F478696

General Info

Members Datasets Scaffolds Average Seq Length
743 328 1486 280

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0001465|Ga0395899_0001465_36_968
Length 310
Sequence LLRPTSRAARFAASSKRDEASAFPGDHDHGICRWLAYSGSPVLIEELLYNRKNSLIVQSLHSRLGAEETNGDGFGLGWYGEQETPGVFRSIEPAWNDRNLHELSGHISSGLVFAHIRASTGSPVQQTNCHPFRHGRWLFMHNGFLDGFHDTKRDLALAVDPALYPEIEGTTDTELMFHLALTFGLEDDPPQAVARMVGLVESTGQAHGVEFPFQGTIATTDGECIWAFRYSSEGASRSLFFSTDLQTLRELYPENEQIRELDVESRLVVSEPLGDLPGVWNEVPEASYGVIQPGQDEMHPFVPTTDAVPA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
204 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
205 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
206 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
323 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
324 2808606394 Promicromonospora sp. C35 Isolate Unclassified
325 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
326 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
327 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
328 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.13
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 9.69
Rhizosphere 88.29
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0001465 3300037312 Bacteria 20107
2 JGI24737J22298_10037680 3300001990 Bacteria 1489
3 Ga0070658_10015743 3300005327 Bacteria 6047
4 Ga0070658_10178513 3300005327 Bacteria 1786
5 Ga0070683_100007790 3300005329 Bacteria 9069
6 Ga0070683_100069543 3300005329 Bacteria 3283
7 Ga0070683_100128326 3300005329 Bacteria 2399
8 Ga0070690_100013375 3300005330 Bacteria 4846
9 Ga0070690_100133682 3300005330 Bacteria 1678
10 Ga0068869_100085320 3300005334 Bacteria 2365
11 Ga0070680_100333103 3300005336 Bacteria 1289
12 Ga0070682_100002964 3300005337 Bacteria 9420
13 Ga0070682_100595744 3300005337 Bacteria 872
14 Ga0070689_100300981 3300005340 Bacteria 1335
15 Ga0070687_100098048 3300005343 Bacteria 1635
16 Ga0070661_100030031 3300005344 Bacteria 3925
17 Ga0070692_10049385 3300005345 Bacteria 2182
18 Ga0070668_100050405 3300005347 Bacteria 3205
19 Ga0070668_100098809 3300005347 Bacteria 2311
20 Ga0070668_100469552 3300005347 Bacteria 1085
21 Ga0070669_100282723 3300005353 Bacteria 1330
22 Ga0070673_100012935 3300005364 Bacteria 5750
23 Ga0070673_100142675 3300005364 Bacteria 2022
24 Ga0070673_100356176 3300005364 Bacteria 1300
25 Ga0070688_100038602 3300005365 Bacteria 2918
26 Ga0070688_100071960 3300005365 Bacteria 2214
27 Ga0070659_100043969 3300005366 Bacteria 3495
28 Ga0070659_100088679 3300005366 Bacteria 2477
29 Ga0070659_100149215 3300005366 Bacteria 1907
30 Ga0070659_100275814 3300005366 Bacteria 1398
31 Ga0070709_10127745 3300005434 Bacteria 1732
32 Ga0070714_100130732 3300005435 Bacteria 2244
33 Ga0070714_100141222 3300005435 Bacteria 2162
34 Ga0070714_100213349 3300005435 Bacteria 1770
35 Ga0070710_10017156 3300005437 Bacteria 3700
36 Ga0070711_100038243 3300005439 Bacteria 3225
37 Ga0070711_100161526 3300005439 Bacteria 1699
38 Ga0070711_100241815 3300005439 Bacteria 1412
39 Ga0070705_100027660 3300005440 Bacteria 3099
40 Ga0070700_100060207 3300005441 Bacteria 2393
41 Ga0070694_100041209 3300005444 Bacteria 3079
42 Ga0070694_100118076 3300005444 Bacteria 1899
43 Ga0070694_100182178 3300005444 Bacteria 1554
44 Ga0070708_100005227 3300005445 Bacteria 10280
45 Ga0070678_100042660 3300005456 Bacteria 3226
46 Ga0070662_100019408 3300005457 Bacteria 4614
47 Ga0070662_100239719 3300005457 Bacteria 1454
48 Ga0070662_100316470 3300005457 Bacteria 1272
49 Ga0070685_10049834 3300005466 Bacteria 2417
50 Ga0070706_100129698 3300005467 Bacteria 2353
51 Ga0070707_100183598 3300005468 Bacteria 2039
52 Ga0070684_100002606 3300005535 Bacteria 13316
53 Ga0070684_100024457 3300005535 Bacteria 5067
54 Ga0070684_100087361 3300005535 Bacteria 2769
55 Ga0070684_100115184 3300005535 Bacteria 2414
56 Ga0068853_100229882 3300005539 Bacteria 1696
57 Ga0070672_100048923 3300005543 Bacteria 3287
58 Ga0070696_100099751 3300005546 Bacteria 2079
59 Ga0070693_100080118 3300005547 Bacteria 1945
60 Ga0070665_100215942 3300005548 Bacteria 1919
61 Ga0070704_100054820 3300005549 Bacteria 2823
62 Ga0068855_100239103 3300005563 Bacteria 2030
63 Ga0068857_100007505 3300005577 Bacteria 9382
64 Ga0068854_100080723 3300005578 Bacteria 2401
65 Ga0068854_100312114 3300005578 Bacteria 1275
66 Ga0068854_100317532 3300005578 Bacteria 1265
67 Ga0068856_100021396 3300005614 Bacteria 6288
68 Ga0068856_100145936 3300005614 Bacteria 2374
69 Ga0068856_100260068 3300005614 Bacteria 1751
70 Ga0068856_100735224 3300005614 Bacteria 1007
71 Ga0068852_100110710 3300005616 Bacteria 2496
72 Ga0068859_100117355 3300005617 Bacteria 2726
73 Ga0068864_100128119 3300005618 Bacteria 2277
74 Ga0068861_100013200 3300005719 Bacteria 5779
75 Ga0068861_100017053 3300005719 Bacteria 5151
76 Ga0068861_100093597 3300005719 Bacteria 2376
77 Ga0068861_100416085 3300005719 Bacteria 1197
78 Ga0068863_100034347 3300005841 Bacteria 4831
79 Ga0068863_100229875 3300005841 Bacteria 1789
80 Ga0068860_100047755 3300005843 Bacteria 4080
81 Ga0081455_10003312 3300005937 Bacteria 18633
82 Ga0081455_10005672 3300005937 Bacteria 13623
83 Ga0081540_1012151 3300005983 Bacteria 5694
84 Ga0081540_1012499 3300005983 Bacteria 5582
85 Ga0081540_1018916 3300005983 Bacteria 4207
86 Ga0081540_1056135 3300005983 Bacteria 1914
87 Ga0081539_10034701 3300005985 Bacteria 3044
88 Ga0070717_10232972 3300006028 Bacteria 1622
89 Ga0075368_10010991 3300006042 Bacteria 3286
90 Ga0075432_10003179 3300006058 Bacteria 5538
91 Ga0075432_10009129 3300006058 Bacteria 3379
92 Ga0070715_10125562 3300006163 Bacteria 1228
93 Ga0070716_100167470 3300006173 Bacteria 1431
94 Ga0070712_100007109 3300006175 Bacteria 6984
95 Ga0070712_100049752 3300006175 Bacteria 2912
96 Ga0070712_100071680 3300006175 Bacteria 2480
97 Ga0070712_100129175 3300006175 Bacteria 1913
98 Ga0075367_10000127 3300006178 Bacteria 22312
99 Ga0075427_10000746 3300006194 Bacteria 3917
100 Ga0097621_100425993 3300006237 Bacteria 1192
101 Ga0075428_100058792 3300006844 Bacteria 4209
102 Ga0075428_100077313 3300006844 Bacteria 3633
103 Ga0075428_100077957 3300006844 Bacteria 3617
104 Ga0075428_100581615 3300006844 Bacteria 1196
105 Ga0075430_100006466 3300006846 Bacteria 9873
106 Ga0075430_100034253 3300006846 Bacteria 4310
107 Ga0075430_100202754 3300006846 Bacteria 1647
108 Ga0075431_100017064 3300006847 Bacteria 7375
109 Ga0075431_100020320 3300006847 Bacteria 6783
110 Ga0075431_100150144 3300006847 Bacteria 2400
111 Ga0075433_10005658 3300006852 Bacteria 9820
112 Ga0075434_100003843 3300006871 Bacteria 13426
113 Ga0075434_100171205 3300006871 Bacteria 2192
114 Ga0075429_100069739 3300006880 Bacteria 3060
115 Ga0075429_100115886 3300006880 Bacteria 2342
116 Ga0075429_100183473 3300006880 Bacteria 1834
117 Ga0068865_100010528 3300006881 Bacteria 5759
118 Ga0068865_100223563 3300006881 Bacteria 1473
119 Ga0075436_100021504 3300006914 Bacteria 4428
120 Ga0075436_100076848 3300006914 Bacteria 2312
121 Ga0097620_100117350 3300006931 Bacteria 2726
122 Ga0075435_100017672 3300007076 Bacteria 5404
123 Ga0111539_10004429 3300009094 Bacteria 18349
124 Ga0111539_10006657 3300009094 Bacteria 14882
125 Ga0111539_10519891 3300009094 Bacteria 1386
126 Ga0105245_10003498 3300009098 Bacteria 14055
127 Ga0105245_10004959 3300009098 Bacteria 11699
128 Ga0105245_10009422 3300009098 Bacteria 8517
129 Ga0105245_10030070 3300009098 Bacteria 4802
130 Ga0105245_10049735 3300009098 Bacteria 3755
131 Ga0105245_10053555 3300009098 Bacteria 3621
132 Ga0105245_10070022 3300009098 Bacteria 3182
133 Ga0105245_10075688 3300009098 Bacteria 3065
134 Ga0105245_10264872 3300009098 Bacteria 1674
135 Ga0114129_10002442 3300009147 Bacteria 25793
136 Ga0114129_10116558 3300009147 Bacteria 3681
