F478706

General Info

Members Datasets Scaffolds Average Seq Length
743 515 1484 309

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0036079|Ga0496126_0036079_3017_4099
Length 360
Sequence MIRTRRAALAQSAKRFSEKIMLEQEPQAMTAALPRRRGPLNQEQPGFLTTEQETSMNLHNASYNTTSAPEELVPSRYAVKIGDIDVLVISDGVLPLPTAMLAHNAEPAARAAWLDDMFLPPDAFDWALNAVVVRSGAQTILVDAGLGLDPDLHLPRAGQLVRRLEAGGIDLSSVTDVVLTHMHMDHVGGLLIDGVKERLRKDLRIHVAAAEVKFWEAPDFSRVSMPPGFPDALRATAKHFVREYGDRLRTFDEAHEVAPGVVVRRTGGHTPGHSVVRVASGGDRLTFAGDLVFTVGFEHPDWHNGFEHDPEEAARVRIDLLRELAANRELLVATHMPFPSVGHVAIAGDAFRWVPAFWDY

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
66 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
162 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
267 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
273 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
281 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
284 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
285 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
286 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
287 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
288 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
289 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
290 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
291 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
292 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
293 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
294 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
295 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
296 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
297 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
298 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
299 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
300 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
301 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
302 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
303 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
304 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
305 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
306 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
307 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
308 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
309 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
310 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
311 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
312 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
313 2643221557 Ensifer sp. Root558 Isolate Unclassified
314 2643221618 Ensifer sp. Root231 Isolate Unclassified
315 2643221626 Ensifer sp. Root31 Isolate Unclassified
316 2643221655 Ensifer sp. Root1252 Isolate Unclassified
317 2643221659 Ensifer sp. Root127 Isolate Unclassified
318 2643221698 Ensifer sp. Root142 Isolate Unclassified
319 2643221712 Ensifer sp. Root258 Isolate Unclassified
320 2643221734 Bosea sp. Root670 Isolate Unclassified
321 2643221736 Bosea sp. Root483D1 Isolate Unclassified
322 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
323 2718217882 Rhizobium sp. N741 Isolate Nodule
324 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
325 2718218009 Rhizobium sp. N561 Isolate Nodule
326 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
327 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
328 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
329 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
330 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
331 2718218363 Rhizobium sp. N113 Isolate Nodule
332 2718218365 Rhizobium sp. N731 Isolate Nodule
333 2718218366 Rhizobium sp. N621 Isolate Nodule
334 2721755514 Rhizobium sp. N6212 Isolate Nodule
335 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
336 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
337 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
338 2721755810 Rhizobium sp. N871 Isolate Nodule
339 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
340 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
341 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
342 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
343 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
344 2728369365 Rhizobium sp. N1341 Isolate Nodule
345 2728369397 Rhizobium sp. N1314 Isolate Nodule
346 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
347 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
348 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
349 2791355260 Rhizobium sp. L9 Isolate Nodule
350 2791355261 Rhizobium sp. J15 Isolate Nodule
351 2791355262 Rhizobium sp. M1 Isolate Nodule
352 2791355264 Rhizobium sp. S9 Isolate Nodule
353 2791355265 Rhizobium sp. H4 Isolate Nodule
354 2791355267 Rhizobium sp. L18 Isolate Nodule
355 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
356 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
357 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
358 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
359 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
360 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
361 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
362 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
363 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
364 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
365 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
366 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
367 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
368 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
369 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
370 2838048938 Rhizobium pisi 27/80 Isolate Nodule
371 2838061910 Rhizobium phaseoli L15 Isolate Nodule
372 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
373 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
374 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
375 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
376 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
377 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
378 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
379 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
380 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
381 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
382 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
383 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
384 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
385 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
386 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
387 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
388 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
389 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
390 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
391 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
392 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
393 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
394 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
395 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
396 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
397 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
398 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
399 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
400 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
401 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
402 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
403 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
404 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
405 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
406 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
407 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
408 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
409 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
410 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
411 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
