F478748

General Info

Members Datasets Scaffolds Average Seq Length
744 317 1478 351

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0104027|Ga0373923_0104027_22_1071
Length 349
Sequence MPFTAEPLVLTLEERGELEEMSRSRTLPAGDVFRARLILLLAEGLPYRTIEEKLATTAPTIARWRARFEEGRVAGLLEVRHPGQQPTVITPALQAKVLSATRKKPSDGSTHWSCRKLAKHLHISKDAVQRIWHKAGLKPHRLERYMASDDPDFERKATDIIGLYLQPPQHAAIFCVDEKSAIQALDRLDPVLPMSPGRAERHGFEYYRHGTLSLYAALDVRTGKVHGKTAARHTSDEFVSFLGDVVGDCKPQQEIHIILDNLSAHKTAKVLGFLEQHPRVRLHFTPTYSSWLNQVEIWFSKIERDVIARGVFNSVRDLARKLMRYIRAYSKTAHPFKWKYSDVQRRLSC

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
235 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 2.42
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 25.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0104027 3300035111 Bacteria 1255
2 CNBas_1000888 3300000531 Unclassified 1476
3 rootH2_10072749 3300003320 Unclassified 2228
4 Ga0065704_10124060 3300005289 Bacteria 1723
5 Ga0065715_10100512 3300005293 Bacteria 3288
6 Ga0070658_10217225 3300005327 Bacteria 1616
7 Ga0070658_10221380 3300005327 Bacteria 1601
8 Ga0070676_10195020 3300005328 Bacteria 1324
9 Ga0070676_10221859 3300005328 Bacteria 1249
10 Ga0070683_100293718 3300005329 Bacteria 1546
11 Ga0070683_100405016 3300005329 Unclassified 1301
12 Ga0070670_100309722 3300005331 Viruses 1382
13 Ga0070670_100349885 3300005331 Bacteria 1298
14 Ga0070677_10052024 3300005333 Bacteria 1660
15 Ga0070677_10087358 3300005333 Bacteria 1349
16 Ga0070666_10059473 3300005335 Bacteria 2584
17 Ga0070666_10072384 3300005335 Bacteria 2346
18 Ga0070666_10262828 3300005335 Bacteria 1224
19 Ga0070680_100273344 3300005336 Unclassified 1431
20 Ga0070682_100064572 3300005337 Bacteria 2324
21 Ga0070682_100208351 3300005337 Bacteria 1384
22 Ga0070682_100288175 3300005337 Unclassified 1200
23 Ga0070682_100290809 3300005337 Bacteria 1195
24 Ga0070660_100149233 3300005339 Unclassified 1879
25 Ga0070660_100166793 3300005339 Unclassified 1777
26 Ga0070660_100349452 3300005339 Bacteria 1217
27 Ga0070689_100248269 3300005340 Bacteria 1468
28 Ga0070687_100101611 3300005343 Bacteria 1611
29 Ga0070661_100060820 3300005344 Unclassified 2771
30 Ga0070661_100061648 3300005344 Bacteria 2753
31 Ga0070661_100069162 3300005344 Bacteria 2596
32 Ga0070661_100153664 3300005344 Unclassified 1741
33 Ga0070661_100252841 3300005344 Bacteria 1360
34 Ga0070661_100283266 3300005344 Bacteria 1286
35 Ga0070692_10087610 3300005345 Bacteria 1687
36 Ga0070668_100255583 3300005347 Bacteria 1455
37 Ga0070668_100331387 3300005347 Unclassified 1284
38 Ga0070669_100097945 3300005353 Bacteria 2208
39 Ga0070669_100341498 3300005353 Bacteria 1213
40 Ga0070669_100385853 3300005353 Bacteria 1143
41 Ga0070675_100093758 3300005354 Bacteria 2518
42 Ga0070675_100148912 3300005354 Unclassified 2005
43 Ga0070675_100326965 3300005354 Bacteria 1355
44 Ga0070671_100401498 3300005355 Bacteria 1172
45 Ga0070674_100194606 3300005356 Unclassified 1561
46 Ga0070674_100318107 3300005356 Bacteria 1247
47 Ga0070673_100068864 3300005364 Bacteria 2834
48 Ga0070673_100295687 3300005364 Bacteria 1424
49 Ga0070688_100195289 3300005365 Unclassified 1412
50 Ga0070688_100241979 3300005365 Bacteria 1281
51 Ga0070659_100045394 3300005366 Unclassified 3442
52 Ga0070659_100065797 3300005366 Bacteria 2871
53 Ga0070659_100080948 3300005366 Bacteria 2593
54 Ga0070659_100229766 3300005366 Bacteria 1533
55 Ga0070659_100240509 3300005366 Unclassified 1498
56 Ga0070659_100251683 3300005366 Unclassified 1464
57 Ga0070659_100336424 3300005366 Bacteria 1264
58 Ga0070659_100397427 3300005366 Bacteria 1163
59 Ga0070667_100092486 3300005367 Bacteria 2602
60 Ga0070667_100142138 3300005367 Bacteria 2103
61 Ga0070667_100159966 3300005367 Unclassified 1983
62 Ga0070703_10059593 3300005406 Bacteria 1245
63 Ga0070714_100192436 3300005435 Bacteria 1862
64 Ga0070714_100268350 3300005435 Bacteria 1582
65 Ga0070714_100462253 3300005435 Bacteria 1207
66 Ga0070713_100072157 3300005436 Bacteria 2919
67 Ga0070713_100278782 3300005436 Bacteria 1533
68 Ga0070713_100297645 3300005436 Bacteria 1485
69 Ga0070713_100385933 3300005436 Bacteria 1306
70 Ga0070710_10034750 3300005437 Bacteria 2744
71 Ga0070710_10045608 3300005437 Unclassified 2437
72 Ga0070711_100042660 3300005439 Bacteria 3068
73 Ga0070711_100165031 3300005439 Unclassified 1683
74 Ga0070711_100350622 3300005439 Unclassified 1187
75 Ga0070705_100209457 3300005440 Bacteria 1343
76 Ga0070705_100263949 3300005440 Bacteria 1216
77 Ga0070700_100069327 3300005441 Bacteria 2245
78 Ga0070700_100247579 3300005441 Bacteria 1277
79 Ga0070694_100366417 3300005444 Bacteria 1120
80 Ga0070708_100344864 3300005445 Unclassified 1403
81 Ga0070663_100055734 3300005455 Bacteria 2830
82 Ga0070663_100189192 3300005455 Unclassified 1601
83 Ga0070663_100189400 3300005455 Bacteria 1600
84 Ga0070663_100224981 3300005455 Bacteria 1475
85 Ga0070663_100393517 3300005455 Bacteria 1131
86 Ga0070678_100093535 3300005456 Bacteria 2312
87 Ga0070678_100115927 3300005456 Unclassified 2104
88 Ga0070678_100116956 3300005456 Bacteria 2096
89 Ga0070678_100271973 3300005456 Bacteria 1429
90 Ga0070678_100281010 3300005456 Bacteria 1408
91 Ga0070662_100164828 3300005457 Unclassified 1736
92 Ga0070662_100168226 3300005457 Bacteria 1719
93 Ga0070662_100217773 3300005457 Bacteria 1522
94 Ga0070662_100242360 3300005457 Bacteria 1446
95 Ga0070662_100406423 3300005457 Unclassified 1124
96 Ga0070681_10136972 3300005458 Bacteria 2379
97 Ga0070681_10245030 3300005458 Bacteria 1705
98 Ga0070681_10284876 3300005458 Bacteria 1563
99 Ga0068867_100344525 3300005459 Bacteria 1242
100 Ga0068867_100362840 3300005459 Bacteria 1212
101 Ga0068867_100365010 3300005459 Unclassified 1209
102 Ga0070707_100269996 3300005468 Bacteria 1654
103 Ga0070707_100411259 3300005468 Bacteria 1313
104 Ga0070698_100199902 3300005471 Unclassified 1935
105 Ga0070698_100342786 3300005471 Bacteria 1426
106 Ga0070699_100079647 3300005518 Bacteria 2854
107 Ga0070699_100214199 3300005518 Bacteria 1716
108 Ga0070699_100415378 3300005518 Bacteria 1217
109 Ga0070679_100043673 3300005530 Unclassified 4463
110 Ga0070679_100082192 3300005530 Unclassified 3211
111 Ga0070679_100211937 3300005530 Bacteria 1901
112 Ga0070679_100253130 3300005530 Bacteria 1717
113 Ga0070679_100261038 3300005530 Bacteria 1687
114 Ga0070679_100362772 3300005530 Bacteria 1396
115 Ga0070684_100086740 3300005535 Plasmid 2778
116 Ga0070684_100373931 3300005535 Unclassified 1312
117 Ga0070697_100131232 3300005536 Bacteria 2101
118 Ga0070697_100262368 3300005536 Unclassified 1479
119 Ga0070697_100311428 3300005536 Bacteria 1355
120 Ga0070697_100418621 3300005536 Bacteria 1164
121 Ga0068853_100014302 3300005539 Bacteria 6494
122 Ga0068853_100132597 3300005539 Unclassified 2232
123 Ga0068853_100416956 3300005539 Bacteria 1259
124 Ga0068853_100519778 3300005539 Bacteria 1125
125 Ga0070672_100024837 3300005543 Bacteria 4435
