F478696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 328 | 1486 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0001465|Ga0395899_0001465_36_968 |
| Length | 310 |
| Sequence | LLRPTSRAARFAASSKRDEASAFPGDHDHGICRWLAYSGSPVLIEELLYNRKNSLIVQSLHSRLGAEETNGDGFGLGWYGEQETPGVFRSIEPAWNDRNLHELSGHISSGLVFAHIRASTGSPVQQTNCHPFRHGRWLFMHNGFLDGFHDTKRDLALAVDPALYPEIEGTTDTELMFHLALTFGLEDDPPQAVARMVGLVESTGQAHGVEFPFQGTIATTDGECIWAFRYSSEGASRSLFFSTDLQTLRELYPENEQIRELDVESRLVVSEPLGDLPGVWNEVPEASYGVIQPGQDEMHPFVPTTDAVPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 196 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 201 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 202 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 203 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 204 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 205 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 206 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 209 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 210 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 211 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 212 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 213 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 323 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 324 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 325 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 326 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 327 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 328 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 9.69 |
| Rhizosphere | 88.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0001465 | 3300037312 | Bacteria | 20107 |
| 2 | JGI24737J22298_10037680 | 3300001990 | Bacteria | 1489 |
| 3 | Ga0070658_10015743 | 3300005327 | Bacteria | 6047 |
| 4 | Ga0070658_10178513 | 3300005327 | Bacteria | 1786 |
| 5 | Ga0070683_100007790 | 3300005329 | Bacteria | 9069 |
| 6 | Ga0070683_100069543 | 3300005329 | Bacteria | 3283 |
| 7 | Ga0070683_100128326 | 3300005329 | Bacteria | 2399 |
| 8 | Ga0070690_100013375 | 3300005330 | Bacteria | 4846 |
| 9 | Ga0070690_100133682 | 3300005330 | Bacteria | 1678 |
| 10 | Ga0068869_100085320 | 3300005334 | Bacteria | 2365 |
| 11 | Ga0070680_100333103 | 3300005336 | Bacteria | 1289 |
| 12 | Ga0070682_100002964 | 3300005337 | Bacteria | 9420 |
| 13 | Ga0070682_100595744 | 3300005337 | Bacteria | 872 |
| 14 | Ga0070689_100300981 | 3300005340 | Bacteria | 1335 |
| 15 | Ga0070687_100098048 | 3300005343 | Bacteria | 1635 |
| 16 | Ga0070661_100030031 | 3300005344 | Bacteria | 3925 |
| 17 | Ga0070692_10049385 | 3300005345 | Bacteria | 2182 |
| 18 | Ga0070668_100050405 | 3300005347 | Bacteria | 3205 |
| 19 | Ga0070668_100098809 | 3300005347 | Bacteria | 2311 |
| 20 | Ga0070668_100469552 | 3300005347 | Bacteria | 1085 |
| 21 | Ga0070669_100282723 | 3300005353 | Bacteria | 1330 |
| 22 | Ga0070673_100012935 | 3300005364 | Bacteria | 5750 |
| 23 | Ga0070673_100142675 | 3300005364 | Bacteria | 2022 |
| 24 | Ga0070673_100356176 | 3300005364 | Bacteria | 1300 |
| 25 | Ga0070688_100038602 | 3300005365 | Bacteria | 2918 |
| 26 | Ga0070688_100071960 | 3300005365 | Bacteria | 2214 |
| 27 | Ga0070659_100043969 | 3300005366 | Bacteria | 3495 |
| 28 | Ga0070659_100088679 | 3300005366 | Bacteria | 2477 |
| 29 | Ga0070659_100149215 | 3300005366 | Bacteria | 1907 |
| 30 | Ga0070659_100275814 | 3300005366 | Bacteria | 1398 |
| 31 | Ga0070709_10127745 | 3300005434 | Bacteria | 1732 |
| 32 | Ga0070714_100130732 | 3300005435 | Bacteria | 2244 |
| 33 | Ga0070714_100141222 | 3300005435 | Bacteria | 2162 |
| 34 | Ga0070714_100213349 | 3300005435 | Bacteria | 1770 |
| 35 | Ga0070710_10017156 | 3300005437 | Bacteria | 3700 |
| 36 | Ga0070711_100038243 | 3300005439 | Bacteria | 3225 |
| 37 | Ga0070711_100161526 | 3300005439 | Bacteria | 1699 |
| 38 | Ga0070711_100241815 | 3300005439 | Bacteria | 1412 |
| 39 | Ga0070705_100027660 | 3300005440 | Bacteria | 3099 |
| 40 | Ga0070700_100060207 | 3300005441 | Bacteria | 2393 |
| 41 | Ga0070694_100041209 | 3300005444 | Bacteria | 3079 |
| 42 | Ga0070694_100118076 | 3300005444 | Bacteria | 1899 |
| 43 | Ga0070694_100182178 | 3300005444 | Bacteria | 1554 |
| 44 | Ga0070708_100005227 | 3300005445 | Bacteria | 10280 |
| 45 | Ga0070678_100042660 | 3300005456 | Bacteria | 3226 |
| 46 | Ga0070662_100019408 | 3300005457 | Bacteria | 4614 |
| 47 | Ga0070662_100239719 | 3300005457 | Bacteria | 1454 |
| 48 | Ga0070662_100316470 | 3300005457 | Bacteria | 1272 |
| 49 | Ga0070685_10049834 | 3300005466 | Bacteria | 2417 |
| 50 | Ga0070706_100129698 | 3300005467 | Bacteria | 2353 |
| 51 | Ga0070707_100183598 | 3300005468 | Bacteria | 2039 |
| 52 | Ga0070684_100002606 | 3300005535 | Bacteria | 13316 |
| 53 | Ga0070684_100024457 | 3300005535 | Bacteria | 5067 |
| 54 | Ga0070684_100087361 | 3300005535 | Bacteria | 2769 |
| 55 | Ga0070684_100115184 | 3300005535 | Bacteria | 2414 |
| 56 | Ga0068853_100229882 | 3300005539 | Bacteria | 1696 |
| 57 | Ga0070672_100048923 | 3300005543 | Bacteria | 3287 |
| 58 | Ga0070696_100099751 | 3300005546 | Bacteria | 2079 |
| 59 | Ga0070693_100080118 | 3300005547 | Bacteria | 1945 |
| 60 | Ga0070665_100215942 | 3300005548 | Bacteria | 1919 |
| 61 | Ga0070704_100054820 | 3300005549 | Bacteria | 2823 |
| 62 | Ga0068855_100239103 | 3300005563 | Bacteria | 2030 |
| 63 | Ga0068857_100007505 | 3300005577 | Bacteria | 9382 |
| 64 | Ga0068854_100080723 | 3300005578 | Bacteria | 2401 |
| 65 | Ga0068854_100312114 | 3300005578 | Bacteria | 1275 |
| 66 | Ga0068854_100317532 | 3300005578 | Bacteria | 1265 |
| 67 | Ga0068856_100021396 | 3300005614 | Bacteria | 6288 |
| 68 | Ga0068856_100145936 | 3300005614 | Bacteria | 2374 |
| 69 | Ga0068856_100260068 | 3300005614 | Bacteria | 1751 |
| 70 | Ga0068856_100735224 | 3300005614 | Bacteria | 1007 |
| 71 | Ga0068852_100110710 | 3300005616 | Bacteria | 2496 |
| 72 | Ga0068859_100117355 | 3300005617 | Bacteria | 2726 |
| 73 | Ga0068864_100128119 | 3300005618 | Bacteria | 2277 |
| 74 | Ga0068861_100013200 | 3300005719 | Bacteria | 5779 |
| 75 | Ga0068861_100017053 | 3300005719 | Bacteria | 5151 |
| 76 | Ga0068861_100093597 | 3300005719 | Bacteria | 2376 |
| 77 | Ga0068861_100416085 | 3300005719 | Bacteria | 1197 |
| 78 | Ga0068863_100034347 | 3300005841 | Bacteria | 4831 |
| 79 | Ga0068863_100229875 | 3300005841 | Bacteria | 1789 |
| 80 | Ga0068860_100047755 | 3300005843 | Bacteria | 4080 |
| 81 | Ga0081455_10003312 | 3300005937 | Bacteria | 18633 |
| 82 | Ga0081455_10005672 | 3300005937 | Bacteria | 13623 |
| 83 | Ga0081540_1012151 | 3300005983 | Bacteria | 5694 |
| 84 | Ga0081540_1012499 | 3300005983 | Bacteria | 5582 |
| 85 | Ga0081540_1018916 | 3300005983 | Bacteria | 4207 |
| 86 | Ga0081540_1056135 | 3300005983 | Bacteria | 1914 |
| 87 | Ga0081539_10034701 | 3300005985 | Bacteria | 3044 |
| 88 | Ga0070717_10232972 | 3300006028 | Bacteria | 1622 |
| 89 | Ga0075368_10010991 | 3300006042 | Bacteria | 3286 |
| 90 | Ga0075432_10003179 | 3300006058 | Bacteria | 5538 |
| 91 | Ga0075432_10009129 | 3300006058 | Bacteria | 3379 |
| 92 | Ga0070715_10125562 | 3300006163 | Bacteria | 1228 |
| 93 | Ga0070716_100167470 | 3300006173 | Bacteria | 1431 |
| 94 | Ga0070712_100007109 | 3300006175 | Bacteria | 6984 |
| 95 | Ga0070712_100049752 | 3300006175 | Bacteria | 2912 |
| 96 | Ga0070712_100071680 | 3300006175 | Bacteria | 2480 |
| 97 | Ga0070712_100129175 | 3300006175 | Bacteria | 1913 |
| 98 | Ga0075367_10000127 | 3300006178 | Bacteria | 22312 |
| 99 | Ga0075427_10000746 | 3300006194 | Bacteria | 3917 |
| 100 | Ga0097621_100425993 | 3300006237 | Bacteria | 1192 |
| 101 | Ga0075428_100058792 | 3300006844 | Bacteria | 4209 |
| 102 | Ga0075428_100077313 | 3300006844 | Bacteria | 3633 |
| 103 | Ga0075428_100077957 | 3300006844 | Bacteria | 3617 |
| 104 | Ga0075428_100581615 | 3300006844 | Bacteria | 1196 |
| 105 | Ga0075430_100006466 | 3300006846 | Bacteria | 9873 |
| 106 | Ga0075430_100034253 | 3300006846 | Bacteria | 4310 |
| 107 | Ga0075430_100202754 | 3300006846 | Bacteria | 1647 |
| 108 | Ga0075431_100017064 | 3300006847 | Bacteria | 7375 |
| 109 | Ga0075431_100020320 | 3300006847 | Bacteria | 6783 |
| 110 | Ga0075431_100150144 | 3300006847 | Bacteria | 2400 |
| 111 | Ga0075433_10005658 | 3300006852 | Bacteria | 9820 |
| 112 | Ga0075434_100003843 | 3300006871 | Bacteria | 13426 |
| 113 | Ga0075434_100171205 | 3300006871 | Bacteria | 2192 |
| 114 | Ga0075429_100069739 | 3300006880 | Bacteria | 3060 |
| 115 | Ga0075429_100115886 | 3300006880 | Bacteria | 2342 |
| 116 | Ga0075429_100183473 | 3300006880 | Bacteria | 1834 |
| 117 | Ga0068865_100010528 | 3300006881 | Bacteria | 5759 |
| 118 | Ga0068865_100223563 | 3300006881 | Bacteria | 1473 |
| 119 | Ga0075436_100021504 | 3300006914 | Bacteria | 4428 |
| 120 | Ga0075436_100076848 | 3300006914 | Bacteria | 2312 |
| 121 | Ga0097620_100117350 | 3300006931 | Bacteria | 2726 |
| 122 | Ga0075435_100017672 | 3300007076 | Bacteria | 5404 |
| 123 | Ga0111539_10004429 | 3300009094 | Bacteria | 18349 |