412 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
413 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
414 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
415 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
416 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
417 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
418 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
419 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
420 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
421 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
422 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
423 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
424 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
425 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
426 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
427 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
428 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
429 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
430 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
431 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
432 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
433 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
434 2909042592 Labrys sp. LIt4 Isolate Nodule
435 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
436 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
437 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
438 2922368715
439 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
440 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
441 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
442 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
443 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
444 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
445 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
446 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
447 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
448 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
449 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
450 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
451 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
452 2933599457 Rhizobium phaseoli M3 Isolate Nodule
453 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
454 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
455 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
456 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
457 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
458 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
459 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
460 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
461 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
462 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
463 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
464 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
465 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
466 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
467 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
468 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
469 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
470 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
471 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
472 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
473 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
474 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
475 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
476 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
477 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
478 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
479 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
480 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
481 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
482 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
483 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
484 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
485 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
486 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
487 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
488 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
489 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
490 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
491 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
492 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
493 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
494 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
495 8005382845 Rhizobium sp. R634 Isolate Nodule
496 8005395548 Rhizobium sp. R339 Isolate Nodule
497 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
498 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
499 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
500 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
501 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
502 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
503 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
504 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
505 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
506 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
507 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
508 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
509 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
510 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
511 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
512 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
513 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
514 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
515 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.52
Metatranscriptomes 0
Isolates 32.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 17.63
Nodule 24.9
Rhizoplane 4.85
Rhizosphere 36.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0036079 3300048929 Bacteria 4627
2 JGI24738J21930_10000044 3300002075 Bacteria 24745
3 JGI25152J39213_1000033 3300002773 Bacteria 95187
4 JGI25152J39213_1006711 3300002773 Bacteria 3074
5 JGI25150J39212_1000310 3300002774 Bacteria 24161
6 JGI25159J45721_1000492 3300002987 Bacteria 18088
7 JGI25151J46595_10000142 3300003187 Bacteria 95187
8 JGI25151J46595_10000332 3300003187 Bacteria 50552
9 JGI25151J46595_10002576 3300003187 Bacteria 10727
10 JGI25153J46596_10000107 3300003215 Bacteria 95187
11 JGI25153J46596_10000317 3300003215 Bacteria 35509
12 JGI25153J46596_10001194 3300003215 Bacteria 15699
13 JGI25153J46596_10004030 3300003215 Bacteria 8011
14 JGI25153J46596_10025608 3300003215 Bacteria 2104
15 JGI25160J50197_1000109 3300003354 Bacteria 77318
16 JGI25160J50197_1002643 3300003354 Bacteria 8250
17 JGI25161J50226_1000011 3300003374 Bacteria 210140
18 Ga0055524_1003271 3300003775 Bacteria 7930
19 Ga0055536_1000008 3300003781 Bacteria 335729
20 Ga0055528_1010323 3300003790 Bacteria 3805
21 Ga0055528_1010380 3300003790 Bacteria 3789
22 Ga0055530_10001010 3300003791 Bacteria 22503
23 Ga0055540_1001958 3300003792 Bacteria 11510
24 Ga0055540_1012743 3300003792 Bacteria 2616
25 Ga0055531_10004575 3300003794 Bacteria 8347
26 Ga0055543_1000071 3300004625 Bacteria 91797
27 Ga0065165_1000048 3300005262 Bacteria 196539
28 Ga0065165_1000135 3300005262 Bacteria 127785
29 Ga0065165_1002106 3300005262 Bacteria 18195
30 Ga0065165_1007973 3300005262 Bacteria 5069
31 Ga0070668_100044905 3300005347 Bacteria 3390
32 Ga0070668_100102385 3300005347 Bacteria 2270
33 Ga0070668_100251058 3300005347 Bacteria 1468
34 Ga0070671_100047428 3300005355 Bacteria 3572
35 Ga0070671_100060953 3300005355 Bacteria 3141
36 Ga0070671_100076134 3300005355 Bacteria 2803
37 Ga0070674_100052801 3300005356 Bacteria 2804
38 Ga0070667_100146871 3300005367 Bacteria 2069
39 Ga0070667_100455089 3300005367 Bacteria 1170
40 Ga0070709_10028436 3300005434 Bacteria 3334
41 Ga0070714_100012268 3300005435 Bacteria 6836
42 Ga0070713_100010360 3300005436 Bacteria 6734