137 Ga0114129_10140917 3300009147 Bacteria 3305
138 Ga0114129_10170295 3300009147 Bacteria 2970
139 Ga0114129_10219464 3300009147 Bacteria 2566
140 Ga0114129_10272190 3300009147 Bacteria 2265
141 Ga0105243_10008596 3300009148 Bacteria 7837
142 Ga0105243_10245396 3300009148 Bacteria 1596
143 Ga0105243_10361432 3300009148 Bacteria 1336
144 Ga0105243_10553918 3300009148 Bacteria 1099
145 Ga0105241_10026812 3300009174 Bacteria 4289
146 Ga0105242_10070593 3300009176 Bacteria 2896
147 Ga0105242_10167761 3300009176 Bacteria 1927
148 Ga0105242_10326781 3300009176 Bacteria 1409
149 Ga0105242_10400145 3300009176 Bacteria 1281
150 Ga0105248_10164830 3300009177 Bacteria 2499
151 Ga0105248_10179747 3300009177 Bacteria 2384
152 Ga0105248_10304569 3300009177 Bacteria 1794
153 Ga0105248_10573591 3300009177 Bacteria 1273
154 Ga0105237_10364398 3300009545 Bacteria 1450
155 Ga0105237_10535619 3300009545 Bacteria 1178
156 Ga0105238_10057804 3300009551 Bacteria 3888
157 Ga0105238_10632839 3300009551 Bacteria 1079
158 Ga0105249_10014389 3300009553 Bacteria 6996
159 Ga0105249_10014923 3300009553 Bacteria 6872
160 Ga0105249_10023359 3300009553 Bacteria 5548
161 Ga0105249_10106663 3300009553 Bacteria 2643
162 Ga0105249_10108974 3300009553 Bacteria 2615
163 Ga0105239_10000854 3300010375 Bacteria 43307
164 Ga0105239_10126266 3300010375 Bacteria 2843
165 Ga0105239_10551954 3300010375 Bacteria 1312
166 Ga0105246_10000321 3300011119 Bacteria 25383
167 Ga0105246_10245237 3300011119 Bacteria 1418
168 Ga0157369_10273107 3300013105 Bacteria 1761
169 Ga0157369_10484608 3300013105 Bacteria 1280
170 Ga0157374_10079468 3300013296 Bacteria 3108
171 Ga0157374_10169153 3300013296 Bacteria 2131
172 Ga0157378_10010899 3300013297 Bacteria 7951
173 Ga0157378_10176142 3300013297 Bacteria 2009
174 Ga0163162_10041769 3300013306 Bacteria 4588
175 Ga0163162_10093000 3300013306 Bacteria 3100
176 Ga0163162_10162043 3300013306 Bacteria 2358
177 Ga0163162_10255562 3300013306 Bacteria 1884
178 Ga0163162_10277297 3300013306 Bacteria 1809
179 Ga0163162_10401614 3300013306 Bacteria 1503
180 Ga0157372_10010217 3300013307 Bacteria 9965
181 Ga0157372_10417211 3300013307 Bacteria 1564
182 Ga0157375_10016368 3300013308 Bacteria 6658
183 Ga0157375_10074964 3300013308 Bacteria 3406
184 Ga0157375_10153844 3300013308 Bacteria 2437
185 Ga0157375_10189535 3300013308 Bacteria 2211
186 Ga0163163_10029804 3300014325 Bacteria 5251
187 Ga0163163_10057048 3300014325 Bacteria 3861
188 Ga0182008_10002142 3300014497 Bacteria 12587
189 Ga0182008_10109282 3300014497 Bacteria 1370
190 Ga0157376_10413138 3300014969 Bacteria 1307
191 Ga0182006_1035134 3300015261 Bacteria 2000
192 Ga0182007_10000163 3300015262 Bacteria 46066
193 Ga0213876_10008277 3300021384 Bacteria 5627
194 Ga0213875_10000921 3300021388 Bacteria 21238
195 Ga0209646_1000168 3300025246 Bacteria 86352
196 Ga0207653_10001294 3300025885 Bacteria 8134
197 Ga0207692_10115783 3300025898 Bacteria 1494
198 Ga0207642_10026636 3300025899 Bacteria 2356
199 Ga0207642_10045572 3300025899 Bacteria 1948
200 Ga0207642_10150544 3300025899 Bacteria 1238
201 Ga0207688_10007114 3300025901 Bacteria 6088
202 Ga0207688_10010141 3300025901 Bacteria 5125
203 Ga0207647_10073819 3300025904 Bacteria 2055
204 Ga0207647_10116650 3300025904 Bacteria 1576
205 Ga0207685_10007674 3300025905 Bacteria 3022
206 Ga0207645_10033502 3300025907 Bacteria 3302
207 Ga0207645_10098316 3300025907 Bacteria 1887
208 Ga0207705_10021619 3300025909 Bacteria 4591
209 Ga0207684_10055388 3300025910 Bacteria 3365
210 Ga0207684_10258388 3300025910 Bacteria 1503
211 Ga0207654_10304327 3300025911 Bacteria 1085
212 Ga0207671_10135497 3300025914 Bacteria 1893
213 Ga0207693_10001310 3300025915 Bacteria 22068
214 Ga0207693_10006783 3300025915 Bacteria 9454
215 Ga0207693_10113464 3300025915 Bacteria 2126
216 Ga0207693_10195113 3300025915 Bacteria 1593
217 Ga0207693_10217057 3300025915 Bacteria 1503
218 Ga0207693_10281846 3300025915 Bacteria 1302
219 Ga0207663_10392415 3300025916 Bacteria 1060
220 Ga0207660_10145178 3300025917 Bacteria 1818
221 Ga0207662_10024759 3300025918 Bacteria 3454
222 Ga0207681_10288804 3300025923 Bacteria 1294
223 Ga0207694_10093370 3300025924 Bacteria 2377
224 Ga0207694_10466132 3300025924 Bacteria 1056
225 Ga0207650_10097661 3300025925 Bacteria 2255
226 Ga0207650_10179036 3300025925 Bacteria 1689
227 Ga0207687_10005902 3300025927 Bacteria 8102
228 Ga0207687_10055633 3300025927 Bacteria 2773
229 Ga0207687_10064731 3300025927 Bacteria 2594
230 Ga0207687_10095551 3300025927 Bacteria 2177
231 Ga0207687_10102709 3300025927 Bacteria 2107
232 Ga0207687_10199900 3300025927 Bacteria 1561
233 Ga0207700_10075115 3300025928 Bacteria 2618
234 Ga0207664_10065712 3300025929 Bacteria 2905
235 Ga0207664_10400600 3300025929 Bacteria 1220
236 Ga0207664_10532698 3300025929 Bacteria 1053
237 Ga0207690_10014172 3300025932 Bacteria 4810
238 Ga0207690_10015756 3300025932 Bacteria 4587
239 Ga0207706_10004454 3300025933 Bacteria 13160
240 Ga0207706_10017762 3300025933 Bacteria 6406
241 Ga0207706_10170035 3300025933 Bacteria 1915
242 Ga0207686_10094288 3300025934 Bacteria 1984
243 Ga0207709_10013760 3300025935 Bacteria 4465
244 Ga0207709_10044552 3300025935 Bacteria 2682
245 Ga0207670_10458924 3300025936 Unclassified 1028
246 Ga0207669_10005135 3300025937 Bacteria 5837
247 Ga0207669_10041197 3300025937 Bacteria 2686
248 Ga0207704_10027547 3300025938 Bacteria 3138
249 Ga0207704_10151319 3300025938 Bacteria 1638
250 Ga0207704_10370740 3300025938 Bacteria 1121
251 Ga0207665_10048820 3300025939 Bacteria 2843
252 Ga0207665_10059630 3300025939 Bacteria 2583
253 Ga0207691_10017500 3300025940 Bacteria 6795
254 Ga0207711_10095814 3300025941 Bacteria 2618
255 Ga0207711_10101337 3300025941 Bacteria 2548
256 Ga0207711_10179643 3300025941 Bacteria 1924
257 Ga0207689_10031027 3300025942 Bacteria 4452
258 Ga0207689_10076687 3300025942 Bacteria 2748
259 Ga0207661_10005367 3300025944 Bacteria 9032
260 Ga0207661_10042996 3300025944 Bacteria 3565
261 Ga0207661_10177937 3300025944 Bacteria 1856
262 Ga0207661_10183905 3300025944 Bacteria 1828
263 Ga0207679_10156448 3300025945 Bacteria 1862
264 Ga0207667_10200935 3300025949 Bacteria 2045
265 Ga0207651_10093427 3300025960 Bacteria 2209
266 Ga0207712_10012362 3300025961 Bacteria 5453
267 Ga0207712_10035420 3300025961 Bacteria 3391
268 Ga0207712_10111019 3300025961 Bacteria 2057
269 Ga0207712_10379420 3300025961 Bacteria 1183
270 Ga0207712_10514605 3300025961 Bacteria 1025
271 Ga0207668_10058310 3300025972 Bacteria 2698
272 Ga0207640_10083172 3300025981 Bacteria 2194
273 Ga0207640_10098816 3300025981 Bacteria 2041
274 Ga0207640_10137685 3300025981 Bacteria 1775
275 Ga0207677_10023102 3300026023 Bacteria 3834
276 Ga0207703_10052048 3300026035 Bacteria 3323
277 Ga0207678_10180586 3300026067 Bacteria 1802
278 Ga0207708_10025382 3300026075 Bacteria 4482
279 Ga0207702_10014846 3300026078 Bacteria 6461
280 Ga0207641_10015911 3300026088 Bacteria 6160
281 Ga0207648_10503181 3300026089 Bacteria 1109
282 Ga0207676_10127424 3300026095 Bacteria 2158
283 Ga0207674_10012449 3300026116 Bacteria 9507
284 Ga0207675_100001735 3300026118 Bacteria 21823
285 Ga0207675_100004766 3300026118 Bacteria 13066
286 Ga0207675_100007749 3300026118 Bacteria 10132
287 Ga0207683_10011380 3300026121 Bacteria 7592
288 Ga0207683_10029097 3300026121 Bacteria 4782
289 Ga0207698_10058706 3300026142 Bacteria 2983
290 Ga0207698_10151249 3300026142 Bacteria 2015
291 Ga0207698_10250421 3300026142 Bacteria 1620
292 Ga0207698_10282912 3300026142 Bacteria 1535
293 Ga0209813_10000869 3300027866 Bacteria 6805
294 Ga0207428_10003189 3300027907 Bacteria 16058
295 Ga0207428_10003628 3300027907 Bacteria 14881
296 Ga0207428_10019096 3300027907 Bacteria 5846
297 Ga0268266_10242124 3300028379 Bacteria 1665