| 124 | Ga0111539_10006657 | 3300009094 | Bacteria | 14882 |
| 125 | Ga0111539_10519891 | 3300009094 | Bacteria | 1386 |
| 126 | Ga0105245_10003498 | 3300009098 | Bacteria | 14055 |
| 127 | Ga0105245_10004959 | 3300009098 | Bacteria | 11699 |
| 128 | Ga0105245_10009422 | 3300009098 | Bacteria | 8517 |
| 129 | Ga0105245_10030070 | 3300009098 | Bacteria | 4802 |
| 130 | Ga0105245_10049735 | 3300009098 | Bacteria | 3755 |
| 131 | Ga0105245_10053555 | 3300009098 | Bacteria | 3621 |
| 132 | Ga0105245_10070022 | 3300009098 | Bacteria | 3182 |
| 133 | Ga0105245_10075688 | 3300009098 | Bacteria | 3065 |
| 134 | Ga0105245_10264872 | 3300009098 | Bacteria | 1674 |
| 135 | Ga0114129_10002442 | 3300009147 | Bacteria | 25793 |
| 136 | Ga0114129_10116558 | 3300009147 | Bacteria | 3681 |
| 137 | Ga0114129_10140917 | 3300009147 | Bacteria | 3305 |
| 138 | Ga0114129_10170295 | 3300009147 | Bacteria | 2970 |
| 139 | Ga0114129_10219464 | 3300009147 | Bacteria | 2566 |
| 140 | Ga0114129_10272190 | 3300009147 | Bacteria | 2265 |
| 141 | Ga0105243_10008596 | 3300009148 | Bacteria | 7837 |
| 142 | Ga0105243_10245396 | 3300009148 | Bacteria | 1596 |
| 143 | Ga0105243_10361432 | 3300009148 | Bacteria | 1336 |
| 144 | Ga0105243_10553918 | 3300009148 | Bacteria | 1099 |
| 145 | Ga0105241_10026812 | 3300009174 | Bacteria | 4289 |
| 146 | Ga0105242_10070593 | 3300009176 | Bacteria | 2896 |
| 147 | Ga0105242_10167761 | 3300009176 | Bacteria | 1927 |
| 148 | Ga0105242_10326781 | 3300009176 | Bacteria | 1409 |
| 149 | Ga0105242_10400145 | 3300009176 | Bacteria | 1281 |
| 150 | Ga0105248_10164830 | 3300009177 | Bacteria | 2499 |
| 151 | Ga0105248_10179747 | 3300009177 | Bacteria | 2384 |
| 152 | Ga0105248_10304569 | 3300009177 | Bacteria | 1794 |
| 153 | Ga0105248_10573591 | 3300009177 | Bacteria | 1273 |
| 154 | Ga0105237_10364398 | 3300009545 | Bacteria | 1450 |
| 155 | Ga0105237_10535619 | 3300009545 | Bacteria | 1178 |
| 156 | Ga0105238_10057804 | 3300009551 | Bacteria | 3888 |
| 157 | Ga0105238_10632839 | 3300009551 | Bacteria | 1079 |
| 158 | Ga0105249_10014389 | 3300009553 | Bacteria | 6996 |
| 159 | Ga0105249_10014923 | 3300009553 | Bacteria | 6872 |
| 160 | Ga0105249_10023359 | 3300009553 | Bacteria | 5548 |
| 161 | Ga0105249_10106663 | 3300009553 | Bacteria | 2643 |
| 162 | Ga0105249_10108974 | 3300009553 | Bacteria | 2615 |
| 163 | Ga0105239_10000854 | 3300010375 | Bacteria | 43307 |
| 164 | Ga0105239_10126266 | 3300010375 | Bacteria | 2843 |
| 165 | Ga0105239_10551954 | 3300010375 | Bacteria | 1312 |
| 166 | Ga0105246_10000321 | 3300011119 | Bacteria | 25383 |
| 167 | Ga0105246_10245237 | 3300011119 | Bacteria | 1418 |
| 168 | Ga0157369_10273107 | 3300013105 | Bacteria | 1761 |
| 169 | Ga0157369_10484608 | 3300013105 | Bacteria | 1280 |
| 170 | Ga0157374_10079468 | 3300013296 | Bacteria | 3108 |
| 171 | Ga0157374_10169153 | 3300013296 | Bacteria | 2131 |
| 172 | Ga0157378_10010899 | 3300013297 | Bacteria | 7951 |
| 173 | Ga0157378_10176142 | 3300013297 | Bacteria | 2009 |
| 174 | Ga0163162_10041769 | 3300013306 | Bacteria | 4588 |
| 175 | Ga0163162_10093000 | 3300013306 | Bacteria | 3100 |
| 176 | Ga0163162_10162043 | 3300013306 | Bacteria | 2358 |
| 177 | Ga0163162_10255562 | 3300013306 | Bacteria | 1884 |
| 178 | Ga0163162_10277297 | 3300013306 | Bacteria | 1809 |
| 179 | Ga0163162_10401614 | 3300013306 | Bacteria | 1503 |
| 180 | Ga0157372_10010217 | 3300013307 | Bacteria | 9965 |
| 181 | Ga0157372_10417211 | 3300013307 | Bacteria | 1564 |
| 182 | Ga0157375_10016368 | 3300013308 | Bacteria | 6658 |
| 183 | Ga0157375_10074964 | 3300013308 | Bacteria | 3406 |
| 184 | Ga0157375_10153844 | 3300013308 | Bacteria | 2437 |
| 185 | Ga0157375_10189535 | 3300013308 | Bacteria | 2211 |
| 186 | Ga0163163_10029804 | 3300014325 | Bacteria | 5251 |
| 187 | Ga0163163_10057048 | 3300014325 | Bacteria | 3861 |
| 188 | Ga0182008_10002142 | 3300014497 | Bacteria | 12587 |
| 189 | Ga0182008_10109282 | 3300014497 | Bacteria | 1370 |
| 190 | Ga0157376_10413138 | 3300014969 | Bacteria | 1307 |
| 191 | Ga0182006_1035134 | 3300015261 | Bacteria | 2000 |
| 192 | Ga0182007_10000163 | 3300015262 | Bacteria | 46066 |
| 193 | Ga0213876_10008277 | 3300021384 | Bacteria | 5627 |
| 194 | Ga0213875_10000921 | 3300021388 | Bacteria | 21238 |
| 195 | Ga0209646_1000168 | 3300025246 | Bacteria | 86352 |
| 196 | Ga0207653_10001294 | 3300025885 | Bacteria | 8134 |
| 197 | Ga0207692_10115783 | 3300025898 | Bacteria | 1494 |
| 198 | Ga0207642_10026636 | 3300025899 | Bacteria | 2356 |
| 199 | Ga0207642_10045572 | 3300025899 | Bacteria | 1948 |
| 200 | Ga0207642_10150544 | 3300025899 | Bacteria | 1238 |
| 201 | Ga0207688_10007114 | 3300025901 | Bacteria | 6088 |
| 202 | Ga0207688_10010141 | 3300025901 | Bacteria | 5125 |
| 203 | Ga0207647_10073819 | 3300025904 | Bacteria | 2055 |
| 204 | Ga0207647_10116650 | 3300025904 | Bacteria | 1576 |
| 205 | Ga0207685_10007674 | 3300025905 | Bacteria | 3022 |
| 206 | Ga0207645_10033502 | 3300025907 | Bacteria | 3302 |
| 207 | Ga0207645_10098316 | 3300025907 | Bacteria | 1887 |
| 208 | Ga0207705_10021619 | 3300025909 | Bacteria | 4591 |
| 209 | Ga0207684_10055388 | 3300025910 | Bacteria | 3365 |
| 210 | Ga0207684_10258388 | 3300025910 | Bacteria | 1503 |
| 211 | Ga0207654_10304327 | 3300025911 | Bacteria | 1085 |
| 212 | Ga0207671_10135497 | 3300025914 | Bacteria | 1893 |
| 213 | Ga0207693_10001310 | 3300025915 | Bacteria | 22068 |
| 214 | Ga0207693_10006783 | 3300025915 | Bacteria | 9454 |
| 215 | Ga0207693_10113464 | 3300025915 | Bacteria | 2126 |
| 216 | Ga0207693_10195113 | 3300025915 | Bacteria | 1593 |
| 217 | Ga0207693_10217057 | 3300025915 | Bacteria | 1503 |
| 218 | Ga0207693_10281846 | 3300025915 | Bacteria | 1302 |
| 219 | Ga0207663_10392415 | 3300025916 | Bacteria | 1060 |
| 220 | Ga0207660_10145178 | 3300025917 | Bacteria | 1818 |
| 221 | Ga0207662_10024759 | 3300025918 | Bacteria | 3454 |
| 222 | Ga0207681_10288804 | 3300025923 | Bacteria | 1294 |
| 223 | Ga0207694_10093370 | 3300025924 | Bacteria | 2377 |
| 224 | Ga0207694_10466132 | 3300025924 | Bacteria | 1056 |
| 225 | Ga0207650_10097661 | 3300025925 | Bacteria | 2255 |
| 226 | Ga0207650_10179036 | 3300025925 | Bacteria | 1689 |
| 227 | Ga0207687_10005902 | 3300025927 | Bacteria | 8102 |
| 228 | Ga0207687_10055633 | 3300025927 | Bacteria | 2773 |
| 229 | Ga0207687_10064731 | 3300025927 | Bacteria | 2594 |
| 230 | Ga0207687_10095551 | 3300025927 | Bacteria | 2177 |
| 231 | Ga0207687_10102709 | 3300025927 | Bacteria | 2107 |
| 232 | Ga0207687_10199900 | 3300025927 | Bacteria | 1561 |
| 233 | Ga0207700_10075115 | 3300025928 | Bacteria | 2618 |
| 234 | Ga0207664_10065712 | 3300025929 | Bacteria | 2905 |
| 235 | Ga0207664_10400600 | 3300025929 | Bacteria | 1220 |
| 236 | Ga0207664_10532698 | 3300025929 | Bacteria | 1053 |
| 237 | Ga0207690_10014172 | 3300025932 | Bacteria | 4810 |
| 238 | Ga0207690_10015756 | 3300025932 | Bacteria | 4587 |
| 239 | Ga0207706_10004454 | 3300025933 | Bacteria | 13160 |
| 240 | Ga0207706_10017762 | 3300025933 | Bacteria | 6406 |
| 241 | Ga0207706_10170035 | 3300025933 | Bacteria | 1915 |
| 242 | Ga0207686_10094288 | 3300025934 | Bacteria | 1984 |
| 243 | Ga0207709_10013760 | 3300025935 | Bacteria | 4465 |
| 244 | Ga0207709_10044552 | 3300025935 | Bacteria | 2682 |
| 245 | Ga0207670_10458924 | 3300025936 | Unclassified | 1028 |
| 246 | Ga0207669_10005135 | 3300025937 | Bacteria | 5837 |
| 247 | Ga0207669_10041197 | 3300025937 | Bacteria | 2686 |
| 248 | Ga0207704_10027547 | 3300025938 | Bacteria | 3138 |
| 249 | Ga0207704_10151319 | 3300025938 | Bacteria | 1638 |
| 250 | Ga0207704_10370740 | 3300025938 | Bacteria | 1121 |
| 251 | Ga0207665_10048820 | 3300025939 | Bacteria | 2843 |
| 252 | Ga0207665_10059630 | 3300025939 | Bacteria | 2583 |
| 253 | Ga0207691_10017500 | 3300025940 | Bacteria | 6795 |
| 254 | Ga0207711_10095814 | 3300025941 | Bacteria | 2618 |
| 255 | Ga0207711_10101337 | 3300025941 | Bacteria | 2548 |
| 256 | Ga0207711_10179643 | 3300025941 | Bacteria | 1924 |
| 257 | Ga0207689_10031027 | 3300025942 | Bacteria | 4452 |
| 258 | Ga0207689_10076687 | 3300025942 | Bacteria | 2748 |
| 259 | Ga0207661_10005367 | 3300025944 | Bacteria | 9032 |
| 260 | Ga0207661_10042996 | 3300025944 | Bacteria | 3565 |
| 261 | Ga0207661_10177937 | 3300025944 | Bacteria | 1856 |
| 262 | Ga0207661_10183905 | 3300025944 | Bacteria | 1828 |
| 263 | Ga0207679_10156448 | 3300025945 | Bacteria | 1862 |
| 264 | Ga0207667_10200935 | 3300025949 | Bacteria | 2045 |
| 265 | Ga0207651_10093427 | 3300025960 | Bacteria | 2209 |
| 266 | Ga0207712_10012362 | 3300025961 | Bacteria | 5453 |
| 267 | Ga0207712_10035420 | 3300025961 | Bacteria | 3391 |
| 268 | Ga0207712_10111019 | 3300025961 | Bacteria | 2057 |
| 269 | Ga0207712_10379420 | 3300025961 | Bacteria | 1183 |
| 270 | Ga0207712_10514605 | 3300025961 | Bacteria | 1025 |
| 271 | Ga0207668_10058310 | 3300025972 | Bacteria | 2698 |
| 272 | Ga0207640_10083172 | 3300025981 | Bacteria | 2194 |
| 273 | Ga0207640_10098816 | 3300025981 | Bacteria | 2041 |
| 274 | Ga0207640_10137685 | 3300025981 | Bacteria | 1775 |