43 Ga0070663_100042908 3300005455 Bacteria 3180
44 Ga0070663_100292920 3300005455 Bacteria 1300
45 Ga0070678_100089315 3300005456 Bacteria 2358
46 Ga0068867_100235382 3300005459 Bacteria 1482
47 Ga0070698_100322456 3300005471 Bacteria 1475
48 Ga0070699_100514921 3300005518 Bacteria 1087
49 Ga0068853_100332619 3300005539 Bacteria 1410
50 Ga0070665_100002435 3300005548 Bacteria 20517
51 Ga0070665_100020048 3300005548 Bacteria 6713
52 Ga0070665_100033586 3300005548 Bacteria 5162
53 Ga0070665_100064478 3300005548 Bacteria 3674
54 Ga0070665_100072276 3300005548 Bacteria 3457
55 Ga0068855_100419161 3300005563 Bacteria 1465
56 Ga0068857_100219968 3300005577 Bacteria 1734
57 Ga0068857_100225779 3300005577 Bacteria 1712
58 Ga0068856_100055528 3300005614 Bacteria 3908
59 Ga0068856_100093797 3300005614 Bacteria 2987
60 Ga0068852_100134034 3300005616 Bacteria 2285
61 Ga0068864_100089820 3300005618 Bacteria 2707
62 Ga0068863_100168478 3300005841 Bacteria 2100
63 Ga0068862_100032832 3300005844 Bacteria 4384
64 Ga0068862_100371510 3300005844 Bacteria 1331
65 Ga0068862_100403960 3300005844 Bacteria 1278
66 Ga0081538_10016832 3300005981 Bacteria 5581
67 Ga0070717_10009089 3300006028 Bacteria 7461
68 Ga0075365_10000025 3300006038 Bacteria 62479
69 Ga0075365_10255718 3300006038 Bacteria 1231
70 Ga0075368_10007647 3300006042 Bacteria 3819
71 Ga0075363_100000716 3300006048 Bacteria 11250
72 Ga0075363_100011888 3300006048 Bacteria 4181
73 Ga0075363_100068354 3300006048 Bacteria 1926
74 Ga0075364_10015875 3300006051 Bacteria 4674
75 Ga0075364_10272642 3300006051 Bacteria 1151
76 Ga0070716_100132947 3300006173 Bacteria 1575
77 Ga0075362_10033193 3300006177 Bacteria 2244
78 Ga0075367_10003271 3300006178 Bacteria 7674
79 Ga0075367_10059868 3300006178 Bacteria 2269
80 Ga0075367_10072494 3300006178 Bacteria 2073
81 Ga0075366_10003061 3300006195 Bacteria 8732
82 Ga0075366_10200575 3300006195 Bacteria 1213
83 Ga0075370_10000361 3300006353 Bacteria 16648
84 Ga0075370_10004952 3300006353 Bacteria 6546
85 Ga0075370_10013655 3300006353 Bacteria 4323
86 Ga0075370_10013858 3300006353 Bacteria 4290
87 Ga0075430_100023375 3300006846 Bacteria 5260
88 Ga0068865_100328892 3300006881 Bacteria 1232
89 Ga0099824_1015176 3300006942 Bacteria 7399
90 Ga0099794_10080464 3300007265 Bacteria 1607
91 Ga0099795_10007287 3300007788 Bacteria 3077
92 Ga0105251_10007523 3300009011 Bacteria 6698
93 Ga0105251_10067109 3300009011 Bacteria 1676
94 Ga0105240_10228453 3300009093 Bacteria 2164
95 Ga0105245_10274633 3300009098 Bacteria 1645
96 Ga0105245_10407192 3300009098 Bacteria 1361
97 Ga0105247_10012525 3300009101 Bacteria 5096
98 Ga0105243_10043199 3300009148 Bacteria 3532
99 Ga0105243_10080135 3300009148 Bacteria 2662
100 Ga0105241_10082415 3300009174 Bacteria 2521
101 Ga0105248_10273195 3300009177 Bacteria 1903
102 Ga0105237_10010413 3300009545 Bacteria 9897
103 Ga0105237_10109347 3300009545 Bacteria 2756
104 Ga0105238_10009947 3300009551 Bacteria 9538
105 Ga0105238_10104369 3300009551 Bacteria 2815
106 Ga0105249_10060091 3300009553 Bacteria 3487
107 Ga0123340_1000026 3300009763 Bacteria 46465
108 Ga0123341_1000042 3300009765 Bacteria 58276
109 Ga0105239_10151822 3300010375 Bacteria 2585
110 Ga0105239_10188494 3300010375 Bacteria 2309
111 Ga0105246_10007411 3300011119 Bacteria 6724
112 Ga0105246_10022898 3300011119 Bacteria 4037
113 Ga0157374_10026591 3300013296 Bacteria 5209
114 Ga0157374_10169638 3300013296 Bacteria 2128
115 Ga0157375_10028075 3300013308 Bacteria 5270
116 Ga0163163_10587646 3300014325 Bacteria 1177
117 Ga0157380_10147314 3300014326 Bacteria 2030
118 Ga0182008_10001248 3300014497 Bacteria 17467
119 Ga0182008_10033298 3300014497 Bacteria 2585
120 Ga0182008_10052462 3300014497 Bacteria 2021
121 Ga0157379_10173448 3300014968 Bacteria 1947
122 Ga0157379_10190353 3300014968 Bacteria 1854
123 Ga0157376_10162832 3300014969 Bacteria 2024
124 Ga0182006_1000005 3300015261 Bacteria 621201
125 Ga0182006_1000271 3300015261 Bacteria 46422
126 Ga0182006_1048567 3300015261 Bacteria 1641
127 Ga0182007_10000001 3300015262 Bacteria 1127301
128 Ga0182005_1004258 3300015265 Bacteria 4664
129 Ga0163161_10002649 3300017792 Bacteria 12717
130 Ga0214544_1023343 3300021320 Bacteria 3477
131 Ga0214542_1009367 3300021321 Bacteria 15278
132 Ga0214543_1001120 3300021327 Bacteria 50226
133 Ga0209436_110868 3300025208 Bacteria 1636
134 Ga0207425_1000064 3300025245 Bacteria 129075
135 Ga0207425_1018101 3300025245 Bacteria 1535
136 Ga0209129_1000101 3300025258 Bacteria 161931
137 Ga0209673_1002399 3300025273 Bacteria 13107
138 Ga0209673_1003294 3300025273 Bacteria 9701
139 Ga0209673_1004031 3300025273 Bacteria 8132
140 Ga0209130_1000058 3300025284 Bacteria 210250
141 Ga0209130_1000071 3300025284 Bacteria 178273
142 Ga0209130_1000637 3300025284 Bacteria 32982
143 Ga0209676_1000042 3300025292 Bacteria 424130
144 Ga0209676_1009721 3300025292 Bacteria 4112
145 Ga0209025_1000048 3300025294 Bacteria 335574
146 Ga0209025_1000265 3300025294 Bacteria 123182
147 Ga0209564_1015010 3300025295 Bacteria 3181
148 Ga0209758_1000011 3300025297 Bacteria 1049685
149 Ga0209758_1000056 3300025297 Bacteria 335574
150 Ga0209758_1000120 3300025297 Bacteria 192212
151 Ga0209758_1004504 3300025297 Bacteria 11556
152 Ga0209758_1011184 3300025297 Bacteria 5237
153 Ga0209758_1012798 3300025297 Bacteria 4649
154 Ga0209050_1000035 3300025298 Bacteria 424005
155 Ga0209050_1006125 3300025298 Bacteria 7255
156 Ga0209256_1000247 3300025299 Bacteria 96046
157 Ga0209256_1001013 3300025299 Bacteria 33164
158 Ga0209256_1004260 3300025299 Bacteria 9142
159 Ga0209256_1006330 3300025299 Bacteria 6325
160 Ga0207426_1000131 3300025302 Bacteria 210250
161 Ga0207426_1000287 3300025302 Bacteria 100566
162 Ga0207426_1000984 3300025302 Bacteria 27966
163 Ga0207426_1002935 3300025302 Bacteria 10037
164 Ga0207426_1026371 3300025302 Bacteria 1947
165 Ga0209051_1000095 3300025303 Bacteria 167840
166 Ga0209051_1001408 3300025303 Bacteria 20672
167 Ga0209257_1001101 3300025304 Bacteria 35153
168 Ga0209257_1002703 3300025304 Bacteria 16913
169 Ga0209257_1010891 3300025304 Bacteria 4496
170 Ga0207713_1028519 3300025735 Bacteria 2515
171 Ga0207710_10011689 3300025900 Bacteria 3692
172 Ga0207710_10064803 3300025900 Bacteria 1665
173 Ga0207688_10012400 3300025901 Bacteria 4636
174 Ga0207647_10023417 3300025904 Bacteria 4084
175 Ga0207699_10024067 3300025906 Bacteria 3324
176 Ga0207684_10331740 3300025910 Bacteria 1310
177 Ga0207654_10031129 3300025911 Bacteria 2936
178 Ga0207671_10014079 3300025914 Bacteria 6340
179 Ga0207671_10029434 3300025914 Bacteria 4100
180 Ga0207650_10313956 3300025925 Bacteria 1283
181 Ga0207687_10006901 3300025927 Bacteria 7481
182 Ga0207687_10259199 3300025927 Bacteria 1385
183 Ga0207700_10057204 3300025928 Bacteria 2939
184 Ga0207644_10077131 3300025931 Bacteria 2453
185 Ga0207644_10213880 3300025931 Bacteria 1525
186 Ga0207709_10010894 3300025935 Bacteria 5010
187 Ga0207709_10160753 3300025935 Bacteria 1566
188 Ga0207669_10028745 3300025937 Bacteria 3063
189 Ga0207665_10164725 3300025939 Bacteria 1597
190 Ga0207711_10097816 3300025941 Bacteria 2592
191 Ga0207689_10008958 3300025942 Bacteria 8674
192 Ga0207712_10039217 3300025961 Bacteria 3244
193 Ga0207668_10122216 3300025972 Bacteria 1973
194 Ga0207668_10216357 3300025972 Bacteria 1535
195 Ga0207658_10157099 3300025986 Bacteria 1860
196 Ga0207658_10319646 3300025986 Bacteria 1343
197 Ga0207703_10201186 3300026035 Bacteria 1770
198 Ga0207639_10404153 3300026041 Bacteria 1231
199 Ga0207678_10020242 3300026067 Bacteria 5841
200 Ga0207678_10022012 3300026067 Bacteria 5587
201 Ga0207678_10023653 3300026067 Bacteria 5372
202 Ga0207678_10028047 3300026067 Bacteria 4917
203 Ga0207678_10469188 3300026067 Bacteria 1095
204 Ga0207702_10243422 3300026078 Bacteria 1686
205 Ga0207641_10070142 3300026088 Bacteria 3011
206 Ga0207648_10142776 3300026089 Bacteria 2111
207 Ga0207676_10073239 3300026095 Bacteria 2756
208 Ga0207674_10053672 3300026116 Bacteria 4107
209 Ga0207674_10055283 3300026116 Bacteria 4037
210 Ga0207674_10271252 3300026116 Bacteria 1644
211 Ga0207675_100247887 3300026118 Bacteria 1723
212 Ga0207683_10073437 3300026121 Bacteria 3026
213 Ga0207683_10096035 3300026121 Bacteria 2643