126 Ga0070672_100206745 3300005543 Bacteria 1643
127 Ga0070672_100254882 3300005543 Bacteria 1479
128 Ga0070672_100274245 3300005543 Bacteria 1425
129 Ga0070695_100184160 3300005545 Bacteria 1482
130 Ga0070696_100138442 3300005546 Bacteria 1776
131 Ga0070693_100138311 3300005547 Unclassified 1530
132 Ga0070693_100175304 3300005547 Bacteria 1376
133 Ga0070693_100188069 3300005547 Bacteria 1334
134 Ga0070665_100142673 3300005548 Bacteria 2398
135 Ga0070665_100222145 3300005548 Bacteria 1889
136 Ga0070665_100402782 3300005548 Bacteria 1376
137 Ga0070704_100209102 3300005549 Bacteria 1580
138 Ga0070704_100321781 3300005549 Bacteria 1296
139 Ga0068855_100029848 3300005563 Bacteria 6520
140 Ga0068855_100359391 3300005563 Unclassified 1603
141 Ga0068855_100398544 3300005563 Bacteria 1508
142 Ga0068855_100464579 3300005563 Bacteria 1380
143 Ga0068855_100501911 3300005563 Bacteria 1318
144 Ga0070664_100076136 3300005564 Unclassified 2882
145 Ga0070664_100111586 3300005564 Bacteria 2387
146 Ga0070664_100287100 3300005564 Bacteria 1485
147 Ga0070664_100301681 3300005564 Unclassified 1448
148 Ga0070664_100416297 3300005564 Bacteria 1230
149 Ga0070664_100469083 3300005564 Bacteria 1157
150 Ga0068857_100146099 3300005577 Bacteria 2140
151 Ga0068857_100514513 3300005577 Unclassified 1124
152 Ga0068854_100194527 3300005578 Unclassified 1591
153 Ga0068856_100075026 3300005614 Bacteria 3349
154 Ga0068856_100103286 3300005614 Bacteria 2844
155 Ga0068856_100248823 3300005614 Bacteria 1792
156 Ga0068856_100377123 3300005614 Bacteria 1437
157 Ga0068856_100445323 3300005614 Bacteria 1316
158 Ga0068856_100497933 3300005614 Unclassified 1239
159 Ga0070702_100078112 3300005615 Unclassified 1975
160 Ga0070702_100265372 3300005615 Bacteria 1171
161 Ga0068852_100369345 3300005616 Bacteria 1405
162 Ga0068852_100372716 3300005616 Bacteria 1399
163 Ga0068852_100473842 3300005616 Bacteria 1243
164 Ga0068859_100172345 3300005617 Bacteria 2245
165 Ga0068859_100226426 3300005617 Bacteria 1958
166 Ga0068859_100232458 3300005617 Unclassified 1932
167 Ga0068859_100286372 3300005617 Viruses 1740
168 Ga0068859_100462544 3300005617 Bacteria 1364
169 Ga0068864_100278113 3300005618 Bacteria 1562
170 Ga0068864_100301774 3300005618 Bacteria 1499
171 Ga0068866_10125269 3300005718 Bacteria 1453
172 Ga0068861_100172167 3300005719 Bacteria 1795
173 Ga0068870_10119191 3300005840 Unclassified 1518
174 Ga0068863_100319686 3300005841 Unclassified 1507
175 Ga0068863_100329946 3300005841 Bacteria 1483
176 Ga0068858_100309899 3300005842 Bacteria 1507
177 Ga0068858_100453303 3300005842 Viruses 1236
178 Ga0068858_100463518 3300005842 Unclassified 1222
179 Ga0068860_100385621 3300005843 Viruses 1384
180 Ga0068862_100094449 3300005844 Bacteria 2608
181 Ga0081455_10067985 3300005937 Bacteria 2967
182 Ga0081538_10013894 3300005981 Bacteria 6345
183 Ga0081538_10098483 3300005981 Bacteria 1481
184 Ga0081538_10121646 3300005981 Unclassified 1252
185 Ga0070717_10277490 3300006028 Unclassified 1486
186 Ga0070717_10312507 3300006028 Bacteria 1399
187 Ga0070717_10319228 3300006028 Unclassified 1384
188 Ga0070717_10342802 3300006028 Bacteria 1335
189 Ga0070715_10032720 3300006163 Bacteria 2120
190 Ga0070716_100152200 3300006173 Bacteria 1489
191 Ga0070716_100164553 3300006173 Bacteria 1441
192 Ga0070716_100176806 3300006173 Unclassified 1398
193 Ga0070716_100195590 3300006173 Bacteria 1340
194 Ga0070716_100215303 3300006173 Bacteria 1286
195 Ga0070716_100220828 3300006173 Unclassified 1273
196 Ga0070712_100180272 3300006175 Unclassified 1645
197 Ga0070712_100185268 3300006175 Bacteria 1625
198 Ga0070712_100254884 3300006175 Unclassified 1404
199 Ga0070712_100358211 3300006175 Bacteria 1196
200 Ga0097621_100201637 3300006237 Bacteria 1727
201 Ga0097621_100260718 3300006237 Bacteria 1520
202 Ga0068871_100251163 3300006358 Bacteria 1540
203 Ga0068871_100306403 3300006358 Bacteria 1395
204 Ga0068871_100414274 3300006358 Bacteria 1202
205 Ga0068871_100429389 3300006358 Bacteria 1181
206 Ga0075428_100459203 3300006844 Bacteria 1364
207 Ga0075431_100274740 3300006847 Bacteria 1707
208 Ga0075431_100468394 3300006847 Bacteria 1254
209 Ga0075433_10014079 3300006852 Bacteria 6522
210 Ga0075433_10041156 3300006852 Plasmid 4002
211 Ga0075433_10346434 3300006852 Bacteria 1313
212 Ga0075433_10420959 3300006852 Bacteria 1178
213 Ga0075434_100173372 3300006871 Bacteria 2177
214 Ga0075434_100284201 3300006871 Bacteria 1674
215 Ga0068865_100221087 3300006881 Bacteria 1481
216 Ga0068865_100237365 3300006881 Bacteria 1433
217 Ga0068865_100265723 3300006881 Bacteria 1360
218 Ga0068865_100310514 3300006881 Bacteria 1265
219 Ga0075436_100078636 3300006914 Bacteria 2285
220 Ga0075436_100201375 3300006914 Unclassified 1410
221 Ga0075436_100218345 3300006914 Bacteria 1353
222 Ga0075436_100246233 3300006914 Bacteria 1272
223 Ga0097620_100172352 3300006931 Bacteria 2245
224 Ga0097620_100226441 3300006931 Bacteria 1958
225 Ga0097620_100232470 3300006931 Unclassified 1932
226 Ga0097620_100286385 3300006931 Viruses 1740
227 Ga0097620_100462549 3300006931 Bacteria 1364
228 Ga0075435_100021274 3300007076 Bacteria 4986
229 Ga0075435_100152987 3300007076 Unclassified 1940
230 Ga0075435_100157184 3300007076 Bacteria 1913
231 Ga0075435_100283355 3300007076 Unclassified 1415
232 Ga0099794_10070774 3300007265 Bacteria 1708
233 Ga0099794_10108078 3300007265 Bacteria 1392
234 Ga0099795_10063706 3300007788 Unclassified 1375
235 Ga0105251_10093855 3300009011 Bacteria 1376
236 Ga0105240_10055087 3300009093 Unclassified 4980
237 Ga0105240_10273048 3300009093 Unclassified 1945
238 Ga0105240_10513682 3300009093 Bacteria 1330
239 Ga0105240_10515624 3300009093 Bacteria 1327
240 Ga0111539_10419893 3300009094 Unclassified 1558
241 Ga0111539_10437439 3300009094 Bacteria 1523
242 Ga0111539_10611461 3300009094 Bacteria 1269
243 Ga0105245_10177706 3300009098 Unclassified 2031
244 Ga0105245_10386237 3300009098 Bacteria 1395
245 Ga0105245_10440702 3300009098 Bacteria 1309
246 Ga0105247_10151257 3300009101 Bacteria 1529
247 Ga0105247_10170597 3300009101 Bacteria 1446
248 Ga0114129_10105138 3300009147 Plasmid 3902
249 Ga0114129_10423399 3300009147 Bacteria 1751
250 Ga0114129_10595489 3300009147 Bacteria 1433
251 Ga0105243_10284021 3300009148 Bacteria 1492
252 Ga0105241_10059419 3300009174 Bacteria 2939
253 Ga0105241_10168726 3300009174 Unclassified 1806
254 Ga0105241_10189298 3300009174 Bacteria 1712
255 Ga0105241_10296294 3300009174 Bacteria 1387
256 Ga0105241_10310511 3300009174 Bacteria 1356
257 Ga0105241_10358461 3300009174 Bacteria 1268
258 Ga0105241_10402985 3300009174 Bacteria 1200
259 Ga0105248_10243301 3300009177 Bacteria 2025
260 Ga0105248_10262783 3300009177 Bacteria 1943
261 Ga0105248_10421473 3300009177 Unclassified 1503
262 Ga0105248_10527918 3300009177 Bacteria 1331
263 Ga0105237_10359745 3300009545 Bacteria 1460
