F478671

General Info

Members Datasets Scaffolds Average Seq Length
743 256 741 850

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10002271|JGI24735J21928_100022714
Length 1003
Sequence MARADAPTPMMIQYRRLKEEAGDALLFYRMGDFFELFFDDAKAASACLDIALTKRGEDAGEPIPMCGVPVHSAESYLARLIRGGHRVAIAEQTESPAEARKARGSKALVDRAIIRLVTPGTLTEETLLESGSPNWLAAIGRAGDDWAXAAADISTGRFELVSCGPGELAAELARLSPAETIAESPIPGIRSSAGKGGFDSIAGESALKSRFGLATLDGLGSPSRAELAAAGGLLAYVDATQKGGGILLDSPRRIARASHMAIDAATRDSLELTRSVXGTVAGSLLGEIDRCQTAAGRRLLCEDIAAPLTDRSAIEQRLVLVAWLHEDAIRRERVRSALKAMPDFARALARLAAGRGSPRDLALLRDGLAAAEALRXALDGEPDLPPLLKSLLPCLGGHDALVGKLARALVAAPPLDASKGGYIAEGFDEDLDTLRDAASNGRRAIAALEARYRDSTSIGSLKIRHNAVLGYHVEVXARHADGLMAPGSGFTHRQTLXGVVRFNSPELHEEASRVIEAGAHALAAEAVHAXELTXXAVAAAPQITGTAEAIARIDVAASHAQRAAEGGWTLPQLADQPCLELEAGRHPVVEAALRDGGERFVAXDLAMSSNDRLWLITGPNMGGKSTFLRQTALIAVLAQAGSFVPATRARXGIVDRLFSRVGASDNLARGRSTFMVEMVETAAILAQAGPSSLVILDEIGRGTSTYDGLAIAWAVVEAMHDQVKCRTLFATHYHELTRLAGRLDSLSLHHVRAREWKGDLVLLHEVADGAADXSYGIAVAKLAGLPPPVVARARSVLAKLEAGRDATGGIAAGLXDLPLFAAASXPXHGPNPLAVALEMXDPDRLTPREALDKLYXLKXLAQSSDGVSXPVTASNMAVSATXSSSLISGRQISNNSPSTTLRVSQPTRRRQPGGTTSGTWQISLVLSXPVCGGMCVPALRIEISAIGERCLMRGIGGSSSNRIVSGHRRAFSSTGSPSFHKWKALHRASLSRLCPREARSDCS