| 275 | Ga0207677_10023102 | 3300026023 | Bacteria | 3834 |
| 276 | Ga0207703_10052048 | 3300026035 | Bacteria | 3323 |
| 277 | Ga0207678_10180586 | 3300026067 | Bacteria | 1802 |
| 278 | Ga0207708_10025382 | 3300026075 | Bacteria | 4482 |
| 279 | Ga0207702_10014846 | 3300026078 | Bacteria | 6461 |
| 280 | Ga0207641_10015911 | 3300026088 | Bacteria | 6160 |
| 281 | Ga0207648_10503181 | 3300026089 | Bacteria | 1109 |
| 282 | Ga0207676_10127424 | 3300026095 | Bacteria | 2158 |
| 283 | Ga0207674_10012449 | 3300026116 | Bacteria | 9507 |
| 284 | Ga0207675_100001735 | 3300026118 | Bacteria | 21823 |
| 285 | Ga0207675_100004766 | 3300026118 | Bacteria | 13066 |
| 286 | Ga0207675_100007749 | 3300026118 | Bacteria | 10132 |
| 287 | Ga0207683_10011380 | 3300026121 | Bacteria | 7592 |
| 288 | Ga0207683_10029097 | 3300026121 | Bacteria | 4782 |
| 289 | Ga0207698_10058706 | 3300026142 | Bacteria | 2983 |
| 290 | Ga0207698_10151249 | 3300026142 | Bacteria | 2015 |
| 291 | Ga0207698_10250421 | 3300026142 | Bacteria | 1620 |
| 292 | Ga0207698_10282912 | 3300026142 | Bacteria | 1535 |
| 293 | Ga0209813_10000869 | 3300027866 | Bacteria | 6805 |
| 294 | Ga0207428_10003189 | 3300027907 | Bacteria | 16058 |
| 295 | Ga0207428_10003628 | 3300027907 | Bacteria | 14881 |
| 296 | Ga0207428_10019096 | 3300027907 | Bacteria | 5846 |
| 297 | Ga0268266_10242124 | 3300028379 | Bacteria | 1665 |
| 298 | Ga0268266_10423242 | 3300028379 | Bacteria | 1262 |
| 299 | Ga0268265_10086911 | 3300028380 | Bacteria | 2486 |
| 300 | Ga0268264_10118767 | 3300028381 | Bacteria | 2327 |
| 301 | Ga0265338_10014450 | 3300028800 | Bacteria | 8787 |
| 302 | Ga0265338_10085651 | 3300028800 | Unclassified | 2626 |
| 303 | Ga0265762_1015481 | 3300030760 | Bacteria | 1380 |
| 304 | Ga0265327_10007811 | 3300031251 | Bacteria | 8145 |
| 305 | Ga0265327_10016221 | 3300031251 | Bacteria | 4749 |
| 306 | Ga0307513_10000392 | 3300031456 | Bacteria | 63905 |
| 307 | Ga0316576_10011298 | 3300031727 | Bacteria | 5846 |
| 308 | Ga0316576_10169774 | 3300031727 | Unclassified | 1646 |
| 309 | Ga0316578_10242200 | 3300031728 | Bacteria | 1083 |
| 310 | Ga0307405_10002150 | 3300031731 | Bacteria | 8601 |
| 311 | Ga0307405_10021265 | 3300031731 | Bacteria | 3643 |
| 312 | Ga0307405_10186955 | 3300031731 | Bacteria | 1492 |
| 313 | Ga0307405_10241731 | 3300031731 | Bacteria | 1338 |
| 314 | Ga0307405_10455273 | 3300031731 | Bacteria | 1016 |
| 315 | Ga0307406_10012752 | 3300031901 | Bacteria | 4796 |
| 316 | Ga0307406_10086920 | 3300031901 | Bacteria | 2095 |
| 317 | Ga0307406_10178989 | 3300031901 | Bacteria | 1542 |
| 318 | Ga0307406_10184961 | 3300031901 | Bacteria | 1520 |
| 319 | Ga0307406_10231244 | 3300031901 | Bacteria | 1381 |
| 320 | Ga0307407_10090711 | 3300031903 | Bacteria | 1872 |
| 321 | Ga0307412_10096572 | 3300031911 | Bacteria | 2080 |
| 322 | Ga0307409_100004005 | 3300031995 | Bacteria | 8172 |
| 323 | Ga0307409_100041099 | 3300031995 | Bacteria | 3450 |
| 324 | Ga0307409_100131744 | 3300031995 | Bacteria | 2138 |
| 325 | Ga0307409_100242774 | 3300031995 | Bacteria | 1641 |
| 326 | Ga0307409_100279438 | 3300031995 | Bacteria | 1542 |
| 327 | Ga0307416_100002457 | 3300032002 | Bacteria | 10647 |
| 328 | Ga0307416_100009077 | 3300032002 | Bacteria | 6475 |
| 329 | Ga0307416_100048195 | 3300032002 | Bacteria | 3378 |
| 330 | Ga0307416_100249221 | 3300032002 | Bacteria | 1727 |
| 331 | Ga0307416_100344430 | 3300032002 | Bacteria | 1505 |
| 332 | Ga0307416_100375876 | 3300032002 | Bacteria | 1449 |
| 333 | Ga0307416_100453044 | 3300032002 | Bacteria | 1336 |
| 334 | Ga0307416_100493537 | 3300032002 | Bacteria | 1287 |
| 335 | Ga0307416_100495668 | 3300032002 | Bacteria | 1285 |
| 336 | Ga0307414_10088700 | 3300032004 | Bacteria | 2290 |
| 337 | Ga0307411_10163791 | 3300032005 | Bacteria | 1669 |
| 338 | Ga0307415_100002675 | 3300032126 | Bacteria | 8897 |
| 339 | Ga0307415_100003274 | 3300032126 | Bacteria | 8234 |
| 340 | Ga0307415_100007140 | 3300032126 | Bacteria | 6085 |
| 341 | Ga0307415_100009591 | 3300032126 | Bacteria | 5438 |
| 342 | Ga0307415_100042158 | 3300032126 | Bacteria | 3036 |
| 343 | Ga0307415_100352964 | 3300032126 | Bacteria | 1239 |
| 344 | Ga0307415_100411688 | 3300032126 | Bacteria | 1157 |
| 345 | Ga0373959_0008840 | 3300034820 | Bacteria | 1724 |
| 346 | Ga0373929_0000928 | 3300035085 | Bacteria | 5708 |
| 347 | Ga0373940_0015857 | 3300035088 | Bacteria | 1859 |
| 348 | Ga0373944_0031380 | 3300035089 | Bacteria | 1599 |
| 349 | Ga0373949_0001204 | 3300035090 | Bacteria | 7670 |
| 350 | Ga0373952_0038047 | 3300035092 | Bacteria | 1100 |
| 351 | Ga0373936_0039959 | 3300035113 | Bacteria | 1878 |
| 352 | Ga0373939_0004523 | 3300035114 | Bacteria | 3293 |
| 353 | Ga0373945_0007337 | 3300035116 | Bacteria | 3574 |
| 354 | Ga0373945_0051386 | 3300035116 | Bacteria | 1516 |
| 355 | Ga0373953_0184586 | 3300035117 | Bacteria | 900 |
| 356 | Ga0373960_0058681 | 3300035121 | Bacteria | 1161 |
| 357 | Ga0373943_0001983 | 3300035170 | Bacteria | 9262 |
| 358 | Ga0373943_0012303 | 3300035170 | Bacteria | 3850 |
| 359 | Ga0373946_0000906 | 3300035171 | Bacteria | 10185 |
| 360 | Ga0373946_0040522 | 3300035171 | Bacteria | 1906 |
| 361 | Ga0373955_0023622 | 3300035172 | Bacteria | 3134 |
| 362 | Ga0373961_0021857 | 3300035241 | Bacteria | 1706 |
| 363 | Ga0316574_0038113 | 3300035398 | Bacteria | 2950 |
| 364 | Ga0316574_0039393 | 3300035398 | Bacteria | 2905 |
| 365 | Ga0316574_0047448 | 3300035398 | Bacteria | 2666 |
| 366 | Ga0373931_0008048 | 3300035691 | Bacteria | 4987 |
| 367 | Ga0373935_0032625 | 3300035692 | Bacteria | 3236 |
| 368 | Ga0373935_0040222 | 3300035692 | Bacteria | 2934 |
| 369 | Ga0373933_0082791 | 3300035724 | Bacteria | 1970 |
| 370 | Ga0373947_0000222 | 3300035725 | Bacteria | 31904 |
| 371 | Ga0373947_0007840 | 3300035725 | Bacteria | 6167 |
| 372 | Ga0373947_0315314 | 3300035725 | Bacteria | 1045 |
| 373 | Ga0373937_0092226 | 3300036401 | Bacteria | 2807 |
| 374 | Ga0373925_0025252 | 3300037068 | Bacteria | 4339 |
| 375 | Ga0373925_0061548 | 3300037068 | Bacteria | 2820 |
| 376 | Ga0395899_0005147 | 3300037312 | Bacteria | 10171 |
| 377 | Ga0395899_0043233 | 3300037312 | Bacteria | 3361 |
| 378 | Ga0395899_0064623 | 3300037312 | Bacteria | 2690 |
| 379 | Ga0395899_0193598 | 3300037312 | Bacteria | 1422 |
| 380 | Ga0395899_0196161 | 3300037312 | Bacteria | 1410 |
| 381 | Ga0395900_0001887 | 3300037418 | Bacteria | 23840 |
| 382 | Ga0395900_0011765 | 3300037418 | Bacteria | 8948 |
| 383 | Ga0395900_0013600 | 3300037418 | Bacteria | 8312 |
| 384 | Ga0395900_0018292 | 3300037418 | Bacteria | 7148 |
| 385 | Ga0395900_0325652 | 3300037418 | Bacteria | 1516 |
| 386 | Ga0395900_0445093 | 3300037418 | Bacteria | 1252 |
| 387 | Ga0395900_0507850 | 3300037418 | Bacteria | 1155 |
| 388 | Ga0395898_0008507 | 3300037466 | Bacteria | 10843 |
| 389 | Ga0395898_0013578 | 3300037466 | Bacteria | 8382 |
| 390 | Ga0395898_0014671 | 3300037466 | Bacteria | 8045 |
| 391 | Ga0395898_0082914 | 3300037466 | Bacteria | 3090 |
| 392 | Ga0395898_0369246 | 3300037466 | Bacteria | 1368 |
| 393 | Ga0395905_0008061 | 3300037471 | Bacteria | 10404 |
| 394 | Ga0395905_0029779 | 3300037471 | Bacteria | 5145 |
| 395 | Ga0395905_0084695 | 3300037471 | Bacteria | 2970 |
| 396 | Ga0395905_0167656 | 3300037471 | Bacteria | 2063 |
| 397 | Ga0436364_0295501 | 3300037853 | Bacteria | 13593 |
| 398 | Ga0395901_0002672 | 3300038443 | Bacteria | 17998 |
| 399 | Ga0395901_0011319 | 3300038443 | Bacteria | 9038 |
| 400 | Ga0395901_0014454 | 3300038443 | Bacteria | 8031 |
| 401 | Ga0395901_0040568 | 3300038443 | Bacteria | 4822 |
| 402 | Ga0395901_0128920 | 3300038443 | Bacteria | 2659 |
| 403 | Ga0395901_0158657 | 3300038443 | Bacteria | 2376 |
| 404 | Ga0436365_0019774 | 3300039437 | Bacteria | 20670 |
| 405 | Ga0439436_0009403 | 3300041404 | Bacteria | 2997 |
| 406 | Ga0451800_0708492 | 3300041459 | Bacteria | 2492 |
| 407 | Ga0451835_0995502 | 3300041492 | Bacteria | 2281 |
| 408 | Ga0451853_1140793 | 3300041512 | Bacteria | 4419 |
| 409 | Ga0439448_0008497 | 3300042005 | Bacteria | 3007 |
| 410 | Ga0439450_000063 | 3300042008 | Bacteria | 9955 |
| 411 | Ga0439455_0013568 | 3300042012 | Bacteria | 1847 |
| 412 | Ga0439457_003162 | 3300042014 | Bacteria | 4543 |
| 413 | Ga0439463_000141 | 3300042016 | Bacteria | 18284 |
| 414 | Ga0450914_000726 | 3300042118 | Bacteria | 1735 |
| 415 | Ga0450915_000292 | 3300042119 | Bacteria | 1636 |
| 416 | Ga0450900_004860 | 3300042136 | Bacteria | 1564 |
| 417 | Ga0439458_0011472 | 3300042157 | Bacteria | 1982 |
| 418 | Ga0450909_008199 | 3300042185 | Bacteria | 1517 |
| 419 | Ga0439435_0064674 | 3300042436 | Bacteria | 1072 |
| 420 | Ga0439444_0000359 | 3300042437 | Bacteria | 4872 |
| 421 | Ga0439464_0005081 | 3300042439 | Bacteria | 3386 |
| 422 | Ga0439460_0000688 | 3300042461 | Bacteria | 7490 |
| 423 | Ga0439460_0010487 | 3300042461 | Bacteria | 2373 |
| 424 | Ga0439440_0000076 | 3300042993 | Bacteria | 12427 |
| 425 | Ga0466969_0090602 | 3300044656 | Bacteria | 1449 |
| 426 | Ga0466965_0084440 | 3300044683 | Bacteria | 1608 |