264 Ga0105237_10394042 3300009545 Bacteria 1389
265 Ga0105238_10205618 3300009551 Unclassified 1945
266 Ga0105238_10233118 3300009551 Bacteria 1817
267 Ga0105238_10335908 3300009551 Bacteria 1498
268 Ga0105249_10384768 3300009553 Bacteria 1430
269 Ga0105249_10423375 3300009553 Bacteria 1366
270 Ga0105249_10448593 3300009553 Bacteria 1328
271 Ga0105239_10362360 3300010375 Bacteria 1637
272 Ga0105246_10202633 3300011119 Unclassified 1544
273 Ga0105246_10242955 3300011119 Bacteria 1424
274 Ga0105246_10309291 3300011119 Bacteria 1279
275 Ga0157338_1003370 3300012515 Bacteria 1322
276 Ga0157373_10045259 3300013100 Bacteria 3142
277 Ga0157373_10055595 3300013100 Unclassified 2812
278 Ga0157373_10101002 3300013100 Unclassified 2030
279 Ga0157373_10135618 3300013100 Bacteria 1731
280 Ga0157373_10218638 3300013100 Bacteria 1344
281 Ga0157371_10160217 3300013102 Bacteria 1607
282 Ga0157371_10196872 3300013102 Unclassified 1444
283 Ga0157370_10223874 3300013104 Bacteria 1742
284 Ga0157370_10240731 3300013104 Bacteria 1674
285 Ga0157369_10133255 3300013105 Bacteria 2632
286 Ga0157369_10199777 3300013105 Bacteria 2099
287 Ga0157369_10252868 3300013105 Bacteria 1839
288 Ga0157369_10255225 3300013105 Bacteria 1829
289 Ga0157369_10349393 3300013105 Bacteria 1536
290 Ga0157374_10089312 3300013296 Unclassified 2936
291 Ga0157374_10169048 3300013296 Bacteria 2132
292 Ga0157374_10175869 3300013296 Bacteria 2089
293 Ga0157374_10326941 3300013296 Bacteria 1520
294 Ga0157374_10348439 3300013296 Bacteria 1471
295 Ga0157374_10424450 3300013296 Bacteria 1329
296 Ga0157374_10601412 3300013296 Unclassified 1110
297 Ga0157378_10087490 3300013297 Bacteria 2826
298 Ga0157378_10345412 3300013297 Bacteria 1452
299 Ga0157378_10481142 3300013297 Bacteria 1237
300 Ga0163162_10219993 3300013306 Bacteria 2029
301 Ga0163162_10402181 3300013306 Bacteria 1502
302 Ga0163162_10449446 3300013306 Bacteria 1421
303 Ga0163162_10488062 3300013306 Bacteria 1363
304 Ga0163162_10538500 3300013306 Bacteria 1296
305 Ga0157372_10095063 3300013307 Unclassified 3395
306 Ga0157372_10172149 3300013307 Bacteria 2505
307 Ga0157372_10174519 3300013307 Unclassified 2488
308 Ga0157372_10230936 3300013307 Bacteria 2145
309 Ga0157372_10342421 3300013307 Unclassified 1742
310 Ga0157372_10393912 3300013307 Bacteria 1614
311 Ga0157372_10405841 3300013307 Bacteria 1588
312 Ga0157372_10571183 3300013307 Bacteria 1318
313 Ga0157372_10756534 3300013307 Bacteria 1130
314 Ga0157375_10193056 3300013308 Bacteria 2191
315 Ga0157375_10236359 3300013308 Bacteria 1987
316 Ga0157375_10423544 3300013308 Unclassified 1497
317 Ga0157375_10536480 3300013308 Bacteria 1332
318 Ga0163163_10286135 3300014325 Bacteria 1700
319 Ga0163163_10379714 3300014325 Bacteria 1471
320 Ga0157380_10200137 3300014326 Unclassified 1771
321 Ga0157380_10264565 3300014326 Bacteria 1564
322 Ga0157377_10135867 3300014745 Bacteria 1507
323 Ga0157379_10362992 3300014968 Unclassified 1327
324 Ga0157376_10238219 3300014969 Bacteria 1694
325 Ga0157376_10305488 3300014969 Bacteria 1507
326 Ga0157376_10355415 3300014969 Unclassified 1403
327 Ga0157376_10493196 3300014969 Bacteria 1202
328 Ga0182007_10024421 3300015262 Unclassified 2114
329 Ga0163161_10063859 3300017792 Bacteria 2685
330 Ga0163161_10174555 3300017792 Bacteria 1645
331 Ga0163161_10182751 3300017792 Bacteria 1609
332 Ga0213872_10123171 3300021361 Unclassified 1145
333 Ga0213876_10159964 3300021384 Unclassified 1198
334 Ga0213875_10053243 3300021388 Unclassified 1895
335 Ga0213875_10086588 3300021388 Unclassified 1461
336 Ga0213875_10134202 3300021388 Unclassified 1157
337 Ga0224712_10104504 3300022467 Unclassified 1206
338 Ga0228598_1026016 3300024227 Bacteria 1151
339 Ga0207697_10092584 3300025315 Bacteria 1282
340 Ga0207653_10039471 3300025885 Unclassified 1546
341 Ga0207682_10093885 3300025893 Bacteria 1304
342 Ga0207692_10111811 3300025898 Bacteria 1516
343 Ga0207692_10153650 3300025898 Unclassified 1320
344 Ga0207692_10173472 3300025898 Bacteria 1251
345 Ga0207710_10110546 3300025900 Bacteria 1305
346 Ga0207688_10193022 3300025901 Bacteria 1219
347 Ga0207680_10243111 3300025903 Bacteria 1241
348 Ga0207680_10243775 3300025903 Bacteria 1239
349 Ga0207647_10060511 3300025904 Unclassified 2315
350 Ga0207685_10079037 3300025905 Bacteria 1356
351 Ga0207685_10099697 3300025905 Bacteria 1240
352 Ga0207699_10195240 3300025906 Unclassified 1368
353 Ga0207699_10262488 3300025906 Bacteria 1194
354 Ga0207699_10267495 3300025906 Unclassified 1183
355 Ga0207645_10184659 3300025907 Bacteria 1369
356 Ga0207645_10208275 3300025907 Bacteria 1288
357 Ga0207645_10249339 3300025907 Unclassified 1174
358 Ga0207643_10044770 3300025908 Bacteria 2498
359 Ga0207643_10159421 3300025908 Bacteria 1357
360 Ga0207705_10091115 3300025909 Bacteria 2233
361 Ga0207705_10273678 3300025909 Bacteria 1291
362 Ga0207705_10348083 3300025909 Bacteria 1141
363 Ga0207684_10032773 3300025910 Unclassified 4418
364 Ga0207654_10232768 3300025911 Bacteria 1228
365 Ga0207654_10264081 3300025911 Unclassified 1159
366 Ga0207654_10268661 3300025911 Bacteria 1150
367 Ga0207654_10270225 3300025911 Bacteria 1147
368 Ga0207707_10147265 3300025912 Bacteria 2059
369 Ga0207707_10229775 3300025912 Bacteria 1614
370 Ga0207707_10239589 3300025912 Bacteria 1577
371 Ga0207707_10244838 3300025912 Unclassified 1558
372 Ga0207707_10393024 3300025912 Bacteria 1191
373 Ga0207695_10018179 3300025913 Bacteria 8134
374 Ga0207695_10112199 3300025913 Bacteria 2705
375 Ga0207695_10481603 3300025913 Unclassified 1123
376 Ga0207671_10239111 3300025914 Unclassified 1426
377 Ga0207693_10074518 3300025915 Plasmid 2658
378 Ga0207693_10153248 3300025915 Unclassified 1813
379 Ga0207693_10231593 3300025915 Bacteria 1450
380 Ga0207693_10262937 3300025915 Bacteria 1353
381 Ga0207693_10342932 3300025915 Bacteria 1169
382 Ga0207663_10193105 3300025916 Bacteria 1463
383 Ga0207663_10263046 3300025916 Unclassified 1275
384 Ga0207663_10271385 3300025916 Unclassified 1257
385 Ga0207663_10327326 3300025916 Bacteria 1153
386 Ga0207660_10213706 3300025917 Bacteria 1511
387 Ga0207660_10377429 3300025917 Unclassified 1139
388 Ga0207657_10035291 3300025919 Bacteria 4485
389 Ga0207657_10130641 3300025919 Bacteria 2058
390 Ga0207649_10021878 3300025920 Bacteria 3689
391 Ga0207649_10067822 3300025920 Bacteria 2266
392 Ga0207649_10070808 3300025920 Bacteria 2225
393 Ga0207649_10185658 3300025920 Unclassified 1459
394 Ga0207649_10283004 3300025920 Bacteria 1206
395 Ga0207649_10309591 3300025920 Unclassified 1157
396 Ga0207652_10024409 3300025921 Bacteria 5016
397 Ga0207652_10207616 3300025921 Bacteria 1763
398 Ga0207652_10234582 3300025921 Unclassified 1653
399 Ga0207652_10467552 3300025921 Bacteria 1136
400 Ga0207646_10166143 3300025922 Bacteria 1992
401 Ga0207646_10459295 3300025922 Bacteria 1149
402 Ga0207681_10074123 3300025923 Bacteria 2383
403 Ga0207681_10304285 3300025923 Bacteria 1262