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
248 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.13
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 3.9
Rhizosphere 89.5
Stem 0
Stem Tuber 0.13
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000664 3300001979 Bacteria 14892
2 JGI24737J22298_10000206 3300001990 Bacteria 19194
3 JGI24737J22298_10003453 3300001990 Bacteria 5584
4 JGI24735J21928_10002271 3300002067 Bacteria 6708
5 JGI24738J21930_10000018 3300002075 Bacteria 30549
6 JGI24738J21930_10000329 3300002075 Bacteria 13054
7 JGI24744J21845_10002247 3300002077 Bacteria 3928
8 Ga0055536_1008392 3300003781 Bacteria 4446
9 Ga0055531_10006840 3300003794 Bacteria 6361
10 Ga0065165_1004269 3300005262 Bacteria 9029
11 Ga0070658_10000374 3300005327 Bacteria 38937
12 Ga0070658_10002325 3300005327 Bacteria 15950
13 Ga0070658_10003546 3300005327 Bacteria 12808
14 Ga0070658_10010136 3300005327 Bacteria 7564
15 Ga0070658_10016492 3300005327 Bacteria 5913
16 Ga0070658_10020039 3300005327 Bacteria 5357
17 Ga0070658_10052771 3300005327 Bacteria 3298
18 Ga0070676_10014345 3300005328 Bacteria 4354
19 Ga0070683_100004124 3300005329 Bacteria 11905
20 Ga0070683_100006559 3300005329 Bacteria 9772
21 Ga0070683_100013120 3300005329 Bacteria 7215
22 Ga0070690_100020446 3300005330 Bacteria 4033
23 Ga0070670_100000653 3300005331 Bacteria 26914
24 Ga0070670_100003772 3300005331 Bacteria 12620
25 Ga0070670_100010209 3300005331 Bacteria 8013
26 Ga0070670_100023106 3300005331 Bacteria 5352
27 Ga0070670_100037887 3300005331 Bacteria 4147
28 Ga0070677_10002908 3300005333 Bacteria 5498
29 Ga0068869_100000415 3300005334 Bacteria 23235
30 Ga0068869_100014747 3300005334 Bacteria 5227
31 Ga0070666_10000054 3300005335 Bacteria 95458
32 Ga0070666_10000701 3300005335 Bacteria 20310
33 Ga0070666_10019939 3300005335 Bacteria 4332
34 Ga0070680_100000584 3300005336 Bacteria 25171
35 Ga0070680_100002229 3300005336 Bacteria 14303
36 Ga0070680_100003391 3300005336 Bacteria 11890
37 Ga0070680_100027087 3300005336 Bacteria 4589
38 Ga0068868_100000581 3300005338 Bacteria 24527
39 Ga0068868_100000734 3300005338 Bacteria 22184
40 Ga0068868_100004915 3300005338 Bacteria 9386
41 Ga0068868_100005223 3300005338 Bacteria 9114
42 Ga0070660_100000116 3300005339 Bacteria 49715
43 Ga0070660_100000209 3300005339 Bacteria 39223
44 Ga0070660_100001300 3300005339 Bacteria 17017
45 Ga0070660_100002258 3300005339 Bacteria 13231
46 Ga0070689_100012545 3300005340 Bacteria 6109
47 Ga0070661_100000198 3300005344 Bacteria 49932
48 Ga0070661_100007737 3300005344 Bacteria 7420
49 Ga0070661_100010064 3300005344 Bacteria 6566
50 Ga0070661_100014601 3300005344 Bacteria 5537
51 Ga0070661_100026191 3300005344 Bacteria 4192
52 Ga0070692_10005845 3300005345 Bacteria 5293
53 Ga0070692_10015432 3300005345 Bacteria 3614
54 Ga0070668_100000007 3300005347 Bacteria 150621
55 Ga0070668_100000618 3300005347 Bacteria 23868
56 Ga0070668_100023246 3300005347 Bacteria 4688
57 Ga0070669_100000097 3300005353 Bacteria 86804
58 Ga0070669_100000613 3300005353 Bacteria 26394
59 Ga0070675_100001980 3300005354 Bacteria 15178
60 Ga0070675_100010635 3300005354 Bacteria 7193
61 Ga0070671_100000041 3300005355 Bacteria 91555
62 Ga0070671_100000068 3300005355 Bacteria 70220
63 Ga0070671_100001153 3300005355 Bacteria 19660
64 Ga0070671_100001512 3300005355 Bacteria 17427
65 Ga0070671_100001973 3300005355 Bacteria 15747
66 Ga0070671_100004025 3300005355 Bacteria 11581
67 Ga0070671_100004757 3300005355 Bacteria 10788
68 Ga0070671_100014134 3300005355 Bacteria 6446
69 Ga0070671_100014195 3300005355 Bacteria 6432
70 Ga0070671_100055446 3300005355 Bacteria 3297
71 Ga0070674_100001041 3300005356 Bacteria 14499
72 Ga0070673_100000858 3300005364 Bacteria 17053
73 Ga0070673_100003335 3300005364 Bacteria 9978
74 Ga0070673_100023532 3300005364 Bacteria 4501
75 Ga0070659_100000381 3300005366 Bacteria 33609
76 Ga0070659_100003487 3300005366 Bacteria 11195
77 Ga0070659_100004639 3300005366 Bacteria 9817
78 Ga0070659_100005141 3300005366 Bacteria 9381
79 Ga0070659_100005351 3300005366 Bacteria 9212
80 Ga0070659_100026671 3300005366 Bacteria 4447
81 Ga0070659_100030630 3300005366 Bacteria 4164
82 Ga0070667_100001661 3300005367 Bacteria 19879
83 Ga0070667_100003113 3300005367 Bacteria 14260
84 Ga0070667_100007351 3300005367 Bacteria 9152
85 Ga0070667_100009156 3300005367 Bacteria 8198
86 Ga0070667_100010193 3300005367 Bacteria 7765
87 Ga0070667_100017456 3300005367 Bacteria 5948
88 Ga0070667_100021092 3300005367 Bacteria 5412
89 Ga0070667_100066131 3300005367 Bacteria 3071
90 Ga0070709_10034557 3300005434 Bacteria 3066
91 Ga0070714_100009413 3300005435 Bacteria 7680
92 Ga0070713_100000066 3300005436 Bacteria 66945
93 Ga0070713_100004394 3300005436 Bacteria 9469
94 Ga0070700_100021864 3300005441 Bacteria 3723
95 Ga0070663_100033850 3300005455 Bacteria 3533
96 Ga0070678_100010042 3300005456 Bacteria 5762
97 Ga0070678_100035758 3300005456 Bacteria 3471
98 Ga0070662_100000012 3300005457 Bacteria 129380
99 Ga0070662_100000513 3300005457 Bacteria 23294
100 Ga0070662_100000723 3300005457 Bacteria 20188
101 Ga0070662_100002417 3300005457 Bacteria 11481
102 Ga0070662_100013671 3300005457 Bacteria 5404
103 Ga0070681_10019776 3300005458 Bacteria 6743
104 Ga0070681_10022891 3300005458 Bacteria 6278
105 Ga0070681_10091110 3300005458 Bacteria 2999
106 Ga0068867_100018169 3300005459 Bacteria 4997
107 Ga0068867_100027521 3300005459 Bacteria 4087
108 Ga0070679_100000001 3300005530 Bacteria 764811
109 Ga0070679_100001280 3300005530 Bacteria 22214
110 Ga0070684_100002224 3300005535 Bacteria 14298
111 Ga0068853_100000032 3300005539 Bacteria 114306
112 Ga0068853_100000570 3300005539 Bacteria 25231
113 Ga0068853_100005879 3300005539 Bacteria 9673
114 Ga0068853_100050193 3300005539 Bacteria 3589
115 Ga0068853_100053302 3300005539 Bacteria 3484
116 Ga0070672_100004663 3300005543 Bacteria 8989
117 Ga0070696_100003345 3300005546 Bacteria 10699
118 Ga0070693_100004519 3300005547 Bacteria 6588
119 Ga0070665_100000303 3300005548 Bacteria 76933
120 Ga0070665_100002063 3300005548 Bacteria 22556
121 Ga0070665_100003398 3300005548 Bacteria 17014
122 Ga0070665_100004218 3300005548 Bacteria 15126
123 Ga0070665_100006371 3300005548 Bacteria 12031
124 Ga0070665_100014300 3300005548 Bacteria 7970
125 Ga0070665_100021320 3300005548 Bacteria 6517
126 Ga0070665_100023313 3300005548 Bacteria 6231
127 Ga0070665_100025783 3300005548 Bacteria 5921
128 Ga0070704_100010200 3300005549 Bacteria 5713
129 Ga0070704_100028454 3300005549 Bacteria 3718
130 Ga0068855_100001355 3300005563 Bacteria 30354
131 Ga0068855_100006268 3300005563 Bacteria 14499
132 Ga0068855_100006747 3300005563 Bacteria 13921
133 Ga0068855_100010689 3300005563 Bacteria 11076
134 Ga0068855_100045776 3300005563 Bacteria 5173
135 Ga0070664_100000133 3300005564 Bacteria 49630
136 Ga0070664_100000848 3300005564 Bacteria 23593
137 Ga0070664_100001296 3300005564 Bacteria 19984
138 Ga0070664_100011633 3300005564 Bacteria 7141
139 Ga0070664_100015527 3300005564 Bacteria 6231
140 Ga0068857_100003085 3300005577 Bacteria 13780
141 Ga0068857_100024974 3300005577 Bacteria 5263
142 Ga0068857_100066943 3300005577 Bacteria 3196
143 Ga0068854_100001547 3300005578 Bacteria 13957
144 Ga0068854_100001986 3300005578 Bacteria 12512
145 Ga0068856_100000190 3300005614 Bacteria 64644
146 Ga0068856_100007786 3300005614 Bacteria 10469
147 Ga0068856_100009268 3300005614 Bacteria 9564
148 Ga0068856_100014423 3300005614 Bacteria 7635
149 Ga0068856_100029278 3300005614 Bacteria 5379
150 Ga0068856_100035110 3300005614 Bacteria 4913
151 Ga0068852_100001557 3300005616 Bacteria 15586
152 Ga0068852_100008321 3300005616 Bacteria 7635
153 Ga0068852_100015523 3300005616 Bacteria 5911
154 Ga0068852_100023324 3300005616 Bacteria 4979
155 Ga0068859_100000270 3300005617 Bacteria 51764
156 Ga0068859_100000685 3300005617 Bacteria 34047
157 Ga0068859_100001592 3300005617 Bacteria 23154
158 Ga0068859_100005151 3300005617 Bacteria 13272
159 Ga0068859_100016680 3300005617 Bacteria 7374
160 Ga0068859_100039659 3300005617 Bacteria 4725
161 Ga0068864_100000706 3300005618 Bacteria 28069
162 Ga0068864_100001341 3300005618 Bacteria 20455
163 Ga0068864_100003892 3300005618 Bacteria 12290
164 Ga0068864_100004090 3300005618 Bacteria 11979
165 Ga0068864_100005288 3300005618 Bacteria 10577
166 Ga0068864_100040491 3300005618 Bacteria 3986
167 Ga0068864_100047267 3300005618 Bacteria 3695
168 Ga0068861_100012258 3300005719 Bacteria 5978
169 Ga0068861_100031650 3300005719 Bacteria 3888
170 Ga0068861_100031870 3300005719 Bacteria 3877
171 Ga0068851_10010640 3300005834 Bacteria 4297
172 Ga0068851_10011140 3300005834 Bacteria 4210
173 Ga0068863_100000006 3300005841 Bacteria 265379
174 Ga0068863_100000027 3300005841 Bacteria 181884
175 Ga0068863_100005453 3300005841 Bacteria 12534
176 Ga0068863_100006973 3300005841 Bacteria 11078
177 Ga0068863_100022866 3300005841 Bacteria 5974
178 Ga0068863_100047769 3300005841 Bacteria 4059
179 Ga0068863_100060153 3300005841 Bacteria 3593
180 Ga0068863_100074369 3300005841 Bacteria 3214
181 Ga0068858_100000971 3300005842 Bacteria 29668
182 Ga0068858_100001171 3300005842 Bacteria 27205
183 Ga0068858_100001863 3300005842 Bacteria 21511
184 Ga0068858_100003773 3300005842 Bacteria 14974
185 Ga0068858_100016331 3300005842 Bacteria 6974
186 Ga0068858_100021830 3300005842 Bacteria 5979
187 Ga0068858_100035523 3300005842 Bacteria 4623
188 Ga0068860_100000093 3300005843 Bacteria 150034
189 Ga0068860_100001106 3300005843 Bacteria 29651
190 Ga0068860_100001602 3300005843 Bacteria 24319
191 Ga0068860_100001606 3300005843 Bacteria 24269
192 Ga0068860_100011638 3300005843 Bacteria 8678
193 Ga0068860_100021760 3300005843 Bacteria 6204
194 Ga0068860_100059698 3300005843 Bacteria 3626
195 Ga0068862_100002553 3300005844 Bacteria 16098
196 Ga0068862_100011671 3300005844 Bacteria 7250
197 Ga0068862_100024878 3300005844 Bacteria 5024
198 Ga0068862_100047100 3300005844 Bacteria 3678
199 Ga0070717_10003094 3300006028 Bacteria 11859
200 Ga0075367_10000329 3300006178 Bacteria 16805
201 Ga0068871_100019293 3300006358 Bacteria 5204
202 Ga0075428_100020860 3300006844 Bacteria 7254
203 Ga0075431_100013027 3300006847 Bacteria 8398
204 Ga0097620_100000270 3300006931 Bacteria 51764
205 Ga0097620_100000685 3300006931 Bacteria 34047
206 Ga0097620_100001592 3300006931 Bacteria 23154
207 Ga0097620_100005150 3300006931 Bacteria 13272
208 Ga0097620_100039658 3300006931 Bacteria 4725
209 Ga0105240_10018195 3300009093 Bacteria 9445
210 Ga0105240_10055409 3300009093 Bacteria 4963
211 Ga0105240_10072734 3300009093 Bacteria 4248
212 Ga0111539_10026357 3300009094 Bacteria 7108
213 Ga0105245_10000128 3300009098 Bacteria 72249
214 Ga0105245_10007030 3300009098 Bacteria 9875
215 Ga0105245_10013215 3300009098 Bacteria 7193
216 Ga0105245_10062817 3300009098 Bacteria 3351
217 Ga0105248_10000083 3300009177 Bacteria 110619
218 Ga0105248_10000170 3300009177 Bacteria 75642
219 Ga0105248_10000660 3300009177 Bacteria 39185
220 Ga0105248_10001290 3300009177 Bacteria 27898
221 Ga0105248_10001775 3300009177 Bacteria 24009
222 Ga0105248_10007989 3300009177 Bacteria 11618
223 Ga0105248_10011330 3300009177 Bacteria 9830
224 Ga0105248_10013432 3300009177 Bacteria 9015
225 Ga0105248_10018121 3300009177 Bacteria 7775
226 Ga0105248_10022678 3300009177 Bacteria 6967
227 Ga0105237_10019701 3300009545 Bacteria 6965
228 Ga0105237_10047358 3300009545 Bacteria 4322
229 Ga0105238_10002495 3300009551 Bacteria 18412
230 Ga0105238_10043610 3300009551 Bacteria 4539
231 Ga0105249_10000424 3300009553 Bacteria 40288
232 Ga0105249_10001126 3300009553 Bacteria 23796
233 Ga0099796_10000460 3300010159 Bacteria 6822
234 Ga0157371_10001109 3300013102 Bacteria 29189
235 Ga0157371_10001392 3300013102 Bacteria 25245
236 Ga0157371_10007119 3300013102 Bacteria 9087
237 Ga0157371_10045796 3300013102 Bacteria 3112
238 Ga0157370_10000497 3300013104 Bacteria 48916
239 Ga0157370_10008251 3300013104 Bacteria 11243
240 Ga0157370_10031202 3300013104 Bacteria 5215
241 Ga0157370_10056633 3300013104 Bacteria 3731
242 Ga0157369_10000137 3300013105 Bacteria 103542
243 Ga0157369_10003724 3300013105 Bacteria 18107
244 Ga0157369_10012543 3300013105 Bacteria 9616
245 Ga0157369_10013100 3300013105 Bacteria 9385
246 Ga0157369_10049758 3300013105 Bacteria 4542
247 Ga0157369_10095327 3300013105 Bacteria 3175
248 Ga0157378_10002066 3300013297 Bacteria 17982
249 Ga0157378_10013139 3300013297 Bacteria 7244
250 Ga0157378_10086770 3300013297 Bacteria 2837
251 Ga0163162_10001622 3300013306 Bacteria 21049
252 Ga0163162_10001754 3300013306 Bacteria 20326
253 Ga0163162_10018777 3300013306 Bacteria 6778
254 Ga0157372_10066976 3300013307 Bacteria 4035
255 Ga0157375_10005011 3300013308 Bacteria 11508
256 Ga0157375_10015938 3300013308 Bacteria 6740
257 Ga0157375_10019356 3300013308 Bacteria 6190
258 Ga0163163_10000364 3300014325 Bacteria 43563
259 Ga0163163_10000890 3300014325 Bacteria 25418
260 Ga0163163_10001686 3300014325 Bacteria 18653
261 Ga0163163_10008590 3300014325 Bacteria 9082
262 Ga0157380_10012004 3300014326 Bacteria 6269
263 Ga0157380_10018441 3300014326 Bacteria 5181
264 Ga0157377_10013175 3300014745 Bacteria 4180
265 Ga0157379_10000566 3300014968 Bacteria 29886
266 Ga0157379_10001895 3300014968 Bacteria 17285
267 Ga0163161_10042600 3300017792 Bacteria 3266
268 Ga0206353_10722721 3300020082 Bacteria 3365
269 Ga0213873_10000026 3300021358 Bacteria 74525
270 Ga0213876_10000149 3300021384 Bacteria 74548
271 Ga0213876_10000257 3300021384 Bacteria 49797
272 Ga0213875_10000166 3300021388 Bacteria 68786