| 427 | Ga0466966_0134286 | 3300044684 | Bacteria | 1514 |
| 428 | Ga0466963_0011149 | 3300044694 | Bacteria | 5468 |
| 429 | Ga0466959_0295416 | 3300045049 | Bacteria | 1110 |
| 430 | Ga0451576_0091689 | 3300045051 | Bacteria | 3161 |
| 431 | Ga0466967_0001726 | 3300045976 | Bacteria | 13025 |
| 432 | Ga0466967_0002670 | 3300045976 | Bacteria | 11254 |
| 433 | Ga0495592_0139865 | 3300046454 | Bacteria | 1685 |
| 434 | Ga0495592_0200987 | 3300046454 | Bacteria | 1345 |
| 435 | Ga0495603_0007444 | 3300046455 | Bacteria | 6584 |
| 436 | Ga0495603_0159256 | 3300046455 | Bacteria | 1310 |
| 437 | Ga0495629_0000214 | 3300046459 | Bacteria | 52123 |
| 438 | Ga0495641_0000795 | 3300046461 | Bacteria | 26778 |
| 439 | Ga0495641_0011242 | 3300046461 | Bacteria | 5119 |
| 440 | Ga0495651_0025628 | 3300046462 | Bacteria | 4592 |
| 441 | Ga0495651_0053561 | 3300046462 | Bacteria | 3105 |
| 442 | Ga0495582_0000389 | 3300046473 | Bacteria | 23879 |
| 443 | Ga0495582_0143336 | 3300046473 | Bacteria | 1355 |
| 444 | Ga0495582_0145990 | 3300046473 | Bacteria | 1342 |
| 445 | Ga0495639_0011451 | 3300046475 | Bacteria | 3824 |
| 446 | Ga0495662_0001778 | 3300046476 | Bacteria | 10785 |
| 447 | Ga0495664_0183449 | 3300046477 | Bacteria | 1269 |
| 448 | Ga0495608_0018463 | 3300046511 | Bacteria | 4810 |
| 449 | Ga0495608_0042456 | 3300046511 | Bacteria | 3041 |
| 450 | Ga0495616_0109872 | 3300046513 | Bacteria | 1282 |
| 451 | Ga0495618_0112034 | 3300046514 | Bacteria | 1747 |
| 452 | Ga0495630_0080335 | 3300046517 | Bacteria | 2459 |
| 453 | Ga0495630_0181401 | 3300046517 | Bacteria | 1605 |
| 454 | Ga0495644_0066990 | 3300046523 | Bacteria | 1349 |
| 455 | Ga0495663_0015632 | 3300046525 | Bacteria | 2139 |
| 456 | Ga0495652_0167729 | 3300046529 | Bacteria | 1697 |
| 457 | Ga0495640_0011559 | 3300046533 | Bacteria | 6787 |
| 458 | Ga0495587_0012552 | 3300046536 | Bacteria | 5327 |
| 459 | Ga0495587_0111034 | 3300046536 | Bacteria | 1575 |
| 460 | Ga0495621_0008214 | 3300046539 | Bacteria | 3121 |
| 461 | Ga0495645_0129003 | 3300046543 | Bacteria | 1774 |
| 462 | Ga0495667_0046189 | 3300046559 | Bacteria | 2880 |
| 463 | Ga0495667_0122127 | 3300046559 | Bacteria | 1681 |
| 464 | Ga0495667_0210350 | 3300046559 | Bacteria | 1243 |
| 465 | Ga0495656_0024211 | 3300046615 | Bacteria | 2395 |
| 466 | Ga0495656_0168679 | 3300046615 | Unclassified | 1069 |
| 467 | Ga0495634_0027180 | 3300046642 | Bacteria | 3982 |
| 468 | Ga0495634_0074471 | 3300046642 | Bacteria | 2231 |
| 469 | Ga0495611_0056852 | 3300046648 | Bacteria | 1772 |
| 470 | Ga0495635_0008410 | 3300046663 | Bacteria | 7203 |
| 471 | Ga0495635_0064663 | 3300046663 | Bacteria | 2511 |
| 472 | Ga0495657_0072414 | 3300046675 | Bacteria | 2247 |
| 473 | Ga0495623_0034884 | 3300046679 | Bacteria | 3225 |
| 474 | Ga0495623_0068429 | 3300046679 | Bacteria | 2215 |
| 475 | Ga0495647_0006683 | 3300046681 | Bacteria | 3834 |
| 476 | Ga0495647_0163611 | 3300046681 | Bacteria | 960 |
| 477 | Ga0495658_0043129 | 3300046683 | Bacteria | 2521 |
| 478 | Ga0495658_0064288 | 3300046683 | Bacteria | 2113 |
| 479 | Ga0495658_0272666 | 3300046683 | Bacteria | 1067 |
| 480 | Ga0495613_0011809 | 3300046689 | Bacteria | 6487 |
| 481 | Ga0495613_0263903 | 3300046689 | Bacteria | 1199 |
| 482 | Ga0495624_0045099 | 3300046690 | Bacteria | 2808 |
| 483 | Ga0495589_0152536 | 3300046794 | Bacteria | 1103 |
| 484 | Ga0495600_0005394 | 3300046809 | Bacteria | 7709 |
| 485 | Ga0495581_0001758 | 3300047315 | Bacteria | 12088 |
| 486 | Ga0495604_0129753 | 3300047317 | Bacteria | 1813 |
| 487 | Ga0495674_0011290 | 3300047319 | Bacteria | 8432 |
| 488 | Ga0495676_0015151 | 3300047321 | Bacteria | 6878 |
| 489 | Ga0495676_0041943 | 3300047321 | Bacteria | 3762 |
| 490 | Ga0495676_0085237 | 3300047321 | Bacteria | 2381 |
| 491 | Ga0495676_0124080 | 3300047321 | Bacteria | 1874 |
| 492 | Ga0495676_0264688 | 3300047321 | Bacteria | 1169 |
| 493 | Ga0495680_0000519 | 3300047322 | Bacteria | 43595 |
| 494 | Ga0495680_0008616 | 3300047322 | Bacteria | 9258 |
| 495 | Ga0495680_0009668 | 3300047322 | Bacteria | 8652 |
| 496 | Ga0495680_0027614 | 3300047322 | Bacteria | 4660 |
| 497 | Ga0495675_0019865 | 3300047444 | Bacteria | 4269 |
| 498 | Ga0495684_0008163 | 3300047471 | Bacteria | 8099 |
| 499 | Ga0495684_0019284 | 3300047471 | Bacteria | 5251 |
| 500 | Ga0495684_0150918 | 3300047471 | Bacteria | 1737 |
| 501 | Ga0495593_0052305 | 3300047673 | Bacteria | 2159 |
| 502 | Ga0495593_0135290 | 3300047673 | Bacteria | 1250 |
| 503 | Ga0496100_0007047 | 3300048903 | Bacteria | 6168 |
| 504 | Ga0496100_0039628 | 3300048903 | Bacteria | 2992 |
| 505 | Ga0496100_0230407 | 3300048903 | Bacteria | 1363 |
| 506 | Ga0496100_0576410 | 3300048903 | Bacteria | 872 |
| 507 | Ga0496101_0007021 | 3300048904 | Bacteria | 7277 |
| 508 | Ga0496101_0012587 | 3300048904 | Bacteria | 5649 |
| 509 | Ga0496101_0100241 | 3300048904 | Bacteria | 2166 |
| 510 | Ga0496101_0193959 | 3300048904 | Bacteria | 1568 |
| 511 | Ga0496101_0236237 | 3300048904 | Bacteria | 1422 |
| 512 | Ga0496101_0295936 | 3300048904 | Bacteria | 1267 |
| 513 | Ga0496101_0336184 | 3300048904 | Bacteria | 1186 |
| 514 | Ga0496101_0436781 | 3300048904 | Bacteria | 1032 |
| 515 | Ga0496102_0004167 | 3300048905 | Bacteria | 12236 |
| 516 | Ga0496102_0021504 | 3300048905 | Bacteria | 5706 |
| 517 | Ga0496102_0099599 | 3300048905 | Bacteria | 2698 |
| 518 | Ga0496104_0000921 | 3300048907 | Bacteria | 25212 |
| 519 | Ga0496104_0039575 | 3300048907 | Bacteria | 4414 |
| 520 | Ga0496104_0115337 | 3300048907 | Bacteria | 2577 |
| 521 | Ga0496104_0156730 | 3300048907 | Bacteria | 2185 |
| 522 | Ga0496104_0195399 | 3300048907 | Bacteria | 1935 |
| 523 | Ga0496104_0246932 | 3300048907 | Bacteria | 1698 |
| 524 | Ga0496105_0011698 | 3300048908 | Bacteria | 6942 |
| 525 | Ga0496105_0013191 | 3300048908 | Bacteria | 6555 |
| 526 | Ga0496105_0140701 | 3300048908 | Bacteria | 1986 |
| 527 | Ga0496105_0232634 | 3300048908 | Bacteria | 1497 |
| 528 | Ga0496106_0030633 | 3300048909 | Bacteria | 4010 |
| 529 | Ga0496106_0039567 | 3300048909 | Bacteria | 3531 |
| 530 | Ga0496106_0081536 | 3300048909 | Bacteria | 2486 |
| 531 | Ga0496107_0013656 | 3300048910 | Bacteria | 5678 |
| 532 | Ga0496107_0043112 | 3300048910 | Bacteria | 3241 |
| 533 | Ga0496107_0080534 | 3300048910 | Bacteria | 2375 |
| 534 | Ga0496107_0164230 | 3300048910 | Bacteria | 1646 |
| 535 | Ga0496108_0002495 | 3300048911 | Bacteria | 14728 |
| 536 | Ga0496108_0043315 | 3300048911 | Bacteria | 3760 |
| 537 | Ga0496108_0155994 | 3300048911 | Bacteria | 1971 |
| 538 | Ga0496109_0005924 | 3300048912 | Bacteria | 10257 |
| 539 | Ga0496109_0008723 | 3300048912 | Bacteria | 8633 |
| 540 | Ga0496109_0031853 | 3300048912 | Bacteria | 4736 |
| 541 | Ga0496109_0248645 | 3300048912 | Bacteria | 1674 |
| 542 | Ga0496110_0005696 | 3300048913 | Bacteria | 9784 |
| 543 | Ga0496110_0043298 | 3300048913 | Bacteria | 3931 |
| 544 | Ga0496110_0237498 | 3300048913 | Bacteria | 1658 |
| 545 | Ga0496110_0356125 | 3300048913 | Bacteria | 1333 |
| 546 | Ga0496110_0367716 | 3300048913 | Bacteria | 1310 |
| 547 | Ga0496110_0410042 | 3300048913 | Bacteria | 1235 |
| 548 | Ga0496110_0543341 | 3300048913 | Bacteria | 1056 |
| 549 | Ga0496111_0015454 | 3300048914 | Bacteria | 5241 |
| 550 | Ga0496111_0016621 | 3300048914 | Bacteria | 5073 |
| 551 | Ga0496111_0041879 | 3300048914 | Bacteria | 3288 |
| 552 | Ga0496111_0048134 | 3300048914 | Bacteria | 3072 |
| 553 | Ga0496111_0123226 | 3300048914 | Bacteria | 1915 |
| 554 | Ga0496111_0508569 | 3300048914 | Bacteria | 886 |
| 555 | Ga0496112_0000998 | 3300048915 | Bacteria | 20731 |
| 556 | Ga0496112_0002635 | 3300048915 | Bacteria | 14499 |
| 557 | Ga0496112_0037461 | 3300048915 | Bacteria | 4733 |
| 558 | Ga0496112_0560780 | 3300048915 | Bacteria | 1076 |
| 559 | Ga0496113_0002742 | 3300048916 | Bacteria | 10355 |
| 560 | Ga0496113_0407486 | 3300048916 | Bacteria | 1092 |
| 561 | Ga0496114_0015313 | 3300048917 | Bacteria | 6165 |
| 562 | Ga0496114_0041450 | 3300048917 | Bacteria | 3816 |
| 563 | Ga0496114_0051296 | 3300048917 | Bacteria | 3435 |
| 564 | Ga0496114_0066961 | 3300048917 | Bacteria | 3012 |
| 565 | Ga0496114_0079857 | 3300048917 | Bacteria | 2762 |
| 566 | Ga0496114_0099380 | 3300048917 | Bacteria | 2482 |
| 567 | Ga0496114_0141495 | 3300048917 | Bacteria | 2083 |
| 568 | Ga0496114_0150832 | 3300048917 | Bacteria | 2017 |
| 569 | Ga0496115_0005039 | 3300048918 | Bacteria | 9598 |
| 570 | Ga0496115_0021730 | 3300048918 | Bacteria | 4961 |
| 571 | Ga0496115_0104947 | 3300048918 | Bacteria | 2319 |
| 572 | Ga0496115_0197155 | 3300048918 | Bacteria | 1664 |
| 573 | Ga0496115_0461675 | 3300048918 | Bacteria | 1024 |
| 574 | Ga0501031_0004169 | 3300049568 | Bacteria | 9338 |
| 575 | Ga0501031_0007447 | 3300049568 | Bacteria | 7129 |
| 576 | Ga0501031_0015950 | 3300049568 | Bacteria | 4877 |
| 577 | Ga0501031_0220168 | 3300049568 | Bacteria | 1236 |
| 578 | Ga0501032_0037047 | 3300049569 | Bacteria | 3327 |
| 579 | Ga0501032_0098357 | 3300049569 | Bacteria | 1939 |
| 580 | Ga0501032_0172408 | 3300049569 | Bacteria | 1418 |
