Bacteria | 2753 |
| 31 | Ga0070661_100069162 | 3300005344 | Bacteria | 2596 |
| 32 | Ga0070661_100153664 | 3300005344 | Unclassified | 1741 |
| 33 | Ga0070661_100252841 | 3300005344 | Bacteria | 1360 |
| 34 | Ga0070661_100283266 | 3300005344 | Bacteria | 1286 |
| 35 | Ga0070692_10087610 | 3300005345 | Bacteria | 1687 |
| 36 | Ga0070668_100255583 | 3300005347 | Bacteria | 1455 |
| 37 | Ga0070668_100331387 | 3300005347 | Unclassified | 1284 |
| 38 | Ga0070669_100097945 | 3300005353 | Bacteria | 2208 |
| 39 | Ga0070669_100341498 | 3300005353 | Bacteria | 1213 |
| 40 | Ga0070669_100385853 | 3300005353 | Bacteria | 1143 |
| 41 | Ga0070675_100093758 | 3300005354 | Bacteria | 2518 |
| 42 | Ga0070675_100148912 | 3300005354 | Unclassified | 2005 |
| 43 | Ga0070675_100326965 | 3300005354 | Bacteria | 1355 |
| 44 | Ga0070671_100401498 | 3300005355 | Bacteria | 1172 |
| 45 | Ga0070674_100194606 | 3300005356 | Unclassified | 1561 |
| 46 | Ga0070674_100318107 | 3300005356 | Bacteria | 1247 |
| 47 | Ga0070673_100068864 | 3300005364 | Bacteria | 2834 |
| 48 | Ga0070673_100295687 | 3300005364 | Bacteria | 1424 |
| 49 | Ga0070688_100195289 | 3300005365 | Unclassified | 1412 |
| 50 | Ga0070688_100241979 | 3300005365 | Bacteria | 1281 |
| 51 | Ga0070659_100045394 | 3300005366 | Unclassified | 3442 |
| 52 | Ga0070659_100065797 | 3300005366 | Bacteria | 2871 |
| 53 | Ga0070659_100080948 | 3300005366 | Bacteria | 2593 |
| 54 | Ga0070659_100229766 | 3300005366 | Bacteria | 1533 |
| 55 | Ga0070659_100240509 | 3300005366 | Unclassified | 1498 |
| 56 | Ga0070659_100251683 | 3300005366 | Unclassified | 1464 |
| 57 | Ga0070659_100336424 | 3300005366 | Bacteria | 1264 |
| 58 | Ga0070659_100397427 | 3300005366 | Bacteria | 1163 |
| 59 | Ga0070667_100092486 | 3300005367 | Bacteria | 2602 |
| 60 | Ga0070667_100142138 | 3300005367 | Bacteria | 2103 |
| 61 | Ga0070667_100159966 | 3300005367 | Unclassified | 1983 |
| 62 | Ga0070703_10059593 | 3300005406 | Bacteria | 1245 |
| 63 | Ga0070714_100192436 | 3300005435 | Bacteria | 1862 |
| 64 | Ga0070714_100268350 | 3300005435 | Bacteria | 1582 |
| 65 | Ga0070714_100462253 | 3300005435 | Bacteria | 1207 |
| 66 | Ga0070713_100072157 | 3300005436 | Bacteria | 2919 |
| 67 | Ga0070713_100278782 | 3300005436 | Bacteria | 1533 |
| 68 | Ga0070713_100297645 | 3300005436 | Bacteria | 1485 |
| 69 | Ga0070713_100385933 | 3300005436 | Bacteria | 1306 |
| 70 | Ga0070710_10034750 | 3300005437 | Bacteria | 2744 |
| 71 | Ga0070710_10045608 | 3300005437 | Unclassified | 2437 |
| 72 | Ga0070711_100042660 | 3300005439 | Bacteria | 3068 |
| 73 | Ga0070711_100165031 | 3300005439 | Unclassified | 1683 |
| 74 | Ga0070711_100350622 | 3300005439 | Unclassified | 1187 |
| 75 | Ga0070705_100209457 | 3300005440 | Bacteria | 1343 |
| 76 | Ga0070705_100263949 | 3300005440 | Bacteria | 1216 |
| 77 | Ga0070700_100069327 | 3300005441 | Bacteria | 2245 |
| 78 | Ga0070700_100247579 | 3300005441 | Bacteria | 1277 |
| 79 | Ga0070694_100366417 | 3300005444 | Bacteria | 1120 |
| 80 | Ga0070708_100344864 | 3300005445 | Unclassified | 1403 |
| 81 | Ga0070663_100055734 | 3300005455 | Bacteria | 2830 |
| 82 | Ga0070663_100189192 | 3300005455 | Unclassified | 1601 |
| 83 | Ga0070663_100189400 | 3300005455 | Bacteria | 1600 |
| 84 | Ga0070663_100224981 | 3300005455 | Bacteria | 1475 |
| 85 | Ga0070663_100393517 | 3300005455 | Bacteria | 1131 |
| 86 | Ga0070678_100093535 | 3300005456 | Bacteria | 2312 |
| 87 | Ga0070678_100115927 | 3300005456 | Unclassified | 2104 |
| 88 | Ga0070678_100116956 | 3300005456 | Bacteria | 2096 |
| 89 | Ga0070678_100271973 | 3300005456 | Bacteria | 1429 |
| 90 | Ga0070678_100281010 | 3300005456 | Bacteria | 1408 |
| 91 | Ga0070662_100164828 | 3300005457 | Unclassified | 1736 |
| 92 | Ga0070662_100168226 | 3300005457 | Bacteria | 1719 |
| 93 | Ga0070662_100217773 | 3300005457 | Bacteria | 1522 |
| 94 | Ga0070662_100242360 | 3300005457 | Bacteria | 1446 |
| 95 | Ga0070662_100406423 | 3300005457 | Unclassified | 1124 |
| 96 | Ga0070681_10136972 | 3300005458 | Bacteria | 2379 |
| 97 | Ga0070681_10245030 | 3300005458 | Bacteria | 1705 |
| 98 | Ga0070681_10284876 | 3300005458 | Bacteria | 1563 |
| 99 | Ga0068867_100344525 | 3300005459 | Bacteria | 1242 |
| 100 | Ga0068867_100362840 | 3300005459 | Bacteria | 1212 |
| 101 | Ga0068867_100365010 | 3300005459 | Unclassified | 1209 |
| 102 | Ga0070707_100269996 | 3300005468 | Bacteria | 1654 |
| 103 | Ga0070707_100411259 | 3300005468 | Bacteria | 1313 |
| 104 | Ga0070698_100199902 | 3300005471 | Unclassified | 1935 |
| 105 | Ga0070698_100342786 | 3300005471 | Bacteria | 1426 |
| 106 | Ga0070699_100079647 | 3300005518 | Bacteria | 2854 |
| 107 | Ga0070699_100214199 | 3300005518 | Bacteria | 1716 |
| 108 | Ga0070699_100415378 | 3300005518 | Bacteria | 1217 |
| 109 | Ga0070679_100043673 | 3300005530 | Unclassified | 4463 |
| 110 | Ga0070679_100082192 | 3300005530 | Unclassified | 3211 |
| 111 | Ga0070679_100211937 | 3300005530 | Bacteria | 1901 |
| 112 | Ga0070679_100253130 | 3300005530 | Bacteria | 1717 |
| 113 | Ga0070679_100261038 | 3300005530 | Bacteria | 1687 |
| 114 | Ga0070679_100362772 | 3300005530 | Bacteria | 1396 |
| 115 | Ga0070684_100086740 | 3300005535 | Plasmid | 2778 |
| 116 | Ga0070684_100373931 | 3300005535 | Unclassified | 1312 |
| 117 | Ga0070697_100131232 | 3300005536 | Bacteria | 2101 |
| 118 | Ga0070697_100262368 | 3300005536 | Unclassified | 1479 |
| 119 | Ga0070697_100311428 | 3300005536 | Bacteria | 1355 |
| 120 | Ga0070697_100418621 | 3300005536 | Bacteria | 1164 |
| 121 | Ga0068853_100014302 | 3300005539 | Bacteria | 6494 |
| 122 | Ga0068853_100132597 | 3300005539 | Unclassified | 2232 |
| 123 | Ga0068853_100416956 | 3300005539 | Bacteria | 1259 |
| 124 | Ga0068853_100519778 | 3300005539 | Bacteria | 1125 |
| 125 | Ga0070672_100024837 | 3300005543 | Bacteria | 4435 |
| 126 | Ga0070672_100206745 | 3300005543 | Bacteria | 1643 |
| 127 | Ga0070672_100254882 | 3300005543 | Bacteria | 1479 |
| 128 | Ga0070672_100274245 | 3300005543 | Bacteria | 1425 |
| 129 | Ga0070695_100184160 | 3300005545 | Bacteria | 1482 |
| 130 | Ga0070696_100138442 | 3300005546 | Bacteria | 1776 |
| 131 | Ga0070693_100138311 | 3300005547 | Unclassified | 1530 |
| 132 | Ga0070693_100175304 | 3300005547 | Bacteria | 1376 |
| 133 | Ga0070693_100188069 | 3300005547 | Bacteria | 1334 |
| 134 | Ga0070665_100142673 | 3300005548 | Bacteria | 2398 |
| 135 | Ga0070665_100222145 | 3300005548 | Bacteria | 1889 |
| 136 | Ga0070665_100402782 | 3300005548 | Bacteria | 1376 |
| 137 | Ga0070704_100209102 | 3300005549 | Bacteria | 1580 |
| 138 | Ga0070704_100321781 | 3300005549 | Bacteria | 1296 |
| 139 | Ga0068855_100029848 | 3300005563 | Bacteria | 6520 |
| 140 | Ga0068855_100359391 | 3300005563 | Unclassified | 1603 |
| 141 | Ga0068855_100398544 | 3300005563 | Bacteria | 1508 |
| 142 | Ga0068855_100464579 | 3300005563 | Bacteria | 1380 |
| 143 | Ga0068855_100501911 | 3300005563 | Bacteria | 1318 |
| 144 | Ga0070664_100076136 | 3300005564 | Unclassified | 2882 |
| 145 | Ga0070664_100111586 | 3300005564 | Bacteria | 2387 |
| 146 | Ga0070664_100287100 | 3300005564 | Bacteria | 1485 |
| 147 | Ga0070664_100301681 | 3300005564 | Unclassified | 1448 |
| 148 | Ga0070664_100416297 | 3300005564 | Bacteria | 1230 |
| 149 | Ga0070664_100469083 | 3300005564 | Bacteria | 1157 |
| 150 | Ga0068857_100146099 | 3300005577 | Bacteria | 2140 |
| 151 | Ga0068857_100514513 | 3300005577 | Unclassified | 1124 |
| 152 | Ga0068854_100194527 | 3300005578 | Unclassified | 1591 |
| 153 | Ga0068856_100075026 | 3300005614 | Bacteria | 3349 |
| 154 | Ga0068856_100103286 | 3300005614 | Bacteria | 2844 |
| 155 | Ga0068856_100248823 | 3300005614 | Bacteria | 1792 |
| 156 | Ga0068856_100377123 | 3300005614 | Bacteria | 1437 |
| 157 | Ga0068856_100445323 | 3300005614 | Bacteria | 1316 |
| 158 | Ga0068856_100497933 | 3300005614 | Unclassified | 1239 |
| 159 | Ga0070702_100078112 | 3300005615 | Unclassified | 1975 |
| 160 | Ga0070702_100265372 | 3300005615 | Bacteria | 1171 |
| 161 | Ga0068852_100369345 | 3300005616 | Bacteria | 1405 |
| 162 | Ga0068852_100372716 | 3300005616 | Bacteria | 1399 |
| 163 | Ga0068852_100473842 | 3300005616 | Bacteria | 1243 |
| 164 | Ga0068859_100172345 | 3300005617 | Bacteria | 2245 |
| 165 | Ga0068859_100226426 | 3300005617 | Bacteria | 1958 |
| 166 | Ga0068859_100232458 | 3300005617 | Unclassified | 1932 |
| 167 | Ga0068859_100286372 | 3300005617 | Viruses | 1740 |
| 168 | Ga0068859_100462544 | 3300005617 | Bacteria | 1364 |
| 169 | Ga0068864_100278113 | 3300005618 | Bacteria | 1562 |