273 Ga0213875_10000380 3300021388 Bacteria 40605
274 Ga0209565_1000172 3300025263 Bacteria 84264
275 Ga0209673_1001352 3300025273 Bacteria 24446
276 Ga0209675_1000773 3300025291 Bacteria 21404
277 Ga0209564_1004716 3300025295 Bacteria 8173
278 Ga0209758_1010218 3300025297 Bacteria 5659
279 Ga0209758_1021184 3300025297 Bacteria 3041
280 Ga0209050_1010889 3300025298 Bacteria 4407
281 Ga0209256_1001634 3300025299 Bacteria 21832
282 Ga0209257_1000192 3300025304 Bacteria 151851
283 Ga0207697_10000059 3300025315 Bacteria 45306
284 Ga0207682_10000177 3300025893 Bacteria 28884
285 Ga0207682_10002081 3300025893 Bacteria 9061
286 Ga0207688_10009969 3300025901 Bacteria 5169
287 Ga0207680_10000183 3300025903 Bacteria 30332
288 Ga0207680_10000328 3300025903 Bacteria 22845
289 Ga0207680_10000911 3300025903 Bacteria 13961
290 Ga0207680_10004458 3300025903 Bacteria 6643
291 Ga0207647_10000968 3300025904 Bacteria 22267
292 Ga0207647_10001938 3300025904 Bacteria 15816
293 Ga0207647_10003235 3300025904 Bacteria 12220
294 Ga0207647_10004569 3300025904 Bacteria 10254
295 Ga0207647_10006311 3300025904 Bacteria 8629
296 Ga0207647_10015394 3300025904 Bacteria 5245
297 Ga0207647_10020566 3300025904 Bacteria 4423
298 Ga0207645_10024979 3300025907 Bacteria 3870
299 Ga0207705_10000030 3300025909 Bacteria 239341
300 Ga0207705_10000072 3300025909 Bacteria 126043
301 Ga0207705_10000123 3300025909 Bacteria 85382
302 Ga0207705_10001768 3300025909 Bacteria 17064
303 Ga0207705_10002020 3300025909 Bacteria 15795
304 Ga0207705_10003058 3300025909 Bacteria 12757
305 Ga0207705_10003236 3300025909 Bacteria 12402
306 Ga0207705_10003465 3300025909 Bacteria 11997
307 Ga0207705_10004136 3300025909 Bacteria 11003
308 Ga0207705_10004488 3300025909 Bacteria 10551
309 Ga0207705_10006438 3300025909 Bacteria 8699
310 Ga0207705_10011779 3300025909 Bacteria 6320
311 Ga0207705_10014165 3300025909 Bacteria 5743
312 Ga0207705_10024163 3300025909 Bacteria 4337
313 Ga0207695_10005782 3300025913 Bacteria 16281
314 Ga0207695_10006988 3300025913 Bacteria 14488
315 Ga0207695_10010664 3300025913 Bacteria 11225
316 Ga0207695_10037772 3300025913 Bacteria 5208
317 Ga0207695_10041344 3300025913 Bacteria 4934
318 Ga0207693_10020496 3300025915 Bacteria 5258
319 Ga0207660_10001036 3300025917 Bacteria 18381
320 Ga0207660_10001792 3300025917 Bacteria 14339
321 Ga0207660_10002482 3300025917 Bacteria 12123
322 Ga0207660_10002582 3300025917 Bacteria 11894
323 Ga0207660_10004827 3300025917 Bacteria 8774
324 Ga0207660_10005438 3300025917 Bacteria 8264
325 Ga0207657_10000267 3300025919 Bacteria 55426
326 Ga0207657_10000496 3300025919 Bacteria 41552
327 Ga0207657_10002033 3300025919 Bacteria 21868
328 Ga0207657_10002077 3300025919 Bacteria 21670
329 Ga0207657_10002179 3300025919 Bacteria 21219
330 Ga0207657_10004176 3300025919 Bacteria 15303
331 Ga0207657_10005014 3300025919 Bacteria 13903
332 Ga0207657_10005448 3300025919 Bacteria 13286
333 Ga0207657_10006412 3300025919 Bacteria 12207
334 Ga0207657_10006813 3300025919 Bacteria 11794
335 Ga0207657_10008867 3300025919 Bacteria 10173
336 Ga0207657_10011037 3300025919 Bacteria 8978
337 Ga0207657_10014259 3300025919 Bacteria 7768
338 Ga0207657_10026695 3300025919 Bacteria 5300
339 Ga0207657_10041100 3300025919 Bacteria 4091
340 Ga0207657_10078768 3300025919 Bacteria 2774
341 Ga0207649_10000158 3300025920 Bacteria 55609
342 Ga0207649_10000993 3300025920 Bacteria 17572
343 Ga0207649_10037838 3300025920 Bacteria 2917
344 Ga0207652_10000034 3300025921 Bacteria 138571
345 Ga0207652_10000274 3300025921 Bacteria 53521
346 Ga0207652_10035188 3300025921 Bacteria 4226
347 Ga0207681_10000030 3300025923 Bacteria 173766
348 Ga0207681_10000737 3300025923 Bacteria 21451
349 Ga0207694_10002303 3300025924 Bacteria 15625
350 Ga0207694_10027856 3300025924 Bacteria 4305
351 Ga0207650_10003264 3300025925 Bacteria 11178
352 Ga0207650_10008777 3300025925 Bacteria 6908
353 Ga0207687_10000745 3300025927 Bacteria 21993
354 Ga0207700_10000045 3300025928 Bacteria 88536
355 Ga0207700_10047881 3300025928 Bacteria 3172
356 Ga0207664_10050213 3300025929 Bacteria 3288
357 Ga0207644_10000017 3300025931 Bacteria 177818
358 Ga0207644_10000098 3300025931 Bacteria 63062
359 Ga0207644_10000358 3300025931 Bacteria 29705
360 Ga0207644_10000415 3300025931 Bacteria 27794
361 Ga0207644_10004273 3300025931 Bacteria 9268
362 Ga0207644_10015213 3300025931 Bacteria 5162
363 Ga0207690_10000160 3300025932 Bacteria 52819
364 Ga0207690_10001997 3300025932 Bacteria 12499
365 Ga0207690_10002179 3300025932 Bacteria 11945
366 Ga0207690_10004007 3300025932 Bacteria 8696
367 Ga0207690_10006517 3300025932 Bacteria 6920
368 Ga0207706_10000041 3300025933 Bacteria 130090
369 Ga0207706_10000253 3300025933 Bacteria 58135
370 Ga0207706_10000426 3300025933 Bacteria 45291
371 Ga0207706_10001436 3300025933 Bacteria 23850
372 Ga0207706_10003800 3300025933 Bacteria 14394
373 Ga0207706_10006444 3300025933 Bacteria 10902
374 Ga0207706_10012889 3300025933 Bacteria 7609
375 Ga0207706_10024797 3300025933 Bacteria 5375
376 Ga0207706_10032157 3300025933 Bacteria 4672
377 Ga0207706_10034375 3300025933 Bacteria 4510
378 Ga0207686_10014056 3300025934 Bacteria 4445
379 Ga0207670_10005825 3300025936 Bacteria 6803
380 Ga0207669_10008626 3300025937 Bacteria 4797
381 Ga0207691_10000563 3300025940 Bacteria 37125
382 Ga0207691_10001958 3300025940 Bacteria 20115
383 Ga0207691_10005229 3300025940 Bacteria 12521
384 Ga0207691_10037280 3300025940 Bacteria 4504
385 Ga0207711_10000374 3300025941 Bacteria 47567
386 Ga0207711_10000831 3300025941 Bacteria 30006
387 Ga0207711_10002128 3300025941 Bacteria 17852
388 Ga0207711_10002381 3300025941 Bacteria 16823
389 Ga0207711_10002712 3300025941 Bacteria 15625
390 Ga0207711_10003449 3300025941 Bacteria 13681
391 Ga0207711_10007702 3300025941 Bacteria 9000
392 Ga0207711_10007812 3300025941 Bacteria 8940
393 Ga0207711_10008412 3300025941 Bacteria 8629
394 Ga0207711_10013720 3300025941 Bacteria 6728
395 Ga0207689_10000128 3300025942 Bacteria 64122
396 Ga0207689_10010796 3300025942 Bacteria 7857
397 Ga0207689_10011804 3300025942 Bacteria 7483
398 Ga0207661_10001415 3300025944 Bacteria 16185
399 Ga0207661_10008050 3300025944 Bacteria 7513
400 Ga0207661_10028679 3300025944 Bacteria 4265
401 Ga0207679_10000532 3300025945 Bacteria 25751
402 Ga0207679_10012365 3300025945 Bacteria 5564
403 Ga0207679_10018481 3300025945 Bacteria 4671
404 Ga0207679_10021199 3300025945 Bacteria 4400
405 Ga0207679_10026459 3300025945 Bacteria 4001
406 Ga0207679_10040630 3300025945 Bacteria 3331
407 Ga0207679_10057252 3300025945 Bacteria 2882
408 Ga0207667_10001389 3300025949 Bacteria 30363
409 Ga0207667_10002612 3300025949 Bacteria 22331
410 Ga0207667_10005579 3300025949 Bacteria 15355
411 Ga0207667_10008667 3300025949 Bacteria 12056
412 Ga0207667_10019982 3300025949 Bacteria 7461
413 Ga0207651_10000785 3300025960 Bacteria 13640
414 Ga0207651_10001030 3300025960 Bacteria 12321
415 Ga0207651_10011884 3300025960 Bacteria 4894
416 Ga0207712_10006289 3300025961 Bacteria 7490
417 Ga0207668_10000054 3300025972 Bacteria 95426
418 Ga0207668_10002806 3300025972 Bacteria 10183
419 Ga0207668_10005448 3300025972 Bacteria 7495
420 Ga0207640_10000589 3300025981 Bacteria 21653
421 Ga0207640_10001476 3300025981 Bacteria 12682
422 Ga0207640_10002630 3300025981 Bacteria 9625
423 Ga0207640_10015445 3300025981 Bacteria 4420
424 Ga0207640_10027401 3300025981 Bacteria 3471
425 Ga0207658_10001748 3300025986 Bacteria 16348
426 Ga0207658_10002652 3300025986 Bacteria 12965
427 Ga0207658_10006047 3300025986 Bacteria 8263
428 Ga0207658_10006879 3300025986 Bacteria 7745
429 Ga0207658_10009750 3300025986 Bacteria 6521
430 Ga0207658_10015630 3300025986 Bacteria 5209
431 Ga0207658_10015732 3300025986 Bacteria 5194
432 Ga0207677_10002148 3300026023 Bacteria 10362
433 Ga0207677_10003209 3300026023 Bacteria 8621
434 Ga0207703_10002174 3300026035 Bacteria 17221
435 Ga0207703_10003645 3300026035 Bacteria 12840
436 Ga0207703_10003816 3300026035 Bacteria 12524
437 Ga0207703_10018840 3300026035 Bacteria 5391
438 Ga0207703_10021870 3300026035 Bacteria 5008
439 Ga0207703_10038484 3300026035 Bacteria 3817
440 Ga0207639_10000074 3300026041 Bacteria 91671
441 Ga0207639_10002528 3300026041 Bacteria 12271
442 Ga0207639_10010081 3300026041 Bacteria 6533
443 Ga0207639_10036827 3300026041 Bacteria 3629
444 Ga0207678_10000530 3300026067 Bacteria 34763
445 Ga0207678_10001578 3300026067 Bacteria 20947
446 Ga0207678_10004268 3300026067 Bacteria 12818
447 Ga0207678_10030016 3300026067 Bacteria 4746
448 Ga0207708_10016875 3300026075 Bacteria 5497
449 Ga0207702_10000444 3300026078 Bacteria 46851
450 Ga0207702_10006134 3300026078 Bacteria 10413
451 Ga0207641_10000045 3300026088 Bacteria 181882
452 Ga0207641_10000113 3300026088 Bacteria 119188
453 Ga0207641_10000887 3300026088 Bacteria 31227
454 Ga0207641_10001862 3300026088 Bacteria 20270
455 Ga0207648_10008301 3300026089 Bacteria 10082
456 Ga0207648_10016665 3300026089 Bacteria 6706
457 Ga0207648_10066836 3300026089 Bacteria 3135
458 Ga0207676_10000253 3300026095 Bacteria 46261
459 Ga0207676_10001070 3300026095 Bacteria 20850
460 Ga0207676_10001717 3300026095 Bacteria 16157
461 Ga0207676_10001727 3300026095 Bacteria 16099
462 Ga0207676_10004139 3300026095 Bacteria 10244
463 Ga0207676_10006932 3300026095 Bacteria 8030
464 Ga0207676_10035629 3300026095 Bacteria 3779
465 Ga0207674_10000086 3300026116 Bacteria 100722
466 Ga0207674_10000827 3300026116 Bacteria 40278
467 Ga0207674_10001715 3300026116 Bacteria 28037
468 Ga0207674_10004040 3300026116 Bacteria 17803
469 Ga0207674_10005045 3300026116 Bacteria 15754
470 Ga0207674_10026884 3300026116 Bacteria 6102
471 Ga0207675_100003847 3300026118 Bacteria 14593
472 Ga0207675_100006057 3300026118 Bacteria 11508
473 Ga0207675_100032620 3300026118 Bacteria 4851
474 Ga0207675_100034678 3300026118 Bacteria 4706
475 Ga0207683_10002667 3300026121 Bacteria 15595
476 Ga0207683_10005397 3300026121 Bacteria 10955
477 Ga0207683_10008598 3300026121 Bacteria 8733
478 Ga0207698_10000774 3300026142 Bacteria 18579
479 Ga0207698_10000913 3300026142 Bacteria 17183
480 Ga0207698_10001798 3300026142 Bacteria 12518
481 Ga0207698_10002058 3300026142 Bacteria 11862
482 Ga0207698_10003524 3300026142 Bacteria 9437
483 Ga0207698_10008676 3300026142 Bacteria 6442
484 Ga0209813_10000029 3300027866 Bacteria 68229
485 Ga0268266_10000003 3300028379 Bacteria 1701703
486 Ga0268266_10000130 3300028379 Bacteria 147912
487 Ga0268266_10004880 3300028379 Bacteria 12724
488 Ga0268266_10012792 3300028379 Bacteria 7249
489 Ga0268266_10016486 3300028379 Bacteria 6316
490 Ga0268266_10028015 3300028379 Bacteria 4790
491 Ga0268265_10000074 3300028380 Bacteria 127599
492 Ga0268265_10017478 3300028380 Bacteria 4950
493 Ga0268265_10031854 3300028380 Bacteria 3812
494 Ga0268264_10000067 3300028381 Bacteria 284445
495 Ga0268264_10000288 3300028381 Bacteria 84755
496 Ga0268264_10000410 3300028381 Bacteria 60680
497 Ga0268264_10000418 3300028381 Bacteria 59942
498 Ga0268264_10001183 3300028381 Bacteria 25301
499 Ga0268264_10002893 3300028381 Bacteria 14931
500 Ga0268264_10013454 3300028381 Bacteria 6736
501 Ga0268264_10034425 3300028381 Bacteria 4167
502 Ga0268264_10063658 3300028381 Bacteria 3101
503 Ga0307517_10004144 3300028786 Bacteria 22364
504 Ga0265327_10000110 3300031251 Bacteria 181251
505 Ga0307513_10000178 3300031456 Bacteria 91751
506 Ga0307513_10004370 3300031456 Bacteria 18876
507 Ga0307513_10045911 3300031456 Bacteria 4771
508 Ga0307405_10001874 3300031731 Bacteria 9032
509 Ga0307405_10014302 3300031731 Bacteria 4262
510 Ga0307405_10016247 3300031731 Bacteria 4053
511 Ga0307413_10000129 3300031824 Bacteria 19750
512 Ga0307413_10008169 3300031824 Bacteria 4921
513 Ga0307410_10000283 3300031852 Bacteria 19590
514 Ga0307410_10001956 3300031852 Bacteria 9676
515 Ga0307410_10003694 3300031852 Bacteria 7739
516 Ga0307410_10005261 3300031852 Bacteria 6822
517 Ga0307410_10008760 3300031852 Bacteria 5632
518 Ga0307410_10013947 3300031852 Bacteria 4708
519 Ga0307406_10009749 3300031901 Bacteria 5400
520 Ga0307406_10021704 3300031901 Bacteria 3801
521 Ga0307407_10003822 3300031903 Bacteria 6272
522 Ga0307407_10006133 3300031903 Bacteria 5306
523 Ga0307407_10011200 3300031903 Bacteria 4257
524 Ga0307407_10012733 3300031903 Bacteria 4055
525 Ga0307412_10004529 3300031911 Bacteria 7739
526 Ga0307409_100006316 3300031995 Bacteria 6946
527 Ga0307409_100020915 3300031995 Bacteria 4473
528 Ga0307409_100050185 3300031995 Bacteria 3185
529 Ga0307416_100002293 3300032002 Bacteria 10917
530 Ga0307416_100010574 3300032002 Bacteria 6104
531 Ga0307414_10001122 3300032004 Bacteria 13688
532 Ga0307414_10005273 3300032004 Bacteria 7101
533 Ga0307414_10005424 3300032004 Bacteria 7023
534 Ga0307414_10010955 3300032004 Bacteria 5295
535 Ga0307414_10043457 3300032004 Bacteria 3061
536 Ga0307411_10000313 3300032005 Bacteria 16232
537 Ga0307411_10005025 3300032005 Bacteria 6435
538 Ga0307411_10006075 3300032005 Bacteria 6005
539 Ga0307411_10021437 3300032005 Bacteria 3781
540 Ga0307411_10022233 3300032005 Bacteria 3729
541 Ga0307411_10043732 3300032005 Bacteria 2867
542 Ga0307415_100003377 3300032126 Bacteria 8120
543 Ga0307415_100013558 3300032126 Bacteria 4761
544 Ga0307415_100016430 3300032126 Bacteria 4412
545 Ga0373943_0015049 3300035170 Bacteria 3511
546 Ga0373955_0019520 3300035172 Bacteria 3390
547 Ga0373927_0002126 3300035695 Bacteria 14596
548 Ga0373933_0008975 3300035724 Bacteria 5455
549 Ga0373933_0018215 3300035724 Bacteria 3947
550 Ga0373937_0013690 3300036401 Bacteria 7145