298 Ga0268266_10423242 3300028379 Bacteria 1262
299 Ga0268265_10086911 3300028380 Bacteria 2486
300 Ga0268264_10118767 3300028381 Bacteria 2327
301 Ga0265338_10014450 3300028800 Bacteria 8787
302 Ga0265338_10085651 3300028800 Unclassified 2626
303 Ga0265762_1015481 3300030760 Bacteria 1380
304 Ga0265327_10007811 3300031251 Bacteria 8145
305 Ga0265327_10016221 3300031251 Bacteria 4749
306 Ga0307513_10000392 3300031456 Bacteria 63905
307 Ga0316576_10011298 3300031727 Bacteria 5846
308 Ga0316576_10169774 3300031727 Unclassified 1646
309 Ga0316578_10242200 3300031728 Bacteria 1083
310 Ga0307405_10002150 3300031731 Bacteria 8601
311 Ga0307405_10021265 3300031731 Bacteria 3643
312 Ga0307405_10186955 3300031731 Bacteria 1492
313 Ga0307405_10241731 3300031731 Bacteria 1338
314 Ga0307405_10455273 3300031731 Bacteria 1016
315 Ga0307406_10012752 3300031901 Bacteria 4796
316 Ga0307406_10086920 3300031901 Bacteria 2095
317 Ga0307406_10178989 3300031901 Bacteria 1542
318 Ga0307406_10184961 3300031901 Bacteria 1520
319 Ga0307406_10231244 3300031901 Bacteria 1381
320 Ga0307407_10090711 3300031903 Bacteria 1872
321 Ga0307412_10096572 3300031911 Bacteria 2080
322 Ga0307409_100004005 3300031995 Bacteria 8172
323 Ga0307409_100041099 3300031995 Bacteria 3450
324 Ga0307409_100131744 3300031995 Bacteria 2138
325 Ga0307409_100242774 3300031995 Bacteria 1641
326 Ga0307409_100279438 3300031995 Bacteria 1542
327 Ga0307416_100002457 3300032002 Bacteria 10647
328 Ga0307416_100009077 3300032002 Bacteria 6475
329 Ga0307416_100048195 3300032002 Bacteria 3378
330 Ga0307416_100249221 3300032002 Bacteria 1727
331 Ga0307416_100344430 3300032002 Bacteria 1505
332 Ga0307416_100375876 3300032002 Bacteria 1449
333 Ga0307416_100453044 3300032002 Bacteria 1336
334 Ga0307416_100493537 3300032002 Bacteria 1287
335 Ga0307416_100495668 3300032002 Bacteria 1285
336 Ga0307414_10088700 3300032004 Bacteria 2290
337 Ga0307411_10163791 3300032005 Bacteria 1669
338 Ga0307415_100002675 3300032126 Bacteria 8897
339 Ga0307415_100003274 3300032126 Bacteria 8234
340 Ga0307415_100007140 3300032126 Bacteria 6085
341 Ga0307415_100009591 3300032126 Bacteria 5438
342 Ga0307415_100042158 3300032126 Bacteria 3036
343 Ga0307415_100352964 3300032126 Bacteria 1239
344 Ga0307415_100411688 3300032126 Bacteria 1157
345 Ga0373959_0008840 3300034820 Bacteria 1724
346 Ga0373929_0000928 3300035085 Bacteria 5708
347 Ga0373940_0015857 3300035088 Bacteria 1859
348 Ga0373944_0031380 3300035089 Bacteria 1599
349 Ga0373949_0001204 3300035090 Bacteria 7670
350 Ga0373952_0038047 3300035092 Bacteria 1100
351 Ga0373936_0039959 3300035113 Bacteria 1878
352 Ga0373939_0004523 3300035114 Bacteria 3293
353 Ga0373945_0007337 3300035116 Bacteria 3574
354 Ga0373945_0051386 3300035116 Bacteria 1516
355 Ga0373953_0184586 3300035117 Bacteria 900
356 Ga0373960_0058681 3300035121 Bacteria 1161
357 Ga0373943_0001983 3300035170 Bacteria 9262
358 Ga0373943_0012303 3300035170 Bacteria 3850
359 Ga0373946_0000906 3300035171 Bacteria 10185
360 Ga0373946_0040522 3300035171 Bacteria 1906
361 Ga0373955_0023622 3300035172 Bacteria 3134
362 Ga0373961_0021857 3300035241 Bacteria 1706
363 Ga0316574_0038113 3300035398 Bacteria 2950
364 Ga0316574_0039393 3300035398 Bacteria 2905
365 Ga0316574_0047448 3300035398 Bacteria 2666
366 Ga0373931_0008048 3300035691 Bacteria 4987
367 Ga0373935_0032625 3300035692 Bacteria 3236
368 Ga0373935_0040222 3300035692 Bacteria 2934
369 Ga0373933_0082791 3300035724 Bacteria 1970
370 Ga0373947_0000222 3300035725 Bacteria 31904
371 Ga0373947_0007840 3300035725 Bacteria 6167
372 Ga0373947_0315314 3300035725 Bacteria 1045
373 Ga0373937_0092226 3300036401 Bacteria 2807
374 Ga0373925_0025252 3300037068 Bacteria 4339
375 Ga0373925_0061548 3300037068 Bacteria 2820
376 Ga0395899_0005147 3300037312 Bacteria 10171
377 Ga0395899_0043233 3300037312 Bacteria 3361
378 Ga0395899_0064623 3300037312 Bacteria 2690
379 Ga0395899_0193598 3300037312 Bacteria 1422
380 Ga0395899_0196161 3300037312 Bacteria 1410
381 Ga0395900_0001887 3300037418 Bacteria 23840
382 Ga0395900_0011765 3300037418 Bacteria 8948
383 Ga0395900_0013600 3300037418 Bacteria 8312
384 Ga0395900_0018292 3300037418 Bacteria 7148
385 Ga0395900_0325652 3300037418 Bacteria 1516
386 Ga0395900_0445093 3300037418 Bacteria 1252
387 Ga0395900_0507850 3300037418 Bacteria 1155
388 Ga0395898_0008507 3300037466 Bacteria 10843
389 Ga0395898_0013578 3300037466 Bacteria 8382
390 Ga0395898_0014671 3300037466 Bacteria 8045
391 Ga0395898_0082914 3300037466 Bacteria 3090
392 Ga0395898_0369246 3300037466 Bacteria 1368
393 Ga0395905_0008061 3300037471 Bacteria 10404
394 Ga0395905_0029779 3300037471 Bacteria 5145
395 Ga0395905_0084695 3300037471 Bacteria 2970
396 Ga0395905_0167656 3300037471 Bacteria 2063
397 Ga0436364_0295501 3300037853 Bacteria 13593
398 Ga0395901_0002672 3300038443 Bacteria 17998
399 Ga0395901_0011319 3300038443 Bacteria 9038
400 Ga0395901_0014454 3300038443 Bacteria 8031
401 Ga0395901_0040568 3300038443 Bacteria 4822
402 Ga0395901_0128920 3300038443 Bacteria 2659
403 Ga0395901_0158657 3300038443 Bacteria 2376
404 Ga0436365_0019774 3300039437 Bacteria 20670
405 Ga0439436_0009403 3300041404 Bacteria 2997
406 Ga0451800_0708492 3300041459 Bacteria 2492
407 Ga0451835_0995502 3300041492 Bacteria 2281
408 Ga0451853_1140793 3300041512 Bacteria 4419
409 Ga0439448_0008497 3300042005 Bacteria 3007
410 Ga0439450_000063 3300042008 Bacteria 9955
411 Ga0439455_0013568 3300042012 Bacteria 1847
412 Ga0439457_003162 3300042014 Bacteria 4543
413 Ga0439463_000141 3300042016 Bacteria 18284
414 Ga0450914_000726 3300042118 Bacteria 1735
415 Ga0450915_000292 3300042119 Bacteria 1636
416 Ga0450900_004860 3300042136 Bacteria 1564
417 Ga0439458_0011472 3300042157 Bacteria 1982
418 Ga0450909_008199 3300042185 Bacteria 1517
419 Ga0439435_0064674 3300042436 Bacteria 1072
420 Ga0439444_0000359 3300042437 Bacteria 4872
421 Ga0439464_0005081 3300042439 Bacteria 3386
422 Ga0439460_0000688 3300042461 Bacteria 7490
423 Ga0439460_0010487 3300042461 Bacteria 2373
424 Ga0439440_0000076 3300042993 Bacteria 12427
425 Ga0466969_0090602 3300044656 Bacteria 1449
426 Ga0466965_0084440 3300044683 Bacteria 1608
427 Ga0466966_0134286 3300044684 Bacteria 1514
428 Ga0466963_0011149 3300044694 Bacteria 5468
429 Ga0466959_0295416 3300045049 Bacteria 1110
430 Ga0451576_0091689 3300045051 Bacteria 3161
431 Ga0466967_0001726 3300045976 Bacteria 13025
432 Ga0466967_0002670 3300045976 Bacteria 11254
433 Ga0495592_0139865 3300046454 Bacteria 1685
434 Ga0495592_0200987 3300046454 Bacteria 1345
435 Ga0495603_0007444 3300046455 Bacteria 6584
436 Ga0495603_0159256 3300046455 Bacteria 1310
437 Ga0495629_0000214 3300046459 Bacteria 52123
438 Ga0495641_0000795 3300046461 Bacteria 26778
439 Ga0495641_0011242 3300046461 Bacteria 5119
440 Ga0495651_0025628 3300046462 Bacteria 4592
441 Ga0495651_0053561 3300046462 Bacteria 3105
442 Ga0495582_0000389 3300046473 Bacteria 23879
443 Ga0495582_0143336 3300046473 Bacteria 1355
444 Ga0495582_0145990 3300046473 Bacteria 1342
445 Ga0495639_0011451 3300046475 Bacteria 3824
446 Ga0495662_0001778 3300046476 Bacteria 10785
447 Ga0495664_0183449 3300046477 Bacteria 1269
448 Ga0495608_0018463 3300046511 Bacteria 4810
449 Ga0495608_0042456 3300046511 Bacteria 3041
450 Ga0495616_0109872 3300046513 Bacteria 1282
451 Ga0495618_0112034 3300046514 Bacteria 1747
452 Ga0495630_0080335 3300046517 Bacteria 2459
453 Ga0495630_0181401 3300046517 Bacteria 1605
454 Ga0495644_0066990 3300046523 Bacteria 1349
455 Ga0495663_0015632 3300046525 Bacteria 2139
456 Ga0495652_0167729 3300046529 Bacteria 1697
457 Ga0495640_0011559 3300046533 Bacteria 6787
458 Ga0495587_0012552 3300046536 Bacteria 5327
459 Ga0495587_0111034 3300046536 Bacteria 1575