214 Ga0209179_1015265 3300027512 Bacteria 1424
215 Ga0209282_1000738 3300027666 Bacteria 16483
216 Ga0209588_1018467 3300027671 Bacteria 2172
217 Ga0209813_10081069 3300027866 Bacteria 1073
218 Ga0268266_10002988 3300028379 Bacteria 17436
219 Ga0268266_10004447 3300028379 Bacteria 13409
220 Ga0268266_10013214 3300028379 Bacteria 7118
221 Ga0268266_10019781 3300028379 Bacteria 5737
222 Ga0268266_10024478 3300028379 Bacteria 5133
223 Ga0268266_10067352 3300028379 Bacteria 3099
224 Ga0268266_10651158 3300028379 Bacteria 1014
225 Ga0268265_10031413 3300028380 Bacteria 3835
226 Ga0268265_10057672 3300028380 Bacteria 2961
227 Ga0268265_10393061 3300028380 Bacteria 1279
228 Ga0268265_10426648 3300028380 Bacteria 1232
229 Ga0268264_10408806 3300028381 Bacteria 1306
230 Ga0307517_10000744 3300028786 Bacteria 56253
231 Ga0307515_10083636 3300028794 Bacteria 4111
232 Ga0307515_10154616 3300028794 Bacteria 2376
233 Ga0307515_10161308 3300028794 Bacteria 2285
234 Ga0265328_10028046 3300031239 Bacteria 2108
235 Ga0265339_10098819 3300031249 Bacteria 1522
236 Ga0307513_10066085 3300031456 Bacteria 3802
237 Ga0307509_10005194 3300031507 Bacteria 18256
238 Ga0307508_10000092 3300031616 Bacteria 105585
239 Ga0307405_10121811 3300031731 Bacteria 1786
240 Ga0307412_10003361 3300031911 Bacteria 8888
241 Ga0307412_10331800 3300031911 Bacteria 1214
242 Ga0307510_10003194 3300033180 Bacteria 19031
243 Ga0307510_10243520 3300033180 Bacteria 1291
244 Ga0315911_1000010 3300033442 Bacteria 322197
245 Ga0395900_0111753 3300037418 Bacteria 2806
246 Ga0395900_0134490 3300037418 Bacteria 2533
247 Ga0395898_0097492 3300037466 Bacteria 2824
248 Ga0395898_0136935 3300037466 Bacteria 2345
249 Ga0395905_0002303 3300037471 Bacteria 21401
250 Ga0395905_0167325 3300037471 Bacteria 2066
251 Ga0395905_0339120 3300037471 Bacteria 1394
252 Ga0395901_0107466 3300038443 Bacteria 2929
253 Ga0395901_0143662 3300038443 Bacteria 2508
254 Ga0395901_0608627 3300038443 Bacteria 1101
255 Ga0237816_00929 3300039145 Bacteria 2402
256 Ga0439436_0000039 3300041404 Bacteria 41518
257 Ga0439465_0000792 3300041413 Bacteria 9884
258 Ga0451807_2442091 3300041486 Bacteria 1965
259 Ga0451833_0219807 3300041491 Bacteria 2954
260 Ga0451835_0182269 3300041492 Bacteria 2363
261 Ga0451837_0064402 3300041494 Bacteria 3059
262 Ga0451839_0113754 3300041496 Bacteria 2889
263 Ga0451841_0436683 3300041498 Bacteria 2798
264 Ga0451845_0696792 3300041501 Bacteria 1807
265 Ga0451847_0355506 3300041503 Bacteria 4974
266 Ga0451849_0031286 3300041505 Bacteria 9836
267 Ga0451851_0164034 3300041507 Bacteria 4615
268 Ga0451843_0144315 3300041509 Bacteria 1852
269 Ga0451853_1876950 3300041512 Bacteria 4136
270 Ga0466968_0030756 3300044735 Bacteria 2225
271 Ga0466968_0094052 3300044735 Bacteria 1332
272 Ga0495638_0007212 3300046460 Bacteria 7994
273 Ga0495664_0176224 3300046477 Bacteria 1297
274 Ga0495594_0116969 3300046499 Bacteria 1506
275 Ga0495607_0070202 3300046501 Bacteria 1958
276 Ga0495583_0070786 3300046506 Bacteria 1533
277 Ga0495606_0001337 3300046507 Bacteria 33546
278 Ga0495606_0014239 3300046507 Bacteria 6221
279 Ga0495606_0028472 3300046507 Bacteria 3941
280 Ga0495606_0098520 3300046507 Bacteria 1784
281 Ga0495606_0100410 3300046507 Bacteria 1763
282 Ga0495610_0000298 3300046512 Bacteria 52207
283 Ga0495610_0067539 3300046512 Bacteria 1679
284 Ga0495616_0028975 3300046513 Bacteria 2927
285 Ga0495620_0023270 3300046515 Bacteria 2965
286 Ga0495632_0107170 3300046519 Bacteria 1314
287 Ga0495643_0000952 3300046522 Bacteria 29892
288 Ga0495643_0046451 3300046522 Bacteria 2354
289 Ga0495643_0138119 3300046522 Bacteria 1218
290 Ga0495648_0016194 3300046524 Bacteria 5380
291 Ga0495648_0027362 3300046524 Bacteria 3819
292 Ga0495648_0043558 3300046524 Bacteria 2812
293 Ga0495654_0028764 3300046530 Bacteria 2839
294 Ga0495640_0014214 3300046533 Bacteria 6034
295 Ga0495609_0000657 3300046538 Bacteria 26874
296 Ga0495668_0088895 3300046616 Bacteria 1693
297 Ga0495634_0020988 3300046642 Bacteria 4626
298 Ga0495611_0021103 3300046648 Bacteria 2811
299 Ga0495625_0000724 3300046660 Bacteria 46327
300 Ga0495625_0035430 3300046660 Bacteria 3679
301 Ga0495625_0083129 3300046660 Bacteria 2226
302 Ga0495635_0002472 3300046663 Bacteria 12617
303 Ga0495588_0002625 3300046674 Bacteria 7697
304 Ga0495588_0025988 3300046674 Bacteria 2921
305 Ga0495657_0004748 3300046675 Bacteria 10827
306 Ga0495613_0038177 3300046689 Bacteria 3560
307 Ga0495624_0007439 3300046690 Bacteria 7686
308 Ga0495624_0174514 3300046690 Bacteria 1311
309 Ga0495670_0000500 3300046691 Bacteria 18592
310 Ga0495670_0002430 3300046691 Bacteria 9201
311 Ga0495671_0156019 3300046692 Bacteria 1111
312 Ga0495649_0021484 3300046694 Bacteria 3615
313 Ga0495649_0170767 3300046694 Bacteria 1138
314 Ga0495600_0002308 3300046809 Bacteria 10889
315 Ga0495600_0013410 3300046809 Bacteria 5150
316 Ga0495660_0000009 3300046810 Bacteria 427395
317 Ga0495581_0044235 3300047315 Bacteria 2575
318 Ga0495604_0044568 3300047317 Bacteria 3464
319 Ga0495672_0016462 3300047320 Bacteria 4980
320 Ga0495683_0125614 3300047323 Bacteria 1214
321 Ga0495687_001412 3300047443 Bacteria 22113
322 Ga0495687_093940 3300047443 Bacteria 1141
323 Ga0495673_0000001 3300047469 Bacteria 1630730
324 Ga0495673_0046382 3300047469 Bacteria 1926
325 Ga0495681_0001029 3300047470 Bacteria 21320
326 Ga0495681_0002809 3300047470 Bacteria 12313
327 Ga0495686_0001485 3300047472 Bacteria 25493
328 Ga0495686_0002808 3300047472 Bacteria 15793
329 Ga0495686_0066528 3300047472 Bacteria 2227
330 Ga0495593_0021758 3300047673 Bacteria 3578
331 Ga0496100_0044166 3300048903 Bacteria 2853
332 Ga0496100_0062432 3300048903 Bacteria 2459
333 Ga0496101_0101872 3300048904 Bacteria 2150
334 Ga0496101_0379258 3300048904 Bacteria 1112
335 Ga0496102_0522443 3300048905 Bacteria 1109
336 Ga0496103_0119981 3300048906 Bacteria 1674
337 Ga0496103_0142253 3300048906 Bacteria 1535
338 Ga0496104_0004370 3300048907 Bacteria 12305
339 Ga0496104_0070913 3300048907 Bacteria 3313
340 Ga0496104_0622988 3300048907 Bacteria 988
341 Ga0496105_0005205 3300048908 Bacteria 9853
342 Ga0496105_0022734 3300048908 Bacteria 5080
343 Ga0496105_0030880 3300048908 Bacteria 4392
344 Ga0496105_0122542 3300048908 Bacteria 2143
345 Ga0496105_0169635 3300048908 Bacteria 1789
346 Ga0496106_0116869 3300048909 Bacteria 2081
347 Ga0496107_0141469 3300048910 Bacteria 1778
348 Ga0496108_0388796 3300048911 Bacteria 1218
349 Ga0496109_0062679 3300048912 Bacteria 3401
350 Ga0496109_0184171 3300048912 Bacteria 1962
351 Ga0496109_0196766 3300048912 Bacteria 1895
352 Ga0496110_0033602 3300048913 Bacteria 4438
353 Ga0496110_0102895 3300048913 Bacteria 2561
354 Ga0496110_0129230 3300048913 Bacteria 2280
355 Ga0496110_0380667 3300048913 Bacteria 1286
356 Ga0496111_0020472 3300048914 Bacteria 4606
357 Ga0496111_0211501 3300048914 Bacteria 1440
358 Ga0496113_0052194 3300048916 Bacteria 3053
359 Ga0496114_0014534 3300048917 Bacteria 6323
360 Ga0496114_0053760 3300048917 Bacteria 3357
361 Ga0496114_0057428 3300048917 Bacteria 3249
362 Ga0496114_0150091 3300048917 Bacteria 2021
363 Ga0496116_0069736 3300048919 Bacteria 2234
364 Ga0496117_0067389 3300048920 Bacteria 2422
365 Ga0496117_0079250 3300048920 Bacteria 2165
366 Ga0496118_0010596 3300048921 Bacteria 9107
367 Ga0496118_0017730 3300048921 Bacteria 6463
368 Ga0496118_0196895 3300048921 Bacteria 1198
369 Ga0496119_0011371 3300048922 Bacteria 7382
370 Ga0496119_0011938 3300048922 Bacteria 7121
371 Ga0496119_0012348 3300048922 Bacteria 6946
372 Ga0496119_0090698 3300048922 Bacteria 1737
373 Ga0496119_0169739 3300048922 Bacteria 1153
374 Ga0496120_0031224 3300048923 Bacteria 3229
375 Ga0496120_0035672 3300048923 Bacteria 2968
376 Ga0496120_0071843 3300048923 Bacteria 1898
377 Ga0496120_0099554 3300048923 Bacteria 1539
378 Ga0496121_0000992 3300048924 Bacteria 50765
379 Ga0496121_0001958 3300048924 Bacteria 32783
380 Ga0496121_0002853 3300048924 Bacteria 25499
381 Ga0496121_0011088 3300048924 Bacteria 10056
382 Ga0496121_0013386 3300048924 Bacteria 8822
383 Ga0496121_0035785 3300048924 Bacteria 4440
384 Ga0496121_0072345 3300048924 Bacteria 2768
385 Ga0496121_0096145 3300048924 Bacteria 2300
386 Ga0496122_0000495 3300048925 Bacteria 81902