551 Ga0373937_0023245 3300036401 Bacteria 5580
552 Ga0373925_0000199 3300037068 Bacteria 65400
553 Ga0395899_0001291 3300037312 Bacteria 21622
554 Ga0395899_0001834 3300037312 Bacteria 17595
555 Ga0395899_0002771 3300037312 Bacteria 14143
556 Ga0395899_0003034 3300037312 Bacteria 13407
557 Ga0395899_0003740 3300037312 Bacteria 12020
558 Ga0395899_0006100 3300037312 Bacteria 9345
559 Ga0395899_0015562 3300037312 Bacteria 5800
560 Ga0395899_0029071 3300037312 Bacteria 4157
561 Ga0395900_0000380 3300037418 Bacteria 64150
562 Ga0395900_0000447 3300037418 Bacteria 59069
563 Ga0395900_0001102 3300037418 Bacteria 34357
564 Ga0395900_0007902 3300037418 Bacteria 10956
565 Ga0395900_0013390 3300037418 Bacteria 8380
566 Ga0395900_0013724 3300037418 Bacteria 8270
567 Ga0395900_0019399 3300037418 Bacteria 6935
568 Ga0395900_0023759 3300037418 Bacteria 6270
569 Ga0395900_0031497 3300037418 Bacteria 5450
570 Ga0395900_0032603 3300037418 Bacteria 5358
571 Ga0395900_0035200 3300037418 Bacteria 5158
572 Ga0395900_0069631 3300037418 Bacteria 3616
573 Ga0395900_0114751 3300037418 Bacteria 2764
574 Ga0395898_0000054 3300037466 Bacteria 279561
575 Ga0395898_0003866 3300037466 Bacteria 16551
576 Ga0395898_0007122 3300037466 Bacteria 11875
577 Ga0395898_0010930 3300037466 Bacteria 9468
578 Ga0395898_0011580 3300037466 Bacteria 9158
579 Ga0395898_0012701 3300037466 Bacteria 8700
580 Ga0395898_0057108 3300037466 Bacteria 3803
581 Ga0395898_0090622 3300037466 Bacteria 2943
582 Ga0395898_0097231 3300037466 Bacteria 2828
583 Ga0395905_0000005 3300037471 Bacteria 557808
584 Ga0395905_0000226 3300037471 Bacteria 85938
585 Ga0395905_0000500 3300037471 Bacteria 53853
586 Ga0395905_0002081 3300037471 Bacteria 22761
587 Ga0395905_0002414 3300037471 Bacteria 20738
588 Ga0395905_0002464 3300037471 Bacteria 20495
589 Ga0395905_0004286 3300037471 Bacteria 14873
590 Ga0395905_0009087 3300037471 Bacteria 9743
591 Ga0395905_0022741 3300037471 Bacteria 5928
592 Ga0395905_0023106 3300037471 Bacteria 5878
593 Ga0395905_0045850 3300037471 Bacteria 4101
594 Ga0395905_0083913 3300037471 Bacteria 2984
595 Ga0395905_0086430 3300037471 Bacteria 2939
596 Ga0436364_0424934 3300037853 Bacteria 51524
597 Ga0436364_0501064 3300037853 Bacteria 12902
598 Ga0436364_0545952 3300037853 Bacteria 79385
599 Ga0436364_0598036 3300037853 Bacteria 22487
600 Ga0395901_0000181 3300038443 Bacteria 81816
601 Ga0395901_0000324 3300038443 Bacteria 59134
602 Ga0395901_0000375 3300038443 Bacteria 53750
603 Ga0395901_0001088 3300038443 Bacteria 29016
604 Ga0395901_0002597 3300038443 Bacteria 18305
605 Ga0395901_0003871 3300038443 Bacteria 15045
606 Ga0395901_0004994 3300038443 Bacteria 13392
607 Ga0395901_0015929 3300038443 Bacteria 7658
608 Ga0395901_0017012 3300038443 Bacteria 7411
609 Ga0395901_0018581 3300038443 Bacteria 7100
610 Ga0395901_0021576 3300038443 Bacteria 6598
611 Ga0395901_0037788 3300038443 Bacteria 4993
612 Ga0395901_0048039 3300038443 Bacteria 4432
613 Ga0395901_0053704 3300038443 Bacteria 4187
614 Ga0395901_0056701 3300038443 Bacteria 4076
615 Ga0395901_0085937 3300038443 Bacteria 3289
616 Ga0436365_0083543 3300039437 Bacteria 85224
617 Ga0436365_1025078 3300039437 Bacteria 33251
618 Ga0436365_1884511 3300039437 Bacteria 98004
619 Ga0436362_0376260 3300039453 Bacteria 74620
620 Ga0439445_0000319 3300042004 Bacteria 9342
621 Ga0450889_000104 3300042144 Bacteria 8174
622 Ga0439458_0000539 3300042157 Bacteria 9729
623 Ga0439464_0000240 3300042439 Bacteria 10093
624 Ga0466969_0001635 3300044656 Bacteria 12016
625 Ga0466969_0006530 3300044656 Bacteria 6204
626 Ga0466966_0000026 3300044684 Bacteria 106896
627 Ga0466966_0002429 3300044684 Bacteria 12173
628 Ga0466966_0005498 3300044684 Bacteria 8324
629 Ga0466961_0003480 3300044693 Bacteria 9814
630 Ga0466961_0003951 3300044693 Bacteria 9274
631 Ga0466961_0014816 3300044693 Bacteria 5009
632 Ga0466963_0001562 3300044694 Bacteria 12416
633 Ga0466963_0003354 3300044694 Bacteria 9143
634 Ga0466963_0005918 3300044694 Bacteria 7200
635 Ga0466963_0008594 3300044694 Bacteria 6129
636 Ga0466963_0016743 3300044694 Bacteria 4562
637 Ga0466971_0002121 3300044719 Bacteria 8404
638 Ga0466971_0017748 3300044719 Bacteria 3151
639 Ga0466968_0011715 3300044735 Bacteria 3421
640 Ga0466970_0006740 3300044765 Bacteria 5748
641 Ga0466957_0000705 3300044842 Bacteria 17083
642 Ga0466957_0030216 3300044842 Bacteria 3234
643 Ga0466959_0045773 3300045049 Bacteria 3221
644 Ga0451576_0059938 3300045051 Bacteria 3971
645 Ga0466958_0006502 3300045836 Bacteria 6368
646 Ga0466958_0024169 3300045836 Bacteria 3574
647 Ga0466967_0000571 3300045976 Bacteria 18131
648 Ga0466967_0022346 3300045976 Bacteria 5158
649 Ga0495590_0002453 3300046457 Bacteria 7679
650 Ga0495638_0001762 3300046460 Bacteria 18966
651 Ga0495638_0010173 3300046460 Bacteria 6550
652 Ga0495638_0021069 3300046460 Bacteria 4300
653 Ga0495650_0000468 3300046471 Bacteria 62149
654 Ga0495583_0000003 3300046506 Bacteria 709273
655 Ga0495616_0000405 3300046513 Bacteria 33255
656 Ga0495632_0005670 3300046519 Bacteria 8207
657 Ga0495648_0000107 3300046524 Bacteria 104376
658 Ga0495663_0001162 3300046525 Bacteria 8502
659 Ga0495663_0002800 3300046525 Bacteria 5156
660 Ga0495642_0002496 3300046528 Bacteria 7476
661 Ga0495654_0000199 3300046530 Bacteria 58450
662 Ga0495621_0000447 3300046539 Bacteria 10144
663 Ga0495621_0000851 3300046539 Bacteria 7770
664 Ga0495621_0002433 3300046539 Bacteria 5021
665 Ga0495621_0005616 3300046539 Bacteria 3618
666 Ga0495633_0003389 3300046558 Bacteria 10664
667 Ga0495668_0012936 3300046616 Bacteria 4940
668 Ga0495668_0033131 3300046616 Bacteria 2903
669 Ga0495625_0022251 3300046660 Bacteria 4864
670 Ga0495661_0009776 3300046665 Bacteria 6566
671 Ga0495669_0000007 3300046684 Bacteria 180797
672 Ga0495669_0000829 3300046684 Bacteria 13166
673 Ga0495669_0004057 3300046684 Bacteria 6022
674 Ga0495669_0006670 3300046684 Bacteria 4829
675 Ga0495669_0007965 3300046684 Bacteria 4446
676 Ga0495669_0016859 3300046684 Bacteria 3132
677 Ga0495670_0023372 3300046691 Bacteria 3051
678 Ga0495589_0003393 3300046794 Bacteria 8637
679 Ga0495673_0000209 3300047469 Bacteria 88818
680 Ga0495673_0001113 3300047469 Bacteria 23132
681 Ga0495673_0007297 3300047469 Bacteria 6380
682 Ga0495602_0028474 3300048088 Bacteria 5345
683 Ga0496101_0023614 3300048904 Bacteria 4250
684 Ga0496104_0073099 3300048907 Bacteria 3262
685 Ga0496107_0001479 3300048910 Bacteria 14543
686 Ga0496107_0019433 3300048910 Bacteria 4794
687 Ga0496108_0000297 3300048911 Bacteria 42741
688 Ga0496108_0001787 3300048911 Bacteria 17132
689 Ga0496108_0006024 3300048911 Bacteria 9816
690 Ga0496108_0012251 3300048911 Bacteria 6973
691 Ga0496109_0006868 3300048912 Bacteria 9598
692 Ga0496109_0009460 3300048912 Bacteria 8308
693 Ga0496109_0042375 3300048912 Bacteria 4123
694 Ga0496110_0001178 3300048913 Bacteria 18586
695 Ga0496110_0003500 3300048913 Bacteria 12050
696 Ga0496110_0004595 3300048913 Bacteria 10724
697 Ga0496110_0009854 3300048913 Bacteria 7744
698 Ga0496111_0005030 3300048914 Bacteria 8409
699 Ga0496112_0002054 3300048915 Bacteria 15962
700 Ga0496112_0002179 3300048915 Bacteria 15582
701 Ga0496112_0004926 3300048915 Bacteria 11427
702 Ga0496112_0012487 3300048915 Bacteria 7805
703 Ga0496112_0018875 3300048915 Bacteria 6497
704 Ga0496113_0003949 3300048916 Bacteria 9000
705 Ga0496113_0011419 3300048916 Bacteria 5923
706 Ga0496114_0000016 3300048917 Bacteria 274656
707 Ga0496114_0002174 3300048917 Bacteria 14931
708 Ga0496114_0007398 3300048917 Bacteria 8677
709 Ga0496115_0001058 3300048918 Bacteria 19947
710 Ga0496115_0002048 3300048918 Bacteria 14424
711 Ga0496115_0015780 3300048918 Bacteria 5736
712 Ga0496118_0017554 3300048921 Bacteria 6506
713 Ga0496122_0002027 3300048925 Bacteria 30082
714 Ga0496124_0044753 3300048927 Bacteria 3796
715 Ga0501033_0003244 3300049570 Bacteria 13460
716 Ga0501034_0007326 3300049571 Bacteria 11753
717 Ga0501047_0062630 3300049581 Bacteria 3588
718 nmdc:mga06z11_112_c1 3300050494 Bacteria 33355
719 nmdc:mga04h51_89_c1 3300050495 Bacteria 28127
720 nmdc:mga07m45_2411_c1 3300050496 Bacteria 8768
721 nmdc:mga09592_70879_c1 3300050508 Bacteria 2958
722 nmdc:mga0qj67_34860_c1 3300050509 Bacteria 3932
723 nmdc:mga06r32_2074_c1 3300050510 Bacteria 7843
724 nmdc:mga08y16_34088_c1 3300050511 Bacteria 5347
725 nmdc:mga08y16_37829_c1 3300050511 Bacteria 5066
726 nmdc:mga0a205_2537_c1 3300050515 Bacteria 16089
727 Ga0495619_0032876 3300053085 Bacteria 3367
728 Ga0500578_0000015 3300053086 Bacteria 179217
729 Ga0500643_000190 3300053087 Bacteria 58677
730 Ga0500643_000843 3300053087 Bacteria 19633
731 Ga0500643_002008 3300053087 Bacteria 10954
732 Ga0500644_0000305 3300053088 Bacteria 25991
733 Ga0500592_000146 3300053116 Bacteria 14471
734 Ga0500594_0000064 3300053118 Bacteria 33313
735 Ga0500658_0000150 3300053134 Bacteria 33225
736 Ga0500604_0000073 3300053151 Bacteria 35955
737 Ga0500622_0000840 3300053156 Bacteria 26274
738 Ga0500627_0000232 3300053158 Bacteria 15858
739 Ga0500645_000706 3300053730 Bacteria 20709
740 Ga0500609_000188 3300053731 Bacteria 8721
741 Ga0466962_0001446 3300061719 Bacteria 11077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053087 Ga0500643_002008 Ga0500643_002008_6541_9240 773
2 3300053730 Ga0500645_000706 Ga0500645_000706_11749_14448 773
3 3300005539 Ga0068853_100050193 Ga0068853_1000501931 778
4 3300005563 Ga0068855_100045776 Ga0068855_1000457762 778
5 3300025909 Ga0207705_10003058 Ga0207705_1000305815 778
6 3300025917 Ga0207660_10002582 Ga0207660_100025825 778
7 3300005366 Ga0070659_100030630 Ga0070659_1000306302 787
8 3300025919 Ga0207657_10011037 Ga0207657_100110376 787
9 3300037466 Ga0395898_0057108 Ga0395898_0057108_50_2620 787
10 3300045051 Ga0451576_0059938 Ga0451576_0059938_909_3515 791
11 3300037853 Ga0436364_0598036 Ga0436364_0598036_13130_15694 792
12 3300049571 Ga0501034_0007326 Ga0501034_0007326_1769_4459 796
13 3300013105 Ga0157369_10012543 Ga0157369_100125433 797
14 3300005327 Ga0070658_10020039 Ga0070658_100200392 800
15 3300005344 Ga0070661_100014601 Ga0070661_1000146012 800
16 3300005366 Ga0070659_100003487 Ga0070659_1000034872 800
17 3300005539 Ga0068853_100005879 Ga0068853_1000058793 800
18 3300009545 Ga0105237_10047358 Ga0105237_100473582 800
19 3300013104 Ga0157370_10008251 Ga0157370_100082513 800
20 3300013307 Ga0157372_10066976 Ga0157372_100669762 800
21 3300025904 Ga0207647_10003235 Ga0207647_100032353 800
22 3300025913 Ga0207695_10041344 Ga0207695_100413442 800
23 3300025924 Ga0207694_10002303 Ga0207694_100023035 800
24 3300025932 Ga0207690_10001997 Ga0207690_100019976 800
25 3300026041 Ga0207639_10000074 Ga0207639_1000007436 800
26 3300048907 Ga0496104_0073099 Ga0496104_0073099_395_2887 800
27 3300046684 Ga0495669_0000007 Ga0495669_0000007_115674_118373 804
28 3300035172 Ga0373955_0019520 Ga0373955_0019520_19_2532 805
29 3300042439 Ga0439464_0000240 Ga0439464_0000240_467_3067 805
30 3300046660 Ga0495625_0022251 Ga0495625_0022251_1734_4421 805
31 3300009551 Ga0105238_10002495 Ga0105238_100024957 806
32 3300046528 Ga0495642_0002496 Ga0495642_0002496_329_3016 806
33 3300005329 Ga0070683_100013120 Ga0070683_1000131202 807
34 3300026041 Ga0207639_10036827 Ga0207639_100368272 807
35 3300005338 Ga0068868_100000581 Ga0068868_10000058121 808
36 3300009098 Ga0105245_10007030 Ga0105245_100070307 808
37 3300009177 Ga0105248_10018121 Ga0105248_100181212 808
38 3300013297 Ga0157378_10086770 Ga0157378_100867702 808
39 3300014325 Ga0163163_10001686 Ga0163163_100016862 808
40 3300026095 Ga0207676_10006932 Ga0207676_100069323 808
41 3300048911 Ga0496108_0000297 Ga0496108_0000297_20775_23369 808
42 3300002075 JGI24738J21930_10000329 JGI24738J21930_100003292 809
43 3300005327 Ga0070658_10000374 Ga0070658_1000037425 809
44 3300005335 Ga0070666_10000701 Ga0070666_100007018 809
45 3300005339 Ga0070660_100000209 Ga0070660_10000020925 809
46 3300005344 Ga0070661_100000198 Ga0070661_10000019841 809
47 3300005366 Ga0070659_100000381 Ga0070659_10000038122 809
48 3300005367 Ga0070667_100009156 Ga0070667_1000091563 809
49 3300005457 Ga0070662_100000012 Ga0070662_10000001285 809
50 3300005539 Ga0068853_100000032 Ga0068853_10000003240 809
51 3300005547 Ga0070693_100004519 Ga0070693_1000045192 809
52 3300005548 Ga0070665_100014300 Ga0070665_1000143004 809
53 3300005563 Ga0068855_100001355 Ga0068855_10000135521 809
54 3300005564 Ga0070664_100000133 Ga0070664_10000013340 809
55 3300005614 Ga0068856_100000190 Ga0068856_10000019025 809
56 3300005616 Ga0068852_100001557 Ga0068852_1000015578 809
57 3300009177 Ga0105248_10000083 Ga0105248_1000008335 809
58 3300014325 Ga0163163_10000364 Ga0163163_1000036428 809
59 3300025903 Ga0207680_10000911 Ga0207680_100009113 809
60 3300025909 Ga0207705_10000072 Ga0207705_1000007240 809
61 3300025913 Ga0207695_10010664 Ga0207695_100106648 809
62 3300025919 Ga0207657_10000496 Ga0207657_1000049625 809
63 3300025920 Ga0207649_10000158 Ga0207649_1000015823 809
64 3300025932 Ga0207690_10000160 Ga0207690_1000016013 809
65 3300025933 Ga0207706_10000041 Ga0207706_1000004141 809
66 3300025941 Ga0207711_10002128 Ga0207711_100021283 809
67 3300025944 Ga0207661_10008050 Ga0207661_100080502 809
68 3300025945 Ga0207679_10000532 Ga0207679_100005327 809
69 3300025949 Ga0207667_10001389 Ga0207667_1000138922 809
70 3300025986 Ga0207658_10006047 Ga0207658_100060473 809
71 3300026041 Ga0207639_10010081 Ga0207639_100100812 809
72 3300026078 Ga0207702_10000444 Ga0207702_1000044410 809
73 3300026142 Ga0207698_10001798 Ga0207698_100017982 809
74 3300044684 Ga0466966_0000026 Ga0466966_0000026_29790_32366 809