| 581 | Ga0501033_0001873 | 3300049570 | Bacteria | 18293 |
| 582 | Ga0501033_0039695 | 3300049570 | Bacteria | 3516 |
| 583 | Ga0501036_0000538 | 3300049572 | Bacteria | 27128 |
| 584 | Ga0501036_0000787 | 3300049572 | Bacteria | 23494 |
| 585 | Ga0501036_0010571 | 3300049572 | Bacteria | 7625 |
| 586 | Ga0501036_0011055 | 3300049572 | Bacteria | 7463 |
| 587 | Ga0501036_0143968 | 3300049572 | Bacteria | 2011 |
| 588 | Ga0501037_0010194 | 3300049573 | Bacteria | 6892 |
| 589 | Ga0501037_0022267 | 3300049573 | Bacteria | 4688 |
| 590 | Ga0501037_0033494 | 3300049573 | Bacteria | 3793 |
| 591 | Ga0501037_0097890 | 3300049573 | Bacteria | 2119 |
| 592 | Ga0501038_0002433 | 3300049574 | Bacteria | 17334 |
| 593 | Ga0501038_0002454 | 3300049574 | Bacteria | 17276 |
| 594 | Ga0501038_0008663 | 3300049574 | Bacteria | 9343 |
| 595 | Ga0501038_0216373 | 3300049574 | Bacteria | 1531 |
| 596 | Ga0501038_0531264 | 3300049574 | Bacteria | 897 |
| 597 | Ga0501039_0002345 | 3300049575 | Bacteria | 14086 |
| 598 | Ga0501039_0002478 | 3300049575 | Bacteria | 13750 |
| 599 | Ga0501039_0012574 | 3300049575 | Bacteria | 6468 |
| 600 | Ga0501039_0017994 | 3300049575 | Bacteria | 5420 |
| 601 | Ga0501040_0001578 | 3300049576 | Bacteria | 14518 |
| 602 | Ga0501040_0020050 | 3300049576 | Bacteria | 4453 |
| 603 | Ga0501040_0028765 | 3300049576 | Bacteria | 3747 |
| 604 | Ga0501040_0065718 | 3300049576 | Bacteria | 2498 |
| 605 | Ga0501041_0000374 | 3300049577 | Bacteria | 22334 |
| 606 | Ga0501041_0001907 | 3300049577 | Bacteria | 11681 |
| 607 | Ga0501041_0004851 | 3300049577 | Bacteria | 7817 |
| 608 | Ga0501041_0046712 | 3300049577 | Bacteria | 2634 |
| 609 | Ga0501041_0198212 | 3300049577 | Bacteria | 1258 |
| 610 | Ga0501041_0287903 | 3300049577 | Bacteria | 1034 |
| 611 | Ga0501042_0001590 | 3300049578 | Bacteria | 13487 |
| 612 | Ga0501042_0003308 | 3300049578 | Bacteria | 10084 |
| 613 | Ga0501042_0431433 | 3300049578 | Bacteria | 955 |
| 614 | Ga0501043_0019361 | 3300049579 | Bacteria | 5344 |
| 615 | Ga0501043_0023348 | 3300049579 | Bacteria | 4851 |
| 616 | Ga0501046_0003448 | 3300049580 | Bacteria | 14511 |
| 617 | Ga0501046_0008214 | 3300049580 | Bacteria | 9115 |
| 618 | Ga0501046_0052538 | 3300049580 | Bacteria | 3211 |
| 619 | Ga0501047_0107379 | 3300049581 | Bacteria | 2673 |
| 620 | Ga0501048_0000098 | 3300049582 | Bacteria | 47500 |
| 621 | Ga0501048_0000481 | 3300049582 | Bacteria | 27939 |
| 622 | Ga0501048_0003830 | 3300049582 | Bacteria | 11473 |
| 623 | Ga0501048_0101152 | 3300049582 | Bacteria | 2033 |
| 624 | Ga0501048_0438988 | 3300049582 | Bacteria | 934 |
| 625 | Ga0501068_0002427 | 3300049584 | Bacteria | 9891 |
| 626 | Ga0501068_0023466 | 3300049584 | Bacteria | 3615 |
| 627 | Ga0501069_0000057 | 3300049585 | Bacteria | 64652 |
| 628 | Ga0501070_0001915 | 3300049586 | Bacteria | 18377 |
| 629 | Ga0501070_0034064 | 3300049586 | Bacteria | 4260 |
| 630 | Ga0501071_0000131 | 3300049587 | Bacteria | 30323 |
| 631 | Ga0501071_0004254 | 3300049587 | Bacteria | 9068 |
| 632 | Ga0501071_0032632 | 3300049587 | Bacteria | 3699 |
| 633 | Ga0501071_0040430 | 3300049587 | Bacteria | 3336 |
| 634 | Ga0501071_0061919 | 3300049587 | Bacteria | 2710 |
| 635 | Ga0501072_0000411 | 3300049588 | Bacteria | 30561 |
| 636 | Ga0501072_0011944 | 3300049588 | Bacteria | 6632 |
| 637 | Ga0501072_0057109 | 3300049588 | Bacteria | 3075 |
| 638 | Ga0501072_0153808 | 3300049588 | Bacteria | 1834 |
| 639 | Ga0501072_0164108 | 3300049588 | Bacteria | 1772 |
| 640 | Ga0501073_0001913 | 3300049589 | Bacteria | 15506 |
| 641 | Ga0501073_0043620 | 3300049589 | Bacteria | 3163 |
| 642 | Ga0501074_0001213 | 3300049590 | Bacteria | 16973 |
| 643 | Ga0501074_0003268 | 3300049590 | Bacteria | 11455 |
| 644 | Ga0501074_0015737 | 3300049590 | Bacteria | 5499 |
| 645 | Ga0501074_0074727 | 3300049590 | Bacteria | 2433 |
| 646 | Ga0501074_0352239 | 3300049590 | Bacteria | 1045 |
| 647 | Ga0501075_0000514 | 3300049591 | Bacteria | 23371 |
| 648 | Ga0501075_0012860 | 3300049591 | Bacteria | 5959 |
| 649 | Ga0501075_0016678 | 3300049591 | Bacteria | 5297 |
| 650 | Ga0501075_0241482 | 3300049591 | Bacteria | 1377 |
| 651 | Ga0501076_0000661 | 3300049592 | Bacteria | 22080 |
| 652 | Ga0501076_0001524 | 3300049592 | Bacteria | 15521 |
| 653 | Ga0501076_0018619 | 3300049592 | Bacteria | 5297 |
| 654 | Ga0501076_0046936 | 3300049592 | Bacteria | 3413 |
| 655 | Ga0501076_0156841 | 3300049592 | Bacteria | 1853 |
| 656 | Ga0501077_0007978 | 3300049593 | Bacteria | 6544 |
| 657 | Ga0501077_0009989 | 3300049593 | Bacteria | 5906 |
| 658 | Ga0501077_0024744 | 3300049593 | Bacteria | 3812 |
| 659 | Ga0501077_0040937 | 3300049593 | Bacteria | 2950 |
| 660 | Ga0501077_0074730 | 3300049593 | Bacteria | 2146 |
| 661 | Ga0501079_0002022 | 3300049741 | Bacteria | 14514 |
| 662 | Ga0501079_0004369 | 3300049741 | Bacteria | 10477 |
| 663 | Ga0501079_0025195 | 3300049741 | Bacteria | 4562 |
| 664 | Ga0501079_0034208 | 3300049741 | Bacteria | 3910 |
| 665 | Ga0501080_0024241 | 3300049742 | Bacteria | 5625 |
| 666 | Ga0501080_0060606 | 3300049742 | Bacteria | 3523 |
| 667 | Ga0501081_0000176 | 3300049743 | Bacteria | 30222 |
| 668 | Ga0501081_0001624 | 3300049743 | Bacteria | 13892 |
| 669 | Ga0501081_0006158 | 3300049743 | Bacteria | 7770 |
| 670 | Ga0501083_0005857 | 3300049744 | Bacteria | 8700 |
| 671 | Ga0501083_0133204 | 3300049744 | Bacteria | 1629 |
| 672 | Ga0501035_0002693 | 3300049822 | Bacteria | 17280 |
| 673 | Ga0501035_0015152 | 3300049822 | Bacteria | 7116 |
| 674 | Ga0501035_0062613 | 3300049822 | Bacteria | 3310 |
| 675 | Ga0501035_0114846 | 3300049822 | Bacteria | 2357 |
| 676 | Ga0501044_0015084 | 3300049823 | Bacteria | 8326 |
| 677 | Ga0501044_0130533 | 3300049823 | Bacteria | 2507 |
| 678 | Ga0501045_0001824 | 3300049824 | Bacteria | 14375 |
| 679 | Ga0501045_0005852 | 3300049824 | Bacteria | 8509 |
| 680 | Ga0501045_0010082 | 3300049824 | Bacteria | 6609 |
| 681 | Ga0501045_0073215 | 3300049824 | Bacteria | 2522 |
| 682 | Ga0501045_0077872 | 3300049824 | Bacteria | 2444 |
| 683 | Ga0501045_0193193 | 3300049824 | Bacteria | 1517 |
| 684 | nmdc:mga05p37_132299_c1 | 3300050507 | Bacteria | 3061 |
| 685 | nmdc:mga05p37_161335_c1 | 3300050507 | Bacteria | 2738 |
| 686 | nmdc:mga05p37_181668_c1 | 3300050507 | Bacteria | 2559 |
| 687 | nmdc:mga05p37_514848_c1 | 3300050507 | Bacteria | 1370 |
| 688 | nmdc:mga05p37_7880_c1 | 3300050507 | Bacteria | 12571 |
| 689 | nmdc:mga09592_115313_c1 | 3300050508 | Bacteria | 2306 |
| 690 | nmdc:mga09592_28356_c1 | 3300050508 | Bacteria | 4651 |
| 691 | nmdc:mga09592_481568_c1 | 3300050508 | Bacteria | 1069 |
| 692 | nmdc:mga09592_73566_c1 | 3300050508 | Bacteria | 2904 |
| 693 | nmdc:mga0qj67_15563_c1 | 3300050509 | Bacteria | 5759 |
| 694 | nmdc:mga0qj67_226027_c1 | 3300050509 | Bacteria | 1519 |
| 695 | nmdc:mga0qj67_27078_c1 | 3300050509 | Bacteria | 4441 |
| 696 | nmdc:mga06r32_234787_c1 | 3300050510 | Bacteria | 1822 |
| 697 | nmdc:mga06r32_55835_c1 | 3300050510 | Bacteria | 3789 |
| 698 | nmdc:mga06r32_7763_c1 | 3300050510 | Bacteria | 9645 |
| 699 | nmdc:mga08y16_129137_c1 | 3300050511 | Bacteria | 2629 |
| 700 | nmdc:mga08y16_154366_c1 | 3300050511 | Bacteria | 2386 |
| 701 | nmdc:mga08y16_172211_c1 | 3300050511 | Bacteria | 2249 |
| 702 | nmdc:mga08y16_387127_c1 | 3300050511 | Bacteria | 1433 |
| 703 | nmdc:mga08y16_44675_c1 | 3300050511 | Bacteria | 4643 |
| 704 | nmdc:mga0n895_175314_c1 | 3300050512 | Bacteria | 2175 |
| 705 | nmdc:mga0n895_187916_c1 | 3300050512 | Bacteria | 2097 |
| 706 | nmdc:mga0n895_31890_c1 | 3300050512 | Bacteria | 5052 |
| 707 | nmdc:mga0n895_6658_c1 | 3300050512 | Bacteria | 9846 |
| 708 | nmdc:mga0rr50_351859_c1 | 3300050513 | Bacteria | 1239 |
| 709 | nmdc:mga0rr50_61963_c1 | 3300050513 | Bacteria | 2820 |
| 710 | nmdc:mga08x19_11682_c1 | 3300050514 | Bacteria | 5288 |
| 711 | nmdc:mga0a205_13461_c1 | 3300050515 | Bacteria | 7615 |
| 712 | nmdc:mga0a205_6619_c2 | 3300050515 | Bacteria | 5956 |
| 713 | Ga0495601_0027475 | 3300053077 | Bacteria | 3518 |
| 714 | Ga0495601_0167993 | 3300053077 | Bacteria | 1433 |
| 715 | Ga0495601_0329848 | 3300053077 | Bacteria | 993 |
| 716 | Ga0495595_0026888 | 3300053084 | Bacteria | 2559 |
| 717 | Ga0495595_0150175 | 3300053084 | Bacteria | 1146 |
| 718 | Ga0495619_0001579 | 3300053085 | Bacteria | 14982 |
| 719 | Ga0495619_0002099 | 3300053085 | Bacteria | 13226 |
| 720 | Ga0495619_0081954 | 3300053085 | Bacteria | 2173 |
| 721 | Ga0501084_0000414 | 3300054114 | Bacteria | 33024 |
| 722 | Ga0501084_0004136 | 3300054114 | Bacteria | 11824 |
| 723 | Ga0501084_0075829 | 3300054114 | Bacteria | 2817 |
| 724 | Ga0501084_0135921 | 3300054114 | Bacteria | 2069 |
| 725 | Ga0501084_0332480 | 3300054114 | Bacteria | 1283 |
| 726 | Ga0501082_0003100 | 3300060353 | Bacteria | 14482 |
| 727 | Ga0501082_0036561 | 3300060353 | Bacteria | 4230 |
| 728 | Ga0501082_0060115 | 3300060353 | Bacteria | 3273 |
| 729 | Ga0501082_0069151 | 3300060353 | Bacteria | 3040 |
| 730 | Ga0501082_0406078 | 3300060353 | Bacteria | 1189 |