460 Ga0495621_0008214 3300046539 Bacteria 3121
461 Ga0495645_0129003 3300046543 Bacteria 1774
462 Ga0495667_0046189 3300046559 Bacteria 2880
463 Ga0495667_0122127 3300046559 Bacteria 1681
464 Ga0495667_0210350 3300046559 Bacteria 1243
465 Ga0495656_0024211 3300046615 Bacteria 2395
466 Ga0495656_0168679 3300046615 Unclassified 1069
467 Ga0495634_0027180 3300046642 Bacteria 3982
468 Ga0495634_0074471 3300046642 Bacteria 2231
469 Ga0495611_0056852 3300046648 Bacteria 1772
470 Ga0495635_0008410 3300046663 Bacteria 7203
471 Ga0495635_0064663 3300046663 Bacteria 2511
472 Ga0495657_0072414 3300046675 Bacteria 2247
473 Ga0495623_0034884 3300046679 Bacteria 3225
474 Ga0495623_0068429 3300046679 Bacteria 2215
475 Ga0495647_0006683 3300046681 Bacteria 3834
476 Ga0495647_0163611 3300046681 Bacteria 960
477 Ga0495658_0043129 3300046683 Bacteria 2521
478 Ga0495658_0064288 3300046683 Bacteria 2113
479 Ga0495658_0272666 3300046683 Bacteria 1067
480 Ga0495613_0011809 3300046689 Bacteria 6487
481 Ga0495613_0263903 3300046689 Bacteria 1199
482 Ga0495624_0045099 3300046690 Bacteria 2808
483 Ga0495589_0152536 3300046794 Bacteria 1103
484 Ga0495600_0005394 3300046809 Bacteria 7709
485 Ga0495581_0001758 3300047315 Bacteria 12088
486 Ga0495604_0129753 3300047317 Bacteria 1813
487 Ga0495674_0011290 3300047319 Bacteria 8432
488 Ga0495676_0015151 3300047321 Bacteria 6878
489 Ga0495676_0041943 3300047321 Bacteria 3762
490 Ga0495676_0085237 3300047321 Bacteria 2381
491 Ga0495676_0124080 3300047321 Bacteria 1874
492 Ga0495676_0264688 3300047321 Bacteria 1169
493 Ga0495680_0000519 3300047322 Bacteria 43595
494 Ga0495680_0008616 3300047322 Bacteria 9258
495 Ga0495680_0009668 3300047322 Bacteria 8652
496 Ga0495680_0027614 3300047322 Bacteria 4660
497 Ga0495675_0019865 3300047444 Bacteria 4269
498 Ga0495684_0008163 3300047471 Bacteria 8099
499 Ga0495684_0019284 3300047471 Bacteria 5251
500 Ga0495684_0150918 3300047471 Bacteria 1737
501 Ga0495593_0052305 3300047673 Bacteria 2159
502 Ga0495593_0135290 3300047673 Bacteria 1250
503 Ga0496100_0007047 3300048903 Bacteria 6168
504 Ga0496100_0039628 3300048903 Bacteria 2992
505 Ga0496100_0230407 3300048903 Bacteria 1363
506 Ga0496100_0576410 3300048903 Bacteria 872
507 Ga0496101_0007021 3300048904 Bacteria 7277
508 Ga0496101_0012587 3300048904 Bacteria 5649
509 Ga0496101_0100241 3300048904 Bacteria 2166
510 Ga0496101_0193959 3300048904 Bacteria 1568
511 Ga0496101_0236237 3300048904 Bacteria 1422
512 Ga0496101_0295936 3300048904 Bacteria 1267
513 Ga0496101_0336184 3300048904 Bacteria 1186
514 Ga0496101_0436781 3300048904 Bacteria 1032
515 Ga0496102_0004167 3300048905 Bacteria 12236
516 Ga0496102_0021504 3300048905 Bacteria 5706
517 Ga0496102_0099599 3300048905 Bacteria 2698
518 Ga0496104_0000921 3300048907 Bacteria 25212
519 Ga0496104_0039575 3300048907 Bacteria 4414
520 Ga0496104_0115337 3300048907 Bacteria 2577
521 Ga0496104_0156730 3300048907 Bacteria 2185
522 Ga0496104_0195399 3300048907 Bacteria 1935
523 Ga0496104_0246932 3300048907 Bacteria 1698
524 Ga0496105_0011698 3300048908 Bacteria 6942
525 Ga0496105_0013191 3300048908 Bacteria 6555
526 Ga0496105_0140701 3300048908 Bacteria 1986
527 Ga0496105_0232634 3300048908 Bacteria 1497
528 Ga0496106_0030633 3300048909 Bacteria 4010
529 Ga0496106_0039567 3300048909 Bacteria 3531
530 Ga0496106_0081536 3300048909 Bacteria 2486
531 Ga0496107_0013656 3300048910 Bacteria 5678
532 Ga0496107_0043112 3300048910 Bacteria 3241
533 Ga0496107_0080534 3300048910 Bacteria 2375
534 Ga0496107_0164230 3300048910 Bacteria 1646
535 Ga0496108_0002495 3300048911 Bacteria 14728
536 Ga0496108_0043315 3300048911 Bacteria 3760
537 Ga0496108_0155994 3300048911 Bacteria 1971
538 Ga0496109_0005924 3300048912 Bacteria 10257
539 Ga0496109_0008723 3300048912 Bacteria 8633
540 Ga0496109_0031853 3300048912 Bacteria 4736
541 Ga0496109_0248645 3300048912 Bacteria 1674
542 Ga0496110_0005696 3300048913 Bacteria 9784
543 Ga0496110_0043298 3300048913 Bacteria 3931
544 Ga0496110_0237498 3300048913 Bacteria 1658
545 Ga0496110_0356125 3300048913 Bacteria 1333
546 Ga0496110_0367716 3300048913 Bacteria 1310
547 Ga0496110_0410042 3300048913 Bacteria 1235
548 Ga0496110_0543341 3300048913 Bacteria 1056
549 Ga0496111_0015454 3300048914 Bacteria 5241
550 Ga0496111_0016621 3300048914 Bacteria 5073
551 Ga0496111_0041879 3300048914 Bacteria 3288
552 Ga0496111_0048134 3300048914 Bacteria 3072
553 Ga0496111_0123226 3300048914 Bacteria 1915
554 Ga0496111_0508569 3300048914 Bacteria 886
555 Ga0496112_0000998 3300048915 Bacteria 20731
556 Ga0496112_0002635 3300048915 Bacteria 14499
557 Ga0496112_0037461 3300048915 Bacteria 4733
558 Ga0496112_0560780 3300048915 Bacteria 1076
559 Ga0496113_0002742 3300048916 Bacteria 10355
560 Ga0496113_0407486 3300048916 Bacteria 1092
561 Ga0496114_0015313 3300048917 Bacteria 6165
562 Ga0496114_0041450 3300048917 Bacteria 3816
563 Ga0496114_0051296 3300048917 Bacteria 3435
564 Ga0496114_0066961 3300048917 Bacteria 3012
565 Ga0496114_0079857 3300048917 Bacteria 2762
566 Ga0496114_0099380 3300048917 Bacteria 2482
567 Ga0496114_0141495 3300048917 Bacteria 2083
568 Ga0496114_0150832 3300048917 Bacteria 2017
569 Ga0496115_0005039 3300048918 Bacteria 9598
570 Ga0496115_0021730 3300048918 Bacteria 4961
571 Ga0496115_0104947 3300048918 Bacteria 2319
572 Ga0496115_0197155 3300048918 Bacteria 1664
573 Ga0496115_0461675 3300048918 Bacteria 1024
574 Ga0501031_0004169 3300049568 Bacteria 9338
575 Ga0501031_0007447 3300049568 Bacteria 7129
576 Ga0501031_0015950 3300049568 Bacteria 4877
577 Ga0501031_0220168 3300049568 Bacteria 1236
578 Ga0501032_0037047 3300049569 Bacteria 3327
579 Ga0501032_0098357 3300049569 Bacteria 1939
580 Ga0501032_0172408 3300049569 Bacteria 1418
581 Ga0501033_0001873 3300049570 Bacteria 18293
582 Ga0501033_0039695 3300049570 Bacteria 3516
583 Ga0501036_0000538 3300049572 Bacteria 27128
584 Ga0501036_0000787 3300049572 Bacteria 23494
585 Ga0501036_0010571 3300049572 Bacteria 7625
586 Ga0501036_0011055 3300049572 Bacteria 7463
587 Ga0501036_0143968 3300049572 Bacteria 2011
588 Ga0501037_0010194 3300049573 Bacteria 6892
589 Ga0501037_0022267 3300049573 Bacteria 4688
590 Ga0501037_0033494 3300049573 Bacteria 3793
591 Ga0501037_0097890 3300049573 Bacteria 2119
592 Ga0501038_0002433 3300049574 Bacteria 17334
593 Ga0501038_0002454 3300049574 Bacteria 17276
594 Ga0501038_0008663 3300049574 Bacteria 9343
595 Ga0501038_0216373 3300049574 Bacteria 1531
596 Ga0501038_0531264 3300049574 Bacteria 897
597 Ga0501039_0002345 3300049575 Bacteria 14086
598 Ga0501039_0002478 3300049575 Bacteria 13750
599 Ga0501039_0012574 3300049575 Bacteria 6468
600 Ga0501039_0017994 3300049575 Bacteria 5420
601 Ga0501040_0001578 3300049576 Bacteria 14518
602 Ga0501040_0020050 3300049576 Bacteria 4453
603 Ga0501040_0028765 3300049576 Bacteria 3747
604 Ga0501040_0065718 3300049576 Bacteria 2498
605 Ga0501041_0000374 3300049577 Bacteria 22334
606 Ga0501041_0001907 3300049577 Bacteria 11681
607 Ga0501041_0004851 3300049577 Bacteria 7817
608 Ga0501041_0046712 3300049577 Bacteria 2634
609 Ga0501041_0198212 3300049577 Bacteria 1258
610 Ga0501041_0287903 3300049577 Bacteria 1034
611 Ga0501042_0001590 3300049578 Bacteria 13487
612 Ga0501042_0003308 3300049578 Bacteria 10084
613 Ga0501042_0431433 3300049578 Bacteria 955
614 Ga0501043_0019361 3300049579 Bacteria 5344
615 Ga0501043_0023348 3300049579 Bacteria 4851
616 Ga0501046_0003448 3300049580 Bacteria 14511
617 Ga0501046_0008214 3300049580 Bacteria 9115
618 Ga0501046_0052538 3300049580 Bacteria 3211
619 Ga0501047_0107379 3300049581 Bacteria 2673
620 Ga0501048_0000098 3300049582 Bacteria 47500
621 Ga0501048_0000481 3300049582 Bacteria 27939
622 Ga0501048_0003830 3300049582 Bacteria 11473
623 Ga0501048_0101152 3300049582 Bacteria 2033