75 3300031456 Ga0307513_10045911 Ga0307513_100459112 810
76 3300005616 Ga0068852_100015523 Ga0068852_1000155233 811
77 3300031852 Ga0307410_10003694 Ga0307410_100036942 811
78 3300032002 Ga0307416_100010574 Ga0307416_1000105742 811
79 3300032004 Ga0307414_10005273 Ga0307414_100052733 811
80 3300032126 Ga0307415_100013558 Ga0307415_1000135582 811
81 3300038443 Ga0395901_0085937 Ga0395901_0085937_343_2919 811
82 3300039437 Ga0436365_0083543 Ga0436365_0083543_70886_73456 811
83 3300025291 Ga0209675_1000773 Ga0209675_100077319 812
84 3300031995 Ga0307409_100050185 Ga0307409_1000501851 813
85 3300021358 Ga0213873_10000026 Ga0213873_1000002649 814
86 3300021384 Ga0213876_10000149 Ga0213876_1000014927 814
87 3300039437 Ga0436365_1025078 Ga0436365_1025078_2880_5447 814
88 3300039453 Ga0436362_0376260 Ga0436362_0376260_44249_46816 814
89 3300046539 Ga0495621_0002433 Ga0495621_0002433_426_3026 814
90 3300050496 nmdc:mga07m45_2411_c1 nmdc:mga07m45_2411_c1_532_3219 814
91 3300005327 Ga0070658_10016492 Ga0070658_100164922 815
92 3300005347 Ga0070668_100000618 Ga0070668_10000061816 815
93 3300013105 Ga0157369_10049758 Ga0157369_100497582 815
94 3300025919 Ga0207657_10002033 Ga0207657_100020333 815
95 3300031852 Ga0307410_10000283 Ga0307410_100002833 815
96 3300032005 Ga0307411_10005025 Ga0307411_100050253 815
97 3300005548 Ga0070665_100003398 Ga0070665_10000339811 816
98 3300005563 Ga0068855_100006268 Ga0068855_1000062686 816
99 3300005617 Ga0068859_100005151 Ga0068859_10000515112 816
100 3300005841 Ga0068863_100005453 Ga0068863_1000054532 816
101 3300006931 Ga0097620_100005150 Ga0097620_10000515012 816
102 3300009093 Ga0105240_10055409 Ga0105240_100554092 816
103 3300009177 Ga0105248_10000170 Ga0105248_1000017055 816
104 3300013105 Ga0157369_10000137 Ga0157369_1000013753 816
105 3300025941 Ga0207711_10000374 Ga0207711_1000037437 816
106 3300025949 Ga0207667_10002612 Ga0207667_100026128 816
107 3300028379 Ga0268266_10028015 Ga0268266_100280152 816
108 3300048917 Ga0496114_0002174 Ga0496114_0002174_8393_10960 816
109 3300005327 Ga0070658_10052771 Ga0070658_100527712 817
110 3300005614 Ga0068856_100014423 Ga0068856_1000144232 817
111 3300005616 Ga0068852_100008321 Ga0068852_1000083212 817
112 3300013102 Ga0157371_10001109 Ga0157371_100011095 817
113 3300013105 Ga0157369_10003724 Ga0157369_100037242 817
114 3300026142 Ga0207698_10008676 Ga0207698_100086762 817
115 3300036401 Ga0373937_0023245 Ga0373937_0023245_2722_5295 818
116 3300037312 Ga0395899_0003034 Ga0395899_0003034_3773_6349 818
117 3300037418 Ga0395900_0023759 Ga0395900_0023759_2488_5064 818
118 3300044693 Ga0466961_0014816 Ga0466961_0014816_1211_3787 818
119 3300049570 Ga0501033_0003244 Ga0501033_0003244_7419_10109 818
120 3300005331 Ga0070670_100000653 Ga0070670_10000065318 819
121 3300005335 Ga0070666_10000054 Ga0070666_1000005434 819
122 3300005345 Ga0070692_10015432 Ga0070692_100154322 819
123 3300005353 Ga0070669_100000097 Ga0070669_10000009740 819
124 3300005355 Ga0070671_100000041 Ga0070671_10000004145 819
125 3300005367 Ga0070667_100010193 Ga0070667_1000101933 819
126 3300005549 Ga0070704_100010200 Ga0070704_1000102003 819
127 3300005617 Ga0068859_100000270 Ga0068859_10000027021 819
128 3300005618 Ga0068864_100047267 Ga0068864_1000472672 819
129 3300005719 Ga0068861_100031650 Ga0068861_1000316503 819
130 3300005841 Ga0068863_100022866 Ga0068863_1000228662 819
131 3300005842 Ga0068858_100035523 Ga0068858_1000355232 819
132 3300005843 Ga0068860_100001602 Ga0068860_10000160217 819
133 3300005844 Ga0068862_100002553 Ga0068862_10000255312 819
134 3300006844 Ga0075428_100020860 Ga0075428_1000208603 819
135 3300006931 Ga0097620_100000270 Ga0097620_10000027021 819
136 3300009553 Ga0105249_10000424 Ga0105249_100004242 819
137 3300013306 Ga0163162_10001754 Ga0163162_100017545 819
138 3300014326 Ga0157380_10012004 Ga0157380_100120042 819
139 3300014326 Ga0157380_10018441 Ga0157380_100184415 819
140 3300025903 Ga0207680_10000183 Ga0207680_100001839 819
141 3300025923 Ga0207681_10000030 Ga0207681_1000003040 819
142 3300025931 Ga0207644_10000017 Ga0207644_1000001743 819
143 3300025961 Ga0207712_10006289 Ga0207712_100062892 819
144 3300025972 Ga0207668_10002806 Ga0207668_100028062 819
145 3300026075 Ga0207708_10016875 Ga0207708_100168755 819
146 3300026095 Ga0207676_10004139 Ga0207676_100041392 819
147 3300026118 Ga0207675_100003847 Ga0207675_1000038476 819
148 3300026118 Ga0207675_100006057 Ga0207675_1000060572 819
149 3300028380 Ga0268265_10000074 Ga0268265_10000074134 819
150 3300028381 Ga0268264_10000288 Ga0268264_1000028868 819
151 3300031852 Ga0307410_10008760 Ga0307410_100087602 819
152 3300037471 Ga0395905_0000500 Ga0395905_0000500_16_2592 819
153 3300048911 Ga0496108_0012251 Ga0496108_0012251_4431_6944 819
154 3300050508 nmdc:mga09592_70879_c1 nmdc:mga09592_70879_c1_73_2649 819
155 3300050509 nmdc:mga0qj67_34860_c1 nmdc:mga0qj67_34860_c1_1130_3709 819
156 3300050511 nmdc:mga08y16_37829_c1 nmdc:mga08y16_37829_c1_2420_4996 819
157 3300005436 Ga0070713_100000066 Ga0070713_10000006653 820
158 3300005548 Ga0070665_100004218 Ga0070665_10000421811 820
159 3300005842 Ga0068858_100021830 Ga0068858_1000218307 820
160 3300005843 Ga0068860_100000093 Ga0068860_100000093139 820
161 3300025928 Ga0207700_10000045 Ga0207700_1000004530 820
162 3300025986 Ga0207658_10001748 Ga0207658_1000174815 820
163 3300026035 Ga0207703_10038484 Ga0207703_100384842 820
164 3300028379 Ga0268266_10004880 Ga0268266_100048806 820
165 3300028381 Ga0268264_10000067 Ga0268264_10000067153 820
166 3300037418 Ga0395900_0035200 Ga0395900_0035200_2260_4947 820
167 3300025986 Ga0207658_10015732 Ga0207658_100157322 821
168 3300028380 Ga0268265_10031854 Ga0268265_100318542 821
169 3300042004 Ga0439445_0000319 Ga0439445_0000319_1241_3847 822
170 3300048913 Ga0496110_0003500 Ga0496110_0003500_9507_12020 822
171 3300005578 Ga0068854_100001547 Ga0068854_1000015472 823
172 3300025981 Ga0207640_10001476 Ga0207640_100014765 823
173 3300032005 Ga0307411_10043732 Ga0307411_100437321 823
174 3300044656 Ga0466969_0001635 Ga0466969_0001635_1878_4454 823
175 3300044684 Ga0466966_0005498 Ga0466966_0005498_5169_7745 823
176 3300044693 Ga0466961_0003480 Ga0466961_0003480_2909_5485 823
177 3300044694 Ga0466963_0003354 Ga0466963_0003354_6265_8841 823
178 3300044719 Ga0466971_0017748 Ga0466971_0017748_10_2586 823
179 3300044765 Ga0466970_0006740 Ga0466970_0006740_2007_4583 823
180 3300045836 Ga0466958_0024169 Ga0466958_0024169_433_3009 823
181 3300048918 Ga0496115_0015780 Ga0496115_0015780_1057_3762 823
182 3300061719 Ga0466962_0001446 Ga0466962_0001446_3222_5798 823
183 3300005841 Ga0068863_100000006 Ga0068863_10000000616 824
184 3300025904 Ga0207647_10020566 Ga0207647_100205661 824
185 3300025909 Ga0207705_10000030 Ga0207705_10000030167 824
186 3300025913 Ga0207695_10005782 Ga0207695_100057825 824
187 3300025920 Ga0207649_10000993 Ga0207649_100009933 824
188 3300025981 Ga0207640_10002630 Ga0207640_100026302 824
189 3300026067 Ga0207678_10001578 Ga0207678_100015784 824
190 3300026078 Ga0207702_10006134 Ga0207702_100061343 824
191 3300026088 Ga0207641_10000113 Ga0207641_10000113119 824
192 3300026142 Ga0207698_10002058 Ga0207698_100020582 824
193 3300031456 Ga0307513_10000178 Ga0307513_1000017850 824
194 3300031852 Ga0307410_10001956 Ga0307410_100019562 824
195 3300048921 Ga0496118_0017554 Ga0496118_0017554_3473_6097 824
196 3300049581 Ga0501047_0062630 Ga0501047_0062630_821_3520 824
197 3300005548 Ga0070665_100006371 Ga0070665_1000063712 825
198 3300005614 Ga0068856_100009268 Ga0068856_1000092683 825
199 3300005719 Ga0068861_100012258 Ga0068861_1000122582 825
200 3300005844 Ga0068862_100047100 Ga0068862_1000471002 825
201 3300013104 Ga0157370_10056633 Ga0157370_100566332 825
202 3300025913 Ga0207695_10006988 Ga0207695_100069884 825
203 3300026118 Ga0207675_100034678 Ga0207675_1000346782 825
204 3300035724 Ga0373933_0018215 Ga0373933_0018215_523_3096 825
205 3300048088 Ga0495602_0028474 Ga0495602_0028474_1271_3844 825
206 3300003794 Ga0055531_10006840 Ga0055531_100068405 826
207 3300005262 Ga0065165_1004269 Ga0065165_10042693 826
208 3300025295 Ga0209564_1004716 Ga0209564_10047162 826
209 3300025297 Ga0209758_1021184 Ga0209758_10211842 826
210 3300025298 Ga0209050_1010889 Ga0209050_10108892 826
211 3300025304 Ga0209257_1000192 Ga0209257_1000192123 826
212 3300037418 Ga0395900_0013390 Ga0395900_0013390_586_3159 826
213 3300037466 Ga0395898_0011580 Ga0395898_0011580_1184_3757 826
214 3300046460 Ga0495638_0010173 Ga0495638_0010173_2669_5368 826
215 3300046513 Ga0495616_0000405 Ga0495616_0000405_2424_5123 826
216 3300046519 Ga0495632_0005670 Ga0495632_0005670_1274_3973 826
217 3300047469 Ga0495673_0007297 Ga0495673_0007297_3259_5958 826
218 3300053731 Ga0500609_000188 Ga0500609_000188_3695_6394 826
219 3300005336 Ga0070680_100027087 Ga0070680_1000270873 827
220 3300009093 Ga0105240_10072734 Ga0105240_100727344 827
221 3300035695 Ga0373927_0002126 Ga0373927_0002126_2726_5428 827
222 3300037068 Ga0373925_0000199 Ga0373925_0000199_25508_28210 827
223 3300037418 Ga0395900_0000380 Ga0395900_0000380_14989_17592 827
224 3300037466 Ga0395898_0097231 Ga0395898_0097231_135_2738 827
225 3300038443 Ga0395901_0000181 Ga0395901_0000181_58281_60884 827
226 3300053151 Ga0500604_0000073 Ga0500604_0000073_14004_16568 827
227 3300005434 Ga0070709_10034557 Ga0070709_100345572 828
228 3300005436 Ga0070713_100004394 Ga0070713_1000043947 828
229 3300005548 Ga0070665_100002063 Ga0070665_1000020638 828
230 3300005841 Ga0068863_100060153 Ga0068863_1000601532 828
231 3300025915 Ga0207693_10020496 Ga0207693_100204962 828
232 3300028379 Ga0268266_10000003 Ga0268266_100000031341 828
233 3300037312 Ga0395899_0001291 Ga0395899_0001291_1636_4212 828
234 3300037418 Ga0395900_0000447 Ga0395900_0000447_29908_32484 828
235 3300037466 Ga0395898_0003866 Ga0395898_0003866_9328_11904 828
236 3300037466 Ga0395898_0090622 Ga0395898_0090622_299_2875 828
237 3300037471 Ga0395905_0045850 Ga0395905_0045850_15_2588 828
238 3300038443 Ga0395901_0000324 Ga0395901_0000324_29940_32516 828
239 3300005329 Ga0070683_100006559 Ga0070683_1000065592 829
240 3300005336 Ga0070680_100000584 Ga0070680_1000005846 829
241 3300005548 Ga0070665_100023313 Ga0070665_1000233134 829
242 3300025917 Ga0207660_10002482 Ga0207660_100024826 829
243 3300037312 Ga0395899_0001834 Ga0395899_0001834_13920_16493 829
244 3300037466 Ga0395898_0012701 Ga0395898_0012701_1432_4005 829
245 3300038443 Ga0395901_0003871 Ga0395901_0003871_9748_12321 829
246 3300046530 Ga0495654_0000199 Ga0495654_0000199_3166_5871 829
247 3300048915 Ga0496112_0018875 Ga0496112_0018875_1153_3732 829
248 3300048916 Ga0496113_0011419 Ga0496113_0011419_90_2687 829
249 3300005327 Ga0070658_10002325 Ga0070658_100023252 830
250 3300005339 Ga0070660_100001300 Ga0070660_1000013009 830
251 3300025909 Ga0207705_10006438 Ga0207705_100064383 830
252 3300025919 Ga0207657_10000267 Ga0207657_1000026728 830
253 3300025929 Ga0207664_10050213 Ga0207664_100502132 830
254 3300037471 Ga0395905_0002464 Ga0395905_0002464_9021_11642 830
255 3300046616 Ga0495668_0012936 Ga0495668_0012936_775_3348 830
256 3300005355 Ga0070671_100004757 Ga0070671_1000047572 831
257 3300025909 Ga0207705_10004488 Ga0207705_100044885 831
258 3300048911 Ga0496108_0006024 Ga0496108_0006024_70_2667 831
259 3300005355 Ga0070671_100014134 Ga0070671_1000141343 832
260 3300005367 Ga0070667_100003113 Ga0070667_1000031138 832
261 3300025263 Ga0209565_1000172 Ga0209565_100017219 832
262 3300025273 Ga0209673_1001352 Ga0209673_100135215 832
263 3300025297 Ga0209758_1010218 Ga0209758_10102184 832
264 3300025299 Ga0209256_1001634 Ga0209256_10016344 832
265 3300028786 Ga0307517_10004144 Ga0307517_1000414414 832
266 3300031251 Ga0265327_10000110 Ga0265327_1000011070 832
267 3300031456 Ga0307513_10004370 Ga0307513_1000437015 832
268 3300035170 Ga0373943_0015049 Ga0373943_0015049_767_3340 832
269 3300035724 Ga0373933_0008975 Ga0373933_0008975_1824_4430 832
270 3300036401 Ga0373937_0013690 Ga0373937_0013690_192_2798 832
271 3300037312 Ga0395899_0006100 Ga0395899_0006100_3731_6304 832
272 3300037418 Ga0395900_0069631 Ga0395900_0069631_502_3075 832
273 3300038443 Ga0395901_0017012 Ga0395901_0017012_1385_3958 832
274 3300046457 Ga0495590_0002453 Ga0495590_0002453_3493_6192 832
275 3300048918 Ga0496115_0002048 Ga0496115_0002048_1249_3948 832
276 3300001990 JGI24737J22298_10003453 JGI24737J22298_100034532 833
277 3300002075 JGI24738J21930_10000018 JGI24738J21930_1000001822 833
278 3300005330 Ga0070690_100020446 Ga0070690_1000204462 833
279 3300005331 Ga0070670_100010209 Ga0070670_1000102094 833
280 3300005334 Ga0068869_100000415 Ga0068869_1000004158 833
281 3300005340 Ga0070689_100012545 Ga0070689_1000125452 833
282 3300005347 Ga0070668_100023246 Ga0070668_1000232463 833
283 3300005353 Ga0070669_100000613 Ga0070669_10000061318 833
284 3300005354 Ga0070675_100010635 Ga0070675_1000106352 833
285 3300005355 Ga0070671_100000068 Ga0070671_10000006825 833
286 3300005367 Ga0070667_100066131 Ga0070667_1000661312 833
287 3300005457 Ga0070662_100000723 Ga0070662_1000007233 833
288 3300005539 Ga0068853_100000570 Ga0068853_1000005703 833
289 3300009177 Ga0105248_10022678 Ga0105248_100226783 833
290 3300013102 Ga0157371_10001392 Ga0157371_1000139217 833
291 3300013297 Ga0157378_10002066 Ga0157378_100020669 833
292 3300025941 Ga0207711_10003449 Ga0207711_100034492 833
293 3300025986 Ga0207658_10009750 Ga0207658_100097503 833
294 3300026067 Ga0207678_10004268 Ga0207678_100042687 833
295 3300031911 Ga0307412_10004529 Ga0307412_100045292 833
296 3300032005 Ga0307411_10006075 Ga0307411_100060753 833