| 170 | Ga0068864_100301774 | 3300005618 | Bacteria | 1499 |
| 171 | Ga0068866_10125269 | 3300005718 | Bacteria | 1453 |
| 172 | Ga0068861_100172167 | 3300005719 | Bacteria | 1795 |
| 173 | Ga0068870_10119191 | 3300005840 | Unclassified | 1518 |
| 174 | Ga0068863_100319686 | 3300005841 | Unclassified | 1507 |
| 175 | Ga0068863_100329946 | 3300005841 | Bacteria | 1483 |
| 176 | Ga0068858_100309899 | 3300005842 | Bacteria | 1507 |
| 177 | Ga0068858_100453303 | 3300005842 | Viruses | 1236 |
| 178 | Ga0068858_100463518 | 3300005842 | Unclassified | 1222 |
| 179 | Ga0068860_100385621 | 3300005843 | Viruses | 1384 |
| 180 | Ga0068862_100094449 | 3300005844 | Bacteria | 2608 |
| 181 | Ga0081455_10067985 | 3300005937 | Bacteria | 2967 |
| 182 | Ga0081538_10013894 | 3300005981 | Bacteria | 6345 |
| 183 | Ga0081538_10098483 | 3300005981 | Bacteria | 1481 |
| 184 | Ga0081538_10121646 | 3300005981 | Unclassified | 1252 |
| 185 | Ga0070717_10277490 | 3300006028 | Unclassified | 1486 |
| 186 | Ga0070717_10312507 | 3300006028 | Bacteria | 1399 |
| 187 | Ga0070717_10319228 | 3300006028 | Unclassified | 1384 |
| 188 | Ga0070717_10342802 | 3300006028 | Bacteria | 1335 |
| 189 | Ga0070715_10032720 | 3300006163 | Bacteria | 2120 |
| 190 | Ga0070716_100152200 | 3300006173 | Bacteria | 1489 |
| 191 | Ga0070716_100164553 | 3300006173 | Bacteria | 1441 |
| 192 | Ga0070716_100176806 | 3300006173 | Unclassified | 1398 |
| 193 | Ga0070716_100195590 | 3300006173 | Bacteria | 1340 |
| 194 | Ga0070716_100215303 | 3300006173 | Bacteria | 1286 |
| 195 | Ga0070716_100220828 | 3300006173 | Unclassified | 1273 |
| 196 | Ga0070712_100180272 | 3300006175 | Unclassified | 1645 |
| 197 | Ga0070712_100185268 | 3300006175 | Bacteria | 1625 |
| 198 | Ga0070712_100254884 | 3300006175 | Unclassified | 1404 |
| 199 | Ga0070712_100358211 | 3300006175 | Bacteria | 1196 |
| 200 | Ga0097621_100201637 | 3300006237 | Bacteria | 1727 |
| 201 | Ga0097621_100260718 | 3300006237 | Bacteria | 1520 |
| 202 | Ga0068871_100251163 | 3300006358 | Bacteria | 1540 |
| 203 | Ga0068871_100306403 | 3300006358 | Bacteria | 1395 |
| 204 | Ga0068871_100414274 | 3300006358 | Bacteria | 1202 |
| 205 | Ga0068871_100429389 | 3300006358 | Bacteria | 1181 |
| 206 | Ga0075428_100459203 | 3300006844 | Bacteria | 1364 |
| 207 | Ga0075431_100274740 | 3300006847 | Bacteria | 1707 |
| 208 | Ga0075431_100468394 | 3300006847 | Bacteria | 1254 |
| 209 | Ga0075433_10014079 | 3300006852 | Bacteria | 6522 |
| 210 | Ga0075433_10041156 | 3300006852 | Plasmid | 4002 |
| 211 | Ga0075433_10346434 | 3300006852 | Bacteria | 1313 |
| 212 | Ga0075433_10420959 | 3300006852 | Bacteria | 1178 |
| 213 | Ga0075434_100173372 | 3300006871 | Bacteria | 2177 |
| 214 | Ga0075434_100284201 | 3300006871 | Bacteria | 1674 |
| 215 | Ga0068865_100221087 | 3300006881 | Bacteria | 1481 |
| 216 | Ga0068865_100237365 | 3300006881 | Bacteria | 1433 |
| 217 | Ga0068865_100265723 | 3300006881 | Bacteria | 1360 |
| 218 | Ga0068865_100310514 | 3300006881 | Bacteria | 1265 |
| 219 | Ga0075436_100078636 | 3300006914 | Bacteria | 2285 |
| 220 | Ga0075436_100201375 | 3300006914 | Unclassified | 1410 |
| 221 | Ga0075436_100218345 | 3300006914 | Bacteria | 1353 |
| 222 | Ga0075436_100246233 | 3300006914 | Bacteria | 1272 |
| 223 | Ga0097620_100172352 | 3300006931 | Bacteria | 2245 |
| 224 | Ga0097620_100226441 | 3300006931 | Bacteria | 1958 |
| 225 | Ga0097620_100232470 | 3300006931 | Unclassified | 1932 |
| 226 | Ga0097620_100286385 | 3300006931 | Viruses | 1740 |
| 227 | Ga0097620_100462549 | 3300006931 | Bacteria | 1364 |
| 228 | Ga0075435_100021274 | 3300007076 | Bacteria | 4986 |
| 229 | Ga0075435_100152987 | 3300007076 | Unclassified | 1940 |
| 230 | Ga0075435_100157184 | 3300007076 | Bacteria | 1913 |
| 231 | Ga0075435_100283355 | 3300007076 | Unclassified | 1415 |
| 232 | Ga0099794_10070774 | 3300007265 | Bacteria | 1708 |
| 233 | Ga0099794_10108078 | 3300007265 | Bacteria | 1392 |
| 234 | Ga0099795_10063706 | 3300007788 | Unclassified | 1375 |
| 235 | Ga0105251_10093855 | 3300009011 | Bacteria | 1376 |
| 236 | Ga0105240_10055087 | 3300009093 | Unclassified | 4980 |
| 237 | Ga0105240_10273048 | 3300009093 | Unclassified | 1945 |
| 238 | Ga0105240_10513682 | 3300009093 | Bacteria | 1330 |
| 239 | Ga0105240_10515624 | 3300009093 | Bacteria | 1327 |
| 240 | Ga0111539_10419893 | 3300009094 | Unclassified | 1558 |
| 241 | Ga0111539_10437439 | 3300009094 | Bacteria | 1523 |
| 242 | Ga0111539_10611461 | 3300009094 | Bacteria | 1269 |
| 243 | Ga0105245_10177706 | 3300009098 | Unclassified | 2031 |
| 244 | Ga0105245_10386237 | 3300009098 | Bacteria | 1395 |
| 245 | Ga0105245_10440702 | 3300009098 | Bacteria | 1309 |
| 246 | Ga0105247_10151257 | 3300009101 | Bacteria | 1529 |
| 247 | Ga0105247_10170597 | 3300009101 | Bacteria | 1446 |
| 248 | Ga0114129_10105138 | 3300009147 | Plasmid | 3902 |
| 249 | Ga0114129_10423399 | 3300009147 | Bacteria | 1751 |
| 250 | Ga0114129_10595489 | 3300009147 | Bacteria | 1433 |
| 251 | Ga0105243_10284021 | 3300009148 | Bacteria | 1492 |
| 252 | Ga0105241_10059419 | 3300009174 | Bacteria | 2939 |
| 253 | Ga0105241_10168726 | 3300009174 | Unclassified | 1806 |
| 254 | Ga0105241_10189298 | 3300009174 | Bacteria | 1712 |
| 255 | Ga0105241_10296294 | 3300009174 | Bacteria | 1387 |
| 256 | Ga0105241_10310511 | 3300009174 | Bacteria | 1356 |
| 257 | Ga0105241_10358461 | 3300009174 | Bacteria | 1268 |
| 258 | Ga0105241_10402985 | 3300009174 | Bacteria | 1200 |
| 259 | Ga0105248_10243301 | 3300009177 | Bacteria | 2025 |
| 260 | Ga0105248_10262783 | 3300009177 | Bacteria | 1943 |
| 261 | Ga0105248_10421473 | 3300009177 | Unclassified | 1503 |
| 262 | Ga0105248_10527918 | 3300009177 | Bacteria | 1331 |
| 263 | Ga0105237_10359745 | 3300009545 | Bacteria | 1460 |
| 264 | Ga0105237_10394042 | 3300009545 | Bacteria | 1389 |
| 265 | Ga0105238_10205618 | 3300009551 | Unclassified | 1945 |
| 266 | Ga0105238_10233118 | 3300009551 | Bacteria | 1817 |
| 267 | Ga0105238_10335908 | 3300009551 | Bacteria | 1498 |
| 268 | Ga0105249_10384768 | 3300009553 | Bacteria | 1430 |
| 269 | Ga0105249_10423375 | 3300009553 | Bacteria | 1366 |
| 270 | Ga0105249_10448593 | 3300009553 | Bacteria | 1328 |
| 271 | Ga0105239_10362360 | 3300010375 | Bacteria | 1637 |
| 272 | Ga0105246_10202633 | 3300011119 | Unclassified | 1544 |
| 273 | Ga0105246_10242955 | 3300011119 | Bacteria | 1424 |
| 274 | Ga0105246_10309291 | 3300011119 | Bacteria | 1279 |
| 275 | Ga0157338_1003370 | 3300012515 | Bacteria | 1322 |
| 276 | Ga0157373_10045259 | 3300013100 | Bacteria | 3142 |
| 277 | Ga0157373_10055595 | 3300013100 | Unclassified | 2812 |
| 278 | Ga0157373_10101002 | 3300013100 | Unclassified | 2030 |
| 279 | Ga0157373_10135618 | 3300013100 | Bacteria | 1731 |
| 280 | Ga0157373_10218638 | 3300013100 | Bacteria | 1344 |
| 281 | Ga0157371_10160217 | 3300013102 | Bacteria | 1607 |
| 282 | Ga0157371_10196872 | 3300013102 | Unclassified | 1444 |
| 283 | Ga0157370_10223874 | 3300013104 | Bacteria | 1742 |
| 284 | Ga0157370_10240731 | 3300013104 | Bacteria | 1674 |
| 285 | Ga0157369_10133255 | 3300013105 | Bacteria | 2632 |
| 286 | Ga0157369_10199777 | 3300013105 | Bacteria | 2099 |
| 287 | Ga0157369_10252868 | 3300013105 | Bacteria | 1839 |
| 288 | Ga0157369_10255225 | 3300013105 | Bacteria | 1829 |
| 289 | Ga0157369_10349393 | 3300013105 | Bacteria | 1536 |
| 290 | Ga0157374_10089312 | 3300013296 | Unclassified | 2936 |
| 291 | Ga0157374_10169048 | 3300013296 | Bacteria | 2132 |
| 292 | Ga0157374_10175869 | 3300013296 | Bacteria | 2089 |
| 293 | Ga0157374_10326941 | 3300013296 | Bacteria | 1520 |
| 294 | Ga0157374_10348439 | 3300013296 | Bacteria | 1471 |
| 295 | Ga0157374_10424450 | 3300013296 | Bacteria | 1329 |
| 296 | Ga0157374_10601412 | 3300013296 | Unclassified | 1110 |
| 297 | Ga0157378_10087490 | 3300013297 | Bacteria | 2826 |
| 298 | Ga0157378_10345412 | 3300013297 | Bacteria | 1452 |
| 299 | Ga0157378_10481142 | 3300013297 | Bacteria | 1237 |
| 300 | Ga0163162_10219993 | 3300013306 | Bacteria | 2029 |
| 301 | Ga0163162_10402181 | 3300013306 | Bacteria | 1502 |
| 302 | Ga0163162_10449446 | 3300013306 | Bacteria | 1421 |
| 303 | Ga0163162_10488062 | 3300013306 | Bacteria | 1363 |
| 304 | Ga0163162_10538500 | 3300013306 | Bacteria | 1296 |
| 305 | Ga0157372_10095063 | 3300013307 | Unclassified | 3395 |
| 306 | Ga0157372_10172149 | 3300013307 | Bacteria | 2505 |
| 307 | Ga0157372_10174519 | 3300013307 | Unclassified | 2488 |
| 308 | Ga0157372_10230936 | 3300013307 | Bacteria | 2145 |