624 Ga0501048_0438988 3300049582 Bacteria 934
625 Ga0501068_0002427 3300049584 Bacteria 9891
626 Ga0501068_0023466 3300049584 Bacteria 3615
627 Ga0501069_0000057 3300049585 Bacteria 64652
628 Ga0501070_0001915 3300049586 Bacteria 18377
629 Ga0501070_0034064 3300049586 Bacteria 4260
630 Ga0501071_0000131 3300049587 Bacteria 30323
631 Ga0501071_0004254 3300049587 Bacteria 9068
632 Ga0501071_0032632 3300049587 Bacteria 3699
633 Ga0501071_0040430 3300049587 Bacteria 3336
634 Ga0501071_0061919 3300049587 Bacteria 2710
635 Ga0501072_0000411 3300049588 Bacteria 30561
636 Ga0501072_0011944 3300049588 Bacteria 6632
637 Ga0501072_0057109 3300049588 Bacteria 3075
638 Ga0501072_0153808 3300049588 Bacteria 1834
639 Ga0501072_0164108 3300049588 Bacteria 1772
640 Ga0501073_0001913 3300049589 Bacteria 15506
641 Ga0501073_0043620 3300049589 Bacteria 3163
642 Ga0501074_0001213 3300049590 Bacteria 16973
643 Ga0501074_0003268 3300049590 Bacteria 11455
644 Ga0501074_0015737 3300049590 Bacteria 5499
645 Ga0501074_0074727 3300049590 Bacteria 2433
646 Ga0501074_0352239 3300049590 Bacteria 1045
647 Ga0501075_0000514 3300049591 Bacteria 23371
648 Ga0501075_0012860 3300049591 Bacteria 5959
649 Ga0501075_0016678 3300049591 Bacteria 5297
650 Ga0501075_0241482 3300049591 Bacteria 1377
651 Ga0501076_0000661 3300049592 Bacteria 22080
652 Ga0501076_0001524 3300049592 Bacteria 15521
653 Ga0501076_0018619 3300049592 Bacteria 5297
654 Ga0501076_0046936 3300049592 Bacteria 3413
655 Ga0501076_0156841 3300049592 Bacteria 1853
656 Ga0501077_0007978 3300049593 Bacteria 6544
657 Ga0501077_0009989 3300049593 Bacteria 5906
658 Ga0501077_0024744 3300049593 Bacteria 3812
659 Ga0501077_0040937 3300049593 Bacteria 2950
660 Ga0501077_0074730 3300049593 Bacteria 2146
661 Ga0501079_0002022 3300049741 Bacteria 14514
662 Ga0501079_0004369 3300049741 Bacteria 10477
663 Ga0501079_0025195 3300049741 Bacteria 4562
664 Ga0501079_0034208 3300049741 Bacteria 3910
665 Ga0501080_0024241 3300049742 Bacteria 5625
666 Ga0501080_0060606 3300049742 Bacteria 3523
667 Ga0501081_0000176 3300049743 Bacteria 30222
668 Ga0501081_0001624 3300049743 Bacteria 13892
669 Ga0501081_0006158 3300049743 Bacteria 7770
670 Ga0501083_0005857 3300049744 Bacteria 8700
671 Ga0501083_0133204 3300049744 Bacteria 1629
672 Ga0501035_0002693 3300049822 Bacteria 17280
673 Ga0501035_0015152 3300049822 Bacteria 7116
674 Ga0501035_0062613 3300049822 Bacteria 3310
675 Ga0501035_0114846 3300049822 Bacteria 2357
676 Ga0501044_0015084 3300049823 Bacteria 8326
677 Ga0501044_0130533 3300049823 Bacteria 2507
678 Ga0501045_0001824 3300049824 Bacteria 14375
679 Ga0501045_0005852 3300049824 Bacteria 8509
680 Ga0501045_0010082 3300049824 Bacteria 6609
681 Ga0501045_0073215 3300049824 Bacteria 2522
682 Ga0501045_0077872 3300049824 Bacteria 2444
683 Ga0501045_0193193 3300049824 Bacteria 1517
684 nmdc:mga05p37_132299_c1 3300050507 Bacteria 3061
685 nmdc:mga05p37_161335_c1 3300050507 Bacteria 2738
686 nmdc:mga05p37_181668_c1 3300050507 Bacteria 2559
687 nmdc:mga05p37_514848_c1 3300050507 Bacteria 1370
688 nmdc:mga05p37_7880_c1 3300050507 Bacteria 12571
689 nmdc:mga09592_115313_c1 3300050508 Bacteria 2306
690 nmdc:mga09592_28356_c1 3300050508 Bacteria 4651
691 nmdc:mga09592_481568_c1 3300050508 Bacteria 1069
692 nmdc:mga09592_73566_c1 3300050508 Bacteria 2904
693 nmdc:mga0qj67_15563_c1 3300050509 Bacteria 5759
694 nmdc:mga0qj67_226027_c1 3300050509 Bacteria 1519
695 nmdc:mga0qj67_27078_c1 3300050509 Bacteria 4441
696 nmdc:mga06r32_234787_c1 3300050510 Bacteria 1822
697 nmdc:mga06r32_55835_c1 3300050510 Bacteria 3789
698 nmdc:mga06r32_7763_c1 3300050510 Bacteria 9645
699 nmdc:mga08y16_129137_c1 3300050511 Bacteria 2629
700 nmdc:mga08y16_154366_c1 3300050511 Bacteria 2386
701 nmdc:mga08y16_172211_c1 3300050511 Bacteria 2249
702 nmdc:mga08y16_387127_c1 3300050511 Bacteria 1433
703 nmdc:mga08y16_44675_c1 3300050511 Bacteria 4643
704 nmdc:mga0n895_175314_c1 3300050512 Bacteria 2175
705 nmdc:mga0n895_187916_c1 3300050512 Bacteria 2097
706 nmdc:mga0n895_31890_c1 3300050512 Bacteria 5052
707 nmdc:mga0n895_6658_c1 3300050512 Bacteria 9846
708 nmdc:mga0rr50_351859_c1 3300050513 Bacteria 1239
709 nmdc:mga0rr50_61963_c1 3300050513 Bacteria 2820
710 nmdc:mga08x19_11682_c1 3300050514 Bacteria 5288
711 nmdc:mga0a205_13461_c1 3300050515 Bacteria 7615
712 nmdc:mga0a205_6619_c2 3300050515 Bacteria 5956
713 Ga0495601_0027475 3300053077 Bacteria 3518
714 Ga0495601_0167993 3300053077 Bacteria 1433
715 Ga0495601_0329848 3300053077 Bacteria 993
716 Ga0495595_0026888 3300053084 Bacteria 2559
717 Ga0495595_0150175 3300053084 Bacteria 1146
718 Ga0495619_0001579 3300053085 Bacteria 14982
719 Ga0495619_0002099 3300053085 Bacteria 13226
720 Ga0495619_0081954 3300053085 Bacteria 2173
721 Ga0501084_0000414 3300054114 Bacteria 33024
722 Ga0501084_0004136 3300054114 Bacteria 11824
723 Ga0501084_0075829 3300054114 Bacteria 2817
724 Ga0501084_0135921 3300054114 Bacteria 2069
725 Ga0501084_0332480 3300054114 Bacteria 1283
726 Ga0501082_0003100 3300060353 Bacteria 14482
727 Ga0501082_0036561 3300060353 Bacteria 4230
728 Ga0501082_0060115 3300060353 Bacteria 3273
729 Ga0501082_0069151 3300060353 Bacteria 3040
730 Ga0501082_0406078 3300060353 Bacteria 1189
731 Ga0530510_0000576 3300061734 Bacteria 23667
732 Ga0530510_0007084 3300061734 Bacteria 7803
733 Ga0530510_0013764 3300061734 Bacteria 5695
734 Ga0530510_0047826 3300061734 Bacteria 3091
735 Ga0530510_0105244 3300061734 Bacteria 2065
736 Ga0530510_0118183 3300061734 Bacteria 1945
737 Ga0530510_0306551 3300061734 Bacteria 1189
738 2785339372 2784746763 Bacteria 9783172
739 2809026195 2808606394 Bacteria 6248540
740 2812374828 2811994882 Bacteria 4688362
741 2954004277 2954002825 Bacteria 9173742
742 3006497655 3006493962 Bacteria 8825450
743 8048411286 8048406513 Bacteria 8936924
744 Ga0395899_0001465
745 JGI24737J22298_10037680
746 Ga0070658_10015743
747 Ga0070658_10178513
748 Ga0070683_100007790
749 Ga0070683_100069543
750 Ga0070683_100128326
751 Ga0070690_100013375
752 Ga0070690_100133682
753 Ga0068869_100085320
754 Ga0070680_100333103
755 Ga0070682_100002964
756 Ga0070682_100595744
757 Ga0070689_100300981
758 Ga0070687_100098048
759 Ga0070661_100030031
760 Ga0070692_10049385
761 Ga0070668_100050405
762 Ga0070668_100098809
763 Ga0070668_100469552
764 Ga0070669_100282723
765 Ga0070673_100012935
766 Ga0070673_100142675
767 Ga0070673_100356176
768 Ga0070688_100038602
769 Ga0070688_100071960
770 Ga0070659_100043969
771 Ga0070659_100088679
772 Ga0070659_100149215
773 Ga0070659_100275814
774 Ga0070709_10127745
775 Ga0070714_100130732
776 Ga0070714_100141222
777 Ga0070714_100213349
778 Ga0070710_10017156
779 Ga0070711_100038243
780 Ga0070711_100161526
781 Ga0070711_100241815
782 Ga0070705_100027660
783 Ga0070700_100060207
784 Ga0070694_100041209
785 Ga0070694_100118076
786 Ga0070694_100182178
787 Ga0070708_100005227
788 Ga0070678_100042660
789 Ga0070662_100019408
790 Ga0070662_100239719
791 Ga0070662_100316470
792 Ga0070685_10049834
793 Ga0070706_100129698
794 Ga0070707_100183598
795 Ga0070684_100002606
796 Ga0070684_100024457
797 Ga0070684_100087361
798 Ga0070684_100115184
799 Ga0068853_100229882
800 Ga0070672_100048923
801 Ga0070696_100099751
802 Ga0070693_100080118
803 Ga0070665_100215942
804 Ga0070704_100054820
805 Ga0068855_100239103
806 Ga0068857_100007505
807 Ga0068854_100080723
808 Ga0068854_100312114
809 Ga0068854_100317532
810 Ga0068856_100021396
811 Ga0068856_100145936
812 Ga0068856_100260068
813 Ga0068856_100735224
814 Ga0068852_100110710
815 Ga0068859_100117355
816 Ga0068864_100128119
817 Ga0068861_100013200
818 Ga0068861_100017053
819 Ga0068861_100093597
820 Ga0068861_100416085
821 Ga0068863_100034347
822 Ga0068863_100229875
823 Ga0068860_100047755
824 Ga0081455_10003312