387 Ga0496122_0002881 3300048925 Bacteria 23547
388 Ga0496122_0140932 3300048925 Bacteria 1508
389 Ga0496123_0000393 3300048926 Bacteria 81747
390 Ga0496123_0041255 3300048926 Bacteria 3202
391 Ga0496123_0070717 3300048926 Bacteria 2182
392 Ga0496124_0012990 3300048927 Bacteria 8164
393 Ga0496124_0103160 3300048927 Bacteria 2307
394 Ga0496124_0210872 3300048927 Bacteria 1470
395 Ga0496125_0008037 3300048928 Bacteria 11136
396 Ga0496125_0013989 3300048928 Bacteria 7846
397 Ga0496125_0015018 3300048928 Bacteria 7520
398 Ga0496125_0073677 3300048928 Bacteria 2653
399 Ga0496126_0007945 3300048929 Bacteria 11532
400 Ga0496126_0043928 3300048929 Bacteria 4119
401 Ga0496126_0057679 3300048929 Bacteria 3503
402 Ga0496126_0152800 3300048929 Bacteria 1977
403 Ga0496126_0160051 3300048929 Bacteria 1924
404 Ga0496126_0239417 3300048929 Bacteria 1517
405 Ga0495682_0016450 3300049460 Bacteria 2800
406 Ga0501031_0008210 3300049568 Bacteria 6794
407 Ga0501032_0002889 3300049569 Bacteria 13357
408 Ga0501033_0005016 3300049570 Bacteria 10534
409 Ga0501033_0125618 3300049570 Bacteria 1860
410 Ga0501034_0001197 3300049571 Bacteria 35694
411 Ga0501034_0007380 3300049571 Bacteria 11711
412 Ga0501034_0285292 3300049571 Bacteria 1590
413 Ga0501036_0169543 3300049572 Bacteria 1839
414 Ga0501037_0000069 3300049573 Bacteria 95277
415 Ga0501037_0179828 3300049573 Bacteria 1501
416 Ga0501038_0000034 3300049574 Bacteria 128854
417 Ga0501038_0093009 3300049574 Bacteria 2524
418 Ga0501039_0000580 3300049575 Bacteria 26450
419 Ga0501043_0003520 3300049579 Bacteria 12881
420 Ga0501046_0001236 3300049580 Bacteria 24723
421 Ga0501046_0126278 3300049580 Bacteria 1943
422 Ga0501047_0000758 3300049581 Bacteria 33713
423 Ga0501047_0094134 3300049581 Bacteria 2875
424 Ga0501047_0097010 3300049581 Bacteria 2826
425 Ga0501047_0286199 3300049581 Bacteria 1492
426 Ga0501048_0002978 3300049582 Bacteria 12927
427 Ga0501067_0003860 3300049583 Bacteria 8273
428 Ga0501068_0174057 3300049584 Bacteria 1359
429 Ga0501070_0009594 3300049586 Bacteria 8176
430 Ga0501070_0016062 3300049586 Bacteria 6292
431 Ga0501071_0236570 3300049587 Bacteria 1377
432 Ga0501072_0451659 3300049588 Bacteria 1018
433 Ga0501073_0000532 3300049589 Bacteria 26744
434 Ga0501074_0001458 3300049590 Bacteria 15854
435 Ga0501076_0032075 3300049592 Bacteria 4100
436 Ga0501079_0011699 3300049741 Bacteria 6702
437 Ga0501080_0009373 3300049742 Bacteria 8928
438 Ga0501080_0033385 3300049742 Bacteria 4803
439 Ga0501080_0177052 3300049742 Bacteria 1964
440 Ga0501083_0007632 3300049744 Bacteria 7666
441 Ga0501083_0136659 3300049744 Bacteria 1606
442 Ga0501035_0000970 3300049822 Bacteria 30303
443 Ga0501035_0391767 3300049822 Bacteria 1157
444 Ga0501044_0000725 3300049823 Bacteria 39776
445 Ga0501044_0026755 3300049823 Bacteria 6103
446 Ga0501044_0032778 3300049823 Bacteria 5460
447 Ga0501044_0081354 3300049823 Bacteria 3279
448 Ga0501044_0407608 3300049823 Bacteria 1271
449 nmdc:mga03683_98721_c1 3300050489 Bacteria 1281
450 nmdc:mga03n38_47042_c1 3300050490 Bacteria 1907
451 nmdc:mga03n38_8518_c1 3300050490 Bacteria 3685
452 nmdc:mga00v17_86968_c1 3300050491 Bacteria 1959
453 nmdc:mga0yw44_18361_c1 3300050492 Bacteria 3828
454 nmdc:mga0yw44_18_c1 3300050492 Bacteria 73023
455 nmdc:mga0yw44_29917_c1 3300050492 Bacteria 3149
456 nmdc:mga0yw44_5033_c1 3300050492 Bacteria 6175
457 nmdc:mga0yw44_73122_c1 3300050492 Bacteria 2132
458 nmdc:mga0k408_11764_c1 3300050493 Bacteria 4774
459 nmdc:mga0k408_55109_c1 3300050493 Bacteria 2305
460 nmdc:mga06z11_234419_c1 3300050494 Bacteria 1076
461 nmdc:mga06z11_35218_c1 3300050494 Bacteria 2463
462 nmdc:mga06z11_46058_c1 3300050494 Bacteria 2208
463 nmdc:mga06z11_54059_c1 3300050494 Bacteria 2068
464 nmdc:mga06z11_62_c1 3300050494 Bacteria 46133
465 nmdc:mga04h51_6646_c1 3300050495 Bacteria 3011
466 nmdc:mga07m45_144522_c1 3300050496 Bacteria 1378
467 nmdc:mga07m45_150502_c1 3300050496 Bacteria 1350
468 nmdc:mga07m45_176_c1 3300050496 Bacteria 25687
469 nmdc:mga07m45_17928_c1 3300050496 Bacteria 3810
470 nmdc:mga0qj67_40738_c1 3300050509 Bacteria 3650
471 nmdc:mga0rr50_128982_c1 3300050513 Bacteria 2022
472 nmdc:mga0sz30_82_c1 3300050516 Bacteria 36445
473 Ga0495655_0037699 3300053083 Bacteria 1216
474 Ga0495619_0145601 3300053085 Bacteria 1633
475 Ga0500578_0052181 3300053086 Bacteria 2619
476 Ga0500581_082843 3300053089 Bacteria 1599
477 Ga0500651_0082524 3300053093 Bacteria 1990
478 Ga0500566_0000304 3300053094 Bacteria 26386
479 Ga0500650_0000371 3300053098 Bacteria 10938
480 Ga0500650_0001330 3300053098 Bacteria 7363
481 Ga0500556_0000004 3300053104 Bacteria 666287
482 Ga0500556_0000018 3300053104 Bacteria 188459
483 Ga0500556_0000029 3300053104 Bacteria 165326
484 Ga0500642_0000020 3300053130 Bacteria 159498
485 Ga0500652_000215 3300053131 Bacteria 22077
486 Ga0500652_000859 3300053131 Bacteria 10050
487 Ga0500658_0000755 3300053134 Bacteria 13347
488 Ga0500658_0138244 3300053134 Bacteria 1091
489 Ga0500568_0000251 3300053139 Bacteria 45763
490 Ga0500568_0001147 3300053139 Bacteria 17764
491 Ga0500577_0004038 3300053142 Bacteria 3846
492 Ga0500604_0000348 3300053151 Bacteria 12759
493 Ga0500604_0003944 3300053151 Bacteria 3965
494 Ga0500616_0000036 3300053153 Bacteria 390769
495 Ga0500616_0000112 3300053153 Bacteria 151210
496 Ga0500616_0004670 3300053153 Bacteria 9654
497 Ga0500622_0002987 3300053156 Bacteria 11723
498 Ga0500634_0082038 3300053161 Bacteria 1659
499 Ga0500601_000272 3300053737 Bacteria 9780
500 Ga0501082_0005142 3300060353 Bacteria 11388
501 2509076415 2508501114 Bacteria 7082538
502 2509387028 2509276021 Bacteria 7634384
503 2513575238 2513237085 Bacteria 7695351
504 2513626005 2513237092 Bacteria 8341956
505 2513636894 2513237094 Bacteria 8789602
506 2513651211 2513237095 Bacteria 8976980
507 2513654889 2513237096 Bacteria 8722461
508 2513692224 2513237101 Bacteria 7952346
509 2513706765 2513237102 Bacteria 7703324
510 2513710188 2513237103 Bacteria 7647401
511 2513722490 2513237104 Bacteria 10034502
512 2513861314 2513237137 Bacteria 9558895
513 2513916088 2513237145 Bacteria 8979722
514 2514000421 2513237159 Bacteria 6810126
515 2514001785 2513237159 Bacteria 6810126
516 2515738934 2515154134 Bacteria 7220242
517 2515741612 2515154134 Bacteria 7220242
518 2517076060 2516653085 Bacteria 7346596
519 2517104323 2517093001 Bacteria 9002274
520 2524451665 2524023207 Bacteria 6813453
521 2524461980 2524023209 Bacteria 6679728
522 2524540697 2524023228 Bacteria 10118060
523 2528849888 2528768022 Bacteria 10457665
524 2578456838 2576861471 Bacteria 4648976
525 2585326817 2582581315 Bacteria 7318924
526 2585335691 2582581316 Bacteria 7774528
527 2585394583 2582581866 Bacteria 6859583
528 2585528203 2585427526 Bacteria 7258840
529 2585820356 2585427590 Bacteria 6824633
530 2599940275 2599185301 Bacteria 6161860
531 2603857245 2602042107 Bacteria 6226103
532 2616293583 2615840624 Bacteria 6557588
533 2643805572 2643221557 Bacteria 7184309
534 2644106733 2643221618 Bacteria 7717186
535 2644148084 2643221626 Bacteria 8069654
536 2644310037 2643221655 Bacteria 7722067
537 2644331986 2643221659 Bacteria 7890716
538 2644543903 2643221698 Bacteria 7756764
539 2644616255 2643221712 Bacteria 7729434
540 2644737730 2643221734 Bacteria 5365412
541 2644747777 2643221736 Bacteria 6608466
542 2671122919 2667528175 Bacteria 7532676
543 2719179398 2718217882 Bacteria 6556348
544 2719663758 2718217997 Bacteria 6740740
545 2719730068 2718218009 Bacteria 6478651
546 2720490177 2718218199 Bacteria 6740745
547 2720611558 2718218232 Bacteria 6720332
548 2720618407 2718218233 Bacteria 6662049
549 2720629815 2718218235 Bacteria 6630699
550 2720773510 2718218269 Bacteria 6906114
551 2721145491 2718218363 Bacteria 6524337
552 2721157025 2718218365 Bacteria 6274507
553 2721162386 2718218366 Bacteria 6425255
554 2722838556 2721755514 Bacteria 6424414
555 2723025182 2721755556 Bacteria 6745503
556 2723558767 2721755684 Bacteria 6859907
557 2723565336 2721755685 Bacteria 6704835
558 2724042824 2721755810 Bacteria 6479005
559 2724088117 2721755819 Bacteria 6906405
560 2724102601 2721755822 Bacteria 6726041
561 2724108497 2721755823 Bacteria 6752556
562 2728748164 2728368998 Bacteria 8720350