| 309 | Ga0157372_10342421 | 3300013307 | Unclassified | 1742 |
| 310 | Ga0157372_10393912 | 3300013307 | Bacteria | 1614 |
| 311 | Ga0157372_10405841 | 3300013307 | Bacteria | 1588 |
| 312 | Ga0157372_10571183 | 3300013307 | Bacteria | 1318 |
| 313 | Ga0157372_10756534 | 3300013307 | Bacteria | 1130 |
| 314 | Ga0157375_10193056 | 3300013308 | Bacteria | 2191 |
| 315 | Ga0157375_10236359 | 3300013308 | Bacteria | 1987 |
| 316 | Ga0157375_10423544 | 3300013308 | Unclassified | 1497 |
| 317 | Ga0157375_10536480 | 3300013308 | Bacteria | 1332 |
| 318 | Ga0163163_10286135 | 3300014325 | Bacteria | 1700 |
| 319 | Ga0163163_10379714 | 3300014325 | Bacteria | 1471 |
| 320 | Ga0157380_10200137 | 3300014326 | Unclassified | 1771 |
| 321 | Ga0157380_10264565 | 3300014326 | Bacteria | 1564 |
| 322 | Ga0157377_10135867 | 3300014745 | Bacteria | 1507 |
| 323 | Ga0157379_10362992 | 3300014968 | Unclassified | 1327 |
| 324 | Ga0157376_10238219 | 3300014969 | Bacteria | 1694 |
| 325 | Ga0157376_10305488 | 3300014969 | Bacteria | 1507 |
| 326 | Ga0157376_10355415 | 3300014969 | Unclassified | 1403 |
| 327 | Ga0157376_10493196 | 3300014969 | Bacteria | 1202 |
| 328 | Ga0182007_10024421 | 3300015262 | Unclassified | 2114 |
| 329 | Ga0163161_10063859 | 3300017792 | Bacteria | 2685 |
| 330 | Ga0163161_10174555 | 3300017792 | Bacteria | 1645 |
| 331 | Ga0163161_10182751 | 3300017792 | Bacteria | 1609 |
| 332 | Ga0213872_10123171 | 3300021361 | Unclassified | 1145 |
| 333 | Ga0213876_10159964 | 3300021384 | Unclassified | 1198 |
| 334 | Ga0213875_10053243 | 3300021388 | Unclassified | 1895 |
| 335 | Ga0213875_10086588 | 3300021388 | Unclassified | 1461 |
| 336 | Ga0213875_10134202 | 3300021388 | Unclassified | 1157 |
| 337 | Ga0224712_10104504 | 3300022467 | Unclassified | 1206 |
| 338 | Ga0228598_1026016 | 3300024227 | Bacteria | 1151 |
| 339 | Ga0207697_10092584 | 3300025315 | Bacteria | 1282 |
| 340 | Ga0207653_10039471 | 3300025885 | Unclassified | 1546 |
| 341 | Ga0207682_10093885 | 3300025893 | Bacteria | 1304 |
| 342 | Ga0207692_10111811 | 3300025898 | Bacteria | 1516 |
| 343 | Ga0207692_10153650 | 3300025898 | Unclassified | 1320 |
| 344 | Ga0207692_10173472 | 3300025898 | Bacteria | 1251 |
| 345 | Ga0207710_10110546 | 3300025900 | Bacteria | 1305 |
| 346 | Ga0207688_10193022 | 3300025901 | Bacteria | 1219 |
| 347 | Ga0207680_10243111 | 3300025903 | Bacteria | 1241 |
| 348 | Ga0207680_10243775 | 3300025903 | Bacteria | 1239 |
| 349 | Ga0207647_10060511 | 3300025904 | Unclassified | 2315 |
| 350 | Ga0207685_10079037 | 3300025905 | Bacteria | 1356 |
| 351 | Ga0207685_10099697 | 3300025905 | Bacteria | 1240 |
| 352 | Ga0207699_10195240 | 3300025906 | Unclassified | 1368 |
| 353 | Ga0207699_10262488 | 3300025906 | Bacteria | 1194 |
| 354 | Ga0207699_10267495 | 3300025906 | Unclassified | 1183 |
| 355 | Ga0207645_10184659 | 3300025907 | Bacteria | 1369 |
| 356 | Ga0207645_10208275 | 3300025907 | Bacteria | 1288 |
| 357 | Ga0207645_10249339 | 3300025907 | Unclassified | 1174 |
| 358 | Ga0207643_10044770 | 3300025908 | Bacteria | 2498 |
| 359 | Ga0207643_10159421 | 3300025908 | Bacteria | 1357 |
| 360 | Ga0207705_10091115 | 3300025909 | Bacteria | 2233 |
| 361 | Ga0207705_10273678 | 3300025909 | Bacteria | 1291 |
| 362 | Ga0207705_10348083 | 3300025909 | Bacteria | 1141 |
| 363 | Ga0207684_10032773 | 3300025910 | Unclassified | 4418 |
| 364 | Ga0207654_10232768 | 3300025911 | Bacteria | 1228 |
| 365 | Ga0207654_10264081 | 3300025911 | Unclassified | 1159 |
| 366 | Ga0207654_10268661 | 3300025911 | Bacteria | 1150 |
| 367 | Ga0207654_10270225 | 3300025911 | Bacteria | 1147 |
| 368 | Ga0207707_10147265 | 3300025912 | Bacteria | 2059 |
| 369 | Ga0207707_10229775 | 3300025912 | Bacteria | 1614 |
| 370 | Ga0207707_10239589 | 3300025912 | Bacteria | 1577 |
| 371 | Ga0207707_10244838 | 3300025912 | Unclassified | 1558 |
| 372 | Ga0207707_10393024 | 3300025912 | Bacteria | 1191 |
| 373 | Ga0207695_10018179 | 3300025913 | Bacteria | 8134 |
| 374 | Ga0207695_10112199 | 3300025913 | Bacteria | 2705 |
| 375 | Ga0207695_10481603 | 3300025913 | Unclassified | 1123 |
| 376 | Ga0207671_10239111 | 3300025914 | Unclassified | 1426 |
| 377 | Ga0207693_10074518 | 3300025915 | Plasmid | 2658 |
| 378 | Ga0207693_10153248 | 3300025915 | Unclassified | 1813 |
| 379 | Ga0207693_10231593 | 3300025915 | Bacteria | 1450 |
| 380 | Ga0207693_10262937 | 3300025915 | Bacteria | 1353 |
| 381 | Ga0207693_10342932 | 3300025915 | Bacteria | 1169 |
| 382 | Ga0207663_10193105 | 3300025916 | Bacteria | 1463 |
| 383 | Ga0207663_10263046 | 3300025916 | Unclassified | 1275 |
| 384 | Ga0207663_10271385 | 3300025916 | Unclassified | 1257 |
| 385 | Ga0207663_10327326 | 3300025916 | Bacteria | 1153 |
| 386 | Ga0207660_10213706 | 3300025917 | Bacteria | 1511 |
| 387 | Ga0207660_10377429 | 3300025917 | Unclassified | 1139 |
| 388 | Ga0207657_10035291 | 3300025919 | Bacteria | 4485 |
| 389 | Ga0207657_10130641 | 3300025919 | Bacteria | 2058 |
| 390 | Ga0207649_10021878 | 3300025920 | Bacteria | 3689 |
| 391 | Ga0207649_10067822 | 3300025920 | Bacteria | 2266 |
| 392 | Ga0207649_10070808 | 3300025920 | Bacteria | 2225 |
| 393 | Ga0207649_10185658 | 3300025920 | Unclassified | 1459 |
| 394 | Ga0207649_10283004 | 3300025920 | Bacteria | 1206 |
| 395 | Ga0207649_10309591 | 3300025920 | Unclassified | 1157 |
| 396 | Ga0207652_10024409 | 3300025921 | Bacteria | 5016 |
| 397 | Ga0207652_10207616 | 3300025921 | Bacteria | 1763 |
| 398 | Ga0207652_10234582 | 3300025921 | Unclassified | 1653 |
| 399 | Ga0207652_10467552 | 3300025921 | Bacteria | 1136 |
| 400 | Ga0207646_10166143 | 3300025922 | Bacteria | 1992 |
| 401 | Ga0207646_10459295 | 3300025922 | Bacteria | 1149 |
| 402 | Ga0207681_10074123 | 3300025923 | Bacteria | 2383 |
| 403 | Ga0207681_10304285 | 3300025923 | Bacteria | 1262 |
| 404 | Ga0207681_10344986 | 3300025923 | Bacteria | 1190 |
| 405 | Ga0207694_10354291 | 3300025924 | Unclassified | 1215 |
| 406 | Ga0207694_10385131 | 3300025924 | Bacteria | 1164 |
| 407 | Ga0207694_10391161 | 3300025924 | Bacteria | 1155 |
| 408 | Ga0207659_10336459 | 3300025926 | Bacteria | 1249 |
| 409 | Ga0207687_10318394 | 3300025927 | Bacteria | 1258 |
| 410 | Ga0207687_10331464 | 3300025927 | Bacteria | 1235 |
| 411 | Ga0207687_10378849 | 3300025927 | Unclassified | 1159 |
| 412 | Ga0207700_10086842 | 3300025928 | Bacteria | 2459 |
| 413 | Ga0207700_10367141 | 3300025928 | Bacteria | 1256 |
| 414 | Ga0207700_10377057 | 3300025928 | Bacteria | 1240 |
| 415 | Ga0207700_10403488 | 3300025928 | Bacteria | 1198 |
| 416 | Ga0207700_10421015 | 3300025928 | Bacteria | 1173 |
| 417 | Ga0207664_10028368 | 3300025929 | Bacteria | 4253 |
| 418 | Ga0207664_10129128 | 3300025929 | Bacteria | 2125 |
| 419 | Ga0207664_10413312 | 3300025929 | Bacteria | 1201 |
| 420 | Ga0207664_10416630 | 3300025929 | Unclassified | 1196 |
| 421 | Ga0207644_10274692 | 3300025931 | Bacteria | 1351 |
| 422 | Ga0207690_10114771 | 3300025932 | Bacteria | 1945 |
| 423 | Ga0207690_10134869 | 3300025932 | Unclassified | 1811 |
| 424 | Ga0207690_10362068 | 3300025932 | Unclassified | 1149 |
| 425 | Ga0207706_10068215 | 3300025933 | Bacteria | 3130 |
| 426 | Ga0207706_10095913 | 3300025933 | Bacteria | 2608 |
| 427 | Ga0207706_10134784 | 3300025933 | Bacteria | 2172 |
| 428 | Ga0207706_10197445 | 3300025933 | Unclassified | 1765 |
| 429 | Ga0207706_10344650 | 3300025933 | Bacteria | 1296 |
| 430 | Ga0207706_10422870 | 3300025933 | Unclassified | 1154 |
| 431 | Ga0207686_10228606 | 3300025934 | Bacteria | 1347 |
| 432 | Ga0207669_10304248 | 3300025937 | Bacteria | 1213 |
| 433 | Ga0207665_10156980 | 3300025939 | Bacteria | 1634 |
| 434 | Ga0207665_10174300 | 3300025939 | Unclassified | 1555 |
| 435 | Ga0207665_10188907 | 3300025939 | Unclassified | 1495 |
| 436 | Ga0207665_10213722 | 3300025939 | Bacteria | 1410 |
| 437 | Ga0207665_10224276 | 3300025939 | Unclassified | 1379 |
| 438 | Ga0207691_10059414 | 3300025940 | Bacteria | 3476 |
| 439 | Ga0207691_10261065 | 3300025940 | Bacteria | 1493 |
| 440 | Ga0207691_10311351 | 3300025940 | Bacteria | 1351 |
| 441 | Ga0207691_10388152 | 3300025940 | Bacteria | 1191 |
| 442 | Ga0207711_10425498 | 3300025941 | Bacteria | 1235 |
| 443 | Ga0207661_10036263 | 3300025944 | Bacteria | 3848 |
| 444 | Ga0207661_10412234 | 3300025944 | Unclassified | 1226 |
| 445 | Ga0207679_10053942 | 3300025945 | Bacteria | 2957 |
| 446 | Ga0207679_10084945 | 3300025945 | Unclassified | 2430 |
| 447 | Ga0207679_10169094 | 3300025945 | Bacteria | 1798 |
| 448 | Ga0207679_10173765 | 3300025945 | Unclassified | 1776 |