297 3300032005 Ga0307411_10021437 Ga0307411_100214372 833
298 3300037466 Ga0395898_0000054 Ga0395898_0000054_27488_30061 833
299 3300037471 Ga0395905_0000005 Ga0395905_0000005_546175_548748 833
300 3300046506 Ga0495583_0000003 Ga0495583_0000003_464637_467336 833
301 3300053085 Ga0495619_0032876 Ga0495619_0032876_91_2700 833
302 3300053156 Ga0500622_0000840 Ga0500622_0000840_3679_6378 833
303 3300005347 Ga0070668_100000007 Ga0070668_10000000742 834
304 3300005548 Ga0070665_100000303 Ga0070665_10000030369 834
305 3300005614 Ga0068856_100029278 Ga0068856_1000292782 834
306 3300005617 Ga0068859_100000685 Ga0068859_10000068532 834
307 3300005618 Ga0068864_100000706 Ga0068864_10000070617 834
308 3300005843 Ga0068860_100001106 Ga0068860_10000110623 834
309 3300006028 Ga0070717_10003094 Ga0070717_100030946 834
310 3300006931 Ga0097620_100000685 Ga0097620_1000006851 834
311 3300009553 Ga0105249_10001126 Ga0105249_100011267 834
312 3300014325 Ga0163163_10008590 Ga0163163_100085904 834
313 3300025941 Ga0207711_10000831 Ga0207711_1000083126 834
314 3300025960 Ga0207651_10011884 Ga0207651_100118843 834
315 3300026088 Ga0207641_10000887 Ga0207641_100008879 834
316 3300026095 Ga0207676_10001717 Ga0207676_100017177 834
317 3300028379 Ga0268266_10000130 Ga0268266_10000130124 834
318 3300028381 Ga0268264_10000410 Ga0268264_1000041063 834
319 3300028381 Ga0268264_10000418 Ga0268264_1000041857 834
320 3300031903 Ga0307407_10006133 Ga0307407_100061332 834
321 3300032004 Ga0307414_10001122 Ga0307414_1000112210 834
322 3300053134 Ga0500658_0000150 Ga0500658_0000150_14294_16891 834
323 3300005577 Ga0068857_100024974 Ga0068857_1000249742 835
324 3300021388 Ga0213875_10000380 Ga0213875_1000038025 835
325 3300025933 Ga0207706_10006444 Ga0207706_100064444 835
326 3300037312 Ga0395899_0015562 Ga0395899_0015562_1892_4471 835
327 3300037471 Ga0395905_0009087 Ga0395905_0009087_4030_6699 835
328 3300037853 Ga0436364_0424934 Ga0436364_0424934_22923_25610 835
329 3300038443 Ga0395901_0002597 Ga0395901_0002597_8577_11198 835
330 3300038443 Ga0395901_0018581 Ga0395901_0018581_3420_6089 835
331 3300046524 Ga0495648_0000107 Ga0495648_0000107_85868_88567 835
332 3300047469 Ga0495673_0000209 Ga0495673_0000209_82940_85639 835
333 3300053088 Ga0500644_0000305 Ga0500644_0000305_14201_16900 835
334 3300005334 Ga0068869_100014747 Ga0068869_1000147473 836
335 3300005355 Ga0070671_100014195 Ga0070671_1000141953 836
336 3300010159 Ga0099796_10000460 Ga0099796_100004605 836
337 3300025919 Ga0207657_10006412 Ga0207657_100064124 836
338 3300025942 Ga0207689_10010796 Ga0207689_100107963 836
339 3300037466 Ga0395898_0007122 Ga0395898_0007122_8358_10979 836
340 3300038443 Ga0395901_0048039 Ga0395901_0048039_1108_3690 836
341 3300005327 Ga0070658_10010136 Ga0070658_100101362 837
342 3300005329 Ga0070683_100004124 Ga0070683_1000041242 837
343 3300005336 Ga0070680_100003391 Ga0070680_1000033915 837
344 3300005339 Ga0070660_100000116 Ga0070660_1000001168 837
345 3300005530 Ga0070679_100001280 Ga0070679_10000128010 837
346 3300005563 Ga0068855_100006747 Ga0068855_1000067474 837
347 3300005614 Ga0068856_100007786 Ga0068856_1000077863 837
348 3300025904 Ga0207647_10006311 Ga0207647_100063113 837
349 3300025909 Ga0207705_10000123 Ga0207705_1000012358 837
350 3300025909 Ga0207705_10001768 Ga0207705_100017689 837
351 3300025917 Ga0207660_10001036 Ga0207660_100010363 837
352 3300025919 Ga0207657_10005014 Ga0207657_100050143 837
353 3300025921 Ga0207652_10000034 Ga0207652_1000003456 837
354 3300025944 Ga0207661_10001415 Ga0207661_100014154 837
355 3300025949 Ga0207667_10005579 Ga0207667_100055795 837
356 3300026067 Ga0207678_10000530 Ga0207678_1000053029 837
357 3300031824 Ga0307413_10000129 Ga0307413_1000012912 837
358 3300031903 Ga0307407_10011200 Ga0307407_100112002 837
359 3300031995 Ga0307409_100006316 Ga0307409_1000063161 837
360 3300032005 Ga0307411_10000313 Ga0307411_100003138 837
361 3300037312 Ga0395899_0002771 Ga0395899_0002771_9318_11939 837
362 3300006847 Ga0075431_100013027 Ga0075431_1000130274 838
363 3300013308 Ga0157375_10005011 Ga0157375_100050118 838
364 3300025928 Ga0207700_10047881 Ga0207700_100478812 838
365 3300031731 Ga0307405_10014302 Ga0307405_100143022 838
366 3300032004 Ga0307414_10043457 Ga0307414_100434572 838
367 3300046460 Ga0495638_0001762 Ga0495638_0001762_2507_5206 838
368 3300048913 Ga0496110_0004595 Ga0496110_0004595_4579_7146 838
369 3300048914 Ga0496111_0005030 Ga0496111_0005030_3177_5813 838
370 3300050510 nmdc:mga06r32_2074_c1 nmdc:mga06r32_2074_c1_241_2847 838
371 3300053086 Ga0500578_0000015 Ga0500578_0000015_70471_73170 838
372 3300053118 Ga0500594_0000064 Ga0500594_0000064_27505_30204 838
373 3300005435 Ga0070714_100009413 Ga0070714_1000094131 839
374 3300005564 Ga0070664_100011633 Ga0070664_1000116332 839
375 3300005842 Ga0068858_100001171 Ga0068858_10000117110 839
376 3300006358 Ga0068871_100019293 Ga0068871_1000192932 839
377 3300009177 Ga0105248_10001775 Ga0105248_1000177510 839
378 3300009177 Ga0105248_10007989 Ga0105248_100079894 839
379 3300013306 Ga0163162_10001622 Ga0163162_100016229 839
380 3300025907 Ga0207645_10024979 Ga0207645_100249793 839
381 3300025933 Ga0207706_10000253 Ga0207706_100002533 839
382 3300025945 Ga0207679_10018481 Ga0207679_100184812 839
383 3300026116 Ga0207674_10000086 Ga0207674_1000008692 839
384 3300037418 Ga0395900_0007902 Ga0395900_0007902_27_2675 839
385 3300037418 Ga0395900_0019399 Ga0395900_0019399_898_3552 839
386 3300037471 Ga0395905_0002081 Ga0395905_0002081_7750_10398 839
387 3300037471 Ga0395905_0004286 Ga0395905_0004286_6672_9326 839
388 3300037471 Ga0395905_0022741 Ga0395905_0022741_363_2936 839
389 3300038443 Ga0395901_0037788 Ga0395901_0037788_1045_3693 839
390 3300044694 Ga0466963_0008594 Ga0466963_0008594_1123_3720 839
391 3300045836 Ga0466958_0006502 Ga0466958_0006502_464_3061 839
392 3300048912 Ga0496109_0006868 Ga0496109_0006868_6938_9511 839
393 3300048913 Ga0496110_0009854 Ga0496110_0009854_1774_4347 839
394 3300048915 Ga0496112_0002054 Ga0496112_0002054_6547_9120 839
395 3300048915 Ga0496112_0012487 Ga0496112_0012487_4139_6721 839
396 3300005843 Ga0068860_100059698 Ga0068860_1000596982 840
397 3300009177 Ga0105248_10011330 Ga0105248_100113303 840
398 3300025909 Ga0207705_10002020 Ga0207705_100020202 840
399 3300025941 Ga0207711_10008412 Ga0207711_100084122 840
400 3300028381 Ga0268264_10063658 Ga0268264_100636582 840
401 3300037471 Ga0395905_0000226 Ga0395905_0000226_75413_77986 840
402 3300037471 Ga0395905_0023106 Ga0395905_0023106_775_3420 840
403 3300042157 Ga0439458_0000539 Ga0439458_0000539_3234_5903 840
404 3300046460 Ga0495638_0021069 Ga0495638_0021069_1293_3974 840
405 3300046684 Ga0495669_0006670 Ga0495669_0006670_596_3169 840
406 3300048918 Ga0496115_0001058 Ga0496115_0001058_9882_12620 840
407 3300005336 Ga0070680_100002229 Ga0070680_1000022297 841
408 3300005355 Ga0070671_100001153 Ga0070671_10000115310 841
409 3300005530 Ga0070679_100000001 Ga0070679_100000001361 841
410 3300005618 Ga0068864_100001341 Ga0068864_1000013418 841
411 3300009177 Ga0105248_10000660 Ga0105248_1000066012 841
412 3300025917 Ga0207660_10001792 Ga0207660_100017927 841
413 3300025919 Ga0207657_10004176 Ga0207657_1000417611 841
414 3300025921 Ga0207652_10000274 Ga0207652_1000027411 841
415 3300025931 Ga0207644_10004273 Ga0207644_100042733 841
416 3300025941 Ga0207711_10007812 Ga0207711_100078122 841
417 3300025944 Ga0207661_10028679 Ga0207661_100286792 841
418 3300025945 Ga0207679_10026459 Ga0207679_100264592 841
419 3300026095 Ga0207676_10000253 Ga0207676_1000025319 841
420 3300046684 Ga0495669_0000829 Ga0495669_0000829_4533_7106 841
421 3300046684 Ga0495669_0007965 Ga0495669_0007965_803_3448 841
422 3300048904 Ga0496101_0023614 Ga0496101_0023614_1273_3918 841
423 3300048910 Ga0496107_0001479 Ga0496107_0001479_3850_6495 841
424 3300048915 Ga0496112_0002179 Ga0496112_0002179_4774_7419 841
425 3300048916 Ga0496113_0003949 Ga0496113_0003949_4370_7015 841
426 3300005339 Ga0070660_100002258 Ga0070660_1000022585 842
427 3300005563 Ga0068855_100010689 Ga0068855_1000106893 842
428 3300005578 Ga0068854_100001986 Ga0068854_1000019862 842
429 3300005616 Ga0068852_100023324 Ga0068852_1000233242 842
430 3300005618 Ga0068864_100004090 Ga0068864_1000040903 842
431 3300005841 Ga0068863_100047769 Ga0068863_1000477692 842
432 3300005842 Ga0068858_100000971 Ga0068858_10000097114 842
433 3300005844 Ga0068862_100011671 Ga0068862_1000116712 842
434 3300009177 Ga0105248_10001290 Ga0105248_100012902 842
435 3300014968 Ga0157379_10000566 Ga0157379_1000056622 842
436 3300021388 Ga0213875_10000166 Ga0213875_1000016611 842
437 3300025901 Ga0207688_10009969 Ga0207688_100099692 842
438 3300025904 Ga0207647_10000968 Ga0207647_1000096818 842
439 3300025919 Ga0207657_10005448 Ga0207657_100054485 842
440 3300025920 Ga0207649_10037838 Ga0207649_100378381 842
441 3300025925 Ga0207650_10003264 Ga0207650_100032641 842
442 3300025927 Ga0207687_10000745 Ga0207687_1000074515 842
443 3300025931 Ga0207644_10000098 Ga0207644_100000981 842
444 3300025932 Ga0207690_10006517 Ga0207690_100065173 842
445 3300025940 Ga0207691_10000563 Ga0207691_1000056310 842
446 3300025949 Ga0207667_10008667 Ga0207667_100086672 842
447 3300025972 Ga0207668_10005448 Ga0207668_100054482 842
448 3300026035 Ga0207703_10021870 Ga0207703_100218703 842
449 3300026041 Ga0207639_10002528 Ga0207639_100025283 842
450 3300026095 Ga0207676_10035629 Ga0207676_100356292 842
451 3300026116 Ga0207674_10001715 Ga0207674_100017153 842
452 3300037312 Ga0395899_0029071 Ga0395899_0029071_24_2597 842
453 3300037471 Ga0395905_0002414 Ga0395905_0002414_14664_17237 842
454 3300037853 Ga0436364_0545952 Ga0436364_0545952_8853_11465 842
455 3300038443 Ga0395901_0004994 Ga0395901_0004994_5120_7693 842
456 3300038443 Ga0395901_0015929 Ga0395901_0015929_1745_4318 842
457 3300048913 Ga0496110_0001178 Ga0496110_0001178_11747_14347 842
458 3300053087 Ga0500643_000843 Ga0500643_000843_9140_11821 842
459 3300005548 Ga0070665_100025783 Ga0070665_1000257832 843
460 3300005841 Ga0068863_100000027 Ga0068863_10000002786 843
461 3300005844 Ga0068862_100024878 Ga0068862_1000248782 843
462 3300025972 Ga0207668_10000054 Ga0207668_1000005416 843
463 3300026088 Ga0207641_10000045 Ga0207641_1000004590 843
464 3300028381 Ga0268264_10001183 Ga0268264_100011832 843
465 3300037418 Ga0395900_0114751 Ga0395900_0114751_66_2663 843
466 3300044694 Ga0466963_0016743 Ga0466963_0016743_1582_4185 843
467 3300044719 Ga0466971_0002121 Ga0466971_0002121_3345_5948 843
468 3300045049 Ga0466959_0045773 Ga0466959_0045773_202_2805 843
469 3300048925 Ga0496122_0002027 Ga0496122_0002027_8754_11348 843
470 3300048927 Ga0496124_0044753 Ga0496124_0044753_105_2699 843
471 3300005338 Ga0068868_100005223 Ga0068868_1000052234 844
472 3300005842 Ga0068858_100016331 Ga0068858_1000163312 844
473 3300006178 Ga0075367_10000329 Ga0075367_100003292 844
474 3300009093 Ga0105240_10018195 Ga0105240_100181952 844
475 3300009177 Ga0105248_10013432 Ga0105248_100134325 844
476 3300021384 Ga0213876_10000257 Ga0213876_1000025718 844
477 3300025903 Ga0207680_10000328 Ga0207680_1000032813 844
478 3300025931 Ga0207644_10015213 Ga0207644_100152132 844
479 3300025941 Ga0207711_10007702 Ga0207711_100077022 844
480 3300025960 Ga0207651_10001030 Ga0207651_100010302 844
481 3300025986 Ga0207658_10002652 Ga0207658_100026528 844
482 3300025986 Ga0207658_10015630 Ga0207658_100156302 844
483 3300026023 Ga0207677_10002148 Ga0207677_100021482 844
484 3300026035 Ga0207703_10003816 Ga0207703_100038163 844
485 3300027866 Ga0209813_10000029 Ga0209813_1000002912 844
486 3300037418 Ga0395900_0001102 Ga0395900_0001102_15748_18312 844
487 3300038443 Ga0395901_0001088 Ga0395901_0001088_16798_19362 844
488 3300039437 Ga0436365_1884511 Ga0436365_1884511_82593_85289 844
489 3300046616 Ga0495668_0033131 Ga0495668_0033131_194_2791 844
490 3300050494 nmdc:mga06z11_112_c1 nmdc:mga06z11_112_c1_15863_18505 844
491 3300050495 nmdc:mga04h51_89_c1 nmdc:mga04h51_89_c1_11201_13843 844
492 3300005327 Ga0070658_10003546 Ga0070658_100035462 845
493 3300005333 Ga0070677_10002908 Ga0070677_100029083 845
494 3300005344 Ga0070661_100010064 Ga0070661_1000100642 845
495 3300005364 Ga0070673_100003335 Ga0070673_1000033353 845
496 3300005366 Ga0070659_100026671 Ga0070659_1000266712 845
497 3300005367 Ga0070667_100007351 Ga0070667_1000073514 845
498 3300005456 Ga0070678_100035758 Ga0070678_1000357582 845
499 3300005614 Ga0068856_100035110 Ga0068856_1000351102 845
500 3300005617 Ga0068859_100039659 Ga0068859_1000396592 845
501 3300005618 Ga0068864_100040491 Ga0068864_1000404912 845
502 3300005834 Ga0068851_10011140 Ga0068851_100111402 845
503 3300005841 Ga0068863_100006973 Ga0068863_1000069733 845
504 3300005843 Ga0068860_100011638 Ga0068860_1000116383 845
505 3300006931 Ga0097620_100039658 Ga0097620_1000396582 845
506 3300009094 Ga0111539_10026357 Ga0111539_100263573 845
507 3300009098 Ga0105245_10062817 Ga0105245_100628172 845
508 3300009551 Ga0105238_10043610 Ga0105238_100436102 845
509 3300013306 Ga0163162_10018777 Ga0163162_100187772 845
510 3300025903 Ga0207680_10004458 Ga0207680_100044582 845
511 3300025909 Ga0207705_10003236 Ga0207705_100032362 845
512 3300025924 Ga0207694_10027856 Ga0207694_100278562 845
513 3300025931 Ga0207644_10000358 Ga0207644_100003587 845
514 3300025933 Ga0207706_10003800 Ga0207706_1000380010 845
515 3300025934 Ga0207686_10014056 Ga0207686_100140562 845
516 3300025940 Ga0207691_10005229 Ga0207691_1000522910 845
517 3300025941 Ga0207711_10013720 Ga0207711_100137203 845
518 3300025945 Ga0207679_10040630 Ga0207679_100406301 845