825 Ga0081455_10005672
826 Ga0081540_1012151
827 Ga0081540_1012499
828 Ga0081540_1018916
829 Ga0081540_1056135
830 Ga0081539_10034701
831 Ga0070717_10232972
832 Ga0075368_10010991
833 Ga0075432_10003179
834 Ga0075432_10009129
835 Ga0070715_10125562
836 Ga0070716_100167470
837 Ga0070712_100007109
838 Ga0070712_100049752
839 Ga0070712_100071680
840 Ga0070712_100129175
841 Ga0075367_10000127
842 Ga0075427_10000746
843 Ga0097621_100425993
844 Ga0075428_100058792
845 Ga0075428_100077313
846 Ga0075428_100077957
847 Ga0075428_100581615
848 Ga0075430_100006466
849 Ga0075430_100034253
850 Ga0075430_100202754
851 Ga0075431_100017064
852 Ga0075431_100020320
853 Ga0075431_100150144
854 Ga0075433_10005658
855 Ga0075434_100003843
856 Ga0075434_100171205
857 Ga0075429_100069739
858 Ga0075429_100115886
859 Ga0075429_100183473
860 Ga0068865_100010528
861 Ga0068865_100223563
862 Ga0075436_100021504
863 Ga0075436_100076848
864 Ga0097620_100117350
865 Ga0075435_100017672
866 Ga0111539_10004429
867 Ga0111539_10006657
868 Ga0111539_10519891
869 Ga0105245_10003498
870 Ga0105245_10004959
871 Ga0105245_10009422
872 Ga0105245_10030070
873 Ga0105245_10049735
874 Ga0105245_10053555
875 Ga0105245_10070022
876 Ga0105245_10075688
877 Ga0105245_10264872
878 Ga0114129_10002442
879 Ga0114129_10116558
880 Ga0114129_10140917
881 Ga0114129_10170295
882 Ga0114129_10219464
883 Ga0114129_10272190
884 Ga0105243_10008596
885 Ga0105243_10245396
886 Ga0105243_10361432
887 Ga0105243_10553918
888 Ga0105241_10026812
889 Ga0105242_10070593
890 Ga0105242_10167761
891 Ga0105242_10326781
892 Ga0105242_10400145
893 Ga0105248_10164830
894 Ga0105248_10179747
895 Ga0105248_10304569
896 Ga0105248_10573591
897 Ga0105237_10364398
898 Ga0105237_10535619
899 Ga0105238_10057804
900 Ga0105238_10632839
901 Ga0105249_10014389
902 Ga0105249_10014923
903 Ga0105249_10023359
904 Ga0105249_10106663
905 Ga0105249_10108974
906 Ga0105239_10000854
907 Ga0105239_10126266
908 Ga0105239_10551954
909 Ga0105246_10000321
910 Ga0105246_10245237
911 Ga0157369_10273107
912 Ga0157369_10484608
913 Ga0157374_10079468
914 Ga0157374_10169153
915 Ga0157378_10010899
916 Ga0157378_10176142
917 Ga0163162_10041769
918 Ga0163162_10093000
919 Ga0163162_10162043
920 Ga0163162_10255562
921 Ga0163162_10277297
922 Ga0163162_10401614
923 Ga0157372_10010217
924 Ga0157372_10417211
925 Ga0157375_10016368
926 Ga0157375_10074964
927 Ga0157375_10153844
928 Ga0157375_10189535
929 Ga0163163_10029804
930 Ga0163163_10057048
931 Ga0182008_10002142
932 Ga0182008_10109282
933 Ga0157376_10413138
934 Ga0182006_1035134
935 Ga0182007_10000163
936 Ga0213876_10008277
937 Ga0213875_10000921
938 Ga0209646_1000168
939 Ga0207653_10001294
940 Ga0207692_10115783
941 Ga0207642_10026636
942 Ga0207642_10045572
943 Ga0207642_10150544
944 Ga0207688_10007114
945 Ga0207688_10010141
946 Ga0207647_10073819
947 Ga0207647_10116650
948 Ga0207685_10007674
949 Ga0207645_10033502
950 Ga0207645_10098316
951 Ga0207705_10021619
952 Ga0207684_10055388
953 Ga0207684_10258388
954 Ga0207654_10304327
955 Ga0207671_10135497
956 Ga0207693_10001310
957 Ga0207693_10006783
958 Ga0207693_10113464
959 Ga0207693_10195113
960 Ga0207693_10217057
961 Ga0207693_10281846
962 Ga0207663_10392415
963 Ga0207660_10145178
964 Ga0207662_10024759
965 Ga0207681_10288804
966 Ga0207694_10093370
967 Ga0207694_10466132
968 Ga0207650_10097661
969 Ga0207650_10179036
970 Ga0207687_10005902
971 Ga0207687_10055633
972 Ga0207687_10064731
973 Ga0207687_10095551
974 Ga0207687_10102709
975 Ga0207687_10199900
976 Ga0207700_10075115
977 Ga0207664_10065712
978 Ga0207664_10400600
979 Ga0207664_10532698
980 Ga0207690_10014172
981 Ga0207690_10015756
982 Ga0207706_10004454
983 Ga0207706_10017762
984 Ga0207706_10170035
985 Ga0207686_10094288
986 Ga0207709_10013760
987 Ga0207709_10044552
988 Ga0207670_10458924
989 Ga0207669_10005135
990 Ga0207669_10041197
991 Ga0207704_10027547
992 Ga0207704_10151319
993 Ga0207704_10370740
994 Ga0207665_10048820
995 Ga0207665_10059630
996 Ga0207691_10017500
997 Ga0207711_10095814
998 Ga0207711_10101337
999 Ga0207711_10179643
1000 Ga0207689_10031027
1001 Ga0207689_10076687
1002 Ga0207661_10005367
1003 Ga0207661_10042996
1004 Ga0207661_10177937
1005 Ga0207661_10183905
1006 Ga0207679_10156448
1007 Ga0207667_10200935
1008 Ga0207651_10093427
1009 Ga0207712_10012362
1010 Ga0207712_10035420
1011 Ga0207712_10111019
1012 Ga0207712_10379420
1013 Ga0207712_10514605
1014 Ga0207668_10058310
1015 Ga0207640_10083172
1016 Ga0207640_10098816
1017 Ga0207640_10137685
1018 Ga0207677_10023102
1019 Ga0207703_10052048
1020 Ga0207678_10180586
1021 Ga0207708_10025382
1022 Ga0207702_10014846
1023 Ga0207641_10015911
1024 Ga0207648_10503181
1025 Ga0207676_10127424
1026 Ga0207674_10012449
1027 Ga0207675_100001735
1028 Ga0207675_100004766
1029 Ga0207675_100007749
1030 Ga0207683_10011380
1031 Ga0207683_10029097
1032 Ga0207698_10058706
1033 Ga0207698_10151249
1034 Ga0207698_10250421
1035 Ga0207698_10282912
1036 Ga0209813_10000869
1037 Ga0207428_10003189
1038 Ga0207428_10003628
1039 Ga0207428_10019096
1040 Ga0268266_10242124
1041 Ga0268266_10423242
1042 Ga0268265_10086911
1043 Ga0268264_10118767
1044 Ga0265338_10014450
1045 Ga0265338_10085651
1046 Ga0265762_1015481
1047 Ga0265327_10007811
1048 Ga0265327_10016221
1049 Ga0307513_10000392
1050 Ga0316576_10011298
1051 Ga0316576_10169774
1052 Ga0316578_10242200
1053 Ga0307405_10002150
1054 Ga0307405_10021265
1055 Ga0307405_10186955
1056 Ga0307405_10241731
1057 Ga0307405_10455273
1058 Ga0307406_10012752
1059 Ga0307406_10086920
1060 Ga0307406_10178989
1061 Ga0307406_10184961
1062 Ga0307406_10231244
1063 Ga0307407_10090711
1064 Ga0307412_10096572
1065 Ga0307409_100004005
1066 Ga0307409_100041099
1067 Ga0307409_100131744
1068 Ga0307409_100242774
1069 Ga0307409_100279438
1070 Ga0307416_100002457
1071 Ga0307416_100009077
1072 Ga0307416_100048195
1073 Ga0307416_100249221
1074 Ga0307416_100344430
1075 Ga0307416_100375876
1076 Ga0307416_100453044
1077 Ga0307416_100493537
1078 Ga0307416_100495668
1079 Ga0307414_10088700
1080 Ga0307411_10163791
1081 Ga0307415_100002675
1082 Ga0307415_100003274
1083 Ga0307415_100007140
1084 Ga0307415_100009591
1085 Ga0307415_100042158
1086 Ga0307415_100352964
1087 Ga0307415_100411688
1088 Ga0373959_0008840
1089 Ga0373929_0000928
1090 Ga0373940_0015857
1091 Ga0373944_0031380
1092 Ga0373949_0001204
1093 Ga0373952_0038047
1094 Ga0373936_0039959
1095 Ga0373939_0004523
1096 Ga0373945_0007337
1097 Ga0373945_0051386
1098 Ga0373953_0184586
1099 Ga0373960_0058681
1100 Ga0373943_0001983
1101 Ga0373943_0012303
1102 Ga0373946_0000906
1103 Ga0373946_0040522
1104 Ga0373955_0023622
1105 Ga0373961_0021857
1106 Ga0316574_0038113
1107 Ga0316574_0039393
1108 Ga0316574_0047448
1109 Ga0373931_0008048
1110 Ga0373935_0032625
1111 Ga0373935_0040222
1112 Ga0373933_0082791
1113 Ga0373947_0000222
1114 Ga0373947_0007840
1115 Ga0373947_0315314
1116 Ga0373937_0092226
1117 Ga0373925_0025252
1118 Ga0373925_0061548
1119 Ga0395899_0005147
1120 Ga0395899_0043233
1121 Ga0395899_0064623
1122 Ga0395899_0193598
1123 Ga0395899_0196161
1124 Ga0395900_0001887
1125 Ga0395900_0011765
1126 Ga0395900_0013600
1127 Ga0395900_0018292
1128 Ga0395900_0325652
1129 Ga0395900_0445093
1130 Ga0395900_0507850
1131 Ga0395898_0008507
1132 Ga0395898_0013578
1133 Ga0395898_0014671
1134 Ga0395898_0082914
1135 Ga0395898_0369246
1136 Ga0395905_0008061
1137 Ga0395905_0029779
1138 Ga0395905_0084695
1139 Ga0395905_0167656
1140 Ga0436364_0295501
1141 Ga0395901_0002672
1142 Ga0395901_0011319
1143 Ga0395901_0014454
1144 Ga0395901_0040568
1145 Ga0395901_0128920
1146 Ga0395901_0158657
1147 Ga0436365_0019774
1148 Ga0439436_0009403
1149 Ga0451800_0708492
1150 Ga0451835_0995502
1151 Ga0451853_1140793
1152 Ga0439448_0008497
1153 Ga0439450_000063
1154 Ga0439455_0013568
1155 Ga0439457_003162