| 449 | Ga0207679_10367938 | 3300025945 | Bacteria | 1257 |
| 450 | Ga0207679_10397096 | 3300025945 | Bacteria | 1212 |
| 451 | Ga0207667_10057799 | 3300025949 | Bacteria | 4070 |
| 452 | Ga0207667_10079257 | 3300025949 | Unclassified | 3404 |
| 453 | Ga0207667_10119523 | 3300025949 | Plasmid | 2716 |
| 454 | Ga0207667_10336645 | 3300025949 | Unclassified | 1540 |
| 455 | Ga0207667_10489738 | 3300025949 | Bacteria | 1248 |
| 456 | Ga0207667_10566873 | 3300025949 | Unclassified | 1147 |
| 457 | Ga0207667_10576851 | 3300025949 | Unclassified | 1136 |
| 458 | Ga0207651_10152885 | 3300025960 | Bacteria | 1799 |
| 459 | Ga0207651_10310083 | 3300025960 | Bacteria | 1315 |
| 460 | Ga0207668_10337720 | 3300025972 | Bacteria | 1255 |
| 461 | Ga0207640_10357294 | 3300025981 | Unclassified | 1176 |
| 462 | Ga0207658_10200036 | 3300025986 | Bacteria | 1667 |
| 463 | Ga0207658_10408088 | 3300025986 | Bacteria | 1195 |
| 464 | Ga0207658_10447591 | 3300025986 | Bacteria | 1143 |
| 465 | Ga0207703_10272083 | 3300026035 | Unclassified | 1535 |
| 466 | Ga0207703_10388259 | 3300026035 | Bacteria | 1293 |
| 467 | Ga0207703_10490273 | 3300026035 | Bacteria | 1152 |
| 468 | Ga0207639_10009030 | 3300026041 | Bacteria | 6865 |
| 469 | Ga0207639_10217133 | 3300026041 | Unclassified | 1649 |
| 470 | Ga0207639_10443857 | 3300026041 | Bacteria | 1177 |
| 471 | Ga0207678_10102472 | 3300026067 | Unclassified | 2444 |
| 472 | Ga0207678_10165354 | 3300026067 | Unclassified | 1889 |
| 473 | Ga0207678_10216197 | 3300026067 | Unclassified | 1640 |
| 474 | Ga0207678_10228880 | 3300026067 | Bacteria | 1592 |
| 475 | Ga0207678_10368430 | 3300026067 | Bacteria | 1241 |
| 476 | Ga0207708_10374010 | 3300026075 | Bacteria | 1173 |
| 477 | Ga0207702_10020373 | 3300026078 | Bacteria | 5493 |
| 478 | Ga0207702_10022282 | 3300026078 | Bacteria | 5250 |
| 479 | Ga0207702_10065041 | 3300026078 | Bacteria | 3123 |
| 480 | Ga0207702_10407809 | 3300026078 | Bacteria | 1312 |
| 481 | Ga0207702_10503259 | 3300026078 | Bacteria | 1181 |
| 482 | Ga0207702_10506546 | 3300026078 | Bacteria | 1177 |
| 483 | Ga0207702_10509861 | 3300026078 | Bacteria | 1173 |
| 484 | Ga0207641_10368239 | 3300026088 | Bacteria | 1373 |
| 485 | Ga0207641_10556992 | 3300026088 | Unclassified | 1118 |
| 486 | Ga0207648_10059514 | 3300026089 | Bacteria | 3331 |
| 487 | Ga0207648_10208217 | 3300026089 | Unclassified | 1735 |
| 488 | Ga0207648_10247181 | 3300026089 | Bacteria | 1590 |
| 489 | Ga0207648_10385996 | 3300026089 | Unclassified | 1267 |
| 490 | Ga0207676_10328128 | 3300026095 | Unclassified | 1407 |
| 491 | Ga0207676_10369772 | 3300026095 | Bacteria | 1331 |
| 492 | Ga0207676_10398506 | 3300026095 | Bacteria | 1285 |
| 493 | Ga0207674_10065416 | 3300026116 | Unclassified | 3665 |
| 494 | Ga0207674_10169444 | 3300026116 | Bacteria | 2137 |
| 495 | Ga0207674_10344903 | 3300026116 | Unclassified | 1440 |
| 496 | Ga0207674_10364157 | 3300026116 | Unclassified | 1397 |
| 497 | Ga0207675_100337944 | 3300026118 | Bacteria | 1474 |
| 498 | Ga0207675_100353105 | 3300026118 | Bacteria | 1441 |
| 499 | Ga0207683_10164375 | 3300026121 | Unclassified | 2008 |
| 500 | Ga0207683_10226711 | 3300026121 | Bacteria | 1703 |
| 501 | Ga0207683_10245029 | 3300026121 | Bacteria | 1635 |
| 502 | Ga0207683_10266097 | 3300026121 | Bacteria | 1566 |
| 503 | Ga0207683_10428523 | 3300026121 | Bacteria | 1219 |
| 504 | Ga0207698_10507875 | 3300026142 | Unclassified | 1174 |
| 505 | Ga0209984_1010850 | 3300027424 | Bacteria | 1174 |
| 506 | Ga0210000_1013427 | 3300027462 | Bacteria | 1222 |
| 507 | Ga0209968_1012321 | 3300027526 | Unclassified | 1332 |
| 508 | Ga0209982_1008329 | 3300027552 | Bacteria | 1520 |
| 509 | Ga0209983_1017187 | 3300027665 | Unclassified | 1496 |
| 510 | Ga0209971_1023436 | 3300027682 | Bacteria | 1473 |
| 511 | Ga0209974_10057539 | 3300027876 | Bacteria | 1313 |
| 512 | Ga0207428_10073657 | 3300027907 | Bacteria | 2679 |
| 513 | Ga0207428_10317202 | 3300027907 | Bacteria | 1152 |
| 514 | Ga0207428_10325969 | 3300027907 | Unclassified | 1133 |
| 515 | Ga0268266_10401168 | 3300028379 | Bacteria | 1296 |
| 516 | Ga0268265_10095557 | 3300028380 | Bacteria | 2386 |
| 517 | Ga0268265_10325775 | 3300028380 | Bacteria | 1393 |
| 518 | Ga0268265_10523177 | 3300028380 | Bacteria | 1121 |
| 519 | Ga0268264_10561556 | 3300028381 | Viruses | 1121 |
| 520 | Ga0265760_10021438 | 3300031090 | Unclassified | 1870 |
| 521 | Ga0265760_10023382 | 3300031090 | Bacteria | 1796 |
| 522 | Ga0265760_10051539 | 3300031090 | Bacteria | 1240 |
| 523 | Ga0265325_10104842 | 3300031241 | Unclassified | 1380 |
| 524 | Ga0265316_10322222 | 3300031344 | Unclassified | 1122 |
| 525 | Ga0307411_10278791 | 3300032005 | Bacteria | 1329 |
| 526 | Ga0373930_0018401 | 3300034816 | Unclassified | 1342 |
| 527 | Ga0373930_0020507 | 3300034816 | Bacteria | 1289 |
| 528 | Ga0373958_0018361 | 3300034819 | Unclassified | 1267 |
| 529 | Ga0373959_0016053 | 3300034820 | Unclassified | 1383 |
| 530 | Ga0373926_0060479 | 3300035083 | Bacteria | 1380 |
| 531 | Ga0373928_0023318 | 3300035084 | Unclassified | 1319 |
| 532 | Ga0373929_0024187 | 3300035085 | Unclassified | 1253 |
| 533 | Ga0373934_0051542 | 3300035086 | Bacteria | 1631 |
| 534 | Ga0373949_0038880 | 3300035090 | Bacteria | 1162 |
| 535 | Ga0373951_0027661 | 3300035091 | Unclassified | 1325 |
| 536 | Ga0373951_0040490 | 3300035091 | Bacteria | 1122 |
| 537 | Ga0373952_0016898 | 3300035092 | Bacteria | 1490 |
| 538 | Ga0373923_0046464 | 3300035111 | Bacteria | 1806 |
| 539 | Ga0373923_0093142 | 3300035111 | Bacteria | 1320 |
| 540 | Ga0373923_0110244 | 3300035111 | Bacteria | 1221 |
| 541 | Ga0373932_0027704 | 3300035112 | Bacteria | 1552 |
| 542 | Ga0373939_0022858 | 3300035114 | Unclassified | 1727 |
| 543 | Ga0373941_0032766 | 3300035115 | Bacteria | 1557 |
| 544 | Ga0373941_0056597 | 3300035115 | Unclassified | 1263 |
| 545 | Ga0373953_0114477 | 3300035117 | Bacteria | 1142 |
| 546 | Ga0373953_0119832 | 3300035117 | Bacteria | 1117 |
| 547 | Ga0373960_0028129 | 3300035121 | Unclassified | 1549 |
| 548 | Ga0373943_0074765 | 3300035170 | Bacteria | 1723 |
| 549 | Ga0373943_0078063 | 3300035170 | Bacteria | 1692 |
| 550 | Ga0373946_0017225 | 3300035171 | Bacteria | 2762 |
| 551 | Ga0373946_0104041 | 3300035171 | Bacteria | 1276 |
| 552 | Ga0373946_0116434 | 3300035171 | Unclassified | 1215 |
| 553 | Ga0373955_0095384 | 3300035172 | Bacteria | 1701 |
| 554 | Ga0373955_0154520 | 3300035172 | Bacteria | 1351 |
| 555 | Ga0373961_0033849 | 3300035241 | Unclassified | 1441 |
| 556 | Ga0373962_0028143 | 3300035242 | Unclassified | 1523 |
| 557 | Ga0373924_0081391 | 3300035410 | Bacteria | 1377 |
| 558 | Ga0373931_0143990 | 3300035691 | Bacteria | 1383 |
| 559 | Ga0373931_0164811 | 3300035691 | Bacteria | 1301 |
| 560 | Ga0373931_0186125 | 3300035691 | Unclassified | 1232 |
| 561 | Ga0373931_0214736 | 3300035691 | Unclassified | 1155 |
| 562 | Ga0373935_0149423 | 3300035692 | Bacteria | 1584 |
| 563 | Ga0373935_0189355 | 3300035692 | Bacteria | 1416 |
| 564 | Ga0373935_0221417 | 3300035692 | Bacteria | 1314 |
| 565 | Ga0373935_0255061 | 3300035692 | Bacteria | 1228 |
| 566 | Ga0373927_0048002 | 3300035695 | Plasmid | 2761 |
| 567 | Ga0373927_0138606 | 3300035695 | Unclassified | 1590 |
| 568 | Ga0373927_0147157 | 3300035695 | Bacteria | 1542 |
| 569 | Ga0373927_0214136 | 3300035695 | Bacteria | 1265 |
| 570 | Ga0373933_0062598 | 3300035724 | Bacteria | 2247 |
| 571 | Ga0373933_0073667 | 3300035724 | Bacteria | 2081 |
| 572 | Ga0373947_0059558 | 3300035725 | Bacteria | 2315 |
| 573 | Ga0373947_0105573 | 3300035725 | Bacteria | 1774 |
| 574 | Ga0373947_0238036 | 3300035725 | Bacteria | 1200 |
| 575 | Ga0373947_0249507 | 3300035725 | Bacteria | 1173 |
| 576 | Ga0373937_0084798 | 3300036401 | Unclassified | 2931 |
| 577 | Ga0373937_0329867 | 3300036401 | Bacteria | 1444 |
| 578 | Ga0316582_0209836 | 3300036647 | Bacteria | 1330 |
| 579 | Ga0373925_0016340 | 3300037068 | Bacteria | 5374 |
| 580 | Ga0373925_0171633 | 3300037068 | Unclassified | 1712 |
| 581 | Ga0373925_0198331 | 3300037068 | Unclassified | 1595 |
| 582 | Ga0373925_0212116 | 3300037068 | Unclassified | 1543 |
| 583 | Ga0373925_0215302 | 3300037068 | Bacteria | 1531 |
| 584 | Ga0373925_0223608 | 3300037068 | Unclassified | 1503 |
| 585 | Ga0436364_0429406 | 3300037853 | Bacteria | 1616 |
| 586 | Ga0436364_1016885 | 3300037853 | Bacteria | 2097 |
| 587 | Ga0436364_1280539 | 3300037853 | Unclassified | 1642 |
| 588 | Ga0395901_0458930 | 3300038443 | Unclassified | 1302 |