563 2730106118 2728369352 Bacteria 6745171
564 2730162635 2728369365 Bacteria 6555560
565 2730296657 2728369397 Bacteria 6274511
566 2757571909 2757320392 Bacteria 3737298
567 2766064244 2765235942 Bacteria 7445910
568 2766067875 2765235942 Bacteria 7445910
569 2793061027 2791355196 Bacteria 7323613
570 2793323278 2791355260 Bacteria 6598818
571 2793326303 2791355261 Bacteria 6661293
572 2793334390 2791355262 Bacteria 6774204
573 2793348301 2791355264 Bacteria 6429314
574 2793355649 2791355265 Bacteria 6539969
575 2793366459 2791355267 Bacteria 7222458
576 2818236711 2816332527 Bacteria 8933356
577 2821446131 2821443989 Bacteria 7658172
578 2824620861 2824617872 Bacteria 8814715
579 2824628277 2824626560 Bacteria 8813858
580 2824636174 2824635225 Bacteria 8785348
581 2824647025 2824644064 Bacteria 8743947
582 2824667497 2824661429 Bacteria 9877870
583 2824681219 2824679649 Bacteria 8248951
584 2824707922 2824704595 Bacteria 9667483
585 2824719086 2824714736 Bacteria 8717648
586 2824727472 2824723954 Bacteria 8758240
587 2824758986 2824753945 Bacteria 9787441
588 2824763950 2824763712 Bacteria 9792355
589 2838020127 2838016132 Bacteria 6577831
590 2838027634 2838022645 Bacteria 6494267
591 2838051658 2838048938 Bacteria 6044578
592 2838064223 2838061910 Bacteria 6794874
593 2838070954 2838068647 Bacteria 6208656
594 2838661805 2838661181 Bacteria 7385261
595 2838689133 2838686498 Bacteria 7807632
596 2838730467 2838729681 Bacteria 7400765
597 2838743408 2838742623 Bacteria 7396178
598 2841854904 2841851746 Bacteria 7532261
599 2841864905 2841864319 Bacteria 6742987
600 2842043034 2842038055 Bacteria 8002051
601 2842051075 2842045827 Bacteria 8006841
602 2842110885 2842110456 Bacteria 7656360
603 2842116832 2842110456 Bacteria 7656360
604 2842157766 2842156927 Bacteria 6894975
605 2842164978 2842163707 Bacteria 6916235
606 2842166716 2842163707 Bacteria 6916235
607 2842180650 2842180545 Bacteria 6888678
608 2842205037 2842198810 Bacteria 6608673
609 2842220645 2842217011 Bacteria 7497767
610 2842231299 2842229732 Bacteria 7475766
611 2842244587 2842243621 Bacteria 7421798
612 2842258400 2842257432 Bacteria 7401195
613 2842270447 2842264693 Bacteria 6472963
614 2842273153 2842271015 Bacteria 7807131
615 2842286669 2842285085 Bacteria 6011953
616 2842303352 2842298080 Bacteria 6123127
617 2842309366 2842304105 Bacteria 7023636
618 2842312778 2842311132 Bacteria 6616990
619 2842334148 2842333319 Bacteria 8899485
620 2842347178 2842341865 Bacteria 7003929
621 2842362075 2842357229 Bacteria 6485165
622 2842366732 2842363717 Bacteria 6844742
623 2842397318 2842395702 Bacteria 6780583
624 2842403778 2842402390 Bacteria 6681310
625 2842410520 2842409023 Bacteria 6687331
626 2842417167 2842415677 Bacteria 6596907
627 2842424569 2842422224 Bacteria 6239196
628 2842434269 2842428310 Bacteria 6767288
629 2842440624 2842434925 Bacteria 6502746
630 2842447276 2842441272 Bacteria 6769273
631 2842452005 2842447887 Bacteria 6754142
632 2842468710 2842462802 Bacteria 6588055
633 2842475207 2842469257 Bacteria 6752936
634 2842500190 2842495871 Bacteria 6820686
635 2842523402 2842521101 Bacteria 6569494
636 2842527293 2842521101 Bacteria 6569494
637 2842922028 2842918807 Bacteria 4289178
638 2844459513 2844454524 Bacteria 7952546
639 2848997086 2848992105 Bacteria 6810864
640 2855875120 2855872281 Bacteria 6964271
641 2857516452 2857509624 Bacteria 7472071
642 2857519596 2857516855 Bacteria 7787325
643 2857523720 2857516855 Bacteria 7787325
644 2857526616 2857524615 Bacteria 6615449
645 2874613027 2874612657 Bacteria 8252029
646 2876371490 2876369609 Bacteria 6807521
647 2876763171 2876761206 Bacteria 10111113
648 2879102040 2879099564 Bacteria 10442239
649 2881365103 2881364244 Bacteria 7710352
650 2885370172 2885366525 Bacteria 8326213
651 2885382426 2885374607 Bacteria 8927485
652 2885417971 2885409591 Bacteria 9235467
653 2888385613 2888378607 Bacteria 9652610
654 2888390155 2888388044 Bacteria 7304136
655 2903749709 2903748898 Bacteria 9972761
656 2904720466 2904711408 Bacteria 9771557
657 2906639866 2906635258 Bacteria 8601019
658 2908744331 2908739725 Bacteria 8628932
659 2909046954 2909042592 Bacteria 6499737
660 2913300445 2913295892 Bacteria 6333755
661 2919077876 2919073203 Bacteria 6531949
662 2919456029 2919450847 Bacteria 5631160
663 2922371263
664 2922399442 2922393267 Bacteria 8285685
665 2929619645 2929615660 Bacteria 9193770
666 2929627884 2929624759 Bacteria 9339455
667 2932785976 2932784394 Bacteria 9704911
668 2932799632 2932794094 Bacteria 7915132
669 2932808777 2932801729 Bacteria 7987968
670 2932817077 2932809354 Bacteria 9135765
671 2932822432 2932818245 Bacteria 9955613
672 2932831020 2932828146 Bacteria 9745859
673 2933575861 2933570622 Bacteria 7023390
674 2933581564 2933577622 Bacteria 9116884
675 2933586910 2933586486 Bacteria 7667493
676 2933593163 2933586486 Bacteria 7667493
677 2933599243 2933594066 Bacteria 5594265
678 2933601753 2933599457 Bacteria 5858799
679 2935624192 2935616580 Bacteria 9032984
680 2935640162 2935638405 Bacteria 10015038
681 2935667000 2935665750 Bacteria 9571747
682 2935680356 2935675223 Bacteria 9928132
683 2935690131 2935684952 Bacteria 9590419
684 2935699784 2935694250 Bacteria 9291695
685 2935704755 2935703347 Bacteria 10242284
686 2935722156 2935713505 Bacteria 9608509
687 2935731466 2935722832 Bacteria 9608746
688 2935735446 2935732158 Bacteria 9706831
689 2935745283 2935741537 Bacteria 9707219
690 2935755142 2935750917 Bacteria 9590372
691 2935762341 2935760218 Bacteria 9817913
692 2935803842 2935801545 Bacteria 9301974
693 2935811758 2935810662 Bacteria 9401221
694 2935829645 2935827899 Bacteria 10038562
695 2935843023 2935837841 Bacteria 9454360
696 2935862308 2935855204 Bacteria 9035059
697 2935870443 2935864058 Bacteria 9784707
698 2935881025 2935873716 Bacteria 9632195
699 2935885707 2935883170 Bacteria 7964738
700 2935903611 2935901341 Bacteria 7341747
701 2935904815 2935901341 Bacteria 7341747
702 2935993522 2935992306 Bacteria 9802711
703 2936004418 2936002035 Bacteria 9362176
704 2936038341 2936037263 Bacteria 9446081
705 2937000100 2936996657 Bacteria 6298727
706 2940561578 2940556831 Bacteria 9590747
707 2941531384 2941531003 Bacteria 7653939
708 2941544247 2941538514 Bacteria 9402094
709 2953997133 2953994433 Bacteria 4303959
710 2960608363 2960603979 Bacteria 6898737
711 2974307443 2974307012 Bacteria 4172388
712 2984517354 2984514374 Bacteria 4172479
713 2987653051 2987652177 Bacteria 6969023
714 2987669585 2987666974 Bacteria 6509233
715 2989349509 2989349275 Bacteria 6349068
716 3005414864 3005409236 Bacteria 7188837
717 3005488436 3005483717 Bacteria 7877331
718 3005588261 3005587118 Bacteria 7794411
719 639648178 639633055 Bacteria 7751309
720 8005289166 8005282627 Bacteria 6675747
721 8005313722 8005307578 Bacteria 7395396
722 8005387444 8005382845 Bacteria 6732062
723 8005399977 8005395548 Bacteria 6806915
724 8005432774 8005430974 Bacteria 6689030
725 8005498504 8005497431 Bacteria 6477605
726 8005619696 8005619151 Bacteria 7030230
727 8005628268 8005626139 Bacteria 6534237
728 8005669915 8005668836 Bacteria 6953162
729 8005696115 8005695170 Bacteria 6912330
730 8006927327 8006926726 Bacteria 6749210
731 8016516364 8016511872 Bacteria 9921665
732 8017060172 8017057580 Bacteria 10023680
733 8018132938 8018127388 Bacteria 7351159
734 8019579689 8019576017 Bacteria 10049540
735 8019587402 8019586578 Bacteria 10212056
736 8019614590 8019608314 Bacteria 10042931
737 8019649585 8019648815 Bacteria 10014479
738 8045864755 8045864390 Bacteria 5043873
739 8054567481 8054563764 Bacteria 5592885
740 8055749099 8055742211 Bacteria 9226248
741 8056380171 8056375014 Bacteria 7006639
742 8056385802 8056382006 Bacteria 6408074
743 Ga0496126_0036079
744 JGI24738J21930_10000044
745 JGI25152J39213_1000033
746 JGI25152J39213_1006711
747 JGI25150J39212_1000310
748 JGI25159J45721_1000492
749 JGI25151J46595_10000142
750 JGI25151J46595_10000332
751 JGI25151J46595_10002576
752 JGI25153J46596_10000107
753 JGI25153J46596_10000317
754 JGI25153J46596_10001194
755 JGI25153J46596_10004030
756 JGI25153J46596_10025608
757 JGI25160J50197_1000109
758 JGI25160J50197_1002643