404 Ga0207681_10344986 3300025923 Bacteria 1190
405 Ga0207694_10354291 3300025924 Unclassified 1215
406 Ga0207694_10385131 3300025924 Bacteria 1164
407 Ga0207694_10391161 3300025924 Bacteria 1155
408 Ga0207659_10336459 3300025926 Bacteria 1249
409 Ga0207687_10318394 3300025927 Bacteria 1258
410 Ga0207687_10331464 3300025927 Bacteria 1235
411 Ga0207687_10378849 3300025927 Unclassified 1159
412 Ga0207700_10086842 3300025928 Bacteria 2459
413 Ga0207700_10367141 3300025928 Bacteria 1256
414 Ga0207700_10377057 3300025928 Bacteria 1240
415 Ga0207700_10403488 3300025928 Bacteria 1198
416 Ga0207700_10421015 3300025928 Bacteria 1173
417 Ga0207664_10028368 3300025929 Bacteria 4253
418 Ga0207664_10129128 3300025929 Bacteria 2125
419 Ga0207664_10413312 3300025929 Bacteria 1201
420 Ga0207664_10416630 3300025929 Unclassified 1196
421 Ga0207644_10274692 3300025931 Bacteria 1351
422 Ga0207690_10114771 3300025932 Bacteria 1945
423 Ga0207690_10134869 3300025932 Unclassified 1811
424 Ga0207690_10362068 3300025932 Unclassified 1149
425 Ga0207706_10068215 3300025933 Bacteria 3130
426 Ga0207706_10095913 3300025933 Bacteria 2608
427 Ga0207706_10134784 3300025933 Bacteria 2172
428 Ga0207706_10197445 3300025933 Unclassified 1765
429 Ga0207706_10344650 3300025933 Bacteria 1296
430 Ga0207706_10422870 3300025933 Unclassified 1154
431 Ga0207686_10228606 3300025934 Bacteria 1347
432 Ga0207669_10304248 3300025937 Bacteria 1213
433 Ga0207665_10156980 3300025939 Bacteria 1634
434 Ga0207665_10174300 3300025939 Unclassified 1555
435 Ga0207665_10188907 3300025939 Unclassified 1495
436 Ga0207665_10213722 3300025939 Bacteria 1410
437 Ga0207665_10224276 3300025939 Unclassified 1379
438 Ga0207691_10059414 3300025940 Bacteria 3476
439 Ga0207691_10261065 3300025940 Bacteria 1493
440 Ga0207691_10311351 3300025940 Bacteria 1351
441 Ga0207691_10388152 3300025940 Bacteria 1191
442 Ga0207711_10425498 3300025941 Bacteria 1235
443 Ga0207661_10036263 3300025944 Bacteria 3848
444 Ga0207661_10412234 3300025944 Unclassified 1226
445 Ga0207679_10053942 3300025945 Bacteria 2957
446 Ga0207679_10084945 3300025945 Unclassified 2430
447 Ga0207679_10169094 3300025945 Bacteria 1798
448 Ga0207679_10173765 3300025945 Unclassified 1776
449 Ga0207679_10367938 3300025945 Bacteria 1257
450 Ga0207679_10397096 3300025945 Bacteria 1212
451 Ga0207667_10057799 3300025949 Bacteria 4070
452 Ga0207667_10079257 3300025949 Unclassified 3404
453 Ga0207667_10119523 3300025949 Plasmid 2716
454 Ga0207667_10336645 3300025949 Unclassified 1540
455 Ga0207667_10489738 3300025949 Bacteria 1248
456 Ga0207667_10566873 3300025949 Unclassified 1147
457 Ga0207667_10576851 3300025949 Unclassified 1136
458 Ga0207651_10152885 3300025960 Bacteria 1799
459 Ga0207651_10310083 3300025960 Bacteria 1315
460 Ga0207668_10337720 3300025972 Bacteria 1255
461 Ga0207640_10357294 3300025981 Unclassified 1176
462 Ga0207658_10200036 3300025986 Bacteria 1667
463 Ga0207658_10408088 3300025986 Bacteria 1195
464 Ga0207658_10447591 3300025986 Bacteria 1143
465 Ga0207703_10272083 3300026035 Unclassified 1535
466 Ga0207703_10388259 3300026035 Bacteria 1293
467 Ga0207703_10490273 3300026035 Bacteria 1152
468 Ga0207639_10009030 3300026041 Bacteria 6865
469 Ga0207639_10217133 3300026041 Unclassified 1649
470 Ga0207639_10443857 3300026041 Bacteria 1177
471 Ga0207678_10102472 3300026067 Unclassified 2444
472 Ga0207678_10165354 3300026067 Unclassified 1889
473 Ga0207678_10216197 3300026067 Unclassified 1640
474 Ga0207678_10228880 3300026067 Bacteria 1592
475 Ga0207678_10368430 3300026067 Bacteria 1241
476 Ga0207708_10374010 3300026075 Bacteria 1173
477 Ga0207702_10020373 3300026078 Bacteria 5493
478 Ga0207702_10022282 3300026078 Bacteria 5250
479 Ga0207702_10065041 3300026078 Bacteria 3123
480 Ga0207702_10407809 3300026078 Bacteria 1312
481 Ga0207702_10503259 3300026078 Bacteria 1181
482 Ga0207702_10506546 3300026078 Bacteria 1177
483 Ga0207702_10509861 3300026078 Bacteria 1173
484 Ga0207641_10368239 3300026088 Bacteria 1373
485 Ga0207641_10556992 3300026088 Unclassified 1118
486 Ga0207648_10059514 3300026089 Bacteria 3331
487 Ga0207648_10208217 3300026089 Unclassified 1735
488 Ga0207648_10247181 3300026089 Bacteria 1590
489 Ga0207648_10385996 3300026089 Unclassified 1267
490 Ga0207676_10328128 3300026095 Unclassified 1407
491 Ga0207676_10369772 3300026095 Bacteria 1331
492 Ga0207676_10398506 3300026095 Bacteria 1285
493 Ga0207674_10065416 3300026116 Unclassified 3665
494 Ga0207674_10169444 3300026116 Bacteria 2137
495 Ga0207674_10344903 3300026116 Unclassified 1440
496 Ga0207674_10364157 3300026116 Unclassified 1397
497 Ga0207675_100337944 3300026118 Bacteria 1474
498 Ga0207675_100353105 3300026118 Bacteria 1441
499 Ga0207683_10164375 3300026121 Unclassified 2008
500 Ga0207683_10226711 3300026121 Bacteria 1703
501 Ga0207683_10245029 3300026121 Bacteria 1635
502 Ga0207683_10266097 3300026121 Bacteria 1566
503 Ga0207683_10428523 3300026121 Bacteria 1219
504 Ga0207698_10507875 3300026142 Unclassified 1174
505 Ga0209984_1010850 3300027424 Bacteria 1174
506 Ga0210000_1013427 3300027462 Bacteria 1222
507 Ga0209968_1012321 3300027526 Unclassified 1332
508 Ga0209982_1008329 3300027552 Bacteria 1520
509 Ga0209983_1017187 3300027665 Unclassified 1496
510 Ga0209971_1023436 3300027682 Bacteria 1473
511 Ga0209974_10057539 3300027876 Bacteria 1313
512 Ga0207428_10073657 3300027907 Bacteria 2679
513 Ga0207428_10317202 3300027907 Bacteria 1152
514 Ga0207428_10325969 3300027907 Unclassified 1133
515 Ga0268266_10401168 3300028379 Bacteria 1296
516 Ga0268265_10095557 3300028380 Bacteria 2386
517 Ga0268265_10325775 3300028380 Bacteria 1393
518 Ga0268265_10523177 3300028380 Bacteria 1121
519 Ga0268264_10561556 3300028381 Viruses 1121
520 Ga0265760_10021438 3300031090 Unclassified 1870
521 Ga0265760_10023382 3300031090 Bacteria 1796
522 Ga0265760_10051539 3300031090 Bacteria 1240
523 Ga0265325_10104842 3300031241 Unclassified 1380
524 Ga0265316_10322222 3300031344 Unclassified 1122
525 Ga0307411_10278791 3300032005 Bacteria 1329
526 Ga0373930_0018401 3300034816 Unclassified 1342
527 Ga0373930_0020507 3300034816 Bacteria 1289
528 Ga0373958_0018361 3300034819 Unclassified 1267
529 Ga0373959_0016053 3300034820 Unclassified 1383
530 Ga0373926_0060479 3300035083 Bacteria 1380
531 Ga0373928_0023318 3300035084 Unclassified 1319
532 Ga0373929_0024187 3300035085 Unclassified 1253
533 Ga0373934_0051542 3300035086 Bacteria 1631
534 Ga0373949_0038880 3300035090 Bacteria 1162
535 Ga0373951_0027661 3300035091 Unclassified 1325
536 Ga0373951_0040490 3300035091 Bacteria 1122
537 Ga0373952_0016898 3300035092 Bacteria 1490
538 Ga0373923_0046464 3300035111 Bacteria 1806
539 Ga0373923_0093142 3300035111 Bacteria 1320
540 Ga0373923_0110244 3300035111 Bacteria 1221
541 Ga0373932_0027704 3300035112 Bacteria 1552
542 Ga0373939_0022858 3300035114 Unclassified 1727