1156 Ga0439463_000141
1157 Ga0450914_000726
1158 Ga0450915_000292
1159 Ga0450900_004860
1160 Ga0439458_0011472
1161 Ga0450909_008199
1162 Ga0439435_0064674
1163 Ga0439444_0000359
1164 Ga0439464_0005081
1165 Ga0439460_0000688
1166 Ga0439460_0010487
1167 Ga0439440_0000076
1168 Ga0466969_0090602
1169 Ga0466965_0084440
1170 Ga0466966_0134286
1171 Ga0466963_0011149
1172 Ga0466959_0295416
1173 Ga0451576_0091689
1174 Ga0466967_0001726
1175 Ga0466967_0002670
1176 Ga0495592_0139865
1177 Ga0495592_0200987
1178 Ga0495603_0007444
1179 Ga0495603_0159256
1180 Ga0495629_0000214
1181 Ga0495641_0000795
1182 Ga0495641_0011242
1183 Ga0495651_0025628
1184 Ga0495651_0053561
1185 Ga0495582_0000389
1186 Ga0495582_0143336
1187 Ga0495582_0145990
1188 Ga0495639_0011451
1189 Ga0495662_0001778
1190 Ga0495664_0183449
1191 Ga0495608_0018463
1192 Ga0495608_0042456
1193 Ga0495616_0109872
1194 Ga0495618_0112034
1195 Ga0495630_0080335
1196 Ga0495630_0181401
1197 Ga0495644_0066990
1198 Ga0495663_0015632
1199 Ga0495652_0167729
1200 Ga0495640_0011559
1201 Ga0495587_0012552
1202 Ga0495587_0111034
1203 Ga0495621_0008214
1204 Ga0495645_0129003
1205 Ga0495667_0046189
1206 Ga0495667_0122127
1207 Ga0495667_0210350
1208 Ga0495656_0024211
1209 Ga0495656_0168679
1210 Ga0495634_0027180
1211 Ga0495634_0074471
1212 Ga0495611_0056852
1213 Ga0495635_0008410
1214 Ga0495635_0064663
1215 Ga0495657_0072414
1216 Ga0495623_0034884
1217 Ga0495623_0068429
1218 Ga0495647_0006683
1219 Ga0495647_0163611
1220 Ga0495658_0043129
1221 Ga0495658_0064288
1222 Ga0495658_0272666
1223 Ga0495613_0011809
1224 Ga0495613_0263903
1225 Ga0495624_0045099
1226 Ga0495589_0152536
1227 Ga0495600_0005394
1228 Ga0495581_0001758
1229 Ga0495604_0129753
1230 Ga0495674_0011290
1231 Ga0495676_0015151
1232 Ga0495676_0041943
1233 Ga0495676_0085237
1234 Ga0495676_0124080
1235 Ga0495676_0264688
1236 Ga0495680_0000519
1237 Ga0495680_0008616
1238 Ga0495680_0009668
1239 Ga0495680_0027614
1240 Ga0495675_0019865
1241 Ga0495684_0008163
1242 Ga0495684_0019284
1243 Ga0495684_0150918
1244 Ga0495593_0052305
1245 Ga0495593_0135290
1246 Ga0496100_0007047
1247 Ga0496100_0039628
1248 Ga0496100_0230407
1249 Ga0496100_0576410
1250 Ga0496101_0007021
1251 Ga0496101_0012587
1252 Ga0496101_0100241
1253 Ga0496101_0193959
1254 Ga0496101_0236237
1255 Ga0496101_0295936
1256 Ga0496101_0336184
1257 Ga0496101_0436781
1258 Ga0496102_0004167
1259 Ga0496102_0021504
1260 Ga0496102_0099599
1261 Ga0496104_0000921
1262 Ga0496104_0039575
1263 Ga0496104_0115337
1264 Ga0496104_0156730
1265 Ga0496104_0195399
1266 Ga0496104_0246932
1267 Ga0496105_0011698
1268 Ga0496105_0013191
1269 Ga0496105_0140701
1270 Ga0496105_0232634
1271 Ga0496106_0030633
1272 Ga0496106_0039567
1273 Ga0496106_0081536
1274 Ga0496107_0013656
1275 Ga0496107_0043112
1276 Ga0496107_0080534
1277 Ga0496107_0164230
1278 Ga0496108_0002495
1279 Ga0496108_0043315
1280 Ga0496108_0155994
1281 Ga0496109_0005924
1282 Ga0496109_0008723
1283 Ga0496109_0031853
1284 Ga0496109_0248645
1285 Ga0496110_0005696
1286 Ga0496110_0043298
1287 Ga0496110_0237498
1288 Ga0496110_0356125
1289 Ga0496110_0367716
1290 Ga0496110_0410042
1291 Ga0496110_0543341
1292 Ga0496111_0015454
1293 Ga0496111_0016621
1294 Ga0496111_0041879
1295 Ga0496111_0048134
1296 Ga0496111_0123226
1297 Ga0496111_0508569
1298 Ga0496112_0000998
1299 Ga0496112_0002635
1300 Ga0496112_0037461
1301 Ga0496112_0560780
1302 Ga0496113_0002742
1303 Ga0496113_0407486
1304 Ga0496114_0015313
1305 Ga0496114_0041450
1306 Ga0496114_0051296
1307 Ga0496114_0066961
1308 Ga0496114_0079857
1309 Ga0496114_0099380
1310 Ga0496114_0141495
1311 Ga0496114_0150832
1312 Ga0496115_0005039
1313 Ga0496115_0021730
1314 Ga0496115_0104947
1315 Ga0496115_0197155
1316 Ga0496115_0461675
1317 Ga0501031_0004169
1318 Ga0501031_0007447
1319 Ga0501031_0015950
1320 Ga0501031_0220168
1321 Ga0501032_0037047
1322 Ga0501032_0098357
1323 Ga0501032_0172408
1324 Ga0501033_0001873
1325 Ga0501033_0039695
1326 Ga0501036_0000538
1327 Ga0501036_0000787
1328 Ga0501036_0010571
1329 Ga0501036_0011055
1330 Ga0501036_0143968
1331 Ga0501037_0010194
1332 Ga0501037_0022267
1333 Ga0501037_0033494
1334 Ga0501037_0097890
1335 Ga0501038_0002433
1336 Ga0501038_0002454
1337 Ga0501038_0008663
1338 Ga0501038_0216373
1339 Ga0501038_0531264
1340 Ga0501039_0002345
1341 Ga0501039_0002478
1342 Ga0501039_0012574
1343 Ga0501039_0017994
1344 Ga0501040_0001578
1345 Ga0501040_0020050
1346 Ga0501040_0028765
1347 Ga0501040_0065718
1348 Ga0501041_0000374
1349 Ga0501041_0001907
1350 Ga0501041_0004851
1351 Ga0501041_0046712
1352 Ga0501041_0198212
1353 Ga0501041_0287903
1354 Ga0501042_0001590
1355 Ga0501042_0003308
1356 Ga0501042_0431433
1357 Ga0501043_0019361
1358 Ga0501043_0023348
1359 Ga0501046_0003448
1360 Ga0501046_0008214
1361 Ga0501046_0052538
1362 Ga0501047_0107379
1363 Ga0501048_0000098
1364 Ga0501048_0000481
1365 Ga0501048_0003830
1366 Ga0501048_0101152
1367 Ga0501048_0438988
1368 Ga0501068_0002427
1369 Ga0501068_0023466
1370 Ga0501069_0000057
1371 Ga0501070_0001915
1372 Ga0501070_0034064
1373 Ga0501071_0000131
1374 Ga0501071_0004254
1375 Ga0501071_0032632
1376 Ga0501071_0040430
1377 Ga0501071_0061919
1378 Ga0501072_0000411
1379 Ga0501072_0011944
1380 Ga0501072_0057109
1381 Ga0501072_0153808
1382 Ga0501072_0164108
1383 Ga0501073_0001913
1384 Ga0501073_0043620
1385 Ga0501074_0001213
1386 Ga0501074_0003268
1387 Ga0501074_0015737
1388 Ga0501074_0074727
1389 Ga0501074_0352239
1390 Ga0501075_0000514
1391 Ga0501075_0012860
1392 Ga0501075_0016678
1393 Ga0501075_0241482
1394 Ga0501076_0000661
1395 Ga0501076_0001524
1396 Ga0501076_0018619
1397 Ga0501076_0046936
1398 Ga0501076_0156841
1399 Ga0501077_0007978
1400 Ga0501077_0009989
1401 Ga0501077_0024744
1402 Ga0501077_0040937
1403 Ga0501077_0074730
1404 Ga0501079_0002022
1405 Ga0501079_0004369
1406 Ga0501079_0025195
1407 Ga0501079_0034208
1408 Ga0501080_0024241
1409 Ga0501080_0060606
1410 Ga0501081_0000176
1411 Ga0501081_0001624
1412 Ga0501081_0006158
1413 Ga0501083_0005857
1414 Ga0501083_0133204
1415 Ga0501035_0002693
1416 Ga0501035_0015152
1417 Ga0501035_0062613
1418 Ga0501035_0114846
1419 Ga0501044_0015084
1420 Ga0501044_0130533
1421 Ga0501045_0001824
1422 Ga0501045_0005852
1423 Ga0501045_0010082
1424 Ga0501045_0073215
1425 Ga0501045_0077872
1426 Ga0501045_0193193
1427 nmdc:mga05p37_132299_c1
1428 nmdc:mga05p37_161335_c1
1429 nmdc:mga05p37_181668_c1
1430 nmdc:mga05p37_514848_c1
1431 nmdc:mga05p37_7880_c1
1432 nmdc:mga09592_115313_c1
1433 nmdc:mga09592_28356_c1
1434 nmdc:mga09592_481568_c1
1435 nmdc:mga09592_73566_c1
1436 nmdc:mga0qj67_15563_c1
1437 nmdc:mga0qj67_226027_c1
1438 nmdc:mga0qj67_27078_c1
1439 nmdc:mga06r32_234787_c1
1440 nmdc:mga06r32_55835_c1
1441 nmdc:mga06r32_7763_c1
1442 nmdc:mga08y16_129137_c1
1443 nmdc:mga08y16_154366_c1
1444 nmdc:mga08y16_172211_c1
1445 nmdc:mga08y16_387127_c1
1446 nmdc:mga08y16_44675_c1
1447 nmdc:mga0n895_175314_c1
1448 nmdc:mga0n895_187916_c1
1449 nmdc:mga0n895_31890_c1
1450 nmdc:mga0n895_6658_c1
1451 nmdc:mga0rr50_351859_c1
1452 nmdc:mga0rr50_61963_c1
1453 nmdc:mga08x19_11682_c1
1454 nmdc:mga0a205_13461_c1
1455 nmdc:mga0a205_6619_c2
1456 Ga0495601_0027475
1457 Ga0495601_0167993
1458 Ga0495601_0329848
1459 Ga0495595_0026888
1460 Ga0495595_0150175
1461 Ga0495619_0001579
1462 Ga0495619_0002099
1463 Ga0495619_0081954
1464 Ga0501084_0000414
1465 Ga0501084_0004136
1466 Ga0501084_0075829
1467 Ga0501084_0135921
1468 Ga0501084_0332480
1469 Ga0501082_0003100
1470 Ga0501082_0036561
1471 Ga0501082_0060115
1472 Ga0501082_0069151
1473 Ga0501082_0406078
1474 Ga0530510_0000576
1475 Ga0530510_0007084
1476 Ga0530510_0013764
1477 Ga0530510_0047826
1478 Ga0530510_0105244
1479 Ga0530510_0118183
1480 Ga0530510_0306551
1481 2785339372
1482 2809026195
1483 2812374828
1484 2954004277
1485 3006497655
1486 8048411286