| 731 | Ga0530510_0000576 | 3300061734 | Bacteria | 23667 |
| 732 | Ga0530510_0007084 | 3300061734 | Bacteria | 7803 |
| 733 | Ga0530510_0013764 | 3300061734 | Bacteria | 5695 |
| 734 | Ga0530510_0047826 | 3300061734 | Bacteria | 3091 |
| 735 | Ga0530510_0105244 | 3300061734 | Bacteria | 2065 |
| 736 | Ga0530510_0118183 | 3300061734 | Bacteria | 1945 |
| 737 | Ga0530510_0306551 | 3300061734 | Bacteria | 1189 |
| 738 | 2785339372 | 2784746763 | Bacteria | 9783172 |
| 739 | 2809026195 | 2808606394 | Bacteria | 6248540 |
| 740 | 2812374828 | 2811994882 | Bacteria | 4688362 |
| 741 | 2954004277 | 2954002825 | Bacteria | 9173742 |
| 742 | 3006497655 | 3006493962 | Bacteria | 8825450 |
| 743 | 8048411286 | 8048406513 | Bacteria | 8936924 |
| 744 | Ga0395899_0001465 | |||
| 745 | JGI24737J22298_10037680 | |||
| 746 | Ga0070658_10015743 | |||
| 747 | Ga0070658_10178513 | |||
| 748 | Ga0070683_100007790 | |||
| 749 | Ga0070683_100069543 | |||
| 750 | Ga0070683_100128326 | |||
| 751 | Ga0070690_100013375 | |||
| 752 | Ga0070690_100133682 | |||
| 753 | Ga0068869_100085320 | |||
| 754 | Ga0070680_100333103 | |||
| 755 | Ga0070682_100002964 | |||
| 756 | Ga0070682_100595744 | |||
| 757 | Ga0070689_100300981 | |||
| 758 | Ga0070687_100098048 | |||
| 759 | Ga0070661_100030031 | |||
| 760 | Ga0070692_10049385 | |||
| 761 | Ga0070668_100050405 | |||
| 762 | Ga0070668_100098809 | |||
| 763 | Ga0070668_100469552 | |||
| 764 | Ga0070669_100282723 | |||
| 765 | Ga0070673_100012935 | |||
| 766 | Ga0070673_100142675 | |||
| 767 | Ga0070673_100356176 | |||
| 768 | Ga0070688_100038602 | |||
| 769 | Ga0070688_100071960 | |||
| 770 | Ga0070659_100043969 | |||
| 771 | Ga0070659_100088679 | |||
| 772 | Ga0070659_100149215 | |||
| 773 | Ga0070659_100275814 | |||
| 774 | Ga0070709_10127745 | |||
| 775 | Ga0070714_100130732 | |||
| 776 | Ga0070714_100141222 | |||
| 777 | Ga0070714_100213349 | |||
| 778 | Ga0070710_10017156 | |||
| 779 | Ga0070711_100038243 | |||
| 780 | Ga0070711_100161526 | |||
| 781 | Ga0070711_100241815 | |||
| 782 | Ga0070705_100027660 | |||
| 783 | Ga0070700_100060207 | |||
| 784 | Ga0070694_100041209 | |||
| 785 | Ga0070694_100118076 | |||
| 786 | Ga0070694_100182178 | |||
| 787 | Ga0070708_100005227 | |||
| 788 | Ga0070678_100042660 | |||
| 789 | Ga0070662_100019408 | |||
| 790 | Ga0070662_100239719 | |||
| 791 | Ga0070662_100316470 | |||
| 792 | Ga0070685_10049834 | |||
| 793 | Ga0070706_100129698 | |||
| 794 | Ga0070707_100183598 | |||
| 795 | Ga0070684_100002606 | |||
| 796 | Ga0070684_100024457 | |||
| 797 | Ga0070684_100087361 | |||
| 798 | Ga0070684_100115184 | |||
| 799 | Ga0068853_100229882 | |||
| 800 | Ga0070672_100048923 | |||
| 801 | Ga0070696_100099751 | |||
| 802 | Ga0070693_100080118 | |||
| 803 | Ga0070665_100215942 | |||
| 804 | Ga0070704_100054820 | |||
| 805 | Ga0068855_100239103 | |||
| 806 | Ga0068857_100007505 | |||
| 807 | Ga0068854_100080723 | |||
| 808 | Ga0068854_100312114 | |||
| 809 | Ga0068854_100317532 | |||
| 810 | Ga0068856_100021396 | |||
| 811 | Ga0068856_100145936 | |||
| 812 | Ga0068856_100260068 | |||
| 813 | Ga0068856_100735224 | |||
| 814 | Ga0068852_100110710 | |||
| 815 | Ga0068859_100117355 | |||
| 816 | Ga0068864_100128119 | |||
| 817 | Ga0068861_100013200 | |||
| 818 | Ga0068861_100017053 | |||
| 819 | Ga0068861_100093597 | |||
| 820 | Ga0068861_100416085 | |||
| 821 | Ga0068863_100034347 | |||
| 822 | Ga0068863_100229875 | |||
| 823 | Ga0068860_100047755 | |||
| 824 | Ga0081455_10003312 | |||
| 825 | Ga0081455_10005672 | |||
| 826 | Ga0081540_1012151 | |||
| 827 | Ga0081540_1012499 | |||
| 828 | Ga0081540_1018916 | |||
| 829 | Ga0081540_1056135 | |||
| 830 | Ga0081539_10034701 | |||
| 831 | Ga0070717_10232972 | |||
| 832 | Ga0075368_10010991 | |||
| 833 | Ga0075432_10003179 | |||
| 834 | Ga0075432_10009129 | |||
| 835 | Ga0070715_10125562 | |||
| 836 | Ga0070716_100167470 | |||
| 837 | Ga0070712_100007109 | |||
| 838 | Ga0070712_100049752 | |||
| 839 | Ga0070712_100071680 | |||
| 840 | Ga0070712_100129175 | |||
| 841 | Ga0075367_10000127 | |||
| 842 | Ga0075427_10000746 | |||
| 843 | Ga0097621_100425993 | |||
| 844 | Ga0075428_100058792 | |||
| 845 | Ga0075428_100077313 | |||
| 846 | Ga0075428_100077957 | |||
| 847 | Ga0075428_100581615 | |||
| 848 | Ga0075430_100006466 | |||
| 849 | Ga0075430_100034253 | |||
| 850 | Ga0075430_100202754 | |||
| 851 | Ga0075431_100017064 | |||
| 852 | Ga0075431_100020320 | |||
| 853 | Ga0075431_100150144 | |||
| 854 | Ga0075433_10005658 | |||
| 855 | Ga0075434_100003843 | |||
| 856 | Ga0075434_100171205 | |||
| 857 | Ga0075429_100069739 | |||
| 858 | Ga0075429_100115886 | |||
| 859 | Ga0075429_100183473 | |||
| 860 | Ga0068865_100010528 | |||
| 861 | Ga0068865_100223563 | |||
| 862 | Ga0075436_100021504 | |||
| 863 | Ga0075436_100076848 | |||
| 864 | Ga0097620_100117350 | |||
| 865 | Ga0075435_100017672 | |||
| 866 | Ga0111539_10004429 | |||
| 867 | Ga0111539_10006657 | |||
| 868 | Ga0111539_10519891 | |||
| 869 | Ga0105245_10003498 | |||
| 870 | Ga0105245_10004959 | |||
| 871 | Ga0105245_10009422 | |||
| 872 | Ga0105245_10030070 | |||
| 873 | Ga0105245_10049735 | |||
| 874 | Ga0105245_10053555 | |||
| 875 | Ga0105245_10070022 | |||
| 876 | Ga0105245_10075688 | |||
| 877 | Ga0105245_10264872 | |||
| 878 | Ga0114129_10002442 | |||
| 879 | Ga0114129_10116558 | |||
| 880 | Ga0114129_10140917 | |||
| 881 | Ga0114129_10170295 | |||
| 882 | Ga0114129_10219464 | |||
| 883 | Ga0114129_10272190 | |||
| 884 | Ga0105243_10008596 | |||
| 885 | Ga0105243_10245396 | |||
| 886 | Ga0105243_10361432 | |||
| 887 | Ga0105243_10553918 | |||
| 888 | Ga0105241_10026812 | |||
| 889 | Ga0105242_10070593 | |||
| 890 | Ga0105242_10167761 | |||
| 891 | Ga0105242_10326781 | |||
| 892 | Ga0105242_10400145 | |||
| 893 | Ga0105248_10164830 | |||
| 894 | Ga0105248_10179747 | |||
| 895 | Ga0105248_10304569 | |||
| 896 | Ga0105248_10573591 | |||
| 897 | Ga0105237_10364398 | |||
| 898 | Ga0105237_10535619 | |||
| 899 | Ga0105238_10057804 | |||
| 900 | Ga0105238_10632839 | |||
| 901 | Ga0105249_10014389 | |||
| 902 | Ga0105249_10014923 | |||
| 903 | Ga0105249_10023359 | |||
| 904 | Ga0105249_10106663 | |||
| 905 | Ga0105249_10108974 | |||
| 906 | Ga0105239_10000854 | |||
| 907 | Ga0105239_10126266 | |||
| 908 | Ga0105239_10551954 | |||
| 909 | Ga0105246_10000321 | |||
| 910 | Ga0105246_10245237 | |||
| 911 | Ga0157369_10273107 | |||
| 912 | Ga0157369_10484608 | |||
| 913 | Ga0157374_10079468 | |||
| 914 | Ga0157374_10169153 | |||
| 915 | Ga0157378_10010899 | |||
| 916 | Ga0157378_10176142 | |||
| 917 | Ga0163162_10041769 | |||
| 918 | Ga0163162_10093000 | |||
| 919 | Ga0163162_10162043 | |||
| 920 | Ga0163162_10255562 | |||
| 921 | Ga0163162_10277297 | |||
| 922 | Ga0163162_10401614 | |||
| 923 | Ga0157372_10010217 | |||
| 924 | Ga0157372_10417211 | |||
| 925 | Ga0157375_10016368 | |||
| 926 | Ga0157375_10074964 | |||
| 927 | Ga0157375_10153844 | |||
| 928 | Ga0157375_10189535 | |||
| 929 | Ga0163163_10029804 | |||
| 930 | Ga0163163_10057048 | |||
| 931 | Ga0182008_10002142 | |||
| 932 | Ga0182008_10109282 | |||
| 933 | Ga0157376_10413138 | |||
| 934 | Ga0182006_1035134 | |||
| 935 | Ga0182007_10000163 | |||
| 936 | Ga0213876_10008277 | |||
| 937 | Ga0213875_10000921 | |||
| 938 | Ga0209646_1000168 | |||
| 939 | Ga0207653_10001294 | |||
| 940 | Ga0207692_10115783 | |||
| 941 | Ga0207642_10026636 | |||
| 942 | Ga0207642_10045572 | |||
| 943 | Ga0207642_10150544 | |||
| 944 | Ga0207688_10007114 | |||
| 945 | Ga0207688_10010141 | |||
| 946 | Ga0207647_10073819 | |||
| 947 | Ga0207647_10116650 | |||
| 948 | Ga0207685_10007674 | |||
| 949 | Ga0207645_10033502 | |||
| 950 | Ga0207645_10098316 | |||
| 951 | Ga0207705_10021619 | |||
| 952 | Ga0207684_10055388 | |||
| 953 | Ga0207684_10258388 | |||
| 954 | Ga0207654_10304327 | |||
| 955 | Ga0207671_10135497 | |||
| 956 | Ga0207693_10001310 | |||
| 957 | Ga0207693_10006783 | |||
| 958 | Ga0207693_10113464 | |||
| 959 | Ga0207693_10195113 | |||
| 960 | Ga0207693_10217057 | |||
| 961 | Ga0207693_10281846 | |||
| 962 | Ga0207663_10392415 | |||
| 963 | Ga0207660_10145178 | |||
| 964 | Ga0207662_10024759 | |||
| 965 | Ga0207681_10288804 | |||
| 966 | Ga0207694_10093370 | |||
| 967 | Ga0207694_10466132 | |||
| 968 | Ga0207650_10097661 | |||
| 969 | Ga0207650_10179036 | |||
| 970 | Ga0207687_10005902 | |||
| 971 | Ga0207687_10055633 | |||
| 972 | Ga0207687_10064731 | |||
| 973 | Ga0207687_10095551 | |||
| 974 | Ga0207687_10102709 | |||
| 975 | Ga0207687_10199900 | |||
| 976 | Ga0207700_10075115 | |||
| 977 | Ga0207664_10065712 | |||
| 978 | Ga0207664_10400600 | |||
| 979 | Ga0207664_10532698 | |||
| 980 | Ga0207690_10014172 | |||
| 981 | Ga0207690_10015756 | |||
| 982 | Ga0207706_10004454 | |||
| 983 | Ga0207706_10017762 | |||
| 984 | Ga0207706_10170035 | |||
| 985 | Ga0207686_10094288 | |||
| 986 | Ga0207709_10013760 | |||
| 987 | Ga0207709_10044552 | |||
| 988 | Ga0207670_10458924 | |||
| 989 | Ga0207669_10005135 | |||
| 990 | Ga0207669_10041197 | |||
| 991 | Ga0207704_10027547 | |||
| 992 | Ga0207704_10151319 | |||