| 589 | Ga0436365_1179962 | 3300039437 | Unclassified | 1508 |
| 590 | Ga0436365_1282369 | 3300039437 | Bacteria | 1194 |
| 591 | Ga0436360_0177423 | 3300039438 | Bacteria | 1282 |
| 592 | Ga0436360_1198479 | 3300039438 | Unclassified | 1409 |
| 593 | Ga0436361_0110909 | 3300039447 | Bacteria | 2075 |
| 594 | Ga0436361_0984751 | 3300039447 | Unclassified | 1951 |
| 595 | Ga0436363_0273568 | 3300039450 | Bacteria | 1764 |
| 596 | Ga0436363_1702755 | 3300039450 | Bacteria | 1816 |
| 597 | Ga0439448_0055631 | 3300042005 | Bacteria | 1301 |
| 598 | Ga0439435_0031562 | 3300042436 | Bacteria | 1441 |
| 599 | Ga0450918_020587 | 3300042531 | Bacteria | 1152 |
| 600 | Ga0451577_0422135 | 3300042876 | Bacteria | 1211 |
| 601 | Ga0453683_0213058 | 3300044673 | Unclassified | 1227 |
| 602 | Ga0466966_0144323 | 3300044684 | Bacteria | 1453 |
| 603 | Ga0466966_0161107 | 3300044684 | Bacteria | 1366 |
| 604 | Ga0466963_0240385 | 3300044694 | Bacteria | 1270 |
| 605 | Ga0453684_0482188 | 3300044712 | Bacteria | 1375 |
| 606 | Ga0466968_0055107 | 3300044735 | Unclassified | 1706 |
| 607 | Ga0451576_0056853 | 3300045051 | Bacteria | 4090 |
| 608 | Ga0451576_0192451 | 3300045051 | Bacteria | 2130 |
| 609 | Ga0451576_0205590 | 3300045051 | Bacteria | 2056 |
| 610 | Ga0451576_0398666 | 3300045051 | Bacteria | 1442 |
| 611 | Ga0451576_0731307 | 3300045051 | Unclassified | 1039 |
| 612 | Ga0466967_0336714 | 3300045976 | Bacteria | 1458 |
| 613 | Ga0466967_0449262 | 3300045976 | Unclassified | 1259 |
| 614 | Ga0466967_0472621 | 3300045976 | Unclassified | 1227 |
| 615 | Ga0495603_0045675 | 3300046455 | Bacteria | 2611 |
| 616 | Ga0495603_0166754 | 3300046455 | Bacteria | 1276 |
| 617 | Ga0495651_0115489 | 3300046462 | Bacteria | 1979 |
| 618 | Ga0495580_0000182 | 3300046472 | Bacteria | 47252 |
| 619 | Ga0495580_0009948 | 3300046472 | Bacteria | 7442 |
| 620 | Ga0495580_0043400 | 3300046472 | Bacteria | 3200 |
| 621 | Ga0495580_0155505 | 3300046472 | Bacteria | 1583 |
| 622 | Ga0495582_0053590 | 3300046473 | Bacteria | 2225 |
| 623 | Ga0495582_0118573 | 3300046473 | Bacteria | 1490 |
| 624 | Ga0495582_0175274 | 3300046473 | Bacteria | 1221 |
| 625 | Ga0495582_0188094 | 3300046473 | Bacteria | 1177 |
| 626 | Ga0495639_0033817 | 3300046475 | Bacteria | 2284 |
| 627 | Ga0495639_0044808 | 3300046475 | Bacteria | 2000 |
| 628 | Ga0495662_0154484 | 3300046476 | Bacteria | 1130 |
| 629 | Ga0495664_0170933 | 3300046477 | Bacteria | 1318 |
| 630 | Ga0495664_0199628 | 3300046477 | Unclassified | 1212 |
| 631 | Ga0495594_0113200 | 3300046499 | Bacteria | 1530 |
| 632 | Ga0495620_0098877 | 3300046515 | Bacteria | 1164 |
| 633 | Ga0495628_0257907 | 3300046516 | Bacteria | 1300 |
| 634 | Ga0495666_0056643 | 3300046526 | Bacteria | 1877 |
| 635 | Ga0495642_0076067 | 3300046528 | Unclassified | 1409 |
| 636 | Ga0495652_0286363 | 3300046529 | Bacteria | 1204 |
| 637 | Ga0495652_0309025 | 3300046529 | Bacteria | 1146 |
| 638 | Ga0495665_0090964 | 3300046531 | Bacteria | 1603 |
| 639 | Ga0495665_0094379 | 3300046531 | Bacteria | 1571 |
| 640 | Ga0495665_0111259 | 3300046531 | Bacteria | 1436 |
| 641 | Ga0495665_0142269 | 3300046531 | Unclassified | 1253 |
| 642 | Ga0495640_0109214 | 3300046533 | Unclassified | 1809 |
| 643 | Ga0495640_0201721 | 3300046533 | Unclassified | 1260 |
| 644 | Ga0495645_0154521 | 3300046543 | Bacteria | 1591 |
| 645 | Ga0495635_0170881 | 3300046663 | Bacteria | 1478 |
| 646 | Ga0495635_0223417 | 3300046663 | Unclassified | 1273 |
| 647 | Ga0495659_0051776 | 3300046664 | Unclassified | 1496 |
| 648 | Ga0495658_0168745 | 3300046683 | Bacteria | 1353 |
| 649 | Ga0495658_0179087 | 3300046683 | Bacteria | 1315 |
| 650 | Ga0495658_0223911 | 3300046683 | Bacteria | 1178 |
| 651 | Ga0495658_0241528 | 3300046683 | Bacteria | 1134 |
| 652 | Ga0495613_0124374 | 3300046689 | Bacteria | 1850 |
| 653 | Ga0495613_0244622 | 3300046689 | Bacteria | 1253 |
| 654 | Ga0495581_0096281 | 3300047315 | Bacteria | 1718 |
| 655 | Ga0495581_0154607 | 3300047315 | Bacteria | 1340 |
| 656 | Ga0495636_0112642 | 3300047318 | Unclassified | 1198 |
| 657 | Ga0495674_0162482 | 3300047319 | Bacteria | 1868 |
| 658 | Ga0495674_0332624 | 3300047319 | Unclassified | 1236 |
| 659 | Ga0495674_0355997 | 3300047319 | Bacteria | 1187 |
| 660 | Ga0495674_0396039 | 3300047319 | Bacteria | 1115 |
| 661 | Ga0495680_0223684 | 3300047322 | Bacteria | 1342 |
| 662 | Ga0495684_0188818 | 3300047471 | Bacteria | 1524 |
| 663 | Ga0495684_0262105 | 3300047471 | Bacteria | 1253 |
| 664 | Ga0495684_0292323 | 3300047471 | Bacteria | 1172 |
| 665 | Ga0495593_0088493 | 3300047673 | Bacteria | 1596 |
| 666 | Ga0495593_0095654 | 3300047673 | Unclassified | 1527 |
| 667 | Ga0495602_0275624 | 3300048088 | Bacteria | 1241 |
| 668 | Ga0496100_0236449 | 3300048903 | Bacteria | 1346 |
| 669 | Ga0496102_0172401 | 3300048905 | Bacteria | 2037 |
| 670 | Ga0496104_0378920 | 3300048907 | Bacteria | 1327 |
| 671 | Ga0496105_0317640 | 3300048908 | Bacteria | 1249 |
| 672 | Ga0496106_0290180 | 3300048909 | Bacteria | 1311 |
| 673 | Ga0496107_0295995 | 3300048910 | Bacteria | 1204 |
| 674 | Ga0496108_0143993 | 3300048911 | Unclassified | 2054 |
| 675 | Ga0496108_0421080 | 3300048911 | Bacteria | 1166 |
| 676 | Ga0496109_0479003 | 3300048912 | Bacteria | 1175 |
| 677 | Ga0496111_0079920 | 3300048914 | Bacteria | 2385 |
| 678 | Ga0496112_0006862 | 3300048915 | Bacteria | 10040 |
| 679 | Ga0496112_0325698 | 3300048915 | Unclassified | 1480 |
| 680 | Ga0496113_0162534 | 3300048916 | Unclassified | 1766 |
| 681 | Ga0496114_0313560 | 3300048917 | Bacteria | 1386 |
| 682 | Ga0496115_0017801 | 3300048918 | Bacteria | 5441 |
| 683 | Ga0496115_0247410 | 3300048918 | Bacteria | 1468 |
| 684 | Ga0496115_0359031 | 3300048918 | Bacteria | 1187 |
| 685 | Ga0496115_0378537 | 3300048918 | Unclassified | 1151 |
| 686 | Ga0496120_0146316 | 3300048923 | Unclassified | 1193 |
| 687 | Ga0501031_0194941 | 3300049568 | Bacteria | 1322 |
| 688 | Ga0501033_0007065 | 3300049570 | Bacteria | 8767 |
| 689 | Ga0501036_0328148 | 3300049572 | Bacteria | 1278 |
| 690 | Ga0501038_0342533 | 3300049574 | Bacteria | 1165 |
| 691 | Ga0501039_0171544 | 3300049575 | Bacteria | 1705 |
| 692 | Ga0501039_0313808 | 3300049575 | Bacteria | 1232 |
| 693 | Ga0501040_0103930 | 3300049576 | Bacteria | 1983 |
| 694 | Ga0501041_0199369 | 3300049577 | Bacteria | 1254 |
| 695 | Ga0501042_0236861 | 3300049578 | Bacteria | 1317 |
| 696 | Ga0501042_0253625 | 3300049578 | Bacteria | 1269 |
| 697 | Ga0501046_0252539 | 3300049580 | Bacteria | 1297 |
| 698 | Ga0501048_0292003 | 3300049582 | Bacteria | 1159 |
| 699 | Ga0501070_0356753 | 3300049586 | Bacteria | 1186 |
| 700 | Ga0501072_0314064 | 3300049588 | Bacteria | 1245 |
| 701 | Ga0501074_0016088 | 3300049590 | Bacteria | 5437 |
| 702 | Ga0501075_0262699 | 3300049591 | Bacteria | 1316 |
| 703 | Ga0501075_0318817 | 3300049591 | Bacteria | 1184 |
| 704 | Ga0501076_0363667 | 3300049592 | Bacteria | 1188 |
| 705 | Ga0501077_0218090 | 3300049593 | Bacteria | 1212 |
| 706 | Ga0501079_0342869 | 3300049741 | Bacteria | 1170 |
| 707 | Ga0501081_0268637 | 3300049743 | Bacteria | 1247 |
| 708 | Ga0501081_0291274 | 3300049743 | Bacteria | 1196 |
| 709 | Ga0501045_0280426 | 3300049824 | Bacteria | 1240 |
| 710 | nmdc:mga05p37_232967_c1 | 3300050507 | Bacteria | 2218 |
| 711 | nmdc:mga05p37_386607_c1 | 3300050507 | Bacteria | 1638 |
| 712 | nmdc:mga05p37_541209_c1 | 3300050507 | Bacteria | 1328 |
| 713 | nmdc:mga06r32_375914_c1 | 3300050510 | Unclassified | 1404 |
| 714 | nmdc:mga08y16_189638_c1 | 3300050511 | Bacteria | 2133 |
| 715 | nmdc:mga08y16_525508_c1 | 3300050511 | Unclassified | 1200 |
| 716 | nmdc:mga0n895_338350_c1 | 3300050512 | Unclassified | 1525 |
| 717 | nmdc:mga0n895_416771_c1 | 3300050512 | Bacteria | 1358 |
| 718 | nmdc:mga0rr50_123895_c1 | 3300050513 | Bacteria | 2061 |
| 719 | nmdc:mga0rr50_145114_c1 | 3300050513 | Bacteria | 1913 |
| 720 | nmdc:mga0rr50_17475_c1 | 3300050513 | Unclassified | 4791 |
| 721 | nmdc:mga0rr50_229460_c1 | 3300050513 | Bacteria | 1536 |
| 722 | nmdc:mga08x19_117557_c1 | 3300050514 | Unclassified | 1779 |
| 723 | nmdc:mga08x19_143986_c1 | 3300050514 | Bacteria | 1611 |
| 724 | nmdc:mga0a205_107246_c1 | 3300050515 | Bacteria | 2691 |
| 725 | nmdc:mga0a205_179526_c1 | 3300050515 | Bacteria | 2011 |
| 726 | nmdc:mga0a205_3164_c2 | 3300050515 | Plasmid | 3769 |
| 727 | nmdc:mga0a205_372834_c1 | 3300050515 | Bacteria | 1293 |
| 728 | nmdc:mga0a205_6654_c2 | 3300050515 | Bacteria | 10152 |
| 729 | Ga0495601_0046747 | 3300053077 | Unclassified | 2724 |