543 Ga0373941_0032766 3300035115 Bacteria 1557
544 Ga0373941_0056597 3300035115 Unclassified 1263
545 Ga0373953_0114477 3300035117 Bacteria 1142
546 Ga0373953_0119832 3300035117 Bacteria 1117
547 Ga0373960_0028129 3300035121 Unclassified 1549
548 Ga0373943_0074765 3300035170 Bacteria 1723
549 Ga0373943_0078063 3300035170 Bacteria 1692
550 Ga0373946_0017225 3300035171 Bacteria 2762
551 Ga0373946_0104041 3300035171 Bacteria 1276
552 Ga0373946_0116434 3300035171 Unclassified 1215
553 Ga0373955_0095384 3300035172 Bacteria 1701
554 Ga0373955_0154520 3300035172 Bacteria 1351
555 Ga0373961_0033849 3300035241 Unclassified 1441
556 Ga0373962_0028143 3300035242 Unclassified 1523
557 Ga0373924_0081391 3300035410 Bacteria 1377
558 Ga0373931_0143990 3300035691 Bacteria 1383
559 Ga0373931_0164811 3300035691 Bacteria 1301
560 Ga0373931_0186125 3300035691 Unclassified 1232
561 Ga0373931_0214736 3300035691 Unclassified 1155
562 Ga0373935_0149423 3300035692 Bacteria 1584
563 Ga0373935_0189355 3300035692 Bacteria 1416
564 Ga0373935_0221417 3300035692 Bacteria 1314
565 Ga0373935_0255061 3300035692 Bacteria 1228
566 Ga0373927_0048002 3300035695 Plasmid 2761
567 Ga0373927_0138606 3300035695 Unclassified 1590
568 Ga0373927_0147157 3300035695 Bacteria 1542
569 Ga0373927_0214136 3300035695 Bacteria 1265
570 Ga0373933_0062598 3300035724 Bacteria 2247
571 Ga0373933_0073667 3300035724 Bacteria 2081
572 Ga0373947_0059558 3300035725 Bacteria 2315
573 Ga0373947_0105573 3300035725 Bacteria 1774
574 Ga0373947_0238036 3300035725 Bacteria 1200
575 Ga0373947_0249507 3300035725 Bacteria 1173
576 Ga0373937_0084798 3300036401 Unclassified 2931
577 Ga0373937_0329867 3300036401 Bacteria 1444
578 Ga0316582_0209836 3300036647 Bacteria 1330
579 Ga0373925_0016340 3300037068 Bacteria 5374
580 Ga0373925_0171633 3300037068 Unclassified 1712
581 Ga0373925_0198331 3300037068 Unclassified 1595
582 Ga0373925_0212116 3300037068 Unclassified 1543
583 Ga0373925_0215302 3300037068 Bacteria 1531
584 Ga0373925_0223608 3300037068 Unclassified 1503
585 Ga0436364_0429406 3300037853 Bacteria 1616
586 Ga0436364_1016885 3300037853 Bacteria 2097
587 Ga0436364_1280539 3300037853 Unclassified 1642
588 Ga0395901_0458930 3300038443 Unclassified 1302
589 Ga0436365_1179962 3300039437 Unclassified 1508
590 Ga0436365_1282369 3300039437 Bacteria 1194
591 Ga0436360_0177423 3300039438 Bacteria 1282
592 Ga0436360_1198479 3300039438 Unclassified 1409
593 Ga0436361_0110909 3300039447 Bacteria 2075
594 Ga0436361_0984751 3300039447 Unclassified 1951
595 Ga0436363_0273568 3300039450 Bacteria 1764
596 Ga0436363_1702755 3300039450 Bacteria 1816
597 Ga0439448_0055631 3300042005 Bacteria 1301
598 Ga0439435_0031562 3300042436 Bacteria 1441
599 Ga0450918_020587 3300042531 Bacteria 1152
600 Ga0451577_0422135 3300042876 Bacteria 1211
601 Ga0453683_0213058 3300044673 Unclassified 1227
602 Ga0466966_0144323 3300044684 Bacteria 1453
603 Ga0466966_0161107 3300044684 Bacteria 1366
604 Ga0466963_0240385 3300044694 Bacteria 1270
605 Ga0453684_0482188 3300044712 Bacteria 1375
606 Ga0466968_0055107 3300044735 Unclassified 1706
607 Ga0451576_0056853 3300045051 Bacteria 4090
608 Ga0451576_0192451 3300045051 Bacteria 2130
609 Ga0451576_0205590 3300045051 Bacteria 2056
610 Ga0451576_0398666 3300045051 Bacteria 1442
611 Ga0451576_0731307 3300045051 Unclassified 1039
612 Ga0466967_0336714 3300045976 Bacteria 1458
613 Ga0466967_0449262 3300045976 Unclassified 1259
614 Ga0466967_0472621 3300045976 Unclassified 1227
615 Ga0495603_0045675 3300046455 Bacteria 2611
616 Ga0495603_0166754 3300046455 Bacteria 1276
617 Ga0495651_0115489 3300046462 Bacteria 1979
618 Ga0495580_0000182 3300046472 Bacteria 47252
619 Ga0495580_0009948 3300046472 Bacteria 7442
620 Ga0495580_0043400 3300046472 Bacteria 3200
621 Ga0495580_0155505 3300046472 Bacteria 1583
622 Ga0495582_0053590 3300046473 Bacteria 2225
623 Ga0495582_0118573 3300046473 Bacteria 1490
624 Ga0495582_0175274 3300046473 Bacteria 1221
625 Ga0495582_0188094 3300046473 Bacteria 1177
626 Ga0495639_0033817 3300046475 Bacteria 2284
627 Ga0495639_0044808 3300046475 Bacteria 2000
628 Ga0495662_0154484 3300046476 Bacteria 1130
629 Ga0495664_0170933 3300046477 Bacteria 1318
630 Ga0495664_0199628 3300046477 Unclassified 1212
631 Ga0495594_0113200 3300046499 Bacteria 1530
632 Ga0495620_0098877 3300046515 Bacteria 1164
633 Ga0495628_0257907 3300046516 Bacteria 1300
634 Ga0495666_0056643 3300046526 Bacteria 1877
635 Ga0495642_0076067 3300046528 Unclassified 1409
636 Ga0495652_0286363 3300046529 Bacteria 1204
637 Ga0495652_0309025 3300046529 Bacteria 1146
638 Ga0495665_0090964 3300046531 Bacteria 1603
639 Ga0495665_0094379 3300046531 Bacteria 1571
640 Ga0495665_0111259 3300046531 Bacteria 1436
641 Ga0495665_0142269 3300046531 Unclassified 1253
642 Ga0495640_0109214 3300046533 Unclassified 1809
643 Ga0495640_0201721 3300046533 Unclassified 1260
644 Ga0495645_0154521 3300046543 Bacteria 1591
645 Ga0495635_0170881 3300046663 Bacteria 1478
646 Ga0495635_0223417 3300046663 Unclassified 1273
647 Ga0495659_0051776 3300046664 Unclassified 1496
648 Ga0495658_0168745 3300046683 Bacteria 1353
649 Ga0495658_0179087 3300046683 Bacteria 1315
650 Ga0495658_0223911 3300046683 Bacteria 1178
651 Ga0495658_0241528 3300046683 Bacteria 1134
652 Ga0495613_0124374 3300046689 Bacteria 1850
653 Ga0495613_0244622 3300046689 Bacteria 1253
654 Ga0495581_0096281 3300047315 Bacteria 1718
655 Ga0495581_0154607 3300047315 Bacteria 1340
656 Ga0495636_0112642 3300047318 Unclassified 1198
657 Ga0495674_0162482 3300047319 Bacteria 1868
658 Ga0495674_0332624 3300047319 Unclassified 1236
659 Ga0495674_0355997 3300047319 Bacteria 1187
660 Ga0495674_0396039 3300047319 Bacteria 1115
661 Ga0495680_0223684 3300047322 Bacteria 1342
662 Ga0495684_0188818 3300047471 Bacteria 1524
663 Ga0495684_0262105 3300047471 Bacteria 1253
664 Ga0495684_0292323 3300047471 Bacteria 1172
665 Ga0495593_0088493 3300047673 Bacteria 1596
666 Ga0495593_0095654 3300047673 Unclassified 1527
667 Ga0495602_0275624 3300048088 Bacteria 1241
668 Ga0496100_0236449 3300048903 Bacteria 1346
669 Ga0496102_0172401 3300048905 Bacteria 2037
670 Ga0496104_0378920 3300048907 Bacteria 1327
671 Ga0496105_0317640 3300048908 Bacteria 1249
672 Ga0496106_0290180 3300048909 Bacteria 1311
673 Ga0496107_0295995 3300048910 Bacteria 1204
674 Ga0496108_0143993 3300048911 Unclassified 2054
675 Ga0496108_0421080 3300048911 Bacteria 1166
676 Ga0496109_0479003 3300048912 Bacteria 1175
677 Ga0496111_0079920 3300048914 Bacteria 2385
678 Ga0496112_0006862 3300048915 Bacteria 10040
679 Ga0496112_0325698 3300048915 Unclassified 1480
680 Ga0496113_0162534 3300048916 Unclassified 1766
681 Ga0496114_0313560 3300048917 Bacteria 1386
682 Ga0496115_0017801 3300048918 Bacteria 5441
683 Ga0496115_0247410 3300048918 Bacteria 1468
684 Ga0496115_0359031 3300048918 Bacteria 1187
685 Ga0496115_0378537 3300048918 Unclassified 1151