759 JGI25161J50226_1000011
760 Ga0055524_1003271
761 Ga0055536_1000008
762 Ga0055528_1010323
763 Ga0055528_1010380
764 Ga0055530_10001010
765 Ga0055540_1001958
766 Ga0055540_1012743
767 Ga0055531_10004575
768 Ga0055543_1000071
769 Ga0065165_1000048
770 Ga0065165_1000135
771 Ga0065165_1002106
772 Ga0065165_1007973
773 Ga0070668_100044905
774 Ga0070668_100102385
775 Ga0070668_100251058
776 Ga0070671_100047428
777 Ga0070671_100060953
778 Ga0070671_100076134
779 Ga0070674_100052801
780 Ga0070667_100146871
781 Ga0070667_100455089
782 Ga0070709_10028436
783 Ga0070714_100012268
784 Ga0070713_100010360
785 Ga0070663_100042908
786 Ga0070663_100292920
787 Ga0070678_100089315
788 Ga0068867_100235382
789 Ga0070698_100322456
790 Ga0070699_100514921
791 Ga0068853_100332619
792 Ga0070665_100002435
793 Ga0070665_100020048
794 Ga0070665_100033586
795 Ga0070665_100064478
796 Ga0070665_100072276
797 Ga0068855_100419161
798 Ga0068857_100219968
799 Ga0068857_100225779
800 Ga0068856_100055528
801 Ga0068856_100093797
802 Ga0068852_100134034
803 Ga0068864_100089820
804 Ga0068863_100168478
805 Ga0068862_100032832
806 Ga0068862_100371510
807 Ga0068862_100403960
808 Ga0081538_10016832
809 Ga0070717_10009089
810 Ga0075365_10000025
811 Ga0075365_10255718
812 Ga0075368_10007647
813 Ga0075363_100000716
814 Ga0075363_100011888
815 Ga0075363_100068354
816 Ga0075364_10015875
817 Ga0075364_10272642
818 Ga0070716_100132947
819 Ga0075362_10033193
820 Ga0075367_10003271
821 Ga0075367_10059868
822 Ga0075367_10072494
823 Ga0075366_10003061
824 Ga0075366_10200575
825 Ga0075370_10000361
826 Ga0075370_10004952
827 Ga0075370_10013655
828 Ga0075370_10013858
829 Ga0075430_100023375
830 Ga0068865_100328892
831 Ga0099824_1015176
832 Ga0099794_10080464
833 Ga0099795_10007287
834 Ga0105251_10007523
835 Ga0105251_10067109
836 Ga0105240_10228453
837 Ga0105245_10274633
838 Ga0105245_10407192
839 Ga0105247_10012525
840 Ga0105243_10043199
841 Ga0105243_10080135
842 Ga0105241_10082415
843 Ga0105248_10273195
844 Ga0105237_10010413
845 Ga0105237_10109347
846 Ga0105238_10009947
847 Ga0105238_10104369
848 Ga0105249_10060091
849 Ga0123340_1000026
850 Ga0123341_1000042
851 Ga0105239_10151822
852 Ga0105239_10188494
853 Ga0105246_10007411
854 Ga0105246_10022898
855 Ga0157374_10026591
856 Ga0157374_10169638
857 Ga0157375_10028075
858 Ga0163163_10587646
859 Ga0157380_10147314
860 Ga0182008_10001248
861 Ga0182008_10033298
862 Ga0182008_10052462
863 Ga0157379_10173448
864 Ga0157379_10190353
865 Ga0157376_10162832
866 Ga0182006_1000005
867 Ga0182006_1000271
868 Ga0182006_1048567
869 Ga0182007_10000001
870 Ga0182005_1004258
871 Ga0163161_10002649
872 Ga0214544_1023343
873 Ga0214542_1009367
874 Ga0214543_1001120
875 Ga0209436_110868
876 Ga0207425_1000064
877 Ga0207425_1018101
878 Ga0209129_1000101
879 Ga0209673_1002399
880 Ga0209673_1003294
881 Ga0209673_1004031
882 Ga0209130_1000058
883 Ga0209130_1000071
884 Ga0209130_1000637
885 Ga0209676_1000042
886 Ga0209676_1009721
887 Ga0209025_1000048
888 Ga0209025_1000265
889 Ga0209564_1015010
890 Ga0209758_1000011
891 Ga0209758_1000056
892 Ga0209758_1000120
893 Ga0209758_1004504
894 Ga0209758_1011184
895 Ga0209758_1012798
896 Ga0209050_1000035
897 Ga0209050_1006125
898 Ga0209256_1000247
899 Ga0209256_1001013
900 Ga0209256_1004260
901 Ga0209256_1006330
902 Ga0207426_1000131
903 Ga0207426_1000287
904 Ga0207426_1000984
905 Ga0207426_1002935
906 Ga0207426_1026371
907 Ga0209051_1000095
908 Ga0209051_1001408
909 Ga0209257_1001101
910 Ga0209257_1002703
911 Ga0209257_1010891
912 Ga0207713_1028519
913 Ga0207710_10011689
914 Ga0207710_10064803
915 Ga0207688_10012400
916 Ga0207647_10023417
917 Ga0207699_10024067
918 Ga0207684_10331740
919 Ga0207654_10031129
920 Ga0207671_10014079
921 Ga0207671_10029434
922 Ga0207650_10313956
923 Ga0207687_10006901
924 Ga0207687_10259199
925 Ga0207700_10057204
926 Ga0207644_10077131
927 Ga0207644_10213880
928 Ga0207709_10010894
929 Ga0207709_10160753
930 Ga0207669_10028745
931 Ga0207665_10164725
932 Ga0207711_10097816
933 Ga0207689_10008958
934 Ga0207712_10039217
935 Ga0207668_10122216
936 Ga0207668_10216357
937 Ga0207658_10157099
938 Ga0207658_10319646
939 Ga0207703_10201186
940 Ga0207639_10404153
941 Ga0207678_10020242
942 Ga0207678_10022012
943 Ga0207678_10023653
944 Ga0207678_10028047
945 Ga0207678_10469188
946 Ga0207702_10243422
947 Ga0207641_10070142
948 Ga0207648_10142776
949 Ga0207676_10073239
950 Ga0207674_10053672
951 Ga0207674_10055283
952 Ga0207674_10271252
953 Ga0207675_100247887
954 Ga0207683_10073437
955 Ga0207683_10096035
956 Ga0209179_1015265
957 Ga0209282_1000738
958 Ga0209588_1018467
959 Ga0209813_10081069
960 Ga0268266_10002988
961 Ga0268266_10004447
962 Ga0268266_10013214
963 Ga0268266_10019781
964 Ga0268266_10024478
965 Ga0268266_10067352
966 Ga0268266_10651158
967 Ga0268265_10031413
968 Ga0268265_10057672
969 Ga0268265_10393061
970 Ga0268265_10426648
971 Ga0268264_10408806
972 Ga0307517_10000744
973 Ga0307515_10083636
974 Ga0307515_10154616
975 Ga0307515_10161308
976 Ga0265328_10028046
977 Ga0265339_10098819
978 Ga0307513_10066085
979 Ga0307509_10005194
980 Ga0307508_10000092
981 Ga0307405_10121811
982 Ga0307412_10003361
983 Ga0307412_10331800
984 Ga0307510_10003194
985 Ga0307510_10243520
986 Ga0315911_1000010
987 Ga0395900_0111753
988 Ga0395900_0134490
989 Ga0395898_0097492
990 Ga0395898_0136935
991 Ga0395905_0002303
992 Ga0395905_0167325
993 Ga0395905_0339120
994 Ga0395901_0107466
995 Ga0395901_0143662
996 Ga0395901_0608627
997 Ga0237816_00929
998 Ga0439436_0000039
999 Ga0439465_0000792
1000 Ga0451807_2442091
1001 Ga0451833_0219807
1002 Ga0451835_0182269
1003 Ga0451837_0064402
1004 Ga0451839_0113754
1005 Ga0451841_0436683
1006 Ga0451845_0696792
1007 Ga0451847_0355506
1008 Ga0451849_0031286
1009 Ga0451851_0164034
1010 Ga0451843_0144315
1011 Ga0451853_1876950
1012 Ga0466968_0030756
1013 Ga0466968_0094052
1014 Ga0495638_0007212
1015 Ga0495664_0176224
1016 Ga0495594_0116969
1017 Ga0495607_0070202
1018 Ga0495583_0070786
1019 Ga0495606_0001337
1020 Ga0495606_0014239
1021 Ga0495606_0028472
1022 Ga0495606_0098520
1023 Ga0495606_0100410
1024 Ga0495610_0000298
1025 Ga0495610_0067539
1026 Ga0495616_0028975
1027 Ga0495620_0023270
1028 Ga0495632_0107170
1029 Ga0495643_0000952
1030 Ga0495643_0046451
1031 Ga0495643_0138119
1032 Ga0495648_0016194
1033 Ga0495648_0027362
1034 Ga0495648_0043558
1035 Ga0495654_0028764
1036 Ga0495640_0014214
1037 Ga0495609_0000657
1038 Ga0495668_0088895
1039 Ga0495634_0020988
1040 Ga0495611_0021103
1041 Ga0495625_0000724
1042 Ga0495625_0035430
1043 Ga0495625_0083129
1044 Ga0495635_0002472
1045 Ga0495588_0002625
1046 Ga0495588_0025988
1047 Ga0495657_0004748
1048 Ga0495613_0038177
1049 Ga0495624_0007439
1050 Ga0495624_0174514
1051 Ga0495670_0000500
1052 Ga0495670_0002430
1053 Ga0495671_0156019
1054 Ga0495649_0021484
1055 Ga0495649_0170767
1056 Ga0495600_0002308
1057 Ga0495600_0013410
1058 Ga0495660_0000009
1059 Ga0495581_0044235
1060 Ga0495604_0044568
1061 Ga0495672_0016462
1062 Ga0495683_0125614
1063 Ga0495687_001412
1064 Ga0495687_093940
1065 Ga0495673_0000001
1066 Ga0495673_0046382
1067 Ga0495681_0001029
1068 Ga0495681_0002809
1069 Ga0495686_0001485
1070 Ga0495686_0002808
1071 Ga0495686_0066528
1072 Ga0495593_0021758
1073 Ga0496100_0044166
1074 Ga0496100_0062432
1075 Ga0496101_0101872
1076 Ga0496101_0379258
1077 Ga0496102_0522443
1078 Ga0496103_0119981
1079 Ga0496103_0142253
1080 Ga0496104_0004370
1081 Ga0496104_0070913
1082 Ga0496104_0622988
1083 Ga0496105_0005205
1084 Ga0496105_0022734
1085 Ga0496105_0030880
1086 Ga0496105_0122542
1087 Ga0496105_0169635
1088 Ga0496106_0116869
1089 Ga0496107_0141469
1090 Ga0496108_0388796
1091 Ga0496109_0062679
1092 Ga0496109_0184171
1093 Ga0496109_0196766
1094 Ga0496110_0033602
1095 Ga0496110_0102895
1096 Ga0496110_0129230
1097 Ga0496110_0380667
1098 Ga0496111_0020472
1099 Ga0496111_0211501
1100 Ga0496113_0052194
1101 Ga0496114_0014534
1102 Ga0496114_0053760
1103 Ga0496114_0057428
1104 Ga0496114_0150091
1105 Ga0496116_0069736
1106 Ga0496117_0067389
1107 Ga0496117_0079250
1108 Ga0496118_0010596
1109 Ga0496118_0017730
1110 Ga0496118_0196895
1111 Ga0496119_0011371
1112 Ga0496119_0011938
1113 Ga0496119_0012348
1114 Ga0496119_0090698
1115 Ga0496119_0169739