| 730 | Ga0495595_0123522 | 3300053084 | Bacteria | 1262 |
| 731 | Ga0495619_0015073 | 3300053085 | Bacteria | 4884 |
| 732 | Ga0495619_0242019 | 3300053085 | Bacteria | 1250 |
| 733 | Ga0495619_0260218 | 3300053085 | Bacteria | 1202 |
| 734 | Ga0500614_046876 | 3300053123 | Bacteria | 1120 |
| 735 | Ga0501084_0345152 | 3300054114 | Bacteria | 1257 |
| 736 | Ga0501084_0359663 | 3300054114 | Bacteria | 1230 |
| 737 | Ga0501082_0124050 | 3300060353 | Bacteria | 2239 |
| 738 | Ga0530510_0109822 | 3300061734 | Bacteria | 2019 |
| 739 | Ga0530510_0244313 | 3300061734 | Bacteria | 1337 |
| 740 | Ga0373923_0104027 | |||
| 741 | CNBas_1000888 | |||
| 742 | rootH2_10072749 | |||
| 743 | Ga0065704_10124060 | |||
| 744 | Ga0065715_10100512 | |||
| 745 | Ga0070658_10217225 | |||
| 746 | Ga0070658_10221380 | |||
| 747 | Ga0070676_10195020 | |||
| 748 | Ga0070676_10221859 | |||
| 749 | Ga0070683_100293718 | |||
| 750 | Ga0070683_100405016 | |||
| 751 | Ga0070670_100309722 | |||
| 752 | Ga0070670_100349885 | |||
| 753 | Ga0070677_10052024 | |||
| 754 | Ga0070677_10087358 | |||
| 755 | Ga0070666_10059473 | |||
| 756 | Ga0070666_10072384 | |||
| 757 | Ga0070666_10262828 | |||
| 758 | Ga0070680_100273344 | |||
| 759 | Ga0070682_100064572 | |||
| 760 | Ga0070682_100208351 | |||
| 761 | Ga0070682_100288175 | |||
| 762 | Ga0070682_100290809 | |||
| 763 | Ga0070660_100149233 | |||
| 764 | Ga0070660_100166793 | |||
| 765 | Ga0070660_100349452 | |||
| 766 | Ga0070689_100248269 | |||
| 767 | Ga0070687_100101611 | |||
| 768 | Ga0070661_100060820 | |||
| 769 | Ga0070661_100061648 | |||
| 770 | Ga0070661_100069162 | |||
| 771 | Ga0070661_100153664 | |||
| 772 | Ga0070661_100252841 | |||
| 773 | Ga0070661_100283266 | |||
| 774 | Ga0070692_10087610 | |||
| 775 | Ga0070668_100255583 | |||
| 776 | Ga0070668_100331387 | |||
| 777 | Ga0070669_100097945 | |||
| 778 | Ga0070669_100341498 | |||
| 779 | Ga0070669_100385853 | |||
| 780 | Ga0070675_100093758 | |||
| 781 | Ga0070675_100148912 | |||
| 782 | Ga0070675_100326965 | |||
| 783 | Ga0070671_100401498 | |||
| 784 | Ga0070674_100194606 | |||
| 785 | Ga0070674_100318107 | |||
| 786 | Ga0070673_100068864 | |||
| 787 | Ga0070673_100295687 | |||
| 788 | Ga0070688_100195289 | |||
| 789 | Ga0070688_100241979 | |||
| 790 | Ga0070659_100045394 | |||
| 791 | Ga0070659_100065797 | |||
| 792 | Ga0070659_100080948 | |||
| 793 | Ga0070659_100229766 | |||
| 794 | Ga0070659_100240509 | |||
| 795 | Ga0070659_100251683 | |||
| 796 | Ga0070659_100336424 | |||
| 797 | Ga0070659_100397427 | |||
| 798 | Ga0070667_100092486 | |||
| 799 | Ga0070667_100142138 | |||
| 800 | Ga0070667_100159966 | |||
| 801 | Ga0070703_10059593 | |||
| 802 | Ga0070714_100192436 | |||
| 803 | Ga0070714_100268350 | |||
| 804 | Ga0070714_100462253 | |||
| 805 | Ga0070713_100072157 | |||
| 806 | Ga0070713_100278782 | |||
| 807 | Ga0070713_100297645 | |||
| 808 | Ga0070713_100385933 | |||
| 809 | Ga0070710_10034750 | |||
| 810 | Ga0070710_10045608 | |||
| 811 | Ga0070711_100042660 | |||
| 812 | Ga0070711_100165031 | |||
| 813 | Ga0070711_100350622 | |||
| 814 | Ga0070705_100209457 | |||
| 815 | Ga0070705_100263949 | |||
| 816 | Ga0070700_100069327 | |||
| 817 | Ga0070700_100247579 | |||
| 818 | Ga0070694_100366417 | |||
| 819 | Ga0070708_100344864 | |||
| 820 | Ga0070663_100055734 | |||
| 821 | Ga0070663_100189192 | |||
| 822 | Ga0070663_100189400 | |||
| 823 | Ga0070663_100224981 | |||
| 824 | Ga0070663_100393517 | |||
| 825 | Ga0070678_100093535 | |||
| 826 | Ga0070678_100115927 | |||
| 827 | Ga0070678_100116956 | |||
| 828 | Ga0070678_100271973 | |||
| 829 | Ga0070678_100281010 | |||
| 830 | Ga0070662_100164828 | |||
| 831 | Ga0070662_100168226 | |||
| 832 | Ga0070662_100217773 | |||
| 833 | Ga0070662_100242360 | |||
| 834 | Ga0070662_100406423 | |||
| 835 | Ga0070681_10136972 | |||
| 836 | Ga0070681_10245030 | |||
| 837 | Ga0070681_10284876 | |||
| 838 | Ga0068867_100344525 | |||
| 839 | Ga0068867_100362840 | |||
| 840 | Ga0068867_100365010 | |||
| 841 | Ga0070707_100269996 | |||
| 842 | Ga0070707_100411259 | |||
| 843 | Ga0070698_100199902 | |||
| 844 | Ga0070698_100342786 | |||
| 845 | Ga0070699_100079647 | |||
| 846 | Ga0070699_100214199 | |||
| 847 | Ga0070699_100415378 | |||
| 848 | Ga0070679_100043673 | |||
| 849 | Ga0070679_100082192 | |||
| 850 | Ga0070679_100211937 | |||
| 851 | Ga0070679_100253130 | |||
| 852 | Ga0070679_100261038 | |||
| 853 | Ga0070679_100362772 | |||
| 854 | Ga0070684_100086740 | |||
| 855 | Ga0070684_100373931 | |||
| 856 | Ga0070697_100131232 | |||
| 857 | Ga0070697_100262368 | |||
| 858 | Ga0070697_100311428 | |||
| 859 | Ga0070697_100418621 | |||
| 860 | Ga0068853_100014302 | |||
| 861 | Ga0068853_100132597 | |||
| 862 | Ga0068853_100416956 | |||
| 863 | Ga0068853_100519778 | |||
| 864 | Ga0070672_100024837 | |||
| 865 | Ga0070672_100206745 | |||
| 866 | Ga0070672_100254882 | |||
| 867 | Ga0070672_100274245 | |||
| 868 | Ga0070695_100184160 | |||
| 869 | Ga0070696_100138442 | |||
| 870 | Ga0070693_100138311 | |||
| 871 | Ga0070693_100175304 | |||
| 872 | Ga0070693_100188069 | |||
| 873 | Ga0070665_100142673 | |||
| 874 | Ga0070665_100222145 | |||
| 875 | Ga0070665_100402782 | |||
| 876 | Ga0070704_100209102 | |||
| 877 | Ga0070704_100321781 | |||
| 878 | Ga0068855_100029848 | |||
| 879 | Ga0068855_100359391 | |||
| 880 | Ga0068855_100398544 | |||
| 881 | Ga0068855_100464579 | |||
| 882 | Ga0068855_100501911 | |||
| 883 | Ga0070664_100076136 | |||
| 884 | Ga0070664_100111586 | |||
| 885 | Ga0070664_100287100 | |||
| 886 | Ga0070664_100301681 | |||
| 887 | Ga0070664_100416297 | |||
| 888 | Ga0070664_100469083 | |||
| 889 | Ga0068857_100146099 | |||
| 890 | Ga0068857_100514513 | |||
| 891 | Ga0068854_100194527 | |||
| 892 | Ga0068856_100075026 | |||
| 893 | Ga0068856_100103286 | |||
| 894 | Ga0068856_100248823 | |||
| 895 | Ga0068856_100377123 | |||
| 896 | Ga0068856_100445323 | |||
| 897 | Ga0068856_100497933 | |||
| 898 | Ga0070702_100078112 | |||
| 899 | Ga0070702_100265372 | |||
| 900 | Ga0068852_100369345 | |||
| 901 | Ga0068852_100372716 | |||
| 902 | Ga0068852_100473842 | |||
| 903 | Ga0068859_100172345 | |||
| 904 | Ga0068859_100226426 | |||
| 905 | Ga0068859_100232458 | |||
| 906 | Ga0068859_100286372 | |||
| 907 | Ga0068859_100462544 | |||
| 908 | Ga0068864_100278113 | |||
| 909 | Ga0068864_100301774 | |||
| 910 | Ga0068866_10125269 | |||
| 911 | Ga0068861_100172167 | |||
| 912 | Ga0068870_10119191 | |||
| 913 | Ga0068863_100319686 | |||
| 914 | Ga0068863_100329946 | |||
| 915 | Ga0068858_100309899 | |||
| 916 | Ga0068858_100453303 | |||
| 917 | Ga0068858_100463518 | |||
| 918 | Ga0068860_100385621 | |||
| 919 | Ga0068862_100094449 | |||
| 920 | Ga0081455_10067985 | |||
| 921 | Ga0081538_10013894 | |||
| 922 | Ga0081538_10098483 | |||
| 923 | Ga0081538_10121646 | |||
| 924 | Ga0070717_10277490 | |||
| 925 | Ga0070717_10312507 | |||
| 926 | Ga0070717_10319228 | |||
| 927 | Ga0070717_10342802 | |||
| 928 | Ga0070715_10032720 | |||
| 929 | Ga0070716_100152200 | |||
| 930 | Ga0070716_100164553 | |||
| 931 | Ga0070716_100176806 | |||
| 932 | Ga0070716_100195590 | |||
| 933 | Ga0070716_100215303 | |||
| 934 | Ga0070716_100220828 | |||
| 935 | Ga0070712_100180272 | |||
| 936 | Ga0070712_100185268 | |||
| 937 | Ga0070712_100254884 | |||
| 938 | Ga0070712_100358211 | |||
| 939 | Ga0097621_100201637 | |||
| 940 | Ga0097621_100260718 | |||
| 941 | Ga0068871_100251163 | |||
| 942 | Ga0068871_100306403 | |||
| 943 | Ga0068871_100414274 | |||
| 944 | Ga0068871_100429389 | |||
| 945 | Ga0075428_100459203 | |||
| 946 | Ga0075431_100274740 | |||
| 947 | Ga0075431_100468394 | |||
| 948 | Ga0075433_10014079 | |||
| 949 | Ga0075433_10041156 | |||
| 950 | Ga0075433_10346434 | |||
| 951 | Ga0075433_10420959 | |||
| 952 | Ga0075434_100173372 | |||
| 953 | Ga0075434_100284201 | |||
| 954 | Ga0068865_100221087 | |||
| 955 | Ga0068865_100237365 | |||
| 956 | Ga0068865_100265723 | |||
| 957 | Ga0068865_100310514 | |||
| 958 | Ga0075436_100078636 | |||
| 959 | Ga0075436_100201375 | |||
| 960 | Ga0075436_100218345 | |||
| 961 | Ga0075436_100246233 | |||
| 962 | Ga0097620_100172352 | |||
| 963 | Ga0097620_100226441 | |||
| 964 | Ga0097620_100232470 | |||
| 965 | Ga0097620_100286385 | |||
| 966 | Ga0097620_100462549 | |||
| 967 | Ga0075435_100021274 | |||
| 968 | Ga0075435_100152987 | |||
| 969 | Ga0075435_100157184 | |||
| 970 | Ga0075435_100283355 | |||
| 971 | Ga0099794_10070774 | |||
| 972 | Ga0099794_10108078 | |||
| 973 | Ga0099795_10063706 | |||