686 Ga0496120_0146316 3300048923 Unclassified 1193
687 Ga0501031_0194941 3300049568 Bacteria 1322
688 Ga0501033_0007065 3300049570 Bacteria 8767
689 Ga0501036_0328148 3300049572 Bacteria 1278
690 Ga0501038_0342533 3300049574 Bacteria 1165
691 Ga0501039_0171544 3300049575 Bacteria 1705
692 Ga0501039_0313808 3300049575 Bacteria 1232
693 Ga0501040_0103930 3300049576 Bacteria 1983
694 Ga0501041_0199369 3300049577 Bacteria 1254
695 Ga0501042_0236861 3300049578 Bacteria 1317
696 Ga0501042_0253625 3300049578 Bacteria 1269
697 Ga0501046_0252539 3300049580 Bacteria 1297
698 Ga0501048_0292003 3300049582 Bacteria 1159
699 Ga0501070_0356753 3300049586 Bacteria 1186
700 Ga0501072_0314064 3300049588 Bacteria 1245
701 Ga0501074_0016088 3300049590 Bacteria 5437
702 Ga0501075_0262699 3300049591 Bacteria 1316
703 Ga0501075_0318817 3300049591 Bacteria 1184
704 Ga0501076_0363667 3300049592 Bacteria 1188
705 Ga0501077_0218090 3300049593 Bacteria 1212
706 Ga0501079_0342869 3300049741 Bacteria 1170
707 Ga0501081_0268637 3300049743 Bacteria 1247
708 Ga0501081_0291274 3300049743 Bacteria 1196
709 Ga0501045_0280426 3300049824 Bacteria 1240
710 nmdc:mga05p37_232967_c1 3300050507 Bacteria 2218
711 nmdc:mga05p37_386607_c1 3300050507 Bacteria 1638
712 nmdc:mga05p37_541209_c1 3300050507 Bacteria 1328
713 nmdc:mga06r32_375914_c1 3300050510 Unclassified 1404
714 nmdc:mga08y16_189638_c1 3300050511 Bacteria 2133
715 nmdc:mga08y16_525508_c1 3300050511 Unclassified 1200
716 nmdc:mga0n895_338350_c1 3300050512 Unclassified 1525
717 nmdc:mga0n895_416771_c1 3300050512 Bacteria 1358
718 nmdc:mga0rr50_123895_c1 3300050513 Bacteria 2061
719 nmdc:mga0rr50_145114_c1 3300050513 Bacteria 1913
720 nmdc:mga0rr50_17475_c1 3300050513 Unclassified 4791
721 nmdc:mga0rr50_229460_c1 3300050513 Bacteria 1536
722 nmdc:mga08x19_117557_c1 3300050514 Unclassified 1779
723 nmdc:mga08x19_143986_c1 3300050514 Bacteria 1611
724 nmdc:mga0a205_107246_c1 3300050515 Bacteria 2691
725 nmdc:mga0a205_179526_c1 3300050515 Bacteria 2011
726 nmdc:mga0a205_3164_c2 3300050515 Plasmid 3769
727 nmdc:mga0a205_372834_c1 3300050515 Bacteria 1293
728 nmdc:mga0a205_6654_c2 3300050515 Bacteria 10152
729 Ga0495601_0046747 3300053077 Unclassified 2724
730 Ga0495595_0123522 3300053084 Bacteria 1262
731 Ga0495619_0015073 3300053085 Bacteria 4884
732 Ga0495619_0242019 3300053085 Bacteria 1250
733 Ga0495619_0260218 3300053085 Bacteria 1202
734 Ga0500614_046876 3300053123 Bacteria 1120
735 Ga0501084_0345152 3300054114 Bacteria 1257
736 Ga0501084_0359663 3300054114 Bacteria 1230
737 Ga0501082_0124050 3300060353 Bacteria 2239
738 Ga0530510_0109822 3300061734 Bacteria 2019
739 Ga0530510_0244313 3300061734 Bacteria 1337
740 Ga0373923_0104027
741 CNBas_1000888
742 rootH2_10072749
743 Ga0065704_10124060
744 Ga0065715_10100512
745 Ga0070658_10217225
746 Ga0070658_10221380
747 Ga0070676_10195020
748 Ga0070676_10221859
749 Ga0070683_100293718
750 Ga0070683_100405016
751 Ga0070670_100309722
752 Ga0070670_100349885
753 Ga0070677_10052024
754 Ga0070677_10087358
755 Ga0070666_10059473
756 Ga0070666_10072384
757 Ga0070666_10262828
758 Ga0070680_100273344
759 Ga0070682_100064572
760 Ga0070682_100208351
761 Ga0070682_100288175
762 Ga0070682_100290809
763 Ga0070660_100149233
764 Ga0070660_100166793
765 Ga0070660_100349452
766 Ga0070689_100248269
767 Ga0070687_100101611
768 Ga0070661_100060820
769 Ga0070661_100061648
770 Ga0070661_100069162
771 Ga0070661_100153664
772 Ga0070661_100252841
773 Ga0070661_100283266
774 Ga0070692_10087610
775 Ga0070668_100255583
776 Ga0070668_100331387
777 Ga0070669_100097945
778 Ga0070669_100341498
779 Ga0070669_100385853
780 Ga0070675_100093758
781 Ga0070675_100148912
782 Ga0070675_100326965
783 Ga0070671_100401498
784 Ga0070674_100194606
785 Ga0070674_100318107
786 Ga0070673_100068864
787 Ga0070673_100295687
788 Ga0070688_100195289
789 Ga0070688_100241979
790 Ga0070659_100045394
791 Ga0070659_100065797
792 Ga0070659_100080948
793 Ga0070659_100229766
794 Ga0070659_100240509
795 Ga0070659_100251683
796 Ga0070659_100336424
797 Ga0070659_100397427
798 Ga0070667_100092486
799 Ga0070667_100142138
800 Ga0070667_100159966
801 Ga0070703_10059593
802 Ga0070714_100192436
803 Ga0070714_100268350
804 Ga0070714_100462253
805 Ga0070713_100072157
806 Ga0070713_100278782
807 Ga0070713_100297645
808 Ga0070713_100385933
809 Ga0070710_10034750
810 Ga0070710_10045608
811 Ga0070711_100042660
812 Ga0070711_100165031
813 Ga0070711_100350622
814 Ga0070705_100209457
815 Ga0070705_100263949
816 Ga0070700_100069327
817 Ga0070700_100247579
818 Ga0070694_100366417
819 Ga0070708_100344864
820 Ga0070663_100055734
821 Ga0070663_100189192
822 Ga0070663_100189400
823 Ga0070663_100224981
824 Ga0070663_100393517
825 Ga0070678_100093535
826 Ga0070678_100115927
827 Ga0070678_100116956
828 Ga0070678_100271973
829 Ga0070678_100281010
830 Ga0070662_100164828
831 Ga0070662_100168226
832 Ga0070662_100217773
833 Ga0070662_100242360
834 Ga0070662_100406423
835 Ga0070681_10136972
836 Ga0070681_10245030
837 Ga0070681_10284876
838 Ga0068867_100344525
839 Ga0068867_100362840
840 Ga0068867_100365010
841 Ga0070707_100269996
842 Ga0070707_100411259
843 Ga0070698_100199902
844 Ga0070698_100342786
845 Ga0070699_100079647
846 Ga0070699_100214199
847 Ga0070699_100415378
848 Ga0070679_100043673
849 Ga0070679_100082192
850 Ga0070679_100211937
851 Ga0070679_100253130
852 Ga0070679_100261038
853 Ga0070679_100362772
854 Ga0070684_100086740
855 Ga0070684_100373931
856 Ga0070697_100131232
857 Ga0070697_100262368
858 Ga0070697_100311428
859 Ga0070697_100418621
860 Ga0068853_100014302
861 Ga0068853_100132597
862 Ga0068853_100416956
863 Ga0068853_100519778
864 Ga0070672_100024837
865 Ga0070672_100206745
866 Ga0070672_100254882
867 Ga0070672_100274245
868 Ga0070695_100184160
869 Ga0070696_100138442
870 Ga0070693_100138311
871 Ga0070693_100175304
872 Ga0070693_100188069
873 Ga0070665_100142673
874 Ga0070665_100222145
875 Ga0070665_100402782
876 Ga0070704_100209102
877 Ga0070704_100321781
878 Ga0068855_100029848
879 Ga0068855_100359391
880 Ga0068855_100398544
881 Ga0068855_100464579
882 Ga0068855_100501911
883 Ga0070664_100076136
884 Ga0070664_100111586
885 Ga0070664_100287100
886 Ga0070664_100301681
887 Ga0070664_100416297
888 Ga0070664_100469083
889 Ga0068857_100146099
890 Ga0068857_100514513
891 Ga0068854_100194527
892 Ga0068856_100075026
893 Ga0068856_100103286
894 Ga0068856_100248823
895 Ga0068856_100377123
896 Ga0068856_100445323
897 Ga0068856_100497933
898 Ga0070702_100078112
899 Ga0070702_100265372
900 Ga0068852_100369345
901 Ga0068852_100372716
902 Ga0068852_100473842
903 Ga0068859_100172345
904 Ga0068859_100226426
905 Ga0068859_100232458
906 Ga0068859_100286372
907 Ga0068859_100462544
908 Ga0068864_100278113
909 Ga0068864_100301774
910 Ga0068866_10125269
911 Ga0068861_100172167
912 Ga0068870_10119191
913 Ga0068863_100319686
914 Ga0068863_100329946
915 Ga0068858_100309899