1116 Ga0496120_0031224
1117 Ga0496120_0035672
1118 Ga0496120_0071843
1119 Ga0496120_0099554
1120 Ga0496121_0000992
1121 Ga0496121_0001958
1122 Ga0496121_0002853
1123 Ga0496121_0011088
1124 Ga0496121_0013386
1125 Ga0496121_0035785
1126 Ga0496121_0072345
1127 Ga0496121_0096145
1128 Ga0496122_0000495
1129 Ga0496122_0002881
1130 Ga0496122_0140932
1131 Ga0496123_0000393
1132 Ga0496123_0041255
1133 Ga0496123_0070717
1134 Ga0496124_0012990
1135 Ga0496124_0103160
1136 Ga0496124_0210872
1137 Ga0496125_0008037
1138 Ga0496125_0013989
1139 Ga0496125_0015018
1140 Ga0496125_0073677
1141 Ga0496126_0007945
1142 Ga0496126_0043928
1143 Ga0496126_0057679
1144 Ga0496126_0152800
1145 Ga0496126_0160051
1146 Ga0496126_0239417
1147 Ga0495682_0016450
1148 Ga0501031_0008210
1149 Ga0501032_0002889
1150 Ga0501033_0005016
1151 Ga0501033_0125618
1152 Ga0501034_0001197
1153 Ga0501034_0007380
1154 Ga0501034_0285292
1155 Ga0501036_0169543
1156 Ga0501037_0000069
1157 Ga0501037_0179828
1158 Ga0501038_0000034
1159 Ga0501038_0093009
1160 Ga0501039_0000580
1161 Ga0501043_0003520
1162 Ga0501046_0001236
1163 Ga0501046_0126278
1164 Ga0501047_0000758
1165 Ga0501047_0094134
1166 Ga0501047_0097010
1167 Ga0501047_0286199
1168 Ga0501048_0002978
1169 Ga0501067_0003860
1170 Ga0501068_0174057
1171 Ga0501070_0009594
1172 Ga0501070_0016062
1173 Ga0501071_0236570
1174 Ga0501072_0451659
1175 Ga0501073_0000532
1176 Ga0501074_0001458
1177 Ga0501076_0032075
1178 Ga0501079_0011699
1179 Ga0501080_0009373
1180 Ga0501080_0033385
1181 Ga0501080_0177052
1182 Ga0501083_0007632
1183 Ga0501083_0136659
1184 Ga0501035_0000970
1185 Ga0501035_0391767
1186 Ga0501044_0000725
1187 Ga0501044_0026755
1188 Ga0501044_0032778
1189 Ga0501044_0081354
1190 Ga0501044_0407608
1191 nmdc:mga03683_98721_c1
1192 nmdc:mga03n38_47042_c1
1193 nmdc:mga03n38_8518_c1
1194 nmdc:mga00v17_86968_c1
1195 nmdc:mga0yw44_18361_c1
1196 nmdc:mga0yw44_18_c1
1197 nmdc:mga0yw44_29917_c1
1198 nmdc:mga0yw44_5033_c1
1199 nmdc:mga0yw44_73122_c1
1200 nmdc:mga0k408_11764_c1
1201 nmdc:mga0k408_55109_c1
1202 nmdc:mga06z11_234419_c1
1203 nmdc:mga06z11_35218_c1
1204 nmdc:mga06z11_46058_c1
1205 nmdc:mga06z11_54059_c1
1206 nmdc:mga06z11_62_c1
1207 nmdc:mga04h51_6646_c1
1208 nmdc:mga07m45_144522_c1
1209 nmdc:mga07m45_150502_c1
1210 nmdc:mga07m45_176_c1
1211 nmdc:mga07m45_17928_c1
1212 nmdc:mga0qj67_40738_c1
1213 nmdc:mga0rr50_128982_c1
1214 nmdc:mga0sz30_82_c1
1215 Ga0495655_0037699
1216 Ga0495619_0145601
1217 Ga0500578_0052181
1218 Ga0500581_082843
1219 Ga0500651_0082524
1220 Ga0500566_0000304
1221 Ga0500650_0000371
1222 Ga0500650_0001330
1223 Ga0500556_0000004
1224 Ga0500556_0000018
1225 Ga0500556_0000029
1226 Ga0500642_0000020
1227 Ga0500652_000215
1228 Ga0500652_000859
1229 Ga0500658_0000755
1230 Ga0500658_0138244
1231 Ga0500568_0000251
1232 Ga0500568_0001147
1233 Ga0500577_0004038
1234 Ga0500604_0000348
1235 Ga0500604_0003944
1236 Ga0500616_0000036
1237 Ga0500616_0000112
1238 Ga0500616_0004670
1239 Ga0500622_0002987
1240 Ga0500634_0082038
1241 Ga0500601_000272
1242 Ga0501082_0005142
1243 2509076415
1244 2509387028
1245 2513575238
1246 2513626005
1247 2513636894
1248 2513651211
1249 2513654889
1250 2513692224
1251 2513706765
1252 2513710188
1253 2513722490
1254 2513861314
1255 2513916088
1256 2514000421
1257 2514001785
1258 2515738934
1259 2515741612
1260 2517076060
1261 2517104323
1262 2524451665
1263 2524461980
1264 2524540697
1265 2528849888
1266 2578456838
1267 2585326817
1268 2585335691
1269 2585394583
1270 2585528203
1271 2585820356
1272 2599940275
1273 2603857245
1274 2616293583
1275 2643805572
1276 2644106733
1277 2644148084
1278 2644310037
1279 2644331986
1280 2644543903
1281 2644616255
1282 2644737730
1283 2644747777
1284 2671122919
1285 2719179398
1286 2719663758
1287 2719730068
1288 2720490177
1289 2720611558
1290 2720618407
1291 2720629815
1292 2720773510
1293 2721145491
1294 2721157025
1295 2721162386
1296 2722838556
1297 2723025182
1298 2723558767
1299 2723565336
1300 2724042824
1301 2724088117
1302 2724102601
1303 2724108497
1304 2728748164
1305 2730106118
1306 2730162635
1307 2730296657
1308 2757571909
1309 2766064244
1310 2766067875
1311 2793061027
1312 2793323278
1313 2793326303
1314 2793334390
1315 2793348301
1316 2793355649
1317 2793366459
1318 2818236711
1319 2821446131
1320 2824620861
1321 2824628277
1322 2824636174
1323 2824647025
1324 2824667497
1325 2824681219
1326 2824707922
1327 2824719086
1328 2824727472
1329 2824758986
1330 2824763950
1331 2838020127
1332 2838027634
1333 2838051658
1334 2838064223
1335 2838070954
1336 2838661805
1337 2838689133
1338 2838730467
1339 2838743408
1340 2841854904
1341 2841864905
1342 2842043034
1343 2842051075
1344 2842110885
1345 2842116832
1346 2842157766
1347 2842164978
1348 2842166716
1349 2842180650
1350 2842205037
1351 2842220645
1352 2842231299
1353 2842244587
1354 2842258400
1355 2842270447
1356 2842273153
1357 2842286669
1358 2842303352
1359 2842309366
1360 2842312778
1361 2842334148
1362 2842347178
1363 2842362075
1364 2842366732
1365 2842397318
1366 2842403778
1367 2842410520
1368 2842417167
1369 2842424569
1370 2842434269
1371 2842440624
1372 2842447276
1373 2842452005
1374 2842468710
1375 2842475207
1376 2842500190
1377 2842523402
1378 2842527293
1379 2842922028
1380 2844459513
1381 2848997086
1382 2855875120
1383 2857516452
1384 2857519596
1385 2857523720
1386 2857526616
1387 2874613027
1388 2876371490
1389 2876763171
1390 2879102040
1391 2881365103
1392 2885370172
1393 2885382426
1394 2885417971
1395 2888385613
1396 2888390155
1397 2903749709
1398 2904720466
1399 2906639866
1400 2908744331
1401 2909046954
1402 2913300445
1403 2919077876
1404 2919456029
1405 2922371263
1406 2922399442
1407 2929619645
1408 2929627884
1409 2932785976
1410 2932799632
1411 2932808777
1412 2932817077
1413 2932822432
1414 2932831020
1415 2933575861
1416 2933581564
1417 2933586910
1418 2933593163
1419 2933599243
1420 2933601753
1421 2935624192
1422 2935640162
1423 2935667000
1424 2935680356
1425 2935690131
1426 2935699784
1427 2935704755
1428 2935722156
1429 2935731466
1430 2935735446
1431 2935745283
1432 2935755142
1433 2935762341
1434 2935803842
1435 2935811758
1436 2935829645
1437 2935843023
1438 2935862308
1439 2935870443
1440 2935881025
1441 2935885707
1442 2935903611
1443 2935904815
1444 2935993522
1445 2936004418
1446 2936038341
1447 2937000100
1448 2940561578
1449 2941531384
1450 2941544247
1451 2953997133
1452 2960608363
1453 2974307443
1454 2984517354
1455 2987653051
1456 2987669585
1457 2989349509
1458 3005414864
1459 3005488436
1460 3005588261
1461 639648178
1462 8005289166
1463 8005313722
1464 8005387444
1465 8005399977
1466 8005432774
1467 8005498504
1468 8005619696
1469 8005628268
1470 8005669915
1471 8005696115
1472 8006927327
1473 8016516364
1474 8017060172
1475 8018132938
1476 8019579689
1477 8019587402
1478 8019614590
1479 8019649585
1480 8045864755
1481 8054567481
1482 8055749099
1483 8056380171
1484 8056385802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

124

335

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4le6-assembly2.cif.gz_C crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8889 10 277
4le6-assembly3.cif.gz_E crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.888 10 277
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.8806 21 277
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.8769 22 280
4le6-assembly1.cif.gz_A-2 crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8732 8 277
ID Description Score Start End Superfamily
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8881 21 277 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.888 10 277 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8511 10 277 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8442 21 277 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.828 1 277 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A486U190-F1-model_v4 Beta-lactamase 0.9662 182 277
AF-B9B6I4-F1-model_v4 deleted 0.9596 188 282
AF-W6S4J1-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9553 199 282
AF-A0A512JRC7-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9546 20 147
AF-A0A357XUG2-F1-model_v4 Glutathione peroxidase 0.9451 185 277 GO:0004601
GO:0034599

Map