519 3300025960 Ga0207651_10000785 Ga0207651_100007854 845
520 3300025981 Ga0207640_10027401 Ga0207640_100274012 845
521 3300026035 Ga0207703_10018840 Ga0207703_100188402 845
522 3300026089 Ga0207648_10016665 Ga0207648_100166652 845
523 3300026121 Ga0207683_10002667 Ga0207683_100026673 845
524 3300026142 Ga0207698_10003524 Ga0207698_100035244 845
525 3300048911 Ga0496108_0001787 Ga0496108_0001787_7323_9923 845
526 3300048912 Ga0496109_0009460 Ga0496109_0009460_3416_6016 845
527 3300048915 Ga0496112_0004926 Ga0496112_0004926_4773_7373 845
528 3300003781 Ga0055536_1008392 Ga0055536_10083923 846
529 3300005539 Ga0068853_100053302 Ga0068853_1000533022 846
530 3300005577 Ga0068857_100066943 Ga0068857_1000669432 846
531 3300013102 Ga0157371_10045796 Ga0157371_100457962 846
532 3300013104 Ga0157370_10000497 Ga0157370_1000049715 846
533 3300013104 Ga0157370_10031202 Ga0157370_100312023 846
534 3300013105 Ga0157369_10013100 Ga0157369_100131002 846
535 3300026067 Ga0207678_10030016 Ga0207678_100300162 846
536 3300026116 Ga0207674_10026884 Ga0207674_100268843 846
537 3300042144 Ga0450889_000104 Ga0450889_000104_431_3001 846
538 3300046471 Ga0495650_0000468 Ga0495650_0000468_56165_58864 846
539 3300046794 Ga0495589_0003393 Ga0495589_0003393_2635_5346 846
540 3300047469 Ga0495673_0001113 Ga0495673_0001113_11215_13926 846
541 3300050511 nmdc:mga08y16_34088_c1 nmdc:mga08y16_34088_c1_261_2831 846
542 3300005331 Ga0070670_100023106 Ga0070670_1000231062 847
543 3300005338 Ga0068868_100000734 Ga0068868_1000007349 847
544 3300005344 Ga0070661_100007737 Ga0070661_1000077372 847
545 3300005345 Ga0070692_10005845 Ga0070692_100058452 847
546 3300005354 Ga0070675_100001980 Ga0070675_1000019802 847
547 3300005355 Ga0070671_100001512 Ga0070671_10000151210 847
548 3300005364 Ga0070673_100000858 Ga0070673_1000008583 847
549 3300005366 Ga0070659_100004639 Ga0070659_1000046393 847
550 3300005367 Ga0070667_100021092 Ga0070667_1000210921 847
551 3300005548 Ga0070665_100021320 Ga0070665_1000213202 847
552 3300005577 Ga0068857_100003085 Ga0068857_1000030857 847
553 3300009098 Ga0105245_10000128 Ga0105245_100001285 847
554 3300025909 Ga0207705_10011779 Ga0207705_100117793 847
555 3300025909 Ga0207705_10014165 Ga0207705_100141652 847
556 3300025919 Ga0207657_10014259 Ga0207657_100142592 847
557 3300025919 Ga0207657_10026695 Ga0207657_100266952 847
558 3300025919 Ga0207657_10041100 Ga0207657_100411002 847
559 3300025933 Ga0207706_10001436 Ga0207706_100014362 847
560 3300025933 Ga0207706_10024797 Ga0207706_100247973 847
561 3300025933 Ga0207706_10034375 Ga0207706_100343752 847
562 3300025940 Ga0207691_10001958 Ga0207691_100019589 847
563 3300025945 Ga0207679_10057252 Ga0207679_100572522 847
564 3300028379 Ga0268266_10016486 Ga0268266_100164862 847
565 3300037312 Ga0395899_0003740 Ga0395899_0003740_2256_4829 847
566 3300037471 Ga0395905_0083913 Ga0395905_0083913_63_2636 847
567 3300037471 Ga0395905_0086430 Ga0395905_0086430_235_2808 847
568 3300038443 Ga0395901_0053704 Ga0395901_0053704_1057_3702 847
569 3300038443 Ga0395901_0056701 Ga0395901_0056701_1148_3724 847
570 3300046539 Ga0495621_0000851 Ga0495621_0000851_2439_5012 847
571 3300048917 Ga0496114_0000016 Ga0496114_0000016_239516_242089 847
572 3300005355 Ga0070671_100004025 Ga0070671_1000040256 848
573 3300005367 Ga0070667_100001661 Ga0070667_1000016613 848
574 3300005457 Ga0070662_100002417 Ga0070662_1000024176 848
575 3300005458 Ga0070681_10091110 Ga0070681_100911101 848
576 3300005618 Ga0068864_100003892 Ga0068864_1000038922 848
577 3300005841 Ga0068863_100074369 Ga0068863_1000743692 848
578 3300014325 Ga0163163_10000890 Ga0163163_100008909 848
579 3300025931 Ga0207644_10000415 Ga0207644_1000041523 848
580 3300025941 Ga0207711_10002381 Ga0207711_100023813 848
581 3300026095 Ga0207676_10001727 Ga0207676_100017277 848
582 3300037418 Ga0395900_0031497 Ga0395900_0031497_985_3654 848
583 3300037466 Ga0395898_0010930 Ga0395898_0010930_838_3507 848
584 3300001990 JGI24737J22298_10000206 JGI24737J22298_1000020618 849
585 3300037418 Ga0395900_0032603 Ga0395900_0032603_369_2969 849
586 3300046525 Ga0495663_0002800 Ga0495663_0002800_1480_4059 849
587 3300005455 Ga0070663_100033850 Ga0070663_1000338502 850
588 3300005617 Ga0068859_100016680 Ga0068859_1000166802 850
589 3300005842 Ga0068858_100003773 Ga0068858_1000037736 850
590 3300005843 Ga0068860_100001606 Ga0068860_1000016069 850
591 3300009545 Ga0105237_10019701 Ga0105237_100197013 850
592 3300025913 Ga0207695_10037772 Ga0207695_100377723 850
593 3300025917 Ga0207660_10004827 Ga0207660_100048272 850
594 3300025919 Ga0207657_10002179 Ga0207657_1000217916 850
595 3300025942 Ga0207689_10011804 Ga0207689_100118041 850
596 3300025949 Ga0207667_10019982 Ga0207667_100199823 850
597 3300026035 Ga0207703_10003645 Ga0207703_100036456 850
598 3300026088 Ga0207641_10001862 Ga0207641_100018627 850
599 3300026095 Ga0207676_10001070 Ga0207676_100010707 850
600 3300026116 Ga0207674_10005045 Ga0207674_100050455 850
601 3300028381 Ga0268264_10013454 Ga0268264_100134542 850
602 3300031901 Ga0307406_10009749 Ga0307406_100097492 850
603 3300044694 Ga0466963_0001562 Ga0466963_0001562_5926_8523 850
604 3300044842 Ga0466957_0000705 Ga0466957_0000705_5144_7741 850
605 3300045976 Ga0466967_0000571 Ga0466967_0000571_9349_11946 850
606 3300005355 Ga0070671_100055446 Ga0070671_1000554462 851
607 3300013308 Ga0157375_10019356 Ga0157375_100193562 851
608 3300017792 Ga0163161_10042600 Ga0163161_100426002 851
609 3300031901 Ga0307406_10021704 Ga0307406_100217042 851
610 3300048910 Ga0496107_0019433 Ga0496107_0019433_298_2892 851
611 3300048912 Ga0496109_0042375 Ga0496109_0042375_507_3101 851
612 3300048917 Ga0496114_0007398 Ga0496114_0007398_5659_8253 851
613 3300053087 Ga0500643_000190 Ga0500643_000190_21408_24062 851
614 3300053116 Ga0500592_000146 Ga0500592_000146_638_3286 851
615 3300053158 Ga0500627_0000232 Ga0500627_0000232_8643_11291 851
616 3300046684 Ga0495669_0004057 Ga0495669_0004057_1224_3821 852
617 iso_pu_bacteria 2885427238 2885429148 852
618 3300005328 Ga0070676_10014345 Ga0070676_100143451 853
619 3300005331 Ga0070670_100003772 Ga0070670_1000037729 853
620 3300005355 Ga0070671_100001973 Ga0070671_10000197310 853
621 3300005364 Ga0070673_100023532 Ga0070673_1000235322 853
622 3300005367 Ga0070667_100017456 Ga0070667_1000174563 853
623 3300005441 Ga0070700_100021864 Ga0070700_1000218642 853
624 3300005457 Ga0070662_100013671 Ga0070662_1000136712 853
625 3300005458 Ga0070681_10019776 Ga0070681_100197762 853
626 3300005459 Ga0068867_100018169 Ga0068867_1000181692 853
627 3300005543 Ga0070672_100004663 Ga0070672_1000046633 853
628 3300013102 Ga0157371_10007119 Ga0157371_100071192 853
629 3300020082 Ga0206353_10722721 Ga0206353_107227212 853
630 3300025893 Ga0207682_10000177 Ga0207682_1000017717 853
631 3300025917 Ga0207660_10005438 Ga0207660_100054383 853
632 3300028381 Ga0268264_10034425 Ga0268264_100344252 853
633 3300046525 Ga0495663_0001162 Ga0495663_0001162_852_3461 853
634 3300046539 Ga0495621_0000447 Ga0495621_0000447_4949_7558 853
635 3300046691 Ga0495670_0023372 Ga0495670_0023372_392_2998 853
636 3300005535 Ga0070684_100002224 Ga0070684_10000222411 854
637 3300005549 Ga0070704_100028454 Ga0070704_1000284541 854
638 3300005564 Ga0070664_100000848 Ga0070664_1000008483 854
639 3300005843 Ga0068860_100021760 Ga0068860_1000217602 854
640 3300014745 Ga0157377_10013175 Ga0157377_100131752 854
641 3300014968 Ga0157379_10001895 Ga0157379_100018954 854
642 3300025904 Ga0207647_10001938 Ga0207647_100019383 854
643 3300025904 Ga0207647_10004569 Ga0207647_100045695 854
644 3300026035 Ga0207703_10002174 Ga0207703_100021746 854
645 3300028380 Ga0268265_10017478 Ga0268265_100174783 854
646 3300028381 Ga0268264_10002893 Ga0268264_100028936 854
647 3300031995 Ga0307409_100020915 Ga0307409_1000209152 854
648 3300050515 nmdc:mga0a205_2537_c1 nmdc:mga0a205_2537_c1_9821_12463 854
649 3300005366 Ga0070659_100005141 Ga0070659_1000051413 855
650 3300005458 Ga0070681_10022891 Ga0070681_100228912 855
651 3300005546 Ga0070696_100003345 Ga0070696_1000033455 855
652 3300005564 Ga0070664_100015527 Ga0070664_1000155272 855
653 3300025909 Ga0207705_10003465 Ga0207705_100034653 855
654 3300025919 Ga0207657_10002077 Ga0207657_100020772 855
655 3300025919 Ga0207657_10006813 Ga0207657_100068135 855
656 3300025919 Ga0207657_10008867 Ga0207657_100088674 855
657 3300025932 Ga0207690_10004007 Ga0207690_100040073 855
658 3300025945 Ga0207679_10012365 Ga0207679_100123653 855
659 3300026142 Ga0207698_10000774 Ga0207698_100007746 855
660 3300044693 Ga0466961_0003951 Ga0466961_0003951_406_3009 855
661 3300044694 Ga0466963_0005918 Ga0466963_0005918_4331_6934 855
662 3300044842 Ga0466957_0030216 Ga0466957_0030216_116_2719 855
663 3300045976 Ga0466967_0022346 Ga0466967_0022346_1274_3871 855
664 iso_pu_bacteria 2512564014 2512641716 855
665 3300001979 JGI24740J21852_10000664 JGI24740J21852_100006646 856
666 3300002067 JGI24735J21928_10002271 JGI24735J21928_100022714 856
667 3300002077 JGI24744J21845_10002247 JGI24744J21845_100022472 856
668 3300005331 Ga0070670_100037887 Ga0070670_1000378872 856
669 3300005335 Ga0070666_10019939 Ga0070666_100199392 856
670 3300005338 Ga0068868_100004915 Ga0068868_1000049152 856
671 3300005344 Ga0070661_100026191 Ga0070661_1000261912 856
672 3300005356 Ga0070674_100001041 Ga0070674_1000010413 856
673 3300005366 Ga0070659_100005351 Ga0070659_1000053513 856
674 3300005456 Ga0070678_100010042 Ga0070678_1000100423 856
675 3300005457 Ga0070662_100000513 Ga0070662_10000051311 856
676 3300005459 Ga0068867_100027521 Ga0068867_1000275212 856
677 3300005564 Ga0070664_100001296 Ga0070664_10000129618 856
678 3300005617 Ga0068859_100001592 Ga0068859_10000159220 856
679 3300005618 Ga0068864_100005288 Ga0068864_1000052884 856
680 3300005719 Ga0068861_100031870 Ga0068861_1000318703 856
681 3300005834 Ga0068851_10010640 Ga0068851_100106402 856
682 3300005842 Ga0068858_100001863 Ga0068858_10000186313 856
683 3300006931 Ga0097620_100001592 Ga0097620_10000159220 856
684 3300009098 Ga0105245_10013215 Ga0105245_100132154 856
685 3300013105 Ga0157369_10095327 Ga0157369_100953272 856
686 3300013297 Ga0157378_10013139 Ga0157378_100131392 856
687 3300013308 Ga0157375_10015938 Ga0157375_100159383 856
688 3300025315 Ga0207697_10000059 Ga0207697_1000005925 856
689 3300025893 Ga0207682_10002081 Ga0207682_100020815 856
690 3300025904 Ga0207647_10015394 Ga0207647_100153942 856
691 3300025909 Ga0207705_10004136 Ga0207705_100041363 856
692 3300025909 Ga0207705_10024163 Ga0207705_100241631 856
693 3300025919 Ga0207657_10078768 Ga0207657_100787681 856
694 3300025921 Ga0207652_10035188 Ga0207652_100351882 856
695 3300025923 Ga0207681_10000737 Ga0207681_1000073711 856
696 3300025925 Ga0207650_10008777 Ga0207650_100087772 856
697 3300025932 Ga0207690_10002179 Ga0207690_100021793 856
698 3300025933 Ga0207706_10000426 Ga0207706_1000042625 856
699 3300025933 Ga0207706_10012889 Ga0207706_100128894 856
700 3300025933 Ga0207706_10032157 Ga0207706_100321572 856
701 3300025936 Ga0207670_10005825 Ga0207670_100058253 856
702 3300025937 Ga0207669_10008626 Ga0207669_100086262 856
703 3300025940 Ga0207691_10037280 Ga0207691_100372802 856
704 3300025941 Ga0207711_10002712 Ga0207711_100027123 856
705 3300025942 Ga0207689_10000128 Ga0207689_1000012839 856
706 3300025945 Ga0207679_10021199 Ga0207679_100211992 856
707 3300025981 Ga0207640_10000589 Ga0207640_100005897 856
708 3300025981 Ga0207640_10015445 Ga0207640_100154452 856
709 3300025986 Ga0207658_10006879 Ga0207658_100068793 856
710 3300026023 Ga0207677_10003209 Ga0207677_100032092 856
711 3300026089 Ga0207648_10008301 Ga0207648_100083015 856
712 3300026089 Ga0207648_10066836 Ga0207648_100668362 856
713 3300026116 Ga0207674_10000827 Ga0207674_100008277 856
714 3300026116 Ga0207674_10004040 Ga0207674_100040404 856
715 3300026118 Ga0207675_100032620 Ga0207675_1000326202 856
716 3300026121 Ga0207683_10005397 Ga0207683_100053974 856
717 3300026121 Ga0207683_10008598 Ga0207683_100085983 856
718 3300026142 Ga0207698_10000913 Ga0207698_1000091310 856
719 3300028379 Ga0268266_10012792 Ga0268266_100127922 856
720 3300031731 Ga0307405_10001874 Ga0307405_100018742 856
721 3300031731 Ga0307405_10016247 Ga0307405_100162472 856
722 3300031824 Ga0307413_10008169 Ga0307413_100081692 856
723 3300031852 Ga0307410_10005261 Ga0307410_100052612 856
724 3300031852 Ga0307410_10013947 Ga0307410_100139472 856
725 3300031903 Ga0307407_10003822 Ga0307407_100038222 856
726 3300031903 Ga0307407_10012733 Ga0307407_100127332 856
727 3300032002 Ga0307416_100002293 Ga0307416_1000022936 856
728 3300032004 Ga0307414_10005424 Ga0307414_100054242 856
729 3300032004 Ga0307414_10010955 Ga0307414_100109552 856
730 3300032005 Ga0307411_10022233 Ga0307411_100222332 856
731 3300032126 Ga0307415_100003377 Ga0307415_1000033773 856
732 3300032126 Ga0307415_100016430 Ga0307415_1000164302 856
733 3300037418 Ga0395900_0013724 Ga0395900_0013724_2042_4645 856
734 3300037853 Ga0436364_0501064 Ga0436364_0501064_6096_8696 856
735 3300038443 Ga0395901_0000375 Ga0395901_0000375_26349_28952 856
736 3300038443 Ga0395901_0021576 Ga0395901_0021576_1746_4346 856
737 3300044656 Ga0466969_0006530 Ga0466969_0006530_2314_4968 856
738 3300044684 Ga0466966_0002429 Ga0466966_0002429_6655_9309 856
739 3300044735 Ga0466968_0011715 Ga0466968_0011715_390_2993 856
740 3300046539 Ga0495621_0005616 Ga0495621_0005616_996_3596 856
741 3300046558 Ga0495633_0003389 Ga0495633_0003389_5549_8149 856
742 3300046665 Ga0495661_0009776 Ga0495661_0009776_3370_5970 856
743 3300046684 Ga0495669_0016859 Ga0495669_0016859_440_3040 856