916 Ga0068858_100453303
917 Ga0068858_100463518
918 Ga0068860_100385621
919 Ga0068862_100094449
920 Ga0081455_10067985
921 Ga0081538_10013894
922 Ga0081538_10098483
923 Ga0081538_10121646
924 Ga0070717_10277490
925 Ga0070717_10312507
926 Ga0070717_10319228
927 Ga0070717_10342802
928 Ga0070715_10032720
929 Ga0070716_100152200
930 Ga0070716_100164553
931 Ga0070716_100176806
932 Ga0070716_100195590
933 Ga0070716_100215303
934 Ga0070716_100220828
935 Ga0070712_100180272
936 Ga0070712_100185268
937 Ga0070712_100254884
938 Ga0070712_100358211
939 Ga0097621_100201637
940 Ga0097621_100260718
941 Ga0068871_100251163
942 Ga0068871_100306403
943 Ga0068871_100414274
944 Ga0068871_100429389
945 Ga0075428_100459203
946 Ga0075431_100274740
947 Ga0075431_100468394
948 Ga0075433_10014079
949 Ga0075433_10041156
950 Ga0075433_10346434
951 Ga0075433_10420959
952 Ga0075434_100173372
953 Ga0075434_100284201
954 Ga0068865_100221087
955 Ga0068865_100237365
956 Ga0068865_100265723
957 Ga0068865_100310514
958 Ga0075436_100078636
959 Ga0075436_100201375
960 Ga0075436_100218345
961 Ga0075436_100246233
962 Ga0097620_100172352
963 Ga0097620_100226441
964 Ga0097620_100232470
965 Ga0097620_100286385
966 Ga0097620_100462549
967 Ga0075435_100021274
968 Ga0075435_100152987
969 Ga0075435_100157184
970 Ga0075435_100283355
971 Ga0099794_10070774
972 Ga0099794_10108078
973 Ga0099795_10063706
974 Ga0105251_10093855
975 Ga0105240_10055087
976 Ga0105240_10273048
977 Ga0105240_10513682
978 Ga0105240_10515624
979 Ga0111539_10419893
980 Ga0111539_10437439
981 Ga0111539_10611461
982 Ga0105245_10177706
983 Ga0105245_10386237
984 Ga0105245_10440702
985 Ga0105247_10151257
986 Ga0105247_10170597
987 Ga0114129_10105138
988 Ga0114129_10423399
989 Ga0114129_10595489
990 Ga0105243_10284021
991 Ga0105241_10059419
992 Ga0105241_10168726
993 Ga0105241_10189298
994 Ga0105241_10296294
995 Ga0105241_10310511
996 Ga0105241_10358461
997 Ga0105241_10402985
998 Ga0105248_10243301
999 Ga0105248_10262783
1000 Ga0105248_10421473
1001 Ga0105248_10527918
1002 Ga0105237_10359745
1003 Ga0105237_10394042
1004 Ga0105238_10205618
1005 Ga0105238_10233118
1006 Ga0105238_10335908
1007 Ga0105249_10384768
1008 Ga0105249_10423375
1009 Ga0105249_10448593
1010 Ga0105239_10362360
1011 Ga0105246_10202633
1012 Ga0105246_10242955
1013 Ga0105246_10309291
1014 Ga0157338_1003370
1015 Ga0157373_10045259
1016 Ga0157373_10055595
1017 Ga0157373_10101002
1018 Ga0157373_10135618
1019 Ga0157373_10218638
1020 Ga0157371_10160217
1021 Ga0157371_10196872
1022 Ga0157370_10223874
1023 Ga0157370_10240731
1024 Ga0157369_10133255
1025 Ga0157369_10199777
1026 Ga0157369_10252868
1027 Ga0157369_10255225
1028 Ga0157369_10349393
1029 Ga0157374_10089312
1030 Ga0157374_10169048
1031 Ga0157374_10175869
1032 Ga0157374_10326941
1033 Ga0157374_10348439
1034 Ga0157374_10424450
1035 Ga0157374_10601412
1036 Ga0157378_10087490
1037 Ga0157378_10345412
1038 Ga0157378_10481142
1039 Ga0163162_10219993
1040 Ga0163162_10402181
1041 Ga0163162_10449446
1042 Ga0163162_10488062
1043 Ga0163162_10538500
1044 Ga0157372_10095063
1045 Ga0157372_10172149
1046 Ga0157372_10174519
1047 Ga0157372_10230936
1048 Ga0157372_10342421
1049 Ga0157372_10393912
1050 Ga0157372_10405841
1051 Ga0157372_10571183
1052 Ga0157372_10756534
1053 Ga0157375_10193056
1054 Ga0157375_10236359
1055 Ga0157375_10423544
1056 Ga0157375_10536480
1057 Ga0163163_10286135
1058 Ga0163163_10379714
1059 Ga0157380_10200137
1060 Ga0157380_10264565
1061 Ga0157377_10135867
1062 Ga0157379_10362992
1063 Ga0157376_10238219
1064 Ga0157376_10305488
1065 Ga0157376_10355415
1066 Ga0157376_10493196
1067 Ga0182007_10024421
1068 Ga0163161_10063859
1069 Ga0163161_10174555
1070 Ga0163161_10182751
1071 Ga0213872_10123171
1072 Ga0213876_10159964
1073 Ga0213875_10053243
1074 Ga0213875_10086588
1075 Ga0213875_10134202
1076 Ga0224712_10104504
1077 Ga0228598_1026016
1078 Ga0207697_10092584
1079 Ga0207653_10039471
1080 Ga0207682_10093885
1081 Ga0207692_10111811
1082 Ga0207692_10153650
1083 Ga0207692_10173472
1084 Ga0207710_10110546
1085 Ga0207688_10193022
1086 Ga0207680_10243111
1087 Ga0207680_10243775
1088 Ga0207647_10060511
1089 Ga0207685_10079037
1090 Ga0207685_10099697
1091 Ga0207699_10195240
1092 Ga0207699_10262488
1093 Ga0207699_10267495
1094 Ga0207645_10184659
1095 Ga0207645_10208275
1096 Ga0207645_10249339
1097 Ga0207643_10044770
1098 Ga0207643_10159421
1099 Ga0207705_10091115
1100 Ga0207705_10273678
1101 Ga0207705_10348083
1102 Ga0207684_10032773
1103 Ga0207654_10232768
1104 Ga0207654_10264081
1105 Ga0207654_10268661
1106 Ga0207654_10270225
1107 Ga0207707_10147265
1108 Ga0207707_10229775
1109 Ga0207707_10239589
1110 Ga0207707_10244838
1111 Ga0207707_10393024
1112 Ga0207695_10018179
1113 Ga0207695_10112199
1114 Ga0207695_10481603
1115 Ga0207671_10239111
1116 Ga0207693_10074518
1117 Ga0207693_10153248
1118 Ga0207693_10231593
1119 Ga0207693_10262937
1120 Ga0207693_10342932
1121 Ga0207663_10193105
1122 Ga0207663_10263046
1123 Ga0207663_10271385
1124 Ga0207663_10327326
1125 Ga0207660_10213706
1126 Ga0207660_10377429
1127 Ga0207657_10035291
1128 Ga0207657_10130641
1129 Ga0207649_10021878
1130 Ga0207649_10067822
1131 Ga0207649_10070808
1132 Ga0207649_10185658
1133 Ga0207649_10283004
1134 Ga0207649_10309591
1135 Ga0207652_10024409
1136 Ga0207652_10207616
1137 Ga0207652_10234582
1138 Ga0207652_10467552
1139 Ga0207646_10166143
1140 Ga0207646_10459295
1141 Ga0207681_10074123
1142 Ga0207681_10304285
1143 Ga0207681_10344986
1144 Ga0207694_10354291
1145 Ga0207694_10385131
1146 Ga0207694_10391161
1147 Ga0207659_10336459
1148 Ga0207687_10318394
1149 Ga0207687_10331464
1150 Ga0207687_10378849
1151 Ga0207700_10086842
1152 Ga0207700_10367141
1153 Ga0207700_10377057
1154 Ga0207700_10403488
1155 Ga0207700_10421015
1156 Ga0207664_10028368
1157 Ga0207664_10129128
1158 Ga0207664_10413312
1159 Ga0207664_10416630
1160 Ga0207644_10274692
1161 Ga0207690_10114771
1162 Ga0207690_10134869
1163 Ga0207690_10362068
1164 Ga0207706_10068215
1165 Ga0207706_10095913
1166 Ga0207706_10134784
1167 Ga0207706_10197445
1168 Ga0207706_10344650
1169 Ga0207706_10422870
1170 Ga0207686_10228606
1171 Ga0207669_10304248
1172 Ga0207665_10156980
1173 Ga0207665_10174300
1174 Ga0207665_10188907
1175 Ga0207665_10213722
1176 Ga0207665_10224276
1177 Ga0207691_10059414
1178 Ga0207691_10261065
1179 Ga0207691_10311351
1180 Ga0207691_10388152
1181 Ga0207711_10425498
1182 Ga0207661_10036263
1183 Ga0207661_10412234
1184 Ga0207679_10053942
1185 Ga0207679_10084945
1186 Ga0207679_10169094
1187 Ga0207679_10173765
1188 Ga0207679_10367938
1189 Ga0207679_10397096
1190 Ga0207667_10057799
1191 Ga0207667_10079257
1192 Ga0207667_10119523
1193 Ga0207667_10336645
1194 Ga0207667_10489738
1195 Ga0207667_10566873
1196 Ga0207667_10576851
1197 Ga0207651_10152885
1198 Ga0207651_10310083
1199 Ga0207668_10337720
1200 Ga0207640_10357294
1201 Ga0207658_10200036
1202 Ga0207658_10408088