| 993 | Ga0207704_10370740 | |||
| 994 | Ga0207665_10048820 | |||
| 995 | Ga0207665_10059630 | |||
| 996 | Ga0207691_10017500 | |||
| 997 | Ga0207711_10095814 | |||
| 998 | Ga0207711_10101337 | |||
| 999 | Ga0207711_10179643 | |||
| 1000 | Ga0207689_10031027 | |||
| 1001 | Ga0207689_10076687 | |||
| 1002 | Ga0207661_10005367 | |||
| 1003 | Ga0207661_10042996 | |||
| 1004 | Ga0207661_10177937 | |||
| 1005 | Ga0207661_10183905 | |||
| 1006 | Ga0207679_10156448 | |||
| 1007 | Ga0207667_10200935 | |||
| 1008 | Ga0207651_10093427 | |||
| 1009 | Ga0207712_10012362 | |||
| 1010 | Ga0207712_10035420 | |||
| 1011 | Ga0207712_10111019 | |||
| 1012 | Ga0207712_10379420 | |||
| 1013 | Ga0207712_10514605 | |||
| 1014 | Ga0207668_10058310 | |||
| 1015 | Ga0207640_10083172 | |||
| 1016 | Ga0207640_10098816 | |||
| 1017 | Ga0207640_10137685 | |||
| 1018 | Ga0207677_10023102 | |||
| 1019 | Ga0207703_10052048 | |||
| 1020 | Ga0207678_10180586 | |||
| 1021 | Ga0207708_10025382 | |||
| 1022 | Ga0207702_10014846 | |||
| 1023 | Ga0207641_10015911 | |||
| 1024 | Ga0207648_10503181 | |||
| 1025 | Ga0207676_10127424 | |||
| 1026 | Ga0207674_10012449 | |||
| 1027 | Ga0207675_100001735 | |||
| 1028 | Ga0207675_100004766 | |||
| 1029 | Ga0207675_100007749 | |||
| 1030 | Ga0207683_10011380 | |||
| 1031 | Ga0207683_10029097 | |||
| 1032 | Ga0207698_10058706 | |||
| 1033 | Ga0207698_10151249 | |||
| 1034 | Ga0207698_10250421 | |||
| 1035 | Ga0207698_10282912 | |||
| 1036 | Ga0209813_10000869 | |||
| 1037 | Ga0207428_10003189 | |||
| 1038 | Ga0207428_10003628 | |||
| 1039 | Ga0207428_10019096 | |||
| 1040 | Ga0268266_10242124 | |||
| 1041 | Ga0268266_10423242 | |||
| 1042 | Ga0268265_10086911 | |||
| 1043 | Ga0268264_10118767 | |||
| 1044 | Ga0265338_10014450 | |||
| 1045 | Ga0265338_10085651 | |||
| 1046 | Ga0265762_1015481 | |||
| 1047 | Ga0265327_10007811 | |||
| 1048 | Ga0265327_10016221 | |||
| 1049 | Ga0307513_10000392 | |||
| 1050 | Ga0316576_10011298 | |||
| 1051 | Ga0316576_10169774 | |||
| 1052 | Ga0316578_10242200 | |||
| 1053 | Ga0307405_10002150 | |||
| 1054 | Ga0307405_10021265 | |||
| 1055 | Ga0307405_10186955 | |||
| 1056 | Ga0307405_10241731 | |||
| 1057 | Ga0307405_10455273 | |||
| 1058 | Ga0307406_10012752 | |||
| 1059 | Ga0307406_10086920 | |||
| 1060 | Ga0307406_10178989 | |||
| 1061 | Ga0307406_10184961 | |||
| 1062 | Ga0307406_10231244 | |||
| 1063 | Ga0307407_10090711 | |||
| 1064 | Ga0307412_10096572 | |||
| 1065 | Ga0307409_100004005 | |||
| 1066 | Ga0307409_100041099 | |||
| 1067 | Ga0307409_100131744 | |||
| 1068 | Ga0307409_100242774 | |||
| 1069 | Ga0307409_100279438 | |||
| 1070 | Ga0307416_100002457 | |||
| 1071 | Ga0307416_100009077 | |||
| 1072 | Ga0307416_100048195 | |||
| 1073 | Ga0307416_100249221 | |||
| 1074 | Ga0307416_100344430 | |||
| 1075 | Ga0307416_100375876 | |||
| 1076 | Ga0307416_100453044 | |||
| 1077 | Ga0307416_100493537 | |||
| 1078 | Ga0307416_100495668 | |||
| 1079 | Ga0307414_10088700 | |||
| 1080 | Ga0307411_10163791 | |||
| 1081 | Ga0307415_100002675 | |||
| 1082 | Ga0307415_100003274 | |||
| 1083 | Ga0307415_100007140 | |||
| 1084 | Ga0307415_100009591 | |||
| 1085 | Ga0307415_100042158 | |||
| 1086 | Ga0307415_100352964 | |||
| 1087 | Ga0307415_100411688 | |||
| 1088 | Ga0373959_0008840 | |||
| 1089 | Ga0373929_0000928 | |||
| 1090 | Ga0373940_0015857 | |||
| 1091 | Ga0373944_0031380 | |||
| 1092 | Ga0373949_0001204 | |||
| 1093 | Ga0373952_0038047 | |||
| 1094 | Ga0373936_0039959 | |||
| 1095 | Ga0373939_0004523 | |||
| 1096 | Ga0373945_0007337 | |||
| 1097 | Ga0373945_0051386 | |||
| 1098 | Ga0373953_0184586 | |||
| 1099 | Ga0373960_0058681 | |||
| 1100 | Ga0373943_0001983 | |||
| 1101 | Ga0373943_0012303 | |||
| 1102 | Ga0373946_0000906 | |||
| 1103 | Ga0373946_0040522 | |||
| 1104 | Ga0373955_0023622 | |||
| 1105 | Ga0373961_0021857 | |||
| 1106 | Ga0316574_0038113 | |||
| 1107 | Ga0316574_0039393 | |||
| 1108 | Ga0316574_0047448 | |||
| 1109 | Ga0373931_0008048 | |||
| 1110 | Ga0373935_0032625 | |||
| 1111 | Ga0373935_0040222 | |||
| 1112 | Ga0373933_0082791 | |||
| 1113 | Ga0373947_0000222 | |||
| 1114 | Ga0373947_0007840 | |||
| 1115 | Ga0373947_0315314 | |||
| 1116 | Ga0373937_0092226 | |||
| 1117 | Ga0373925_0025252 | |||
| 1118 | Ga0373925_0061548 | |||
| 1119 | Ga0395899_0005147 | |||
| 1120 | Ga0395899_0043233 | |||
| 1121 | Ga0395899_0064623 | |||
| 1122 | Ga0395899_0193598 | |||
| 1123 | Ga0395899_0196161 | |||
| 1124 | Ga0395900_0001887 | |||
| 1125 | Ga0395900_0011765 | |||
| 1126 | Ga0395900_0013600 | |||
| 1127 | Ga0395900_0018292 | |||
| 1128 | Ga0395900_0325652 | |||
| 1129 | Ga0395900_0445093 | |||
| 1130 | Ga0395900_0507850 | |||
| 1131 | Ga0395898_0008507 | |||
| 1132 | Ga0395898_0013578 | |||
| 1133 | Ga0395898_0014671 | |||
| 1134 | Ga0395898_0082914 | |||
| 1135 | Ga0395898_0369246 | |||
| 1136 | Ga0395905_0008061 | |||
| 1137 | Ga0395905_0029779 | |||
| 1138 | Ga0395905_0084695 | |||
| 1139 | Ga0395905_0167656 | |||
| 1140 | Ga0436364_0295501 | |||
| 1141 | Ga0395901_0002672 | |||
| 1142 | Ga0395901_0011319 | |||
| 1143 | Ga0395901_0014454 | |||
| 1144 | Ga0395901_0040568 | |||
| 1145 | Ga0395901_0128920 | |||
| 1146 | Ga0395901_0158657 | |||
| 1147 | Ga0436365_0019774 | |||
| 1148 | Ga0439436_0009403 | |||
| 1149 | Ga0451800_0708492 | |||
| 1150 | Ga0451835_0995502 | |||
| 1151 | Ga0451853_1140793 | |||
| 1152 | Ga0439448_0008497 | |||
| 1153 | Ga0439450_000063 | |||
| 1154 | Ga0439455_0013568 | |||
| 1155 | Ga0439457_003162 | |||
| 1156 | Ga0439463_000141 | |||
| 1157 | Ga0450914_000726 | |||
| 1158 | Ga0450915_000292 | |||
| 1159 | Ga0450900_004860 | |||
| 1160 | Ga0439458_0011472 | |||
| 1161 | Ga0450909_008199 | |||
| 1162 | Ga0439435_0064674 | |||
| 1163 | Ga0439444_0000359 | |||
| 1164 | Ga0439464_0005081 | |||
| 1165 | Ga0439460_0000688 | |||
| 1166 | Ga0439460_0010487 | |||
| 1167 | Ga0439440_0000076 | |||
| 1168 | Ga0466969_0090602 | |||
| 1169 | Ga0466965_0084440 | |||
| 1170 | Ga0466966_0134286 | |||
| 1171 | Ga0466963_0011149 | |||
| 1172 | Ga0466959_0295416 | |||
| 1173 | Ga0451576_0091689 | |||
| 1174 | Ga0466967_0001726 | |||
| 1175 | Ga0466967_0002670 | |||
| 1176 | Ga0495592_0139865 | |||
| 1177 | Ga0495592_0200987 | |||
| 1178 | Ga0495603_0007444 | |||
| 1179 | Ga0495603_0159256 | |||
| 1180 | Ga0495629_0000214 | |||
| 1181 | Ga0495641_0000795 | |||
| 1182 | Ga0495641_0011242 | |||
| 1183 | Ga0495651_0025628 | |||
| 1184 | Ga0495651_0053561 | |||
| 1185 | Ga0495582_0000389 | |||
| 1186 | Ga0495582_0143336 | |||
| 1187 | Ga0495582_0145990 | |||
| 1188 | Ga0495639_0011451 | |||
| 1189 | Ga0495662_0001778 | |||
| 1190 | Ga0495664_0183449 | |||
| 1191 | Ga0495608_0018463 | |||
| 1192 | Ga0495608_0042456 | |||
| 1193 | Ga0495616_0109872 | |||
| 1194 | Ga0495618_0112034 | |||
| 1195 | Ga0495630_0080335 | |||
| 1196 | Ga0495630_0181401 | |||
| 1197 | Ga0495644_0066990 | |||
| 1198 | Ga0495663_0015632 | |||
| 1199 | Ga0495652_0167729 | |||
| 1200 | Ga0495640_0011559 | |||
| 1201 | Ga0495587_0012552 | |||
| 1202 | Ga0495587_0111034 | |||
| 1203 | Ga0495621_0008214 | |||
| 1204 | Ga0495645_0129003 | |||
| 1205 | Ga0495667_0046189 | |||
| 1206 | Ga0495667_0122127 | |||
| 1207 | Ga0495667_0210350 | |||
| 1208 | Ga0495656_0024211 | |||
| 1209 | Ga0495656_0168679 | |||
| 1210 | Ga0495634_0027180 | |||
| 1211 | Ga0495634_0074471 | |||
| 1212 | Ga0495611_0056852 | |||
| 1213 | Ga0495635_0008410 | |||
| 1214 | Ga0495635_0064663 | |||
| 1215 | Ga0495657_0072414 | |||
| 1216 | Ga0495623_0034884 | |||
| 1217 | Ga0495623_0068429 | |||
| 1218 | Ga0495647_0006683 | |||
| 1219 | Ga0495647_0163611 | |||
| 1220 | Ga0495658_0043129 | |||
| 1221 | Ga0495658_0064288 | |||
| 1222 | Ga0495658_0272666 | |||
| 1223 | Ga0495613_0011809 | |||
| 1224 | Ga0495613_0263903 | |||
| 1225 | Ga0495624_0045099 | |||
| 1226 | Ga0495589_0152536 | |||
| 1227 | Ga0495600_0005394 | |||
| 1228 | Ga0495581_0001758 | |||
| 1229 | Ga0495604_0129753 | |||
| 1230 | Ga0495674_0011290 | |||
| 1231 | Ga0495676_0015151 | |||
| 1232 | Ga0495676_0041943 | |||
| 1233 | Ga0495676_0085237 | |||
| 1234 | Ga0495676_0124080 | |||
| 1235 | Ga0495676_0264688 | |||
| 1236 | Ga0495680_0000519 | |||
| 1237 | Ga0495680_0008616 | |||
| 1238 | Ga0495680_0009668 | |||
| 1239 | Ga0495680_0027614 | |||
| 1240 | Ga0495675_0019865 | |||
| 1241 | Ga0495684_0008163 | |||
| 1242 | Ga0495684_0019284 | |||
| 1243 | Ga0495684_0150918 | |||
| 1244 | Ga0495593_0052305 | |||
| 1245 | Ga0495593_0135290 | |||
| 1246 | Ga0496100_0007047 | |||
| 1247 | Ga0496100_0039628 | |||
| 1248 | Ga0496100_0230407 | |||
| 1249 | Ga0496100_0576410 | |||
| 1250 | Ga0496101_0007021 | |||
| 1251 | Ga0496101_0012587 | |||
| 1252 | Ga0496101_0100241 | |||
| 1253 | Ga0496101_0193959 | |||
| 1254 | Ga0496101_0236237 | |||
| 1255 | Ga0496101_0295936 | |||
| 1256 | Ga0496101_0336184 | |||
| 1257 | Ga0496101_0436781 | |||
| 1258 | Ga0496102_0004167 | |||
| 1259 | Ga0496102_0021504 | |||
| 1260 | Ga0496102_0099599 | |||
| 1261 | Ga0496104_0000921 | |||
| 1262 | Ga0496104_0039575 | |||
| 1263 | Ga0496104_0115337 | |||
| 1264 | Ga0496104_0156730 | |||