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00488

MutS_V

MutS domain V

614

801

0.99

PF01624

MutS_I

MutS domain I

8

126

0.98

PF05192

MutS_III

MutS domain III

265

560

0.96

PF05190

MutS_IV

MutS family domain IV

426

519

0.94

PF05188

MutS_II

MutS domain II

134

250

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i5f-assembly1.cif.gz_B crystal structure of dna-free e.coli muts p839e dimer mutant 0.8893 5 792
7ou0-assembly1.cif.gz_A the structure of muts bound to two molecules of adp-vanadate 0.8858 7 792
6i5f-assembly1.cif.gz_B crystal structure of dna-free e.coli muts p839e dimer mutant 0.8851 5 792
7ou0-assembly1.cif.gz_A the structure of muts bound to two molecules of adp-vanadate 0.8822 7 792
7ou4-assembly1.cif.gz_B the structure of muts bound to one molecule of atp and one molecule of adp 0.8819 11 791
ID Description Score Start End Superfamily
3zljA05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9604 558 792 3.40.50.300
1ewqB05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 558 787 3.40.50.300
af_A0A1D8PSP4_685_923_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 561 787 3.40.50.300
af_Q9TXR4_592_846_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9486 560 791 3.40.50.300
3zljA05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9473 558 792 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520H136-F1-model_v4 DNA mismatch repair protein MutS 0.9898 10 176 GO:0005524
GO:0006298
GO:0030983
AF-D5LU65-F1-model_v4 Methyl-directed mismatch repair protein 0.9864 570 738 GO:0005524
GO:0005829
GO:0006298
GO:0030983
GO:0140664
AF-A0A1B1GFK4-F1-model_v4 DNA mismatch repair protein MutS 0.984 590 770 GO:0005524
GO:0005829
GO:0006298
GO:0030983
GO:0140664
AF-K1U212-F1-model_v4 DNA mismatch repair protein MutS domain protein 0.9796 587 759 GO:0005524
GO:0005829
GO:0006298
GO:0030983
GO:0140664
AF-A0A3P7KV04-F1-model_v4 DNA mismatch repair proteins mutS family domain-containing protein 0.9784 603 727 GO:0005524
GO:0005634
GO:0005739
GO:0006298
GO:0030983
GO:0043504
GO:0140664

Feature Viewer

pLDDT pTM Quality
85.73 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map