| 974 | Ga0105251_10093855 | |||
| 975 | Ga0105240_10055087 | |||
| 976 | Ga0105240_10273048 | |||
| 977 | Ga0105240_10513682 | |||
| 978 | Ga0105240_10515624 | |||
| 979 | Ga0111539_10419893 | |||
| 980 | Ga0111539_10437439 | |||
| 981 | Ga0111539_10611461 | |||
| 982 | Ga0105245_10177706 | |||
| 983 | Ga0105245_10386237 | |||
| 984 | Ga0105245_10440702 | |||
| 985 | Ga0105247_10151257 | |||
| 986 | Ga0105247_10170597 | |||
| 987 | Ga0114129_10105138 | |||
| 988 | Ga0114129_10423399 | |||
| 989 | Ga0114129_10595489 | |||
| 990 | Ga0105243_10284021 | |||
| 991 | Ga0105241_10059419 | |||
| 992 | Ga0105241_10168726 | |||
| 993 | Ga0105241_10189298 | |||
| 994 | Ga0105241_10296294 | |||
| 995 | Ga0105241_10310511 | |||
| 996 | Ga0105241_10358461 | |||
| 997 | Ga0105241_10402985 | |||
| 998 | Ga0105248_10243301 | |||
| 999 | Ga0105248_10262783 | |||
| 1000 | Ga0105248_10421473 | |||
| 1001 | Ga0105248_10527918 | |||
| 1002 | Ga0105237_10359745 | |||
| 1003 | Ga0105237_10394042 | |||
| 1004 | Ga0105238_10205618 | |||
| 1005 | Ga0105238_10233118 | |||
| 1006 | Ga0105238_10335908 | |||
| 1007 | Ga0105249_10384768 | |||
| 1008 | Ga0105249_10423375 | |||
| 1009 | Ga0105249_10448593 | |||
| 1010 | Ga0105239_10362360 | |||
| 1011 | Ga0105246_10202633 | |||
| 1012 | Ga0105246_10242955 | |||
| 1013 | Ga0105246_10309291 | |||
| 1014 | Ga0157338_1003370 | |||
| 1015 | Ga0157373_10045259 | |||
| 1016 | Ga0157373_10055595 | |||
| 1017 | Ga0157373_10101002 | |||
| 1018 | Ga0157373_10135618 | |||
| 1019 | Ga0157373_10218638 | |||
| 1020 | Ga0157371_10160217 | |||
| 1021 | Ga0157371_10196872 | |||
| 1022 | Ga0157370_10223874 | |||
| 1023 | Ga0157370_10240731 | |||
| 1024 | Ga0157369_10133255 | |||
| 1025 | Ga0157369_10199777 | |||
| 1026 | Ga0157369_10252868 | |||
| 1027 | Ga0157369_10255225 | |||
| 1028 | Ga0157369_10349393 | |||
| 1029 | Ga0157374_10089312 | |||
| 1030 | Ga0157374_10169048 | |||
| 1031 | Ga0157374_10175869 | |||
| 1032 | Ga0157374_10326941 | |||
| 1033 | Ga0157374_10348439 | |||
| 1034 | Ga0157374_10424450 | |||
| 1035 | Ga0157374_10601412 | |||
| 1036 | Ga0157378_10087490 | |||
| 1037 | Ga0157378_10345412 | |||
| 1038 | Ga0157378_10481142 | |||
| 1039 | Ga0163162_10219993 | |||
| 1040 | Ga0163162_10402181 | |||
| 1041 | Ga0163162_10449446 | |||
| 1042 | Ga0163162_10488062 | |||
| 1043 | Ga0163162_10538500 | |||
| 1044 | Ga0157372_10095063 | |||
| 1045 | Ga0157372_10172149 | |||
| 1046 | Ga0157372_10174519 | |||
| 1047 | Ga0157372_10230936 | |||
| 1048 | Ga0157372_10342421 | |||
| 1049 | Ga0157372_10393912 | |||
| 1050 | Ga0157372_10405841 | |||
| 1051 | Ga0157372_10571183 | |||
| 1052 | Ga0157372_10756534 | |||
| 1053 | Ga0157375_10193056 | |||
| 1054 | Ga0157375_10236359 | |||
| 1055 | Ga0157375_10423544 | |||
| 1056 | Ga0157375_10536480 | |||
| 1057 | Ga0163163_10286135 | |||
| 1058 | Ga0163163_10379714 | |||
| 1059 | Ga0157380_10200137 | |||
| 1060 | Ga0157380_10264565 | |||
| 1061 | Ga0157377_10135867 | |||
| 1062 | Ga0157379_10362992 | |||
| 1063 | Ga0157376_10238219 | |||
| 1064 | Ga0157376_10305488 | |||
| 1065 | Ga0157376_10355415 | |||
| 1066 | Ga0157376_10493196 | |||
| 1067 | Ga0182007_10024421 | |||
| 1068 | Ga0163161_10063859 | |||
| 1069 | Ga0163161_10174555 | |||
| 1070 | Ga0163161_10182751 | |||
| 1071 | Ga0213872_10123171 | |||
| 1072 | Ga0213876_10159964 | |||
| 1073 | Ga0213875_10053243 | |||
| 1074 | Ga0213875_10086588 | |||
| 1075 | Ga0213875_10134202 | |||
| 1076 | Ga0224712_10104504 | |||
| 1077 | Ga0228598_1026016 | |||
| 1078 | Ga0207697_10092584 | |||
| 1079 | Ga0207653_10039471 | |||
| 1080 | Ga0207682_10093885 | |||
| 1081 | Ga0207692_10111811 | |||
| 1082 | Ga0207692_10153650 | |||
| 1083 | Ga0207692_10173472 | |||
| 1084 | Ga0207710_10110546 | |||
| 1085 | Ga0207688_10193022 | |||
| 1086 | Ga0207680_10243111 | |||
| 1087 | Ga0207680_10243775 | |||
| 1088 | Ga0207647_10060511 | |||
| 1089 | Ga0207685_10079037 | |||
| 1090 | Ga0207685_10099697 | |||
| 1091 | Ga0207699_10195240 | |||
| 1092 | Ga0207699_10262488 | |||
| 1093 | Ga0207699_10267495 | |||
| 1094 | Ga0207645_10184659 | |||
| 1095 | Ga0207645_10208275 | |||
| 1096 | Ga0207645_10249339 | |||
| 1097 | Ga0207643_10044770 | |||
| 1098 | Ga0207643_10159421 | |||
| 1099 | Ga0207705_10091115 | |||
| 1100 | Ga0207705_10273678 | |||
| 1101 | Ga0207705_10348083 | |||
| 1102 | Ga0207684_10032773 | |||
| 1103 | Ga0207654_10232768 | |||
| 1104 | Ga0207654_10264081 | |||
| 1105 | Ga0207654_10268661 | |||
| 1106 | Ga0207654_10270225 | |||
| 1107 | Ga0207707_10147265 | |||
| 1108 | Ga0207707_10229775 | |||
| 1109 | Ga0207707_10239589 | |||
| 1110 | Ga0207707_10244838 | |||
| 1111 | Ga0207707_10393024 | |||
| 1112 | Ga0207695_10018179 | |||
| 1113 | Ga0207695_10112199 | |||
| 1114 | Ga0207695_10481603 | |||
| 1115 | Ga0207671_10239111 | |||
| 1116 | Ga0207693_10074518 | |||
| 1117 | Ga0207693_10153248 | |||
| 1118 | Ga0207693_10231593 | |||
| 1119 | Ga0207693_10262937 | |||
| 1120 | Ga0207693_10342932 | |||
| 1121 | Ga0207663_10193105 | |||
| 1122 | Ga0207663_10263046 | |||
| 1123 | Ga0207663_10271385 | |||
| 1124 | Ga0207663_10327326 | |||
| 1125 | Ga0207660_10213706 | |||
| 1126 | Ga0207660_10377429 | |||
| 1127 | Ga0207657_10035291 | |||
| 1128 | Ga0207657_10130641 | |||
| 1129 | Ga0207649_10021878 | |||
| 1130 | Ga0207649_10067822 | |||
| 1131 | Ga0207649_10070808 | |||
| 1132 | Ga0207649_10185658 | |||
| 1133 | Ga0207649_10283004 | |||
| 1134 | Ga0207649_10309591 | |||
| 1135 | Ga0207652_10024409 | |||
| 1136 | Ga0207652_10207616 | |||
| 1137 | Ga0207652_10234582 | |||
| 1138 | Ga0207652_10467552 | |||
| 1139 | Ga0207646_10166143 | |||
| 1140 | Ga0207646_10459295 | |||
| 1141 | Ga0207681_10074123 | |||
| 1142 | Ga0207681_10304285 | |||
| 1143 | Ga0207681_10344986 | |||
| 1144 | Ga0207694_10354291 | |||
| 1145 | Ga0207694_10385131 | |||
| 1146 | Ga0207694_10391161 | |||
| 1147 | Ga0207659_10336459 | |||
| 1148 | Ga0207687_10318394 | |||
| 1149 | Ga0207687_10331464 | |||
| 1150 | Ga0207687_10378849 | |||
| 1151 | Ga0207700_10086842 | |||
| 1152 | Ga0207700_10367141 | |||
| 1153 | Ga0207700_10377057 | |||
| 1154 | Ga0207700_10403488 | |||
| 1155 | Ga0207700_10421015 | |||
| 1156 | Ga0207664_10028368 | |||
| 1157 | Ga0207664_10129128 | |||
| 1158 | Ga0207664_10413312 | |||
| 1159 | Ga0207664_10416630 | |||
| 1160 | Ga0207644_10274692 | |||
| 1161 | Ga0207690_10114771 | |||
| 1162 | Ga0207690_10134869 | |||
| 1163 | Ga0207690_10362068 | |||
| 1164 | Ga0207706_10068215 | |||
| 1165 | Ga0207706_10095913 | |||
| 1166 | Ga0207706_10134784 | |||
| 1167 | Ga0207706_10197445 | |||
| 1168 | Ga0207706_10344650 | |||
| 1169 | Ga0207706_10422870 | |||
| 1170 | Ga0207686_10228606 | |||
| 1171 | Ga0207669_10304248 | |||
| 1172 | Ga0207665_10156980 | |||
| 1173 | Ga0207665_10174300 | |||
| 1174 | Ga0207665_10188907 | |||
| 1175 | Ga0207665_10213722 | |||
| 1176 | Ga0207665_10224276 | |||
| 1177 | Ga0207691_10059414 | |||
| 1178 | Ga0207691_10261065 | |||
| 1179 | Ga0207691_10311351 | |||
| 1180 | Ga0207691_10388152 | |||
| 1181 | Ga0207711_10425498 | |||
| 1182 | Ga0207661_10036263 | |||
| 1183 | Ga0207661_10412234 | |||
| 1184 | Ga0207679_10053942 | |||
| 1185 | Ga0207679_10084945 | |||
| 1186 | Ga0207679_10169094 | |||
| 1187 | Ga0207679_10173765 | |||
| 1188 | Ga0207679_10367938 | |||
| 1189 | Ga0207679_10397096 | |||
| 1190 | Ga0207667_10057799 | |||
| 1191 | Ga0207667_10079257 | |||
| 1192 | Ga0207667_10119523 | |||
| 1193 | Ga0207667_10336645 | |||
| 1194 | Ga0207667_10489738 | |||
| 1195 | Ga0207667_10566873 | |||
| 1196 | Ga0207667_10576851 | |||
| 1197 | Ga0207651_10152885 | |||
| 1198 | Ga0207651_10310083 | |||
| 1199 | Ga0207668_10337720 | |||
| 1200 | Ga0207640_10357294 | |||
| 1201 | Ga0207658_10200036 | |||
| 1202 | Ga0207658_10408088 | |||
| 1203 | Ga0207658_10447591 | |||
| 1204 | Ga0207703_10272083 | |||
| 1205 | Ga0207703_10388259 | |||
| 1206 | Ga0207703_10490273 | |||
| 1207 | Ga0207639_10009030 | |||
| 1208 | Ga0207639_10217133 | |||
| 1209 | Ga0207639_10443857 | |||
| 1210 | Ga0207678_10102472 | |||
| 1211 | Ga0207678_10165354 | |||
| 1212 | Ga0207678_10216197 | |||
| 1213 | Ga0207678_10228880 | |||
| 1214 | Ga0207678_10368430 | |||
| 1215 | Ga0207708_10374010 | |||
| 1216 | Ga0207702_10020373 | |||
| 1217 | Ga0207702_10022282 | |||
| 1218 | Ga0207702_10065041 | |||
| 1219 | Ga0207702_10407809 | |||
| 1220 | Ga0207702_10503259 | |||
| 1221 | Ga0207702_10506546 | |||
| 1222 | Ga0207702_10509861 | |||
| 1223 | Ga0207641_10368239 | |||
| 1224 | Ga0207641_10556992 | |||
| 1225 | Ga0207648_10059514 | |||