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13522

GATase_6

Glutamine amidotransferase domain

97

204

0.82

PF13230

GATase_4

Glutamine amidotransferases class-II

49

292

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mdn-assembly1.cif.gz_C structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9441 2 273
3mdn-assembly1.cif.gz_B structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.943 2 273
3mdn-assembly1.cif.gz_C structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9399 2 273
3mdn-assembly1.cif.gz_B structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.9387 2 273
3mdn-assembly1.cif.gz_D structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi 0.937 2 274
ID Description Score Start End Superfamily
3mdnB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9414 2 273 3.60.20.10
3mdnB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9371 2 273 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9041 2 274 3.60.20.10
4zfjA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9003 2 274 3.60.20.10
af_P53871_1_308_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8752 1 271 3.60.20.10
ID Description Score Start End GO Terms
AF-A2VSM1-F1-model_v4 deleted 0.981 1 276
AF-B1JWG0-F1-model_v4 Glutamine amidotransferase class-II 0.9804 1 276 GO:0016740
AF-A0A521MLF0-F1-model_v4 Class II glutamine amidotransferase 0.9802 1 271 GO:0016740
AF-A0A529L1G1-F1-model_v4 Class II glutamine amidotransferase 0.98 102 206 GO:0016740
AF-A0A7K2QPS2-F1-model_v4 Class II glutamine amidotransferase 0.9781 1 168 GO:0016740

Map