1203 Ga0207658_10447591
1204 Ga0207703_10272083
1205 Ga0207703_10388259
1206 Ga0207703_10490273
1207 Ga0207639_10009030
1208 Ga0207639_10217133
1209 Ga0207639_10443857
1210 Ga0207678_10102472
1211 Ga0207678_10165354
1212 Ga0207678_10216197
1213 Ga0207678_10228880
1214 Ga0207678_10368430
1215 Ga0207708_10374010
1216 Ga0207702_10020373
1217 Ga0207702_10022282
1218 Ga0207702_10065041
1219 Ga0207702_10407809
1220 Ga0207702_10503259
1221 Ga0207702_10506546
1222 Ga0207702_10509861
1223 Ga0207641_10368239
1224 Ga0207641_10556992
1225 Ga0207648_10059514
1226 Ga0207648_10208217
1227 Ga0207648_10247181
1228 Ga0207648_10385996
1229 Ga0207676_10328128
1230 Ga0207676_10369772
1231 Ga0207676_10398506
1232 Ga0207674_10065416
1233 Ga0207674_10169444
1234 Ga0207674_10344903
1235 Ga0207674_10364157
1236 Ga0207675_100337944
1237 Ga0207675_100353105
1238 Ga0207683_10164375
1239 Ga0207683_10226711
1240 Ga0207683_10245029
1241 Ga0207683_10266097
1242 Ga0207683_10428523
1243 Ga0207698_10507875
1244 Ga0209984_1010850
1245 Ga0210000_1013427
1246 Ga0209968_1012321
1247 Ga0209982_1008329
1248 Ga0209983_1017187
1249 Ga0209971_1023436
1250 Ga0209974_10057539
1251 Ga0207428_10073657
1252 Ga0207428_10317202
1253 Ga0207428_10325969
1254 Ga0268266_10401168
1255 Ga0268265_10095557
1256 Ga0268265_10325775
1257 Ga0268265_10523177
1258 Ga0268264_10561556
1259 Ga0265760_10021438
1260 Ga0265760_10023382
1261 Ga0265760_10051539
1262 Ga0265325_10104842
1263 Ga0265316_10322222
1264 Ga0307411_10278791
1265 Ga0373930_0018401
1266 Ga0373930_0020507
1267 Ga0373958_0018361
1268 Ga0373959_0016053
1269 Ga0373926_0060479
1270 Ga0373928_0023318
1271 Ga0373929_0024187
1272 Ga0373934_0051542
1273 Ga0373949_0038880
1274 Ga0373951_0027661
1275 Ga0373951_0040490
1276 Ga0373952_0016898
1277 Ga0373923_0046464
1278 Ga0373923_0093142
1279 Ga0373923_0110244
1280 Ga0373932_0027704
1281 Ga0373939_0022858
1282 Ga0373941_0032766
1283 Ga0373941_0056597
1284 Ga0373953_0114477
1285 Ga0373953_0119832
1286 Ga0373960_0028129
1287 Ga0373943_0074765
1288 Ga0373943_0078063
1289 Ga0373946_0017225
1290 Ga0373946_0104041
1291 Ga0373946_0116434
1292 Ga0373955_0095384
1293 Ga0373955_0154520
1294 Ga0373961_0033849
1295 Ga0373962_0028143
1296 Ga0373924_0081391
1297 Ga0373931_0143990
1298 Ga0373931_0164811
1299 Ga0373931_0186125
1300 Ga0373931_0214736
1301 Ga0373935_0149423
1302 Ga0373935_0189355
1303 Ga0373935_0221417
1304 Ga0373935_0255061
1305 Ga0373927_0048002
1306 Ga0373927_0138606
1307 Ga0373927_0147157
1308 Ga0373927_0214136
1309 Ga0373933_0062598
1310 Ga0373933_0073667
1311 Ga0373947_0059558
1312 Ga0373947_0105573
1313 Ga0373947_0238036
1314 Ga0373947_0249507
1315 Ga0373937_0084798
1316 Ga0373937_0329867
1317 Ga0316582_0209836
1318 Ga0373925_0016340
1319 Ga0373925_0171633
1320 Ga0373925_0198331
1321 Ga0373925_0212116
1322 Ga0373925_0215302
1323 Ga0373925_0223608
1324 Ga0436364_0429406
1325 Ga0436364_1016885
1326 Ga0436364_1280539
1327 Ga0395901_0458930
1328 Ga0436365_1179962
1329 Ga0436365_1282369
1330 Ga0436360_0177423
1331 Ga0436360_1198479
1332 Ga0436361_0110909
1333 Ga0436361_0984751
1334 Ga0436363_0273568
1335 Ga0436363_1702755
1336 Ga0439448_0055631
1337 Ga0439435_0031562
1338 Ga0450918_020587
1339 Ga0451577_0422135
1340 Ga0453683_0213058
1341 Ga0466966_0144323
1342 Ga0466966_0161107
1343 Ga0466963_0240385
1344 Ga0453684_0482188
1345 Ga0466968_0055107
1346 Ga0451576_0056853
1347 Ga0451576_0192451
1348 Ga0451576_0205590
1349 Ga0451576_0398666
1350 Ga0451576_0731307
1351 Ga0466967_0336714
1352 Ga0466967_0449262
1353 Ga0466967_0472621
1354 Ga0495603_0045675
1355 Ga0495603_0166754
1356 Ga0495651_0115489
1357 Ga0495580_0000182
1358 Ga0495580_0009948
1359 Ga0495580_0043400
1360 Ga0495580_0155505
1361 Ga0495582_0053590
1362 Ga0495582_0118573
1363 Ga0495582_0175274
1364 Ga0495582_0188094
1365 Ga0495639_0033817
1366 Ga0495639_0044808
1367 Ga0495662_0154484
1368 Ga0495664_0170933
1369 Ga0495664_0199628
1370 Ga0495594_0113200
1371 Ga0495620_0098877
1372 Ga0495628_0257907
1373 Ga0495666_0056643
1374 Ga0495642_0076067
1375 Ga0495652_0286363
1376 Ga0495652_0309025
1377 Ga0495665_0090964
1378 Ga0495665_0094379
1379 Ga0495665_0111259
1380 Ga0495665_0142269
1381 Ga0495640_0109214
1382 Ga0495640_0201721
1383 Ga0495645_0154521
1384 Ga0495635_0170881
1385 Ga0495635_0223417
1386 Ga0495659_0051776
1387 Ga0495658_0168745
1388 Ga0495658_0179087
1389 Ga0495658_0223911
1390 Ga0495658_0241528
1391 Ga0495613_0124374
1392 Ga0495613_0244622
1393 Ga0495581_0096281
1394 Ga0495581_0154607
1395 Ga0495636_0112642
1396 Ga0495674_0162482
1397 Ga0495674_0332624
1398 Ga0495674_0355997
1399 Ga0495674_0396039
1400 Ga0495680_0223684
1401 Ga0495684_0188818
1402 Ga0495684_0262105
1403 Ga0495684_0292323
1404 Ga0495593_0088493
1405 Ga0495593_0095654
1406 Ga0495602_0275624
1407 Ga0496100_0236449
1408 Ga0496102_0172401
1409 Ga0496104_0378920
1410 Ga0496105_0317640
1411 Ga0496106_0290180
1412 Ga0496107_0295995
1413 Ga0496108_0143993
1414 Ga0496108_0421080
1415 Ga0496109_0479003
1416 Ga0496111_0079920
1417 Ga0496112_0006862
1418 Ga0496112_0325698
1419 Ga0496113_0162534
1420 Ga0496114_0313560
1421 Ga0496115_0017801
1422 Ga0496115_0247410
1423 Ga0496115_0359031
1424 Ga0496115_0378537
1425 Ga0496120_0146316
1426 Ga0501031_0194941
1427 Ga0501033_0007065
1428 Ga0501036_0328148
1429 Ga0501038_0342533
1430 Ga0501039_0171544
1431 Ga0501039_0313808
1432 Ga0501040_0103930
1433 Ga0501041_0199369
1434 Ga0501042_0236861
1435 Ga0501042_0253625
1436 Ga0501046_0252539
1437 Ga0501048_0292003
1438 Ga0501070_0356753
1439 Ga0501072_0314064
1440 Ga0501074_0016088
1441 Ga0501075_0262699
1442 Ga0501075_0318817
1443 Ga0501076_0363667
1444 Ga0501077_0218090
1445 Ga0501079_0342869
1446 Ga0501081_0268637
1447 Ga0501081_0291274
1448 Ga0501045_0280426
1449 nmdc:mga05p37_232967_c1
1450 nmdc:mga05p37_386607_c1
1451 nmdc:mga05p37_541209_c1
1452 nmdc:mga06r32_375914_c1
1453 nmdc:mga08y16_189638_c1
1454 nmdc:mga08y16_525508_c1
1455 nmdc:mga0n895_338350_c1
1456 nmdc:mga0n895_416771_c1
1457 nmdc:mga0rr50_123895_c1
1458 nmdc:mga0rr50_145114_c1
1459 nmdc:mga0rr50_17475_c1
1460 nmdc:mga0rr50_229460_c1
1461 nmdc:mga08x19_117557_c1
1462 nmdc:mga08x19_143986_c1
1463 nmdc:mga0a205_107246_c1
1464 nmdc:mga0a205_179526_c1
1465 nmdc:mga0a205_3164_c2
1466 nmdc:mga0a205_372834_c1
1467 nmdc:mga0a205_6654_c2
1468 Ga0495601_0046747
1469 Ga0495595_0123522
1470 Ga0495619_0015073
1471 Ga0495619_0242019
1472 Ga0495619_0260218
1473 Ga0500614_046876
1474 Ga0501084_0345152
1475 Ga0501084_0359663
1476 Ga0501082_0124050
1477 Ga0530510_0109822
1478 Ga0530510_0244313

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13384

HTH_23

Homeodomain-like domain

34

77

0.97

PF13518

HTH_28

Helix-turn-helix domain

33

83

0.96

PF13565

HTH_32

Homeodomain-like domain

60

132

0.95

PF13358

DDE_3

DDE superfamily endonuclease

172

319

0.94

PF13551

HTH_29

Winged helix-turn helix

34

95

0.9

Map