| 1265 | Ga0496104_0195399 | |||
| 1266 | Ga0496104_0246932 | |||
| 1267 | Ga0496105_0011698 | |||
| 1268 | Ga0496105_0013191 | |||
| 1269 | Ga0496105_0140701 | |||
| 1270 | Ga0496105_0232634 | |||
| 1271 | Ga0496106_0030633 | |||
| 1272 | Ga0496106_0039567 | |||
| 1273 | Ga0496106_0081536 | |||
| 1274 | Ga0496107_0013656 | |||
| 1275 | Ga0496107_0043112 | |||
| 1276 | Ga0496107_0080534 | |||
| 1277 | Ga0496107_0164230 | |||
| 1278 | Ga0496108_0002495 | |||
| 1279 | Ga0496108_0043315 | |||
| 1280 | Ga0496108_0155994 | |||
| 1281 | Ga0496109_0005924 | |||
| 1282 | Ga0496109_0008723 | |||
| 1283 | Ga0496109_0031853 | |||
| 1284 | Ga0496109_0248645 | |||
| 1285 | Ga0496110_0005696 | |||
| 1286 | Ga0496110_0043298 | |||
| 1287 | Ga0496110_0237498 | |||
| 1288 | Ga0496110_0356125 | |||
| 1289 | Ga0496110_0367716 | |||
| 1290 | Ga0496110_0410042 | |||
| 1291 | Ga0496110_0543341 | |||
| 1292 | Ga0496111_0015454 | |||
| 1293 | Ga0496111_0016621 | |||
| 1294 | Ga0496111_0041879 | |||
| 1295 | Ga0496111_0048134 | |||
| 1296 | Ga0496111_0123226 | |||
| 1297 | Ga0496111_0508569 | |||
| 1298 | Ga0496112_0000998 | |||
| 1299 | Ga0496112_0002635 | |||
| 1300 | Ga0496112_0037461 | |||
| 1301 | Ga0496112_0560780 | |||
| 1302 | Ga0496113_0002742 | |||
| 1303 | Ga0496113_0407486 | |||
| 1304 | Ga0496114_0015313 | |||
| 1305 | Ga0496114_0041450 | |||
| 1306 | Ga0496114_0051296 | |||
| 1307 | Ga0496114_0066961 | |||
| 1308 | Ga0496114_0079857 | |||
| 1309 | Ga0496114_0099380 | |||
| 1310 | Ga0496114_0141495 | |||
| 1311 | Ga0496114_0150832 | |||
| 1312 | Ga0496115_0005039 | |||
| 1313 | Ga0496115_0021730 | |||
| 1314 | Ga0496115_0104947 | |||
| 1315 | Ga0496115_0197155 | |||
| 1316 | Ga0496115_0461675 | |||
| 1317 | Ga0501031_0004169 | |||
| 1318 | Ga0501031_0007447 | |||
| 1319 | Ga0501031_0015950 | |||
| 1320 | Ga0501031_0220168 | |||
| 1321 | Ga0501032_0037047 | |||
| 1322 | Ga0501032_0098357 | |||
| 1323 | Ga0501032_0172408 | |||
| 1324 | Ga0501033_0001873 | |||
| 1325 | Ga0501033_0039695 | |||
| 1326 | Ga0501036_0000538 | |||
| 1327 | Ga0501036_0000787 | |||
| 1328 | Ga0501036_0010571 | |||
| 1329 | Ga0501036_0011055 | |||
| 1330 | Ga0501036_0143968 | |||
| 1331 | Ga0501037_0010194 | |||
| 1332 | Ga0501037_0022267 | |||
| 1333 | Ga0501037_0033494 | |||
| 1334 | Ga0501037_0097890 | |||
| 1335 | Ga0501038_0002433 | |||
| 1336 | Ga0501038_0002454 | |||
| 1337 | Ga0501038_0008663 | |||
| 1338 | Ga0501038_0216373 | |||
| 1339 | Ga0501038_0531264 | |||
| 1340 | Ga0501039_0002345 | |||
| 1341 | Ga0501039_0002478 | |||
| 1342 | Ga0501039_0012574 | |||
| 1343 | Ga0501039_0017994 | |||
| 1344 | Ga0501040_0001578 | |||
| 1345 | Ga0501040_0020050 | |||
| 1346 | Ga0501040_0028765 | |||
| 1347 | Ga0501040_0065718 | |||
| 1348 | Ga0501041_0000374 | |||
| 1349 | Ga0501041_0001907 | |||
| 1350 | Ga0501041_0004851 | |||
| 1351 | Ga0501041_0046712 | |||
| 1352 | Ga0501041_0198212 | |||
| 1353 | Ga0501041_0287903 | |||
| 1354 | Ga0501042_0001590 | |||
| 1355 | Ga0501042_0003308 | |||
| 1356 | Ga0501042_0431433 | |||
| 1357 | Ga0501043_0019361 | |||
| 1358 | Ga0501043_0023348 | |||
| 1359 | Ga0501046_0003448 | |||
| 1360 | Ga0501046_0008214 | |||
| 1361 | Ga0501046_0052538 | |||
| 1362 | Ga0501047_0107379 | |||
| 1363 | Ga0501048_0000098 | |||
| 1364 | Ga0501048_0000481 | |||
| 1365 | Ga0501048_0003830 | |||
| 1366 | Ga0501048_0101152 | |||
| 1367 | Ga0501048_0438988 | |||
| 1368 | Ga0501068_0002427 | |||
| 1369 | Ga0501068_0023466 | |||
| 1370 | Ga0501069_0000057 | |||
| 1371 | Ga0501070_0001915 | |||
| 1372 | Ga0501070_0034064 | |||
| 1373 | Ga0501071_0000131 | |||
| 1374 | Ga0501071_0004254 | |||
| 1375 | Ga0501071_0032632 | |||
| 1376 | Ga0501071_0040430 | |||
| 1377 | Ga0501071_0061919 | |||
| 1378 | Ga0501072_0000411 | |||
| 1379 | Ga0501072_0011944 | |||
| 1380 | Ga0501072_0057109 | |||
| 1381 | Ga0501072_0153808 | |||
| 1382 | Ga0501072_0164108 | |||
| 1383 | Ga0501073_0001913 | |||
| 1384 | Ga0501073_0043620 | |||
| 1385 | Ga0501074_0001213 | |||
| 1386 | Ga0501074_0003268 | |||
| 1387 | Ga0501074_0015737 | |||
| 1388 | Ga0501074_0074727 | |||
| 1389 | Ga0501074_0352239 | |||
| 1390 | Ga0501075_0000514 | |||
| 1391 | Ga0501075_0012860 | |||
| 1392 | Ga0501075_0016678 | |||
| 1393 | Ga0501075_0241482 | |||
| 1394 | Ga0501076_0000661 | |||
| 1395 | Ga0501076_0001524 | |||
| 1396 | Ga0501076_0018619 | |||
| 1397 | Ga0501076_0046936 | |||
| 1398 | Ga0501076_0156841 | |||
| 1399 | Ga0501077_0007978 | |||
| 1400 | Ga0501077_0009989 | |||
| 1401 | Ga0501077_0024744 | |||
| 1402 | Ga0501077_0040937 | |||
| 1403 | Ga0501077_0074730 | |||
| 1404 | Ga0501079_0002022 | |||
| 1405 | Ga0501079_0004369 | |||
| 1406 | Ga0501079_0025195 | |||
| 1407 | Ga0501079_0034208 | |||
| 1408 | Ga0501080_0024241 | |||
| 1409 | Ga0501080_0060606 | |||
| 1410 | Ga0501081_0000176 | |||
| 1411 | Ga0501081_0001624 | |||
| 1412 | Ga0501081_0006158 | |||
| 1413 | Ga0501083_0005857 | |||
| 1414 | Ga0501083_0133204 | |||
| 1415 | Ga0501035_0002693 | |||
| 1416 | Ga0501035_0015152 | |||
| 1417 | Ga0501035_0062613 | |||
| 1418 | Ga0501035_0114846 | |||
| 1419 | Ga0501044_0015084 | |||
| 1420 | Ga0501044_0130533 | |||
| 1421 | Ga0501045_0001824 | |||
| 1422 | Ga0501045_0005852 | |||
| 1423 | Ga0501045_0010082 | |||
| 1424 | Ga0501045_0073215 | |||
| 1425 | Ga0501045_0077872 | |||
| 1426 | Ga0501045_0193193 | |||
| 1427 | nmdc:mga05p37_132299_c1 | |||
| 1428 | nmdc:mga05p37_161335_c1 | |||
| 1429 | nmdc:mga05p37_181668_c1 | |||
| 1430 | nmdc:mga05p37_514848_c1 | |||
| 1431 | nmdc:mga05p37_7880_c1 | |||
| 1432 | nmdc:mga09592_115313_c1 | |||
| 1433 | nmdc:mga09592_28356_c1 | |||
| 1434 | nmdc:mga09592_481568_c1 | |||
| 1435 | nmdc:mga09592_73566_c1 | |||
| 1436 | nmdc:mga0qj67_15563_c1 | |||
| 1437 | nmdc:mga0qj67_226027_c1 | |||
| 1438 | nmdc:mga0qj67_27078_c1 | |||
| 1439 | nmdc:mga06r32_234787_c1 | |||
| 1440 | nmdc:mga06r32_55835_c1 | |||
| 1441 | nmdc:mga06r32_7763_c1 | |||
| 1442 | nmdc:mga08y16_129137_c1 | |||
| 1443 | nmdc:mga08y16_154366_c1 | |||
| 1444 | nmdc:mga08y16_172211_c1 | |||
| 1445 | nmdc:mga08y16_387127_c1 | |||
| 1446 | nmdc:mga08y16_44675_c1 | |||
| 1447 | nmdc:mga0n895_175314_c1 | |||
| 1448 | nmdc:mga0n895_187916_c1 | |||
| 1449 | nmdc:mga0n895_31890_c1 | |||
| 1450 | nmdc:mga0n895_6658_c1 | |||
| 1451 | nmdc:mga0rr50_351859_c1 | |||
| 1452 | nmdc:mga0rr50_61963_c1 | |||
| 1453 | nmdc:mga08x19_11682_c1 | |||
| 1454 | nmdc:mga0a205_13461_c1 | |||
| 1455 | nmdc:mga0a205_6619_c2 | |||
| 1456 | Ga0495601_0027475 | |||
| 1457 | Ga0495601_0167993 | |||
| 1458 | Ga0495601_0329848 | |||
| 1459 | Ga0495595_0026888 | |||
| 1460 | Ga0495595_0150175 | |||
| 1461 | Ga0495619_0001579 | |||
| 1462 | Ga0495619_0002099 | |||
| 1463 | Ga0495619_0081954 | |||
| 1464 | Ga0501084_0000414 | |||
| 1465 | Ga0501084_0004136 | |||
| 1466 | Ga0501084_0075829 | |||
| 1467 | Ga0501084_0135921 | |||
| 1468 | Ga0501084_0332480 | |||
| 1469 | Ga0501082_0003100 | |||
| 1470 | Ga0501082_0036561 | |||
| 1471 | Ga0501082_0060115 | |||
| 1472 | Ga0501082_0069151 | |||
| 1473 | Ga0501082_0406078 | |||
| 1474 | Ga0530510_0000576 | |||
| 1475 | Ga0530510_0007084 | |||
| 1476 | Ga0530510_0013764 | |||
| 1477 | Ga0530510_0047826 | |||
| 1478 | Ga0530510_0105244 | |||
| 1479 | Ga0530510_0118183 | |||
| 1480 | Ga0530510_0306551 | |||
| 1481 | 2785339372 | |||
| 1482 | 2809026195 | |||
| 1483 | 2812374828 | |||
| 1484 | 2954004277 | |||
| 1485 | 3006497655 | |||
| 1486 | 8048411286 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mdn-assembly1.cif.gz_C | structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi | 0.9441 | 2 | 273 |
| 3mdn-assembly1.cif.gz_B | structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi | 0.943 | 2 | 273 |
| 3mdn-assembly1.cif.gz_C | structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi | 0.9399 | 2 | 273 |
| 3mdn-assembly1.cif.gz_B | structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi | 0.9387 | 2 | 273 |
| 3mdn-assembly1.cif.gz_D | structure of glutamine aminotransferase class-ii domain protein (spo2029) from silicibacter pomeroyi | 0.937 | 2 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mdnB00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9414 | 2 | 273 | 3.60.20.10 |
| 3mdnB00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9371 | 2 | 273 | 3.60.20.10 |
| 4zfjA00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9041 | 2 | 274 | 3.60.20.10 |
| 4zfjA00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9003 | 2 | 274 | 3.60.20.10 |
| af_P53871_1_308_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.8752 | 1 | 271 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A2VSM1-F1-model_v4 | deleted | 0.981 | 1 | 276 |
|
| AF-B1JWG0-F1-model_v4 | Glutamine amidotransferase class-II | 0.9804 | 1 | 276 |
GO:0016740
|
| AF-A0A521MLF0-F1-model_v4 | Class II glutamine amidotransferase | 0.9802 | 1 | 271 |
GO:0016740
|
| AF-A0A529L1G1-F1-model_v4 | Class II glutamine amidotransferase | 0.98 | 102 | 206 |
GO:0016740
|
| AF-A0A7K2QPS2-F1-model_v4 | Class II glutamine amidotransferase | 0.9781 | 1 | 168 |
GO:0016740
|