| 1226 | Ga0207648_10208217 | |||
| 1227 | Ga0207648_10247181 | |||
| 1228 | Ga0207648_10385996 | |||
| 1229 | Ga0207676_10328128 | |||
| 1230 | Ga0207676_10369772 | |||
| 1231 | Ga0207676_10398506 | |||
| 1232 | Ga0207674_10065416 | |||
| 1233 | Ga0207674_10169444 | |||
| 1234 | Ga0207674_10344903 | |||
| 1235 | Ga0207674_10364157 | |||
| 1236 | Ga0207675_100337944 | |||
| 1237 | Ga0207675_100353105 | |||
| 1238 | Ga0207683_10164375 | |||
| 1239 | Ga0207683_10226711 | |||
| 1240 | Ga0207683_10245029 | |||
| 1241 | Ga0207683_10266097 | |||
| 1242 | Ga0207683_10428523 | |||
| 1243 | Ga0207698_10507875 | |||
| 1244 | Ga0209984_1010850 | |||
| 1245 | Ga0210000_1013427 | |||
| 1246 | Ga0209968_1012321 | |||
| 1247 | Ga0209982_1008329 | |||
| 1248 | Ga0209983_1017187 | |||
| 1249 | Ga0209971_1023436 | |||
| 1250 | Ga0209974_10057539 | |||
| 1251 | Ga0207428_10073657 | |||
| 1252 | Ga0207428_10317202 | |||
| 1253 | Ga0207428_10325969 | |||
| 1254 | Ga0268266_10401168 | |||
| 1255 | Ga0268265_10095557 | |||
| 1256 | Ga0268265_10325775 | |||
| 1257 | Ga0268265_10523177 | |||
| 1258 | Ga0268264_10561556 | |||
| 1259 | Ga0265760_10021438 | |||
| 1260 | Ga0265760_10023382 | |||
| 1261 | Ga0265760_10051539 | |||
| 1262 | Ga0265325_10104842 | |||
| 1263 | Ga0265316_10322222 | |||
| 1264 | Ga0307411_10278791 | |||
| 1265 | Ga0373930_0018401 | |||
| 1266 | Ga0373930_0020507 | |||
| 1267 | Ga0373958_0018361 | |||
| 1268 | Ga0373959_0016053 | |||
| 1269 | Ga0373926_0060479 | |||
| 1270 | Ga0373928_0023318 | |||
| 1271 | Ga0373929_0024187 | |||
| 1272 | Ga0373934_0051542 | |||
| 1273 | Ga0373949_0038880 | |||
| 1274 | Ga0373951_0027661 | |||
| 1275 | Ga0373951_0040490 | |||
| 1276 | Ga0373952_0016898 | |||
| 1277 | Ga0373923_0046464 | |||
| 1278 | Ga0373923_0093142 | |||
| 1279 | Ga0373923_0110244 | |||
| 1280 | Ga0373932_0027704 | |||
| 1281 | Ga0373939_0022858 | |||
| 1282 | Ga0373941_0032766 | |||
| 1283 | Ga0373941_0056597 | |||
| 1284 | Ga0373953_0114477 | |||
| 1285 | Ga0373953_0119832 | |||
| 1286 | Ga0373960_0028129 | |||
| 1287 | Ga0373943_0074765 | |||
| 1288 | Ga0373943_0078063 | |||
| 1289 | Ga0373946_0017225 | |||
| 1290 | Ga0373946_0104041 | |||
| 1291 | Ga0373946_0116434 | |||
| 1292 | Ga0373955_0095384 | |||
| 1293 | Ga0373955_0154520 | |||
| 1294 | Ga0373961_0033849 | |||
| 1295 | Ga0373962_0028143 | |||
| 1296 | Ga0373924_0081391 | |||
| 1297 | Ga0373931_0143990 | |||
| 1298 | Ga0373931_0164811 | |||
| 1299 | Ga0373931_0186125 | |||
| 1300 | Ga0373931_0214736 | |||
| 1301 | Ga0373935_0149423 | |||
| 1302 | Ga0373935_0189355 | |||
| 1303 | Ga0373935_0221417 | |||
| 1304 | Ga0373935_0255061 | |||
| 1305 | Ga0373927_0048002 | |||
| 1306 | Ga0373927_0138606 | |||
| 1307 | Ga0373927_0147157 | |||
| 1308 | Ga0373927_0214136 | |||
| 1309 | Ga0373933_0062598 | |||
| 1310 | Ga0373933_0073667 | |||
| 1311 | Ga0373947_0059558 | |||
| 1312 | Ga0373947_0105573 | |||
| 1313 | Ga0373947_0238036 | |||
| 1314 | Ga0373947_0249507 | |||
| 1315 | Ga0373937_0084798 | |||
| 1316 | Ga0373937_0329867 | |||
| 1317 | Ga0316582_0209836 | |||
| 1318 | Ga0373925_0016340 | |||
| 1319 | Ga0373925_0171633 | |||
| 1320 | Ga0373925_0198331 | |||
| 1321 | Ga0373925_0212116 | |||
| 1322 | Ga0373925_0215302 | |||
| 1323 | Ga0373925_0223608 | |||
| 1324 | Ga0436364_0429406 | |||
| 1325 | Ga0436364_1016885 | |||
| 1326 | Ga0436364_1280539 | |||
| 1327 | Ga0395901_0458930 | |||
| 1328 | Ga0436365_1179962 | |||
| 1329 | Ga0436365_1282369 | |||
| 1330 | Ga0436360_0177423 | |||
| 1331 | Ga0436360_1198479 | |||
| 1332 | Ga0436361_0110909 | |||
| 1333 | Ga0436361_0984751 | |||
| 1334 | Ga0436363_0273568 | |||
| 1335 | Ga0436363_1702755 | |||
| 1336 | Ga0439448_0055631 | |||
| 1337 | Ga0439435_0031562 | |||
| 1338 | Ga0450918_020587 | |||
| 1339 | Ga0451577_0422135 | |||
| 1340 | Ga0453683_0213058 | |||
| 1341 | Ga0466966_0144323 | |||
| 1342 | Ga0466966_0161107 | |||
| 1343 | Ga0466963_0240385 | |||
| 1344 | Ga0453684_0482188 | |||
| 1345 | Ga0466968_0055107 | |||
| 1346 | Ga0451576_0056853 | |||
| 1347 | Ga0451576_0192451 | |||
| 1348 | Ga0451576_0205590 | |||
| 1349 | Ga0451576_0398666 | |||
| 1350 | Ga0451576_0731307 | |||
| 1351 | Ga0466967_0336714 | |||
| 1352 | Ga0466967_0449262 | |||
| 1353 | Ga0466967_0472621 | |||
| 1354 | Ga0495603_0045675 | |||
| 1355 | Ga0495603_0166754 | |||
| 1356 | Ga0495651_0115489 | |||
| 1357 | Ga0495580_0000182 | |||
| 1358 | Ga0495580_0009948 | |||
| 1359 | Ga0495580_0043400 | |||
| 1360 | Ga0495580_0155505 | |||
| 1361 | Ga0495582_0053590 | |||
| 1362 | Ga0495582_0118573 | |||
| 1363 | Ga0495582_0175274 | |||
| 1364 | Ga0495582_0188094 | |||
| 1365 | Ga0495639_0033817 | |||
| 1366 | Ga0495639_0044808 | |||
| 1367 | Ga0495662_0154484 | |||
| 1368 | Ga0495664_0170933 | |||
| 1369 | Ga0495664_0199628 | |||
| 1370 | Ga0495594_0113200 | |||
| 1371 | Ga0495620_0098877 | |||
| 1372 | Ga0495628_0257907 | |||
| 1373 | Ga0495666_0056643 | |||
| 1374 | Ga0495642_0076067 | |||
| 1375 | Ga0495652_0286363 | |||
| 1376 | Ga0495652_0309025 | |||
| 1377 | Ga0495665_0090964 | |||
| 1378 | Ga0495665_0094379 | |||
| 1379 | Ga0495665_0111259 | |||
| 1380 | Ga0495665_0142269 | |||
| 1381 | Ga0495640_0109214 | |||
| 1382 | Ga0495640_0201721 | |||
| 1383 | Ga0495645_0154521 | |||
| 1384 | Ga0495635_0170881 | |||
| 1385 | Ga0495635_0223417 | |||
| 1386 | Ga0495659_0051776 | |||
| 1387 | Ga0495658_0168745 | |||
| 1388 | Ga0495658_0179087 | |||
| 1389 | Ga0495658_0223911 | |||
| 1390 | Ga0495658_0241528 | |||
| 1391 | Ga0495613_0124374 | |||
| 1392 | Ga0495613_0244622 | |||
| 1393 | Ga0495581_0096281 | |||
| 1394 | Ga0495581_0154607 | |||
| 1395 | Ga0495636_0112642 | |||
| 1396 | Ga0495674_0162482 | |||
| 1397 | Ga0495674_0332624 | |||
| 1398 | Ga0495674_0355997 | |||
| 1399 | Ga0495674_0396039 | |||
| 1400 | Ga0495680_0223684 | |||
| 1401 | Ga0495684_0188818 | |||
| 1402 | Ga0495684_0262105 | |||
| 1403 | Ga0495684_0292323 | |||
| 1404 | Ga0495593_0088493 | |||
| 1405 | Ga0495593_0095654 | |||
| 1406 | Ga0495602_0275624 | |||
| 1407 | Ga0496100_0236449 | |||
| 1408 | Ga0496102_0172401 | |||
| 1409 | Ga0496104_0378920 | |||
| 1410 | Ga0496105_0317640 | |||
| 1411 | Ga0496106_0290180 | |||
| 1412 | Ga0496107_0295995 | |||
| 1413 | Ga0496108_0143993 | |||
| 1414 | Ga0496108_0421080 | |||
| 1415 | Ga0496109_0479003 | |||
| 1416 | Ga0496111_0079920 | |||
| 1417 | Ga0496112_0006862 | |||
| 1418 | Ga0496112_0325698 | |||
| 1419 | Ga0496113_0162534 | |||
| 1420 | Ga0496114_0313560 | |||
| 1421 | Ga0496115_0017801 | |||
| 1422 | Ga0496115_0247410 | |||
| 1423 | Ga0496115_0359031 | |||
| 1424 | Ga0496115_0378537 | |||
| 1425 | Ga0496120_0146316 | |||
| 1426 | Ga0501031_0194941 | |||
| 1427 | Ga0501033_0007065 | |||
| 1428 | Ga0501036_0328148 | |||
| 1429 | Ga0501038_0342533 | |||
| 1430 | Ga0501039_0171544 | |||
| 1431 | Ga0501039_0313808 | |||
| 1432 | Ga0501040_0103930 | |||
| 1433 | Ga0501041_0199369 | |||
| 1434 | Ga0501042_0236861 | |||
| 1435 | Ga0501042_0253625 | |||
| 1436 | Ga0501046_0252539 | |||
| 1437 | Ga0501048_0292003 | |||
| 1438 | Ga0501070_0356753 | |||
| 1439 | Ga0501072_0314064 | |||
| 1440 | Ga0501074_0016088 | |||
| 1441 | Ga0501075_0262699 | |||
| 1442 | Ga0501075_0318817 | |||
| 1443 | Ga0501076_0363667 | |||
| 1444 | Ga0501077_0218090 | |||
| 1445 | Ga0501079_0342869 | |||
| 1446 | Ga0501081_0268637 | |||
| 1447 | Ga0501081_0291274 | |||
| 1448 | Ga0501045_0280426 | |||
| 1449 | nmdc:mga05p37_232967_c1 | |||
| 1450 | nmdc:mga05p37_386607_c1 | |||
| 1451 | nmdc:mga05p37_541209_c1 | |||
| 1452 | nmdc:mga06r32_375914_c1 | |||
| 1453 | nmdc:mga08y16_189638_c1 | |||
| 1454 | nmdc:mga08y16_525508_c1 | |||
| 1455 | nmdc:mga0n895_338350_c1 | |||
| 1456 | nmdc:mga0n895_416771_c1 | |||
| 1457 | nmdc:mga0rr50_123895_c1 | |||
| 1458 | nmdc:mga0rr50_145114_c1 | |||
| 1459 | nmdc:mga0rr50_17475_c1 | |||
| 1460 | nmdc:mga0rr50_229460_c1 | |||
| 1461 | nmdc:mga08x19_117557_c1 | |||
| 1462 | nmdc:mga08x19_143986_c1 | |||
| 1463 | nmdc:mga0a205_107246_c1 | |||
| 1464 | nmdc:mga0a205_179526_c1 | |||
| 1465 | nmdc:mga0a205_3164_c2 | |||
| 1466 | nmdc:mga0a205_372834_c1 | |||
| 1467 | nmdc:mga0a205_6654_c2 | |||
| 1468 | Ga0495601_0046747 | |||
| 1469 | Ga0495595_0123522 | |||
| 1470 | Ga0495619_0015073 | |||
| 1471 | Ga0495619_0242019 | |||
| 1472 | Ga0495619_0260218 | |||
| 1473 | Ga0500614_046876 | |||
| 1474 | Ga0501084_0345152 | |||
| 1475 | Ga0501084_0359663 | |||
| 1476 | Ga0501082_0124050 | |||
| 1477 | Ga0530510_0109822 | |||
| 1478 | Ga0530510_0244313 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy