F478671
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 256 | 741 | 850 |
Family's Representative Sequence
| Representative Sequence | 3300002067|JGI24735J21928_10002271|JGI24735J21928_100022714 |
| Length | 1003 |
| Sequence | MARADAPTPMMIQYRRLKEEAGDALLFYRMGDFFELFFDDAKAASACLDIALTKRGEDAGEPIPMCGVPVHSAESYLARLIRGGHRVAIAEQTESPAEARKARGSKALVDRAIIRLVTPGTLTEETLLESGSPNWLAAIGRAGDDWAXAAADISTGRFELVSCGPGELAAELARLSPAETIAESPIPGIRSSAGKGGFDSIAGESALKSRFGLATLDGLGSPSRAELAAAGGLLAYVDATQKGGGILLDSPRRIARASHMAIDAATRDSLELTRSVXGTVAGSLLGEIDRCQTAAGRRLLCEDIAAPLTDRSAIEQRLVLVAWLHEDAIRRERVRSALKAMPDFARALARLAAGRGSPRDLALLRDGLAAAEALRXALDGEPDLPPLLKSLLPCLGGHDALVGKLARALVAAPPLDASKGGYIAEGFDEDLDTLRDAASNGRRAIAALEARYRDSTSIGSLKIRHNAVLGYHVEVXARHADGLMAPGSGFTHRQTLXGVVRFNSPELHEEASRVIEAGAHALAAEAVHAXELTXXAVAAAPQITGTAEAIARIDVAASHAQRAAEGGWTLPQLADQPCLELEAGRHPVVEAALRDGGERFVAXDLAMSSNDRLWLITGPNMGGKSTFLRQTALIAVLAQAGSFVPATRARXGIVDRLFSRVGASDNLARGRSTFMVEMVETAAILAQAGPSSLVILDEIGRGTSTYDGLAIAWAVVEAMHDQVKCRTLFATHYHELTRLAGRLDSLSLHHVRAREWKGDLVLLHEVADGAADXSYGIAVAKLAGLPPPVVARARSVLAKLEAGRDATGGIAAGLXDLPLFAAASXPXHGPNPLAVALEMXDPDRLTPREALDKLYXLKXLAQSSDGVSXPVTASNMAVSATXSSSLISGRQISNNSPSTTLRVSQPTRRRQPGGTTSGTWQISLVLSXPVCGGMCVPALRIEISAIGERCLMRGIGGSSSNRIVSGHRRAFSSTGSPSFHKWKALHRASLSRLCPREARSDCS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 184 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 185 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 186 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 246 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 247 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 249 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 250 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 252 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 253 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 0 |
| Rhizoplane | 3.9 |
| Rhizosphere | 89.5 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 2.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000664 | 3300001979 | Bacteria | 14892 |
| 2 | JGI24737J22298_10000206 | 3300001990 | Bacteria | 19194 |
| 3 | JGI24737J22298_10003453 | 3300001990 | Bacteria | 5584 |
| 4 | JGI24735J21928_10002271 | 3300002067 | Bacteria | 6708 |
| 5 | JGI24738J21930_10000018 | 3300002075 | Bacteria | 30549 |
| 6 | JGI24738J21930_10000329 | 3300002075 | Bacteria | 13054 |
| 7 | JGI24744J21845_10002247 | 3300002077 | Bacteria | 3928 |
| 8 | Ga0055536_1008392 | 3300003781 | Bacteria | 4446 |
| 9 | Ga0055531_10006840 | 3300003794 | Bacteria | 6361 |
| 10 | Ga0065165_1004269 | 3300005262 | Bacteria | 9029 |
| 11 | Ga0070658_10000374 | 3300005327 | Bacteria | 38937 |
| 12 | Ga0070658_10002325 | 3300005327 | Bacteria | 15950 |
| 13 | Ga0070658_10003546 | 3300005327 | Bacteria | 12808 |
| 14 | Ga0070658_10010136 | 3300005327 | Bacteria | 7564 |
| 15 | Ga0070658_10016492 | 3300005327 | Bacteria | 5913 |
| 16 | Ga0070658_10020039 | 3300005327 | Bacteria | 5357 |
| 17 | Ga0070658_10052771 | 3300005327 | Bacteria | 3298 |
| 18 | Ga0070676_10014345 | 3300005328 | Bacteria | 4354 |
| 19 | Ga0070683_100004124 | 3300005329 | Bacteria | 11905 |
| 20 | Ga0070683_100006559 | 3300005329 | Bacteria | 9772 |
| 21 | Ga0070683_100013120 | 3300005329 | Bacteria | 7215 |
| 22 | Ga0070690_100020446 | 3300005330 | Bacteria | 4033 |
| 23 | Ga0070670_100000653 | 3300005331 | Bacteria | 26914 |
| 24 | Ga0070670_100003772 | 3300005331 | Bacteria | 12620 |
| 25 | Ga0070670_100010209 | 3300005331 | Bacteria | 8013 |
| 26 | Ga0070670_100023106 | 3300005331 | Bacteria | 5352 |
| 27 | Ga0070670_100037887 | 3300005331 | Bacteria | 4147 |
| 28 | Ga0070677_10002908 | 3300005333 | Bacteria | 5498 |
| 29 | Ga0068869_100000415 | 3300005334 | Bacteria | 23235 |
| 30 | Ga0068869_100014747 | 3300005334 | Bacteria | 5227 |
| 31 | Ga0070666_10000054 | 3300005335 | Bacteria | 95458 |
| 32 | Ga0070666_10000701 | 3300005335 | Bacteria | 20310 |
| 33 | Ga0070666_10019939 | 3300005335 | Bacteria | 4332 |
| 34 | Ga0070680_100000584 | 3300005336 | Bacteria | 25171 |
| 35 | Ga0070680_100002229 | 3300005336 | Bacteria | 14303 |
| 36 | Ga0070680_100003391 | 3300005336 | Bacteria | 11890 |
| 37 | Ga0070680_100027087 | 3300005336 | Bacteria | 4589 |
| 38 | Ga0068868_100000581 | 3300005338 | Bacteria | 24527 |
| 39 | Ga0068868_100000734 | 3300005338 | Bacteria | 22184 |
| 40 | Ga0068868_100004915 | 3300005338 | Bacteria | 9386 |
| 41 | Ga0068868_100005223 | 3300005338 | Bacteria | 9114 |
| 42 | Ga0070660_100000116 | 3300005339 | Bacteria | 49715 |
| 43 | Ga0070660_100000209 | 3300005339 | Bacteria | 39223 |
| 44 | Ga0070660_100001300 | 3300005339 | Bacteria | 17017 |
| 45 | Ga0070660_100002258 | 3300005339 | Bacteria | 13231 |
| 46 | Ga0070689_100012545 | 3300005340 | Bacteria | 6109 |
| 47 | Ga0070661_100000198 | 3300005344 | Bacteria | 49932 |
| 48 | Ga0070661_100007737 | 3300005344 | Bacteria | 7420 |
| 49 | Ga0070661_100010064 | 3300005344 | Bacteria | 6566 |
| 50 | Ga0070661_100014601 | 3300005344 | Bacteria | 5537 |
| 51 | Ga0070661_100026191 | 3300005344 | Bacteria | 4192 |
| 52 | Ga0070692_10005845 | 3300005345 | Bacteria | 5293 |
| 53 | Ga0070692_10015432 | 3300005345 | Bacteria | 3614 |
| 54 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 55 | Ga0070668_100000618 | 3300005347 | Bacteria | 23868 |
| 56 | Ga0070668_100023246 | 3300005347 | Bacteria | 4688 |
| 57 | Ga0070669_100000097 | 3300005353 | Bacteria | 86804 |
| 58 | Ga0070669_100000613 | 3300005353 | Bacteria | 26394 |
| 59 | Ga0070675_100001980 | 3300005354 | Bacteria | 15178 |
| 60 | Ga0070675_100010635 | 3300005354 | Bacteria | 7193 |
| 61 | Ga0070671_100000041 | 3300005355 | Bacteria | 91555 |
| 62 | Ga0070671_100000068 | 3300005355 | Bacteria | 70220 |
| 63 | Ga0070671_100001153 | 3300005355 | Bacteria | 19660 |
| 64 | Ga0070671_100001512 | 3300005355 | Bacteria | 17427 |
| 65 | Ga0070671_100001973 | 3300005355 | Bacteria | 15747 |
| 66 | Ga0070671_100004025 | 3300005355 | Bacteria | 11581 |
| 67 | Ga0070671_100004757 | 3300005355 | Bacteria | 10788 |
| 68 | Ga0070671_100014134 | 3300005355 | Bacteria | 6446 |
| 69 | Ga0070671_100014195 | 3300005355 | Bacteria | 6432 |
| 70 | Ga0070671_100055446 | 3300005355 | Bacteria | 3297 |
| 71 | Ga0070674_100001041 | 3300005356 | Bacteria | 14499 |
| 72 | Ga0070673_100000858 | 3300005364 | Bacteria | 17053 |
| 73 | Ga0070673_100003335 | 3300005364 | Bacteria | 9978 |
| 74 | Ga0070673_100023532 | 3300005364 | Bacteria | 4501 |
| 75 | Ga0070659_100000381 | 3300005366 | Bacteria | 33609 |
| 76 | Ga0070659_100003487 | 3300005366 | Bacteria | 11195 |
| 77 | Ga0070659_100004639 | 3300005366 | Bacteria | 9817 |
| 78 | Ga0070659_100005141 | 3300005366 | Bacteria | 9381 |
| 79 | Ga0070659_100005351 | 3300005366 | Bacteria | 9212 |
| 80 | Ga0070659_100026671 | 3300005366 | Bacteria | 4447 |
| 81 | Ga0070659_100030630 | 3300005366 | Bacteria | 4164 |
| 82 | Ga0070667_100001661 | 3300005367 | Bacteria | 19879 |
| 83 | Ga0070667_100003113 | 3300005367 | Bacteria | 14260 |
| 84 | Ga0070667_100007351 | 3300005367 | Bacteria | 9152 |
| 85 | Ga0070667_100009156 | 3300005367 | Bacteria | 8198 |
| 86 | Ga0070667_100010193 | 3300005367 | Bacteria | 7765 |
| 87 | Ga0070667_100017456 | 3300005367 | Bacteria | 5948 |
| 88 | Ga0070667_100021092 | 3300005367 | Bacteria | 5412 |
| 89 | Ga0070667_100066131 | 3300005367 | Bacteria | 3071 |
| 90 | Ga0070709_10034557 | 3300005434 | Bacteria | 3066 |
| 91 | Ga0070714_100009413 | 3300005435 | Bacteria | 7680 |
| 92 | Ga0070713_100000066 | 3300005436 | Bacteria | 66945 |
| 93 | Ga0070713_100004394 | 3300005436 | Bacteria | 9469 |
| 94 | Ga0070700_100021864 | 3300005441 | Bacteria | 3723 |
| 95 | Ga0070663_100033850 | 3300005455 | Bacteria | 3533 |
| 96 | Ga0070678_100010042 | 3300005456 | Bacteria | 5762 |
| 97 | Ga0070678_100035758 | 3300005456 | Bacteria | 3471 |
| 98 | Ga0070662_100000012 | 3300005457 | Bacteria | 129380 |
| 99 | Ga0070662_100000513 | 3300005457 | Bacteria | 23294 |
| 100 | Ga0070662_100000723 | 3300005457 | Bacteria | 20188 |
| 101 | Ga0070662_100002417 | 3300005457 | Bacteria | 11481 |
| 102 | Ga0070662_100013671 | 3300005457 | Bacteria | 5404 |
| 103 | Ga0070681_10019776 | 3300005458 | Bacteria | 6743 |
| 104 | Ga0070681_10022891 | 3300005458 | Bacteria | 6278 |
| 105 | Ga0070681_10091110 | 3300005458 | Bacteria | 2999 |
| 106 | Ga0068867_100018169 | 3300005459 | Bacteria | 4997 |
| 107 | Ga0068867_100027521 | 3300005459 | Bacteria | 4087 |
| 108 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 109 | Ga0070679_100001280 | 3300005530 | Bacteria | 22214 |
| 110 | Ga0070684_100002224 | 3300005535 | Bacteria | 14298 |
| 111 | Ga0068853_100000032 | 3300005539 | Bacteria | 114306 |
| 112 | Ga0068853_100000570 | 3300005539 | Bacteria | 25231 |
| 113 | Ga0068853_100005879 | 3300005539 | Bacteria | 9673 |
| 114 | Ga0068853_100050193 | 3300005539 | Bacteria | 3589 |
| 115 | Ga0068853_100053302 | 3300005539 | Bacteria | 3484 |
| 116 | Ga0070672_100004663 | 3300005543 | Bacteria | 8989 |
| 117 | Ga0070696_100003345 | 3300005546 | Bacteria | 10699 |
| 118 | Ga0070693_100004519 | 3300005547 | Bacteria | 6588 |
| 119 | Ga0070665_100000303 | 3300005548 | Bacteria | 76933 |
| 120 | Ga0070665_100002063 | 3300005548 | Bacteria | 22556 |
| 121 | Ga0070665_100003398 | 3300005548 | Bacteria | 17014 |
| 122 | Ga0070665_100004218 | 3300005548 | Bacteria | 15126 |
| 123 | Ga0070665_100006371 | 3300005548 | Bacteria | 12031 |
| 124 | Ga0070665_100014300 | 3300005548 | Bacteria | 7970 |
| 125 | Ga0070665_100021320 | 3300005548 | Bacteria | 6517 |
| 126 | Ga0070665_100023313 | 3300005548 | Bacteria | 6231 |
| 127 | Ga0070665_100025783 | 3300005548 | Bacteria | 5921 |
| 128 | Ga0070704_100010200 | 3300005549 | Bacteria | 5713 |
| 129 | Ga0070704_100028454 | 3300005549 | Bacteria | 3718 |
| 130 | Ga0068855_100001355 | 3300005563 | Bacteria | 30354 |
| 131 | Ga0068855_100006268 | 3300005563 | Bacteria | 14499 |
| 132 | Ga0068855_100006747 | 3300005563 | Bacteria | 13921 |
| 133 | Ga0068855_100010689 | 3300005563 | Bacteria | 11076 |
| 134 | Ga0068855_100045776 | 3300005563 | Bacteria | 5173 |
| 135 | Ga0070664_100000133 | 3300005564 | Bacteria | 49630 |
| 136 | Ga0070664_100000848 | 3300005564 | Bacteria | 23593 |
| 137 | Ga0070664_100001296 | 3300005564 | Bacteria | 19984 |
| 138 | Ga0070664_100011633 | 3300005564 | Bacteria | 7141 |
| 139 | Ga0070664_100015527 | 3300005564 | Bacteria | 6231 |
| 140 | Ga0068857_100003085 | 3300005577 | Bacteria | 13780 |
| 141 | Ga0068857_100024974 | 3300005577 | Bacteria | 5263 |
| 142 | Ga0068857_100066943 | 3300005577 | Bacteria | 3196 |
| 143 | Ga0068854_100001547 | 3300005578 | Bacteria | 13957 |
| 144 | Ga0068854_100001986 | 3300005578 | Bacteria | 12512 |
| 145 | Ga0068856_100000190 | 3300005614 | Bacteria | 64644 |
| 146 | Ga0068856_100007786 | 3300005614 | Bacteria | 10469 |
| 147 | Ga0068856_100009268 | 3300005614 | Bacteria | 9564 |
| 148 | Ga0068856_100014423 | 3300005614 | Bacteria | 7635 |
| 149 | Ga0068856_100029278 | 3300005614 | Bacteria | 5379 |
| 150 | Ga0068856_100035110 | 3300005614 | Bacteria | 4913 |
| 151 | Ga0068852_100001557 | 3300005616 | Bacteria | 15586 |
| 152 | Ga0068852_100008321 | 3300005616 | Bacteria | 7635 |
| 153 | Ga0068852_100015523 | 3300005616 | Bacteria | 5911 |
| 154 | Ga0068852_100023324 | 3300005616 | Bacteria | 4979 |
| 155 | Ga0068859_100000270 | 3300005617 | Bacteria | 51764 |
| 156 | Ga0068859_100000685 | 3300005617 | Bacteria | 34047 |
| 157 | Ga0068859_100001592 | 3300005617 | Bacteria | 23154 |
| 158 | Ga0068859_100005151 | 3300005617 | Bacteria | 13272 |
| 159 | Ga0068859_100016680 | 3300005617 | Bacteria | 7374 |
| 160 | Ga0068859_100039659 | 3300005617 | Bacteria | 4725 |
| 161 | Ga0068864_100000706 | 3300005618 | Bacteria | 28069 |
| 162 | Ga0068864_100001341 | 3300005618 | Bacteria | 20455 |
| 163 | Ga0068864_100003892 | 3300005618 | Bacteria | 12290 |
| 164 | Ga0068864_100004090 | 3300005618 | Bacteria | 11979 |
| 165 | Ga0068864_100005288 | 3300005618 | Bacteria | 10577 |
| 166 | Ga0068864_100040491 | 3300005618 | Bacteria | 3986 |
| 167 | Ga0068864_100047267 | 3300005618 | Bacteria | 3695 |
| 168 | Ga0068861_100012258 | 3300005719 | Bacteria | 5978 |
| 169 | Ga0068861_100031650 | 3300005719 | Bacteria | 3888 |
| 170 | Ga0068861_100031870 | 3300005719 | Bacteria | 3877 |
| 171 | Ga0068851_10010640 | 3300005834 | Bacteria | 4297 |
| 172 | Ga0068851_10011140 | 3300005834 | Bacteria | 4210 |
| 173 | Ga0068863_100000006 | 3300005841 | Bacteria | 265379 |
| 174 | Ga0068863_100000027 | 3300005841 | Bacteria | 181884 |
| 175 | Ga0068863_100005453 | 3300005841 | Bacteria | 12534 |
| 176 | Ga0068863_100006973 | 3300005841 | Bacteria | 11078 |
| 177 | Ga0068863_100022866 | 3300005841 | Bacteria | 5974 |
| 178 | Ga0068863_100047769 | 3300005841 | Bacteria | 4059 |
| 179 | Ga0068863_100060153 | 3300005841 | Bacteria | 3593 |
| 180 | Ga0068863_100074369 | 3300005841 | Bacteria | 3214 |
| 181 | Ga0068858_100000971 | 3300005842 | Bacteria | 29668 |
| 182 | Ga0068858_100001171 | 3300005842 | Bacteria | 27205 |
| 183 | Ga0068858_100001863 | 3300005842 | Bacteria | 21511 |
| 184 | Ga0068858_100003773 | 3300005842 | Bacteria | 14974 |
| 185 | Ga0068858_100016331 | 3300005842 | Bacteria | 6974 |
| 186 | Ga0068858_100021830 | 3300005842 | Bacteria | 5979 |
| 187 | Ga0068858_100035523 | 3300005842 | Bacteria | 4623 |
| 188 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 189 | Ga0068860_100001106 | 3300005843 | Bacteria | 29651 |
| 190 | Ga0068860_100001602 | 3300005843 | Bacteria | 24319 |
| 191 | Ga0068860_100001606 | 3300005843 | Bacteria | 24269 |
| 192 | Ga0068860_100011638 | 3300005843 | Bacteria | 8678 |
| 193 | Ga0068860_100021760 | 3300005843 | Bacteria | 6204 |
| 194 | Ga0068860_100059698 | 3300005843 | Bacteria | 3626 |
| 195 | Ga0068862_100002553 | 3300005844 | Bacteria | 16098 |
| 196 | Ga0068862_100011671 | 3300005844 | Bacteria | 7250 |
| 197 | Ga0068862_100024878 | 3300005844 | Bacteria | 5024 |
| 198 | Ga0068862_100047100 | 3300005844 | Bacteria | 3678 |
| 199 | Ga0070717_10003094 | 3300006028 | Bacteria | 11859 |
| 200 | Ga0075367_10000329 | 3300006178 | Bacteria | 16805 |
| 201 | Ga0068871_100019293 | 3300006358 | Bacteria | 5204 |
| 202 | Ga0075428_100020860 | 3300006844 | Bacteria | 7254 |
| 203 | Ga0075431_100013027 | 3300006847 | Bacteria | 8398 |
| 204 | Ga0097620_100000270 | 3300006931 | Bacteria | 51764 |
| 205 | Ga0097620_100000685 | 3300006931 | Bacteria | 34047 |
| 206 | Ga0097620_100001592 | 3300006931 | Bacteria | 23154 |
| 207 | Ga0097620_100005150 | 3300006931 | Bacteria | 13272 |
| 208 | Ga0097620_100039658 | 3300006931 | Bacteria | 4725 |
| 209 | Ga0105240_10018195 | 3300009093 | Bacteria | 9445 |
| 210 | Ga0105240_10055409 | 3300009093 | Bacteria | 4963 |
| 211 | Ga0105240_10072734 | 3300009093 | Bacteria | 4248 |
| 212 | Ga0111539_10026357 | 3300009094 | Bacteria | 7108 |
| 213 | Ga0105245_10000128 | 3300009098 | Bacteria | 72249 |
| 214 | Ga0105245_10007030 | 3300009098 | Bacteria | 9875 |
| 215 | Ga0105245_10013215 | 3300009098 | Bacteria | 7193 |
| 216 | Ga0105245_10062817 | 3300009098 | Bacteria | 3351 |
| 217 | Ga0105248_10000083 | 3300009177 | Bacteria | 110619 |
| 218 | Ga0105248_10000170 | 3300009177 | Bacteria | 75642 |
| 219 | Ga0105248_10000660 | 3300009177 | Bacteria | 39185 |
| 220 | Ga0105248_10001290 | 3300009177 | Bacteria | 27898 |
| 221 | Ga0105248_10001775 | 3300009177 | Bacteria | 24009 |
| 222 | Ga0105248_10007989 | 3300009177 | Bacteria | 11618 |
| 223 | Ga0105248_10011330 | 3300009177 | Bacteria | 9830 |
| 224 | Ga0105248_10013432 | 3300009177 | Bacteria | 9015 |
| 225 | Ga0105248_10018121 | 3300009177 | Bacteria | 7775 |
| 226 | Ga0105248_10022678 | 3300009177 | Bacteria | 6967 |
| 227 | Ga0105237_10019701 | 3300009545 | Bacteria | 6965 |
| 228 | Ga0105237_10047358 | 3300009545 | Bacteria | 4322 |
| 229 | Ga0105238_10002495 | 3300009551 | Bacteria | 18412 |
| 230 | Ga0105238_10043610 | 3300009551 | Bacteria | 4539 |
| 231 | Ga0105249_10000424 | 3300009553 | Bacteria | 40288 |
| 232 | Ga0105249_10001126 | 3300009553 | Bacteria | 23796 |
| 233 | Ga0099796_10000460 | 3300010159 | Bacteria | 6822 |
| 234 | Ga0157371_10001109 | 3300013102 | Bacteria | 29189 |
| 235 | Ga0157371_10001392 | 3300013102 | Bacteria | 25245 |
| 236 | Ga0157371_10007119 | 3300013102 | Bacteria | 9087 |
| 237 | Ga0157371_10045796 | 3300013102 | Bacteria | 3112 |
| 238 | Ga0157370_10000497 | 3300013104 | Bacteria | 48916 |
| 239 | Ga0157370_10008251 | 3300013104 | Bacteria | 11243 |
| 240 | Ga0157370_10031202 | 3300013104 | Bacteria | 5215 |
| 241 | Ga0157370_10056633 | 3300013104 | Bacteria | 3731 |
| 242 | Ga0157369_10000137 | 3300013105 | Bacteria | 103542 |
| 243 | Ga0157369_10003724 | 3300013105 | Bacteria | 18107 |
| 244 | Ga0157369_10012543 | 3300013105 | Bacteria | 9616 |
| 245 | Ga0157369_10013100 | 3300013105 | Bacteria | 9385 |
| 246 | Ga0157369_10049758 | 3300013105 | Bacteria | 4542 |
| 247 | Ga0157369_10095327 | 3300013105 | Bacteria | 3175 |
| 248 | Ga0157378_10002066 | 3300013297 | Bacteria | 17982 |
| 249 | Ga0157378_10013139 | 3300013297 | Bacteria | 7244 |
| 250 | Ga0157378_10086770 | 3300013297 | Bacteria | 2837 |
| 251 | Ga0163162_10001622 | 3300013306 | Bacteria | 21049 |
| 252 | Ga0163162_10001754 | 3300013306 | Bacteria | 20326 |
| 253 | Ga0163162_10018777 | 3300013306 | Bacteria | 6778 |
| 254 | Ga0157372_10066976 | 3300013307 | Bacteria | 4035 |
| 255 | Ga0157375_10005011 | 3300013308 | Bacteria | 11508 |
| 256 | Ga0157375_10015938 | 3300013308 | Bacteria | 6740 |
| 257 | Ga0157375_10019356 | 3300013308 | Bacteria | 6190 |
| 258 | Ga0163163_10000364 | 3300014325 | Bacteria | 43563 |
| 259 | Ga0163163_10000890 | 3300014325 | Bacteria | 25418 |
| 260 | Ga0163163_10001686 | 3300014325 | Bacteria | 18653 |
| 261 | Ga0163163_10008590 | 3300014325 | Bacteria | 9082 |
| 262 | Ga0157380_10012004 | 3300014326 | Bacteria | 6269 |
| 263 | Ga0157380_10018441 | 3300014326 | Bacteria | 5181 |
| 264 | Ga0157377_10013175 | 3300014745 | Bacteria | 4180 |
| 265 | Ga0157379_10000566 | 3300014968 | Bacteria | 29886 |
| 266 | Ga0157379_10001895 | 3300014968 | Bacteria | 17285 |
| 267 | Ga0163161_10042600 | 3300017792 | Bacteria | 3266 |
| 268 | Ga0206353_10722721 | 3300020082 | Bacteria | 3365 |
| 269 | Ga0213873_10000026 | 3300021358 | Bacteria | 74525 |
| 270 | Ga0213876_10000149 | 3300021384 | Bacteria | 74548 |
| 271 | Ga0213876_10000257 | 3300021384 | Bacteria | 49797 |
| 272 | Ga0213875_10000166 | 3300021388 | Bacteria | 68786 |
| 273 | Ga0213875_10000380 | 3300021388 | Bacteria | 40605 |
| 274 | Ga0209565_1000172 | 3300025263 | Bacteria | 84264 |
| 275 | Ga0209673_1001352 | 3300025273 | Bacteria | 24446 |
| 276 | Ga0209675_1000773 | 3300025291 | Bacteria | 21404 |
| 277 | Ga0209564_1004716 | 3300025295 | Bacteria | 8173 |
| 278 | Ga0209758_1010218 | 3300025297 | Bacteria | 5659 |
| 279 | Ga0209758_1021184 | 3300025297 | Bacteria | 3041 |
| 280 | Ga0209050_1010889 | 3300025298 | Bacteria | 4407 |
| 281 | Ga0209256_1001634 | 3300025299 | Bacteria | 21832 |
| 282 | Ga0209257_1000192 | 3300025304 | Bacteria | 151851 |
| 283 | Ga0207697_10000059 | 3300025315 | Bacteria | 45306 |
| 284 | Ga0207682_10000177 | 3300025893 | Bacteria | 28884 |
| 285 | Ga0207682_10002081 | 3300025893 | Bacteria | 9061 |
| 286 | Ga0207688_10009969 | 3300025901 | Bacteria | 5169 |
| 287 | Ga0207680_10000183 | 3300025903 | Bacteria | 30332 |
| 288 | Ga0207680_10000328 | 3300025903 | Bacteria | 22845 |
| 289 | Ga0207680_10000911 | 3300025903 | Bacteria | 13961 |
| 290 | Ga0207680_10004458 | 3300025903 | Bacteria | 6643 |
| 291 | Ga0207647_10000968 | 3300025904 | Bacteria | 22267 |
| 292 | Ga0207647_10001938 | 3300025904 | Bacteria | 15816 |
| 293 | Ga0207647_10003235 | 3300025904 | Bacteria | 12220 |
| 294 | Ga0207647_10004569 | 3300025904 | Bacteria | 10254 |
| 295 | Ga0207647_10006311 | 3300025904 | Bacteria | 8629 |
| 296 | Ga0207647_10015394 | 3300025904 | Bacteria | 5245 |
| 297 | Ga0207647_10020566 | 3300025904 | Bacteria | 4423 |
| 298 | Ga0207645_10024979 | 3300025907 | Bacteria | 3870 |
| 299 | Ga0207705_10000030 | 3300025909 | Bacteria | 239341 |
| 300 | Ga0207705_10000072 | 3300025909 | Bacteria | 126043 |
| 301 | Ga0207705_10000123 | 3300025909 | Bacteria | 85382 |
| 302 | Ga0207705_10001768 | 3300025909 | Bacteria | 17064 |
| 303 | Ga0207705_10002020 | 3300025909 | Bacteria | 15795 |
| 304 | Ga0207705_10003058 | 3300025909 | Bacteria | 12757 |
| 305 | Ga0207705_10003236 | 3300025909 | Bacteria | 12402 |
| 306 | Ga0207705_10003465 | 3300025909 | Bacteria | 11997 |
| 307 | Ga0207705_10004136 | 3300025909 | Bacteria | 11003 |
| 308 | Ga0207705_10004488 | 3300025909 | Bacteria | 10551 |
| 309 | Ga0207705_10006438 | 3300025909 | Bacteria | 8699 |
| 310 | Ga0207705_10011779 | 3300025909 | Bacteria | 6320 |
| 311 | Ga0207705_10014165 | 3300025909 | Bacteria | 5743 |
| 312 | Ga0207705_10024163 | 3300025909 | Bacteria | 4337 |
| 313 | Ga0207695_10005782 | 3300025913 | Bacteria | 16281 |
| 314 | Ga0207695_10006988 | 3300025913 | Bacteria | 14488 |
| 315 | Ga0207695_10010664 | 3300025913 | Bacteria | 11225 |
| 316 | Ga0207695_10037772 | 3300025913 | Bacteria | 5208 |
| 317 | Ga0207695_10041344 | 3300025913 | Bacteria | 4934 |
| 318 | Ga0207693_10020496 | 3300025915 | Bacteria | 5258 |
| 319 | Ga0207660_10001036 | 3300025917 | Bacteria | 18381 |
| 320 | Ga0207660_10001792 | 3300025917 | Bacteria | 14339 |
| 321 | Ga0207660_10002482 | 3300025917 | Bacteria | 12123 |
| 322 | Ga0207660_10002582 | 3300025917 | Bacteria | 11894 |
| 323 | Ga0207660_10004827 | 3300025917 | Bacteria | 8774 |
| 324 | Ga0207660_10005438 | 3300025917 | Bacteria | 8264 |
| 325 | Ga0207657_10000267 | 3300025919 | Bacteria | 55426 |
| 326 | Ga0207657_10000496 | 3300025919 | Bacteria | 41552 |
| 327 | Ga0207657_10002033 | 3300025919 | Bacteria | 21868 |
| 328 | Ga0207657_10002077 | 3300025919 | Bacteria | 21670 |
| 329 | Ga0207657_10002179 | 3300025919 | Bacteria | 21219 |
| 330 | Ga0207657_10004176 | 3300025919 | Bacteria | 15303 |
| 331 | Ga0207657_10005014 | 3300025919 | Bacteria | 13903 |
| 332 | Ga0207657_10005448 | 3300025919 | Bacteria | 13286 |
| 333 | Ga0207657_10006412 | 3300025919 | Bacteria | 12207 |
| 334 | Ga0207657_10006813 | 3300025919 | Bacteria | 11794 |
| 335 | Ga0207657_10008867 | 3300025919 | Bacteria | 10173 |
| 336 | Ga0207657_10011037 | 3300025919 | Bacteria | 8978 |
| 337 | Ga0207657_10014259 | 3300025919 | Bacteria | 7768 |
| 338 | Ga0207657_10026695 | 3300025919 | Bacteria | 5300 |
| 339 | Ga0207657_10041100 | 3300025919 | Bacteria | 4091 |
| 340 | Ga0207657_10078768 | 3300025919 | Bacteria | 2774 |
| 341 | Ga0207649_10000158 | 3300025920 | Bacteria | 55609 |
| 342 | Ga0207649_10000993 | 3300025920 | Bacteria | 17572 |
| 343 | Ga0207649_10037838 | 3300025920 | Bacteria | 2917 |
| 344 | Ga0207652_10000034 | 3300025921 | Bacteria | 138571 |
| 345 | Ga0207652_10000274 | 3300025921 | Bacteria | 53521 |
| 346 | Ga0207652_10035188 | 3300025921 | Bacteria | 4226 |
| 347 | Ga0207681_10000030 | 3300025923 | Bacteria | 173766 |
| 348 | Ga0207681_10000737 | 3300025923 | Bacteria | 21451 |
| 349 | Ga0207694_10002303 | 3300025924 | Bacteria | 15625 |
| 350 | Ga0207694_10027856 | 3300025924 | Bacteria | 4305 |
| 351 | Ga0207650_10003264 | 3300025925 | Bacteria | 11178 |
| 352 | Ga0207650_10008777 | 3300025925 | Bacteria | 6908 |
| 353 | Ga0207687_10000745 | 3300025927 | Bacteria | 21993 |
| 354 | Ga0207700_10000045 | 3300025928 | Bacteria | 88536 |
| 355 | Ga0207700_10047881 | 3300025928 | Bacteria | 3172 |
| 356 | Ga0207664_10050213 | 3300025929 | Bacteria | 3288 |
| 357 | Ga0207644_10000017 | 3300025931 | Bacteria | 177818 |
| 358 | Ga0207644_10000098 | 3300025931 | Bacteria | 63062 |
| 359 | Ga0207644_10000358 | 3300025931 | Bacteria | 29705 |
| 360 | Ga0207644_10000415 | 3300025931 | Bacteria | 27794 |
| 361 | Ga0207644_10004273 | 3300025931 | Bacteria | 9268 |
| 362 | Ga0207644_10015213 | 3300025931 | Bacteria | 5162 |
| 363 | Ga0207690_10000160 | 3300025932 | Bacteria | 52819 |
| 364 | Ga0207690_10001997 | 3300025932 | Bacteria | 12499 |
| 365 | Ga0207690_10002179 | 3300025932 | Bacteria | 11945 |
| 366 | Ga0207690_10004007 | 3300025932 | Bacteria | 8696 |
| 367 | Ga0207690_10006517 | 3300025932 | Bacteria | 6920 |
| 368 | Ga0207706_10000041 | 3300025933 | Bacteria | 130090 |
| 369 | Ga0207706_10000253 | 3300025933 | Bacteria | 58135 |
| 370 | Ga0207706_10000426 | 3300025933 | Bacteria | 45291 |
| 371 | Ga0207706_10001436 | 3300025933 | Bacteria | 23850 |
| 372 | Ga0207706_10003800 | 3300025933 | Bacteria | 14394 |
| 373 | Ga0207706_10006444 | 3300025933 | Bacteria | 10902 |
| 374 | Ga0207706_10012889 | 3300025933 | Bacteria | 7609 |
| 375 | Ga0207706_10024797 | 3300025933 | Bacteria | 5375 |
| 376 | Ga0207706_10032157 | 3300025933 | Bacteria | 4672 |
| 377 | Ga0207706_10034375 | 3300025933 | Bacteria | 4510 |
| 378 | Ga0207686_10014056 | 3300025934 | Bacteria | 4445 |
| 379 | Ga0207670_10005825 | 3300025936 | Bacteria | 6803 |
| 380 | Ga0207669_10008626 | 3300025937 | Bacteria | 4797 |
| 381 | Ga0207691_10000563 | 3300025940 | Bacteria | 37125 |
| 382 | Ga0207691_10001958 | 3300025940 | Bacteria | 20115 |
| 383 | Ga0207691_10005229 | 3300025940 | Bacteria | 12521 |
| 384 | Ga0207691_10037280 | 3300025940 | Bacteria | 4504 |
| 385 | Ga0207711_10000374 | 3300025941 | Bacteria | 47567 |
| 386 | Ga0207711_10000831 | 3300025941 | Bacteria | 30006 |
| 387 | Ga0207711_10002128 | 3300025941 | Bacteria | 17852 |
| 388 | Ga0207711_10002381 | 3300025941 | Bacteria | 16823 |
| 389 | Ga0207711_10002712 | 3300025941 | Bacteria | 15625 |
| 390 | Ga0207711_10003449 | 3300025941 | Bacteria | 13681 |
| 391 | Ga0207711_10007702 | 3300025941 | Bacteria | 9000 |
| 392 | Ga0207711_10007812 | 3300025941 | Bacteria | 8940 |
| 393 | Ga0207711_10008412 | 3300025941 | Bacteria | 8629 |
| 394 | Ga0207711_10013720 | 3300025941 | Bacteria | 6728 |
| 395 | Ga0207689_10000128 | 3300025942 | Bacteria | 64122 |
| 396 | Ga0207689_10010796 | 3300025942 | Bacteria | 7857 |
| 397 | Ga0207689_10011804 | 3300025942 | Bacteria | 7483 |
| 398 | Ga0207661_10001415 | 3300025944 | Bacteria | 16185 |
| 399 | Ga0207661_10008050 | 3300025944 | Bacteria | 7513 |
| 400 | Ga0207661_10028679 | 3300025944 | Bacteria | 4265 |
| 401 | Ga0207679_10000532 | 3300025945 | Bacteria | 25751 |
| 402 | Ga0207679_10012365 | 3300025945 | Bacteria | 5564 |
| 403 | Ga0207679_10018481 | 3300025945 | Bacteria | 4671 |
| 404 | Ga0207679_10021199 | 3300025945 | Bacteria | 4400 |
| 405 | Ga0207679_10026459 | 3300025945 | Bacteria | 4001 |
| 406 | Ga0207679_10040630 | 3300025945 | Bacteria | 3331 |
| 407 | Ga0207679_10057252 | 3300025945 | Bacteria | 2882 |
| 408 | Ga0207667_10001389 | 3300025949 | Bacteria | 30363 |
| 409 | Ga0207667_10002612 | 3300025949 | Bacteria | 22331 |
| 410 | Ga0207667_10005579 | 3300025949 | Bacteria | 15355 |
| 411 | Ga0207667_10008667 | 3300025949 | Bacteria | 12056 |
| 412 | Ga0207667_10019982 | 3300025949 | Bacteria | 7461 |
| 413 | Ga0207651_10000785 | 3300025960 | Bacteria | 13640 |
| 414 | Ga0207651_10001030 | 3300025960 | Bacteria | 12321 |
| 415 | Ga0207651_10011884 | 3300025960 | Bacteria | 4894 |
| 416 | Ga0207712_10006289 | 3300025961 | Bacteria | 7490 |
| 417 | Ga0207668_10000054 | 3300025972 | Bacteria | 95426 |
| 418 | Ga0207668_10002806 | 3300025972 | Bacteria | 10183 |
| 419 | Ga0207668_10005448 | 3300025972 | Bacteria | 7495 |
| 420 | Ga0207640_10000589 | 3300025981 | Bacteria | 21653 |
| 421 | Ga0207640_10001476 | 3300025981 | Bacteria | 12682 |
| 422 | Ga0207640_10002630 | 3300025981 | Bacteria | 9625 |
| 423 | Ga0207640_10015445 | 3300025981 | Bacteria | 4420 |
| 424 | Ga0207640_10027401 | 3300025981 | Bacteria | 3471 |
| 425 | Ga0207658_10001748 | 3300025986 | Bacteria | 16348 |
| 426 | Ga0207658_10002652 | 3300025986 | Bacteria | 12965 |
| 427 | Ga0207658_10006047 | 3300025986 | Bacteria | 8263 |
| 428 | Ga0207658_10006879 | 3300025986 | Bacteria | 7745 |
| 429 | Ga0207658_10009750 | 3300025986 | Bacteria | 6521 |
| 430 | Ga0207658_10015630 | 3300025986 | Bacteria | 5209 |
| 431 | Ga0207658_10015732 | 3300025986 | Bacteria | 5194 |
| 432 | Ga0207677_10002148 | 3300026023 | Bacteria | 10362 |
| 433 | Ga0207677_10003209 | 3300026023 | Bacteria | 8621 |
| 434 | Ga0207703_10002174 | 3300026035 | Bacteria | 17221 |
| 435 | Ga0207703_10003645 | 3300026035 | Bacteria | 12840 |
| 436 | Ga0207703_10003816 | 3300026035 | Bacteria | 12524 |
| 437 | Ga0207703_10018840 | 3300026035 | Bacteria | 5391 |
| 438 | Ga0207703_10021870 | 3300026035 | Bacteria | 5008 |
| 439 | Ga0207703_10038484 | 3300026035 | Bacteria | 3817 |
| 440 | Ga0207639_10000074 | 3300026041 | Bacteria | 91671 |
| 441 | Ga0207639_10002528 | 3300026041 | Bacteria | 12271 |
| 442 | Ga0207639_10010081 | 3300026041 | Bacteria | 6533 |
| 443 | Ga0207639_10036827 | 3300026041 | Bacteria | 3629 |
| 444 | Ga0207678_10000530 | 3300026067 | Bacteria | 34763 |
| 445 | Ga0207678_10001578 | 3300026067 | Bacteria | 20947 |
| 446 | Ga0207678_10004268 | 3300026067 | Bacteria | 12818 |
| 447 | Ga0207678_10030016 | 3300026067 | Bacteria | 4746 |
| 448 | Ga0207708_10016875 | 3300026075 | Bacteria | 5497 |
| 449 | Ga0207702_10000444 | 3300026078 | Bacteria | 46851 |
| 450 | Ga0207702_10006134 | 3300026078 | Bacteria | 10413 |
| 451 | Ga0207641_10000045 | 3300026088 | Bacteria | 181882 |
| 452 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 453 | Ga0207641_10000887 | 3300026088 | Bacteria | 31227 |
| 454 | Ga0207641_10001862 | 3300026088 | Bacteria | 20270 |
| 455 | Ga0207648_10008301 | 3300026089 | Bacteria | 10082 |
| 456 | Ga0207648_10016665 | 3300026089 | Bacteria | 6706 |
| 457 | Ga0207648_10066836 | 3300026089 | Bacteria | 3135 |
| 458 | Ga0207676_10000253 | 3300026095 | Bacteria | 46261 |
| 459 | Ga0207676_10001070 | 3300026095 | Bacteria | 20850 |
| 460 | Ga0207676_10001717 | 3300026095 | Bacteria | 16157 |
| 461 | Ga0207676_10001727 | 3300026095 | Bacteria | 16099 |
| 462 | Ga0207676_10004139 | 3300026095 | Bacteria | 10244 |
| 463 | Ga0207676_10006932 | 3300026095 | Bacteria | 8030 |
| 464 | Ga0207676_10035629 | 3300026095 | Bacteria | 3779 |
| 465 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 466 | Ga0207674_10000827 | 3300026116 | Bacteria | 40278 |
| 467 | Ga0207674_10001715 | 3300026116 | Bacteria | 28037 |
| 468 | Ga0207674_10004040 | 3300026116 | Bacteria | 17803 |
| 469 | Ga0207674_10005045 | 3300026116 | Bacteria | 15754 |
| 470 | Ga0207674_10026884 | 3300026116 | Bacteria | 6102 |
| 471 | Ga0207675_100003847 | 3300026118 | Bacteria | 14593 |
| 472 | Ga0207675_100006057 | 3300026118 | Bacteria | 11508 |
| 473 | Ga0207675_100032620 | 3300026118 | Bacteria | 4851 |
| 474 | Ga0207675_100034678 | 3300026118 | Bacteria | 4706 |
| 475 | Ga0207683_10002667 | 3300026121 | Bacteria | 15595 |
| 476 | Ga0207683_10005397 | 3300026121 | Bacteria | 10955 |
| 477 | Ga0207683_10008598 | 3300026121 | Bacteria | 8733 |
| 478 | Ga0207698_10000774 | 3300026142 | Bacteria | 18579 |
| 479 | Ga0207698_10000913 | 3300026142 | Bacteria | 17183 |
| 480 | Ga0207698_10001798 | 3300026142 | Bacteria | 12518 |
| 481 | Ga0207698_10002058 | 3300026142 | Bacteria | 11862 |
| 482 | Ga0207698_10003524 | 3300026142 | Bacteria | 9437 |
| 483 | Ga0207698_10008676 | 3300026142 | Bacteria | 6442 |
| 484 | Ga0209813_10000029 | 3300027866 | Bacteria | 68229 |
| 485 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 486 | Ga0268266_10000130 | 3300028379 | Bacteria | 147912 |
| 487 | Ga0268266_10004880 | 3300028379 | Bacteria | 12724 |
| 488 | Ga0268266_10012792 | 3300028379 | Bacteria | 7249 |
| 489 | Ga0268266_10016486 | 3300028379 | Bacteria | 6316 |
| 490 | Ga0268266_10028015 | 3300028379 | Bacteria | 4790 |
| 491 | Ga0268265_10000074 | 3300028380 | Bacteria | 127599 |
| 492 | Ga0268265_10017478 | 3300028380 | Bacteria | 4950 |
| 493 | Ga0268265_10031854 | 3300028380 | Bacteria | 3812 |
| 494 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 495 | Ga0268264_10000288 | 3300028381 | Bacteria | 84755 |
| 496 | Ga0268264_10000410 | 3300028381 | Bacteria | 60680 |
| 497 | Ga0268264_10000418 | 3300028381 | Bacteria | 59942 |
| 498 | Ga0268264_10001183 | 3300028381 | Bacteria | 25301 |
| 499 | Ga0268264_10002893 | 3300028381 | Bacteria | 14931 |
| 500 | Ga0268264_10013454 | 3300028381 | Bacteria | 6736 |
| 501 | Ga0268264_10034425 | 3300028381 | Bacteria | 4167 |
| 502 | Ga0268264_10063658 | 3300028381 | Bacteria | 3101 |
| 503 | Ga0307517_10004144 | 3300028786 | Bacteria | 22364 |
| 504 | Ga0265327_10000110 | 3300031251 | Bacteria | 181251 |
| 505 | Ga0307513_10000178 | 3300031456 | Bacteria | 91751 |
| 506 | Ga0307513_10004370 | 3300031456 | Bacteria | 18876 |
| 507 | Ga0307513_10045911 | 3300031456 | Bacteria | 4771 |
| 508 | Ga0307405_10001874 | 3300031731 | Bacteria | 9032 |
| 509 | Ga0307405_10014302 | 3300031731 | Bacteria | 4262 |
| 510 | Ga0307405_10016247 | 3300031731 | Bacteria | 4053 |
| 511 | Ga0307413_10000129 | 3300031824 | Bacteria | 19750 |
| 512 | Ga0307413_10008169 | 3300031824 | Bacteria | 4921 |
| 513 | Ga0307410_10000283 | 3300031852 | Bacteria | 19590 |
| 514 | Ga0307410_10001956 | 3300031852 | Bacteria | 9676 |
| 515 | Ga0307410_10003694 | 3300031852 | Bacteria | 7739 |
| 516 | Ga0307410_10005261 | 3300031852 | Bacteria | 6822 |
| 517 | Ga0307410_10008760 | 3300031852 | Bacteria | 5632 |
| 518 | Ga0307410_10013947 | 3300031852 | Bacteria | 4708 |
| 519 | Ga0307406_10009749 | 3300031901 | Bacteria | 5400 |
| 520 | Ga0307406_10021704 | 3300031901 | Bacteria | 3801 |
| 521 | Ga0307407_10003822 | 3300031903 | Bacteria | 6272 |
| 522 | Ga0307407_10006133 | 3300031903 | Bacteria | 5306 |
| 523 | Ga0307407_10011200 | 3300031903 | Bacteria | 4257 |
| 524 | Ga0307407_10012733 | 3300031903 | Bacteria | 4055 |
| 525 | Ga0307412_10004529 | 3300031911 | Bacteria | 7739 |
| 526 | Ga0307409_100006316 | 3300031995 | Bacteria | 6946 |
| 527 | Ga0307409_100020915 | 3300031995 | Bacteria | 4473 |
| 528 | Ga0307409_100050185 | 3300031995 | Bacteria | 3185 |
| 529 | Ga0307416_100002293 | 3300032002 | Bacteria | 10917 |
| 530 | Ga0307416_100010574 | 3300032002 | Bacteria | 6104 |
| 531 | Ga0307414_10001122 | 3300032004 | Bacteria | 13688 |
| 532 | Ga0307414_10005273 | 3300032004 | Bacteria | 7101 |
| 533 | Ga0307414_10005424 | 3300032004 | Bacteria | 7023 |
| 534 | Ga0307414_10010955 | 3300032004 | Bacteria | 5295 |
| 535 | Ga0307414_10043457 | 3300032004 | Bacteria | 3061 |
| 536 | Ga0307411_10000313 | 3300032005 | Bacteria | 16232 |
| 537 | Ga0307411_10005025 | 3300032005 | Bacteria | 6435 |
| 538 | Ga0307411_10006075 | 3300032005 | Bacteria | 6005 |
| 539 | Ga0307411_10021437 | 3300032005 | Bacteria | 3781 |
| 540 | Ga0307411_10022233 | 3300032005 | Bacteria | 3729 |
| 541 | Ga0307411_10043732 | 3300032005 | Bacteria | 2867 |
| 542 | Ga0307415_100003377 | 3300032126 | Bacteria | 8120 |
| 543 | Ga0307415_100013558 | 3300032126 | Bacteria | 4761 |
| 544 | Ga0307415_100016430 | 3300032126 | Bacteria | 4412 |
| 545 | Ga0373943_0015049 | 3300035170 | Bacteria | 3511 |
| 546 | Ga0373955_0019520 | 3300035172 | Bacteria | 3390 |
| 547 | Ga0373927_0002126 | 3300035695 | Bacteria | 14596 |
| 548 | Ga0373933_0008975 | 3300035724 | Bacteria | 5455 |
| 549 | Ga0373933_0018215 | 3300035724 | Bacteria | 3947 |
| 550 | Ga0373937_0013690 | 3300036401 | Bacteria | 7145 |
| 551 | Ga0373937_0023245 | 3300036401 | Bacteria | 5580 |
| 552 | Ga0373925_0000199 | 3300037068 | Bacteria | 65400 |
| 553 | Ga0395899_0001291 | 3300037312 | Bacteria | 21622 |
| 554 | Ga0395899_0001834 | 3300037312 | Bacteria | 17595 |
| 555 | Ga0395899_0002771 | 3300037312 | Bacteria | 14143 |
| 556 | Ga0395899_0003034 | 3300037312 | Bacteria | 13407 |
| 557 | Ga0395899_0003740 | 3300037312 | Bacteria | 12020 |
| 558 | Ga0395899_0006100 | 3300037312 | Bacteria | 9345 |
| 559 | Ga0395899_0015562 | 3300037312 | Bacteria | 5800 |
| 560 | Ga0395899_0029071 | 3300037312 | Bacteria | 4157 |
| 561 | Ga0395900_0000380 | 3300037418 | Bacteria | 64150 |
| 562 | Ga0395900_0000447 | 3300037418 | Bacteria | 59069 |
| 563 | Ga0395900_0001102 | 3300037418 | Bacteria | 34357 |
| 564 | Ga0395900_0007902 | 3300037418 | Bacteria | 10956 |
| 565 | Ga0395900_0013390 | 3300037418 | Bacteria | 8380 |
| 566 | Ga0395900_0013724 | 3300037418 | Bacteria | 8270 |
| 567 | Ga0395900_0019399 | 3300037418 | Bacteria | 6935 |
| 568 | Ga0395900_0023759 | 3300037418 | Bacteria | 6270 |
| 569 | Ga0395900_0031497 | 3300037418 | Bacteria | 5450 |
| 570 | Ga0395900_0032603 | 3300037418 | Bacteria | 5358 |
| 571 | Ga0395900_0035200 | 3300037418 | Bacteria | 5158 |
| 572 | Ga0395900_0069631 | 3300037418 | Bacteria | 3616 |
| 573 | Ga0395900_0114751 | 3300037418 | Bacteria | 2764 |
| 574 | Ga0395898_0000054 | 3300037466 | Bacteria | 279561 |
| 575 | Ga0395898_0003866 | 3300037466 | Bacteria | 16551 |
| 576 | Ga0395898_0007122 | 3300037466 | Bacteria | 11875 |
| 577 | Ga0395898_0010930 | 3300037466 | Bacteria | 9468 |
| 578 | Ga0395898_0011580 | 3300037466 | Bacteria | 9158 |
| 579 | Ga0395898_0012701 | 3300037466 | Bacteria | 8700 |
| 580 | Ga0395898_0057108 | 3300037466 | Bacteria | 3803 |
| 581 | Ga0395898_0090622 | 3300037466 | Bacteria | 2943 |
| 582 | Ga0395898_0097231 | 3300037466 | Bacteria | 2828 |
| 583 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 584 | Ga0395905_0000226 | 3300037471 | Bacteria | 85938 |
| 585 | Ga0395905_0000500 | 3300037471 | Bacteria | 53853 |
| 586 | Ga0395905_0002081 | 3300037471 | Bacteria | 22761 |
| 587 | Ga0395905_0002414 | 3300037471 | Bacteria | 20738 |
| 588 | Ga0395905_0002464 | 3300037471 | Bacteria | 20495 |
| 589 | Ga0395905_0004286 | 3300037471 | Bacteria | 14873 |
| 590 | Ga0395905_0009087 | 3300037471 | Bacteria | 9743 |
| 591 | Ga0395905_0022741 | 3300037471 | Bacteria | 5928 |
| 592 | Ga0395905_0023106 | 3300037471 | Bacteria | 5878 |
| 593 | Ga0395905_0045850 | 3300037471 | Bacteria | 4101 |
| 594 | Ga0395905_0083913 | 3300037471 | Bacteria | 2984 |
| 595 | Ga0395905_0086430 | 3300037471 | Bacteria | 2939 |
| 596 | Ga0436364_0424934 | 3300037853 | Bacteria | 51524 |
| 597 | Ga0436364_0501064 | 3300037853 | Bacteria | 12902 |
| 598 | Ga0436364_0545952 | 3300037853 | Bacteria | 79385 |
| 599 | Ga0436364_0598036 | 3300037853 | Bacteria | 22487 |
| 600 | Ga0395901_0000181 | 3300038443 | Bacteria | 81816 |
| 601 | Ga0395901_0000324 | 3300038443 | Bacteria | 59134 |
| 602 | Ga0395901_0000375 | 3300038443 | Bacteria | 53750 |
| 603 | Ga0395901_0001088 | 3300038443 | Bacteria | 29016 |
| 604 | Ga0395901_0002597 | 3300038443 | Bacteria | 18305 |
| 605 | Ga0395901_0003871 | 3300038443 | Bacteria | 15045 |
| 606 | Ga0395901_0004994 | 3300038443 | Bacteria | 13392 |
| 607 | Ga0395901_0015929 | 3300038443 | Bacteria | 7658 |
| 608 | Ga0395901_0017012 | 3300038443 | Bacteria | 7411 |
| 609 | Ga0395901_0018581 | 3300038443 | Bacteria | 7100 |
| 610 | Ga0395901_0021576 | 3300038443 | Bacteria | 6598 |
| 611 | Ga0395901_0037788 | 3300038443 | Bacteria | 4993 |
| 612 | Ga0395901_0048039 | 3300038443 | Bacteria | 4432 |
| 613 | Ga0395901_0053704 | 3300038443 | Bacteria | 4187 |
| 614 | Ga0395901_0056701 | 3300038443 | Bacteria | 4076 |
| 615 | Ga0395901_0085937 | 3300038443 | Bacteria | 3289 |
| 616 | Ga0436365_0083543 | 3300039437 | Bacteria | 85224 |
| 617 | Ga0436365_1025078 | 3300039437 | Bacteria | 33251 |
| 618 | Ga0436365_1884511 | 3300039437 | Bacteria | 98004 |
| 619 | Ga0436362_0376260 | 3300039453 | Bacteria | 74620 |
| 620 | Ga0439445_0000319 | 3300042004 | Bacteria | 9342 |
| 621 | Ga0450889_000104 | 3300042144 | Bacteria | 8174 |
| 622 | Ga0439458_0000539 | 3300042157 | Bacteria | 9729 |
| 623 | Ga0439464_0000240 | 3300042439 | Bacteria | 10093 |
| 624 | Ga0466969_0001635 | 3300044656 | Bacteria | 12016 |
| 625 | Ga0466969_0006530 | 3300044656 | Bacteria | 6204 |
| 626 | Ga0466966_0000026 | 3300044684 | Bacteria | 106896 |
| 627 | Ga0466966_0002429 | 3300044684 | Bacteria | 12173 |
| 628 | Ga0466966_0005498 | 3300044684 | Bacteria | 8324 |
| 629 | Ga0466961_0003480 | 3300044693 | Bacteria | 9814 |
| 630 | Ga0466961_0003951 | 3300044693 | Bacteria | 9274 |
| 631 | Ga0466961_0014816 | 3300044693 | Bacteria | 5009 |
| 632 | Ga0466963_0001562 | 3300044694 | Bacteria | 12416 |
| 633 | Ga0466963_0003354 | 3300044694 | Bacteria | 9143 |
| 634 | Ga0466963_0005918 | 3300044694 | Bacteria | 7200 |
| 635 | Ga0466963_0008594 | 3300044694 | Bacteria | 6129 |
| 636 | Ga0466963_0016743 | 3300044694 | Bacteria | 4562 |
| 637 | Ga0466971_0002121 | 3300044719 | Bacteria | 8404 |
| 638 | Ga0466971_0017748 | 3300044719 | Bacteria | 3151 |
| 639 | Ga0466968_0011715 | 3300044735 | Bacteria | 3421 |
| 640 | Ga0466970_0006740 | 3300044765 | Bacteria | 5748 |
| 641 | Ga0466957_0000705 | 3300044842 | Bacteria | 17083 |
| 642 | Ga0466957_0030216 | 3300044842 | Bacteria | 3234 |
| 643 | Ga0466959_0045773 | 3300045049 | Bacteria | 3221 |
| 644 | Ga0451576_0059938 | 3300045051 | Bacteria | 3971 |
| 645 | Ga0466958_0006502 | 3300045836 | Bacteria | 6368 |
| 646 | Ga0466958_0024169 | 3300045836 | Bacteria | 3574 |
| 647 | Ga0466967_0000571 | 3300045976 | Bacteria | 18131 |
| 648 | Ga0466967_0022346 | 3300045976 | Bacteria | 5158 |
| 649 | Ga0495590_0002453 | 3300046457 | Bacteria | 7679 |
| 650 | Ga0495638_0001762 | 3300046460 | Bacteria | 18966 |
| 651 | Ga0495638_0010173 | 3300046460 | Bacteria | 6550 |
| 652 | Ga0495638_0021069 | 3300046460 | Bacteria | 4300 |
| 653 | Ga0495650_0000468 | 3300046471 | Bacteria | 62149 |
| 654 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 655 | Ga0495616_0000405 | 3300046513 | Bacteria | 33255 |
| 656 | Ga0495632_0005670 | 3300046519 | Bacteria | 8207 |
| 657 | Ga0495648_0000107 | 3300046524 | Bacteria | 104376 |
| 658 | Ga0495663_0001162 | 3300046525 | Bacteria | 8502 |
| 659 | Ga0495663_0002800 | 3300046525 | Bacteria | 5156 |
| 660 | Ga0495642_0002496 | 3300046528 | Bacteria | 7476 |
| 661 | Ga0495654_0000199 | 3300046530 | Bacteria | 58450 |
| 662 | Ga0495621_0000447 | 3300046539 | Bacteria | 10144 |
| 663 | Ga0495621_0000851 | 3300046539 | Bacteria | 7770 |
| 664 | Ga0495621_0002433 | 3300046539 | Bacteria | 5021 |
| 665 | Ga0495621_0005616 | 3300046539 | Bacteria | 3618 |
| 666 | Ga0495633_0003389 | 3300046558 | Bacteria | 10664 |
| 667 | Ga0495668_0012936 | 3300046616 | Bacteria | 4940 |
| 668 | Ga0495668_0033131 | 3300046616 | Bacteria | 2903 |
| 669 | Ga0495625_0022251 | 3300046660 | Bacteria | 4864 |
| 670 | Ga0495661_0009776 | 3300046665 | Bacteria | 6566 |
| 671 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 672 | Ga0495669_0000829 | 3300046684 | Bacteria | 13166 |
| 673 | Ga0495669_0004057 | 3300046684 | Bacteria | 6022 |
| 674 | Ga0495669_0006670 | 3300046684 | Bacteria | 4829 |
| 675 | Ga0495669_0007965 | 3300046684 | Bacteria | 4446 |
| 676 | Ga0495669_0016859 | 3300046684 | Bacteria | 3132 |
| 677 | Ga0495670_0023372 | 3300046691 | Bacteria | 3051 |
| 678 | Ga0495589_0003393 | 3300046794 | Bacteria | 8637 |
| 679 | Ga0495673_0000209 | 3300047469 | Bacteria | 88818 |
| 680 | Ga0495673_0001113 | 3300047469 | Bacteria | 23132 |
| 681 | Ga0495673_0007297 | 3300047469 | Bacteria | 6380 |
| 682 | Ga0495602_0028474 | 3300048088 | Bacteria | 5345 |
| 683 | Ga0496101_0023614 | 3300048904 | Bacteria | 4250 |
| 684 | Ga0496104_0073099 | 3300048907 | Bacteria | 3262 |
| 685 | Ga0496107_0001479 | 3300048910 | Bacteria | 14543 |
| 686 | Ga0496107_0019433 | 3300048910 | Bacteria | 4794 |
| 687 | Ga0496108_0000297 | 3300048911 | Bacteria | 42741 |
| 688 | Ga0496108_0001787 | 3300048911 | Bacteria | 17132 |
| 689 | Ga0496108_0006024 | 3300048911 | Bacteria | 9816 |
| 690 | Ga0496108_0012251 | 3300048911 | Bacteria | 6973 |
| 691 | Ga0496109_0006868 | 3300048912 | Bacteria | 9598 |
| 692 | Ga0496109_0009460 | 3300048912 | Bacteria | 8308 |
| 693 | Ga0496109_0042375 | 3300048912 | Bacteria | 4123 |
| 694 | Ga0496110_0001178 | 3300048913 | Bacteria | 18586 |
| 695 | Ga0496110_0003500 | 3300048913 | Bacteria | 12050 |
| 696 | Ga0496110_0004595 | 3300048913 | Bacteria | 10724 |
| 697 | Ga0496110_0009854 | 3300048913 | Bacteria | 7744 |
| 698 | Ga0496111_0005030 | 3300048914 | Bacteria | 8409 |
| 699 | Ga0496112_0002054 | 3300048915 | Bacteria | 15962 |
| 700 | Ga0496112_0002179 | 3300048915 | Bacteria | 15582 |
| 701 | Ga0496112_0004926 | 3300048915 | Bacteria | 11427 |
| 702 | Ga0496112_0012487 | 3300048915 | Bacteria | 7805 |
| 703 | Ga0496112_0018875 | 3300048915 | Bacteria | 6497 |
| 704 | Ga0496113_0003949 | 3300048916 | Bacteria | 9000 |
| 705 | Ga0496113_0011419 | 3300048916 | Bacteria | 5923 |
| 706 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 707 | Ga0496114_0002174 | 3300048917 | Bacteria | 14931 |
| 708 | Ga0496114_0007398 | 3300048917 | Bacteria | 8677 |
| 709 | Ga0496115_0001058 | 3300048918 | Bacteria | 19947 |
| 710 | Ga0496115_0002048 | 3300048918 | Bacteria | 14424 |
| 711 | Ga0496115_0015780 | 3300048918 | Bacteria | 5736 |
| 712 | Ga0496118_0017554 | 3300048921 | Bacteria | 6506 |
| 713 | Ga0496122_0002027 | 3300048925 | Bacteria | 30082 |
| 714 | Ga0496124_0044753 | 3300048927 | Bacteria | 3796 |
| 715 | Ga0501033_0003244 | 3300049570 | Bacteria | 13460 |
| 716 | Ga0501034_0007326 | 3300049571 | Bacteria | 11753 |
| 717 | Ga0501047_0062630 | 3300049581 | Bacteria | 3588 |
| 718 | nmdc:mga06z11_112_c1 | 3300050494 | Bacteria | 33355 |
| 719 | nmdc:mga04h51_89_c1 | 3300050495 | Bacteria | 28127 |
| 720 | nmdc:mga07m45_2411_c1 | 3300050496 | Bacteria | 8768 |
| 721 | nmdc:mga09592_70879_c1 | 3300050508 | Bacteria | 2958 |
| 722 | nmdc:mga0qj67_34860_c1 | 3300050509 | Bacteria | 3932 |
| 723 | nmdc:mga06r32_2074_c1 | 3300050510 | Bacteria | 7843 |
| 724 | nmdc:mga08y16_34088_c1 | 3300050511 | Bacteria | 5347 |
| 725 | nmdc:mga08y16_37829_c1 | 3300050511 | Bacteria | 5066 |
| 726 | nmdc:mga0a205_2537_c1 | 3300050515 | Bacteria | 16089 |
| 727 | Ga0495619_0032876 | 3300053085 | Bacteria | 3367 |
| 728 | Ga0500578_0000015 | 3300053086 | Bacteria | 179217 |
| 729 | Ga0500643_000190 | 3300053087 | Bacteria | 58677 |
| 730 | Ga0500643_000843 | 3300053087 | Bacteria | 19633 |
| 731 | Ga0500643_002008 | 3300053087 | Bacteria | 10954 |
| 732 | Ga0500644_0000305 | 3300053088 | Bacteria | 25991 |
| 733 | Ga0500592_000146 | 3300053116 | Bacteria | 14471 |
| 734 | Ga0500594_0000064 | 3300053118 | Bacteria | 33313 |
| 735 | Ga0500658_0000150 | 3300053134 | Bacteria | 33225 |
| 736 | Ga0500604_0000073 | 3300053151 | Bacteria | 35955 |
| 737 | Ga0500622_0000840 | 3300053156 | Bacteria | 26274 |
| 738 | Ga0500627_0000232 | 3300053158 | Bacteria | 15858 |
| 739 | Ga0500645_000706 | 3300053730 | Bacteria | 20709 |
| 740 | Ga0500609_000188 | 3300053731 | Bacteria | 8721 |
| 741 | Ga0466962_0001446 | 3300061719 | Bacteria | 11077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053087 | Ga0500643_002008 | Ga0500643_002008_6541_9240 | 773 |
| 2 | 3300053730 | Ga0500645_000706 | Ga0500645_000706_11749_14448 | 773 |
| 3 | 3300005539 | Ga0068853_100050193 | Ga0068853_1000501931 | 778 |
| 4 | 3300005563 | Ga0068855_100045776 | Ga0068855_1000457762 | 778 |
| 5 | 3300025909 | Ga0207705_10003058 | Ga0207705_1000305815 | 778 |
| 6 | 3300025917 | Ga0207660_10002582 | Ga0207660_100025825 | 778 |
| 7 | 3300005366 | Ga0070659_100030630 | Ga0070659_1000306302 | 787 |
| 8 | 3300025919 | Ga0207657_10011037 | Ga0207657_100110376 | 787 |
| 9 | 3300037466 | Ga0395898_0057108 | Ga0395898_0057108_50_2620 | 787 |
| 10 | 3300045051 | Ga0451576_0059938 | Ga0451576_0059938_909_3515 | 791 |
| 11 | 3300037853 | Ga0436364_0598036 | Ga0436364_0598036_13130_15694 | 792 |
| 12 | 3300049571 | Ga0501034_0007326 | Ga0501034_0007326_1769_4459 | 796 |
| 13 | 3300013105 | Ga0157369_10012543 | Ga0157369_100125433 | 797 |
| 14 | 3300005327 | Ga0070658_10020039 | Ga0070658_100200392 | 800 |
| 15 | 3300005344 | Ga0070661_100014601 | Ga0070661_1000146012 | 800 |
| 16 | 3300005366 | Ga0070659_100003487 | Ga0070659_1000034872 | 800 |
| 17 | 3300005539 | Ga0068853_100005879 | Ga0068853_1000058793 | 800 |
| 18 | 3300009545 | Ga0105237_10047358 | Ga0105237_100473582 | 800 |
| 19 | 3300013104 | Ga0157370_10008251 | Ga0157370_100082513 | 800 |
| 20 | 3300013307 | Ga0157372_10066976 | Ga0157372_100669762 | 800 |
| 21 | 3300025904 | Ga0207647_10003235 | Ga0207647_100032353 | 800 |
| 22 | 3300025913 | Ga0207695_10041344 | Ga0207695_100413442 | 800 |
| 23 | 3300025924 | Ga0207694_10002303 | Ga0207694_100023035 | 800 |
| 24 | 3300025932 | Ga0207690_10001997 | Ga0207690_100019976 | 800 |
| 25 | 3300026041 | Ga0207639_10000074 | Ga0207639_1000007436 | 800 |
| 26 | 3300048907 | Ga0496104_0073099 | Ga0496104_0073099_395_2887 | 800 |
| 27 | 3300046684 | Ga0495669_0000007 | Ga0495669_0000007_115674_118373 | 804 |
| 28 | 3300035172 | Ga0373955_0019520 | Ga0373955_0019520_19_2532 | 805 |
| 29 | 3300042439 | Ga0439464_0000240 | Ga0439464_0000240_467_3067 | 805 |
| 30 | 3300046660 | Ga0495625_0022251 | Ga0495625_0022251_1734_4421 | 805 |
| 31 | 3300009551 | Ga0105238_10002495 | Ga0105238_100024957 | 806 |
| 32 | 3300046528 | Ga0495642_0002496 | Ga0495642_0002496_329_3016 | 806 |
| 33 | 3300005329 | Ga0070683_100013120 | Ga0070683_1000131202 | 807 |
| 34 | 3300026041 | Ga0207639_10036827 | Ga0207639_100368272 | 807 |
| 35 | 3300005338 | Ga0068868_100000581 | Ga0068868_10000058121 | 808 |
| 36 | 3300009098 | Ga0105245_10007030 | Ga0105245_100070307 | 808 |
| 37 | 3300009177 | Ga0105248_10018121 | Ga0105248_100181212 | 808 |
| 38 | 3300013297 | Ga0157378_10086770 | Ga0157378_100867702 | 808 |
| 39 | 3300014325 | Ga0163163_10001686 | Ga0163163_100016862 | 808 |
| 40 | 3300026095 | Ga0207676_10006932 | Ga0207676_100069323 | 808 |
| 41 | 3300048911 | Ga0496108_0000297 | Ga0496108_0000297_20775_23369 | 808 |
| 42 | 3300002075 | JGI24738J21930_10000329 | JGI24738J21930_100003292 | 809 |
| 43 | 3300005327 | Ga0070658_10000374 | Ga0070658_1000037425 | 809 |
| 44 | 3300005335 | Ga0070666_10000701 | Ga0070666_100007018 | 809 |
| 45 | 3300005339 | Ga0070660_100000209 | Ga0070660_10000020925 | 809 |
| 46 | 3300005344 | Ga0070661_100000198 | Ga0070661_10000019841 | 809 |
| 47 | 3300005366 | Ga0070659_100000381 | Ga0070659_10000038122 | 809 |
| 48 | 3300005367 | Ga0070667_100009156 | Ga0070667_1000091563 | 809 |
| 49 | 3300005457 | Ga0070662_100000012 | Ga0070662_10000001285 | 809 |
| 50 | 3300005539 | Ga0068853_100000032 | Ga0068853_10000003240 | 809 |
| 51 | 3300005547 | Ga0070693_100004519 | Ga0070693_1000045192 | 809 |
| 52 | 3300005548 | Ga0070665_100014300 | Ga0070665_1000143004 | 809 |
| 53 | 3300005563 | Ga0068855_100001355 | Ga0068855_10000135521 | 809 |
| 54 | 3300005564 | Ga0070664_100000133 | Ga0070664_10000013340 | 809 |
| 55 | 3300005614 | Ga0068856_100000190 | Ga0068856_10000019025 | 809 |
| 56 | 3300005616 | Ga0068852_100001557 | Ga0068852_1000015578 | 809 |
| 57 | 3300009177 | Ga0105248_10000083 | Ga0105248_1000008335 | 809 |
| 58 | 3300014325 | Ga0163163_10000364 | Ga0163163_1000036428 | 809 |
| 59 | 3300025903 | Ga0207680_10000911 | Ga0207680_100009113 | 809 |
| 60 | 3300025909 | Ga0207705_10000072 | Ga0207705_1000007240 | 809 |
| 61 | 3300025913 | Ga0207695_10010664 | Ga0207695_100106648 | 809 |
| 62 | 3300025919 | Ga0207657_10000496 | Ga0207657_1000049625 | 809 |
| 63 | 3300025920 | Ga0207649_10000158 | Ga0207649_1000015823 | 809 |
| 64 | 3300025932 | Ga0207690_10000160 | Ga0207690_1000016013 | 809 |
| 65 | 3300025933 | Ga0207706_10000041 | Ga0207706_1000004141 | 809 |
| 66 | 3300025941 | Ga0207711_10002128 | Ga0207711_100021283 | 809 |
| 67 | 3300025944 | Ga0207661_10008050 | Ga0207661_100080502 | 809 |
| 68 | 3300025945 | Ga0207679_10000532 | Ga0207679_100005327 | 809 |
| 69 | 3300025949 | Ga0207667_10001389 | Ga0207667_1000138922 | 809 |
| 70 | 3300025986 | Ga0207658_10006047 | Ga0207658_100060473 | 809 |
| 71 | 3300026041 | Ga0207639_10010081 | Ga0207639_100100812 | 809 |
| 72 | 3300026078 | Ga0207702_10000444 | Ga0207702_1000044410 | 809 |
| 73 | 3300026142 | Ga0207698_10001798 | Ga0207698_100017982 | 809 |
| 74 | 3300044684 | Ga0466966_0000026 | Ga0466966_0000026_29790_32366 | 809 |
| 75 | 3300031456 | Ga0307513_10045911 | Ga0307513_100459112 | 810 |
| 76 | 3300005616 | Ga0068852_100015523 | Ga0068852_1000155233 | 811 |
| 77 | 3300031852 | Ga0307410_10003694 | Ga0307410_100036942 | 811 |
| 78 | 3300032002 | Ga0307416_100010574 | Ga0307416_1000105742 | 811 |
| 79 | 3300032004 | Ga0307414_10005273 | Ga0307414_100052733 | 811 |
| 80 | 3300032126 | Ga0307415_100013558 | Ga0307415_1000135582 | 811 |
| 81 | 3300038443 | Ga0395901_0085937 | Ga0395901_0085937_343_2919 | 811 |
| 82 | 3300039437 | Ga0436365_0083543 | Ga0436365_0083543_70886_73456 | 811 |
| 83 | 3300025291 | Ga0209675_1000773 | Ga0209675_100077319 | 812 |
| 84 | 3300031995 | Ga0307409_100050185 | Ga0307409_1000501851 | 813 |
| 85 | 3300021358 | Ga0213873_10000026 | Ga0213873_1000002649 | 814 |
| 86 | 3300021384 | Ga0213876_10000149 | Ga0213876_1000014927 | 814 |
| 87 | 3300039437 | Ga0436365_1025078 | Ga0436365_1025078_2880_5447 | 814 |
| 88 | 3300039453 | Ga0436362_0376260 | Ga0436362_0376260_44249_46816 | 814 |
| 89 | 3300046539 | Ga0495621_0002433 | Ga0495621_0002433_426_3026 | 814 |
| 90 | 3300050496 | nmdc:mga07m45_2411_c1 | nmdc:mga07m45_2411_c1_532_3219 | 814 |
| 91 | 3300005327 | Ga0070658_10016492 | Ga0070658_100164922 | 815 |
| 92 | 3300005347 | Ga0070668_100000618 | Ga0070668_10000061816 | 815 |
| 93 | 3300013105 | Ga0157369_10049758 | Ga0157369_100497582 | 815 |
| 94 | 3300025919 | Ga0207657_10002033 | Ga0207657_100020333 | 815 |
| 95 | 3300031852 | Ga0307410_10000283 | Ga0307410_100002833 | 815 |
| 96 | 3300032005 | Ga0307411_10005025 | Ga0307411_100050253 | 815 |
| 97 | 3300005548 | Ga0070665_100003398 | Ga0070665_10000339811 | 816 |
| 98 | 3300005563 | Ga0068855_100006268 | Ga0068855_1000062686 | 816 |
| 99 | 3300005617 | Ga0068859_100005151 | Ga0068859_10000515112 | 816 |
| 100 | 3300005841 | Ga0068863_100005453 | Ga0068863_1000054532 | 816 |
| 101 | 3300006931 | Ga0097620_100005150 | Ga0097620_10000515012 | 816 |
| 102 | 3300009093 | Ga0105240_10055409 | Ga0105240_100554092 | 816 |
| 103 | 3300009177 | Ga0105248_10000170 | Ga0105248_1000017055 | 816 |
| 104 | 3300013105 | Ga0157369_10000137 | Ga0157369_1000013753 | 816 |
| 105 | 3300025941 | Ga0207711_10000374 | Ga0207711_1000037437 | 816 |
| 106 | 3300025949 | Ga0207667_10002612 | Ga0207667_100026128 | 816 |
| 107 | 3300028379 | Ga0268266_10028015 | Ga0268266_100280152 | 816 |
| 108 | 3300048917 | Ga0496114_0002174 | Ga0496114_0002174_8393_10960 | 816 |
| 109 | 3300005327 | Ga0070658_10052771 | Ga0070658_100527712 | 817 |
| 110 | 3300005614 | Ga0068856_100014423 | Ga0068856_1000144232 | 817 |
| 111 | 3300005616 | Ga0068852_100008321 | Ga0068852_1000083212 | 817 |
| 112 | 3300013102 | Ga0157371_10001109 | Ga0157371_100011095 | 817 |
| 113 | 3300013105 | Ga0157369_10003724 | Ga0157369_100037242 | 817 |
| 114 | 3300026142 | Ga0207698_10008676 | Ga0207698_100086762 | 817 |
| 115 | 3300036401 | Ga0373937_0023245 | Ga0373937_0023245_2722_5295 | 818 |
| 116 | 3300037312 | Ga0395899_0003034 | Ga0395899_0003034_3773_6349 | 818 |
| 117 | 3300037418 | Ga0395900_0023759 | Ga0395900_0023759_2488_5064 | 818 |
| 118 | 3300044693 | Ga0466961_0014816 | Ga0466961_0014816_1211_3787 | 818 |
| 119 | 3300049570 | Ga0501033_0003244 | Ga0501033_0003244_7419_10109 | 818 |
| 120 | 3300005331 | Ga0070670_100000653 | Ga0070670_10000065318 | 819 |
| 121 | 3300005335 | Ga0070666_10000054 | Ga0070666_1000005434 | 819 |
| 122 | 3300005345 | Ga0070692_10015432 | Ga0070692_100154322 | 819 |
| 123 | 3300005353 | Ga0070669_100000097 | Ga0070669_10000009740 | 819 |
| 124 | 3300005355 | Ga0070671_100000041 | Ga0070671_10000004145 | 819 |
| 125 | 3300005367 | Ga0070667_100010193 | Ga0070667_1000101933 | 819 |
| 126 | 3300005549 | Ga0070704_100010200 | Ga0070704_1000102003 | 819 |
| 127 | 3300005617 | Ga0068859_100000270 | Ga0068859_10000027021 | 819 |
| 128 | 3300005618 | Ga0068864_100047267 | Ga0068864_1000472672 | 819 |
| 129 | 3300005719 | Ga0068861_100031650 | Ga0068861_1000316503 | 819 |
| 130 | 3300005841 | Ga0068863_100022866 | Ga0068863_1000228662 | 819 |
| 131 | 3300005842 | Ga0068858_100035523 | Ga0068858_1000355232 | 819 |
| 132 | 3300005843 | Ga0068860_100001602 | Ga0068860_10000160217 | 819 |
| 133 | 3300005844 | Ga0068862_100002553 | Ga0068862_10000255312 | 819 |
| 134 | 3300006844 | Ga0075428_100020860 | Ga0075428_1000208603 | 819 |
| 135 | 3300006931 | Ga0097620_100000270 | Ga0097620_10000027021 | 819 |
| 136 | 3300009553 | Ga0105249_10000424 | Ga0105249_100004242 | 819 |
| 137 | 3300013306 | Ga0163162_10001754 | Ga0163162_100017545 | 819 |
| 138 | 3300014326 | Ga0157380_10012004 | Ga0157380_100120042 | 819 |
| 139 | 3300014326 | Ga0157380_10018441 | Ga0157380_100184415 | 819 |
| 140 | 3300025903 | Ga0207680_10000183 | Ga0207680_100001839 | 819 |
| 141 | 3300025923 | Ga0207681_10000030 | Ga0207681_1000003040 | 819 |
| 142 | 3300025931 | Ga0207644_10000017 | Ga0207644_1000001743 | 819 |
| 143 | 3300025961 | Ga0207712_10006289 | Ga0207712_100062892 | 819 |
| 144 | 3300025972 | Ga0207668_10002806 | Ga0207668_100028062 | 819 |
| 145 | 3300026075 | Ga0207708_10016875 | Ga0207708_100168755 | 819 |
| 146 | 3300026095 | Ga0207676_10004139 | Ga0207676_100041392 | 819 |
| 147 | 3300026118 | Ga0207675_100003847 | Ga0207675_1000038476 | 819 |
| 148 | 3300026118 | Ga0207675_100006057 | Ga0207675_1000060572 | 819 |
| 149 | 3300028380 | Ga0268265_10000074 | Ga0268265_10000074134 | 819 |
| 150 | 3300028381 | Ga0268264_10000288 | Ga0268264_1000028868 | 819 |
| 151 | 3300031852 | Ga0307410_10008760 | Ga0307410_100087602 | 819 |
| 152 | 3300037471 | Ga0395905_0000500 | Ga0395905_0000500_16_2592 | 819 |
| 153 | 3300048911 | Ga0496108_0012251 | Ga0496108_0012251_4431_6944 | 819 |
| 154 | 3300050508 | nmdc:mga09592_70879_c1 | nmdc:mga09592_70879_c1_73_2649 | 819 |
| 155 | 3300050509 | nmdc:mga0qj67_34860_c1 | nmdc:mga0qj67_34860_c1_1130_3709 | 819 |
| 156 | 3300050511 | nmdc:mga08y16_37829_c1 | nmdc:mga08y16_37829_c1_2420_4996 | 819 |
| 157 | 3300005436 | Ga0070713_100000066 | Ga0070713_10000006653 | 820 |
| 158 | 3300005548 | Ga0070665_100004218 | Ga0070665_10000421811 | 820 |
| 159 | 3300005842 | Ga0068858_100021830 | Ga0068858_1000218307 | 820 |
| 160 | 3300005843 | Ga0068860_100000093 | Ga0068860_100000093139 | 820 |
| 161 | 3300025928 | Ga0207700_10000045 | Ga0207700_1000004530 | 820 |
| 162 | 3300025986 | Ga0207658_10001748 | Ga0207658_1000174815 | 820 |
| 163 | 3300026035 | Ga0207703_10038484 | Ga0207703_100384842 | 820 |
| 164 | 3300028379 | Ga0268266_10004880 | Ga0268266_100048806 | 820 |
| 165 | 3300028381 | Ga0268264_10000067 | Ga0268264_10000067153 | 820 |
| 166 | 3300037418 | Ga0395900_0035200 | Ga0395900_0035200_2260_4947 | 820 |
| 167 | 3300025986 | Ga0207658_10015732 | Ga0207658_100157322 | 821 |
| 168 | 3300028380 | Ga0268265_10031854 | Ga0268265_100318542 | 821 |
| 169 | 3300042004 | Ga0439445_0000319 | Ga0439445_0000319_1241_3847 | 822 |
| 170 | 3300048913 | Ga0496110_0003500 | Ga0496110_0003500_9507_12020 | 822 |
| 171 | 3300005578 | Ga0068854_100001547 | Ga0068854_1000015472 | 823 |
| 172 | 3300025981 | Ga0207640_10001476 | Ga0207640_100014765 | 823 |
| 173 | 3300032005 | Ga0307411_10043732 | Ga0307411_100437321 | 823 |
| 174 | 3300044656 | Ga0466969_0001635 | Ga0466969_0001635_1878_4454 | 823 |
| 175 | 3300044684 | Ga0466966_0005498 | Ga0466966_0005498_5169_7745 | 823 |
| 176 | 3300044693 | Ga0466961_0003480 | Ga0466961_0003480_2909_5485 | 823 |
| 177 | 3300044694 | Ga0466963_0003354 | Ga0466963_0003354_6265_8841 | 823 |
| 178 | 3300044719 | Ga0466971_0017748 | Ga0466971_0017748_10_2586 | 823 |
| 179 | 3300044765 | Ga0466970_0006740 | Ga0466970_0006740_2007_4583 | 823 |
| 180 | 3300045836 | Ga0466958_0024169 | Ga0466958_0024169_433_3009 | 823 |
| 181 | 3300048918 | Ga0496115_0015780 | Ga0496115_0015780_1057_3762 | 823 |
| 182 | 3300061719 | Ga0466962_0001446 | Ga0466962_0001446_3222_5798 | 823 |
| 183 | 3300005841 | Ga0068863_100000006 | Ga0068863_10000000616 | 824 |
| 184 | 3300025904 | Ga0207647_10020566 | Ga0207647_100205661 | 824 |
| 185 | 3300025909 | Ga0207705_10000030 | Ga0207705_10000030167 | 824 |
| 186 | 3300025913 | Ga0207695_10005782 | Ga0207695_100057825 | 824 |
| 187 | 3300025920 | Ga0207649_10000993 | Ga0207649_100009933 | 824 |
| 188 | 3300025981 | Ga0207640_10002630 | Ga0207640_100026302 | 824 |
| 189 | 3300026067 | Ga0207678_10001578 | Ga0207678_100015784 | 824 |
| 190 | 3300026078 | Ga0207702_10006134 | Ga0207702_100061343 | 824 |
| 191 | 3300026088 | Ga0207641_10000113 | Ga0207641_10000113119 | 824 |
| 192 | 3300026142 | Ga0207698_10002058 | Ga0207698_100020582 | 824 |
| 193 | 3300031456 | Ga0307513_10000178 | Ga0307513_1000017850 | 824 |
| 194 | 3300031852 | Ga0307410_10001956 | Ga0307410_100019562 | 824 |
| 195 | 3300048921 | Ga0496118_0017554 | Ga0496118_0017554_3473_6097 | 824 |
| 196 | 3300049581 | Ga0501047_0062630 | Ga0501047_0062630_821_3520 | 824 |
| 197 | 3300005548 | Ga0070665_100006371 | Ga0070665_1000063712 | 825 |
| 198 | 3300005614 | Ga0068856_100009268 | Ga0068856_1000092683 | 825 |
| 199 | 3300005719 | Ga0068861_100012258 | Ga0068861_1000122582 | 825 |
| 200 | 3300005844 | Ga0068862_100047100 | Ga0068862_1000471002 | 825 |
| 201 | 3300013104 | Ga0157370_10056633 | Ga0157370_100566332 | 825 |
| 202 | 3300025913 | Ga0207695_10006988 | Ga0207695_100069884 | 825 |
| 203 | 3300026118 | Ga0207675_100034678 | Ga0207675_1000346782 | 825 |
| 204 | 3300035724 | Ga0373933_0018215 | Ga0373933_0018215_523_3096 | 825 |
| 205 | 3300048088 | Ga0495602_0028474 | Ga0495602_0028474_1271_3844 | 825 |
| 206 | 3300003794 | Ga0055531_10006840 | Ga0055531_100068405 | 826 |
| 207 | 3300005262 | Ga0065165_1004269 | Ga0065165_10042693 | 826 |
| 208 | 3300025295 | Ga0209564_1004716 | Ga0209564_10047162 | 826 |
| 209 | 3300025297 | Ga0209758_1021184 | Ga0209758_10211842 | 826 |
| 210 | 3300025298 | Ga0209050_1010889 | Ga0209050_10108892 | 826 |
| 211 | 3300025304 | Ga0209257_1000192 | Ga0209257_1000192123 | 826 |
| 212 | 3300037418 | Ga0395900_0013390 | Ga0395900_0013390_586_3159 | 826 |
| 213 | 3300037466 | Ga0395898_0011580 | Ga0395898_0011580_1184_3757 | 826 |
| 214 | 3300046460 | Ga0495638_0010173 | Ga0495638_0010173_2669_5368 | 826 |
| 215 | 3300046513 | Ga0495616_0000405 | Ga0495616_0000405_2424_5123 | 826 |
| 216 | 3300046519 | Ga0495632_0005670 | Ga0495632_0005670_1274_3973 | 826 |
| 217 | 3300047469 | Ga0495673_0007297 | Ga0495673_0007297_3259_5958 | 826 |
| 218 | 3300053731 | Ga0500609_000188 | Ga0500609_000188_3695_6394 | 826 |
| 219 | 3300005336 | Ga0070680_100027087 | Ga0070680_1000270873 | 827 |
| 220 | 3300009093 | Ga0105240_10072734 | Ga0105240_100727344 | 827 |
| 221 | 3300035695 | Ga0373927_0002126 | Ga0373927_0002126_2726_5428 | 827 |
| 222 | 3300037068 | Ga0373925_0000199 | Ga0373925_0000199_25508_28210 | 827 |
| 223 | 3300037418 | Ga0395900_0000380 | Ga0395900_0000380_14989_17592 | 827 |
| 224 | 3300037466 | Ga0395898_0097231 | Ga0395898_0097231_135_2738 | 827 |
| 225 | 3300038443 | Ga0395901_0000181 | Ga0395901_0000181_58281_60884 | 827 |
| 226 | 3300053151 | Ga0500604_0000073 | Ga0500604_0000073_14004_16568 | 827 |
| 227 | 3300005434 | Ga0070709_10034557 | Ga0070709_100345572 | 828 |
| 228 | 3300005436 | Ga0070713_100004394 | Ga0070713_1000043947 | 828 |
| 229 | 3300005548 | Ga0070665_100002063 | Ga0070665_1000020638 | 828 |
| 230 | 3300005841 | Ga0068863_100060153 | Ga0068863_1000601532 | 828 |
| 231 | 3300025915 | Ga0207693_10020496 | Ga0207693_100204962 | 828 |
| 232 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031341 | 828 |
| 233 | 3300037312 | Ga0395899_0001291 | Ga0395899_0001291_1636_4212 | 828 |
| 234 | 3300037418 | Ga0395900_0000447 | Ga0395900_0000447_29908_32484 | 828 |
| 235 | 3300037466 | Ga0395898_0003866 | Ga0395898_0003866_9328_11904 | 828 |
| 236 | 3300037466 | Ga0395898_0090622 | Ga0395898_0090622_299_2875 | 828 |
| 237 | 3300037471 | Ga0395905_0045850 | Ga0395905_0045850_15_2588 | 828 |
| 238 | 3300038443 | Ga0395901_0000324 | Ga0395901_0000324_29940_32516 | 828 |
| 239 | 3300005329 | Ga0070683_100006559 | Ga0070683_1000065592 | 829 |
| 240 | 3300005336 | Ga0070680_100000584 | Ga0070680_1000005846 | 829 |
| 241 | 3300005548 | Ga0070665_100023313 | Ga0070665_1000233134 | 829 |
| 242 | 3300025917 | Ga0207660_10002482 | Ga0207660_100024826 | 829 |
| 243 | 3300037312 | Ga0395899_0001834 | Ga0395899_0001834_13920_16493 | 829 |
| 244 | 3300037466 | Ga0395898_0012701 | Ga0395898_0012701_1432_4005 | 829 |
| 245 | 3300038443 | Ga0395901_0003871 | Ga0395901_0003871_9748_12321 | 829 |
| 246 | 3300046530 | Ga0495654_0000199 | Ga0495654_0000199_3166_5871 | 829 |
| 247 | 3300048915 | Ga0496112_0018875 | Ga0496112_0018875_1153_3732 | 829 |
| 248 | 3300048916 | Ga0496113_0011419 | Ga0496113_0011419_90_2687 | 829 |
| 249 | 3300005327 | Ga0070658_10002325 | Ga0070658_100023252 | 830 |
| 250 | 3300005339 | Ga0070660_100001300 | Ga0070660_1000013009 | 830 |
| 251 | 3300025909 | Ga0207705_10006438 | Ga0207705_100064383 | 830 |
| 252 | 3300025919 | Ga0207657_10000267 | Ga0207657_1000026728 | 830 |
| 253 | 3300025929 | Ga0207664_10050213 | Ga0207664_100502132 | 830 |
| 254 | 3300037471 | Ga0395905_0002464 | Ga0395905_0002464_9021_11642 | 830 |
| 255 | 3300046616 | Ga0495668_0012936 | Ga0495668_0012936_775_3348 | 830 |
| 256 | 3300005355 | Ga0070671_100004757 | Ga0070671_1000047572 | 831 |
| 257 | 3300025909 | Ga0207705_10004488 | Ga0207705_100044885 | 831 |
| 258 | 3300048911 | Ga0496108_0006024 | Ga0496108_0006024_70_2667 | 831 |
| 259 | 3300005355 | Ga0070671_100014134 | Ga0070671_1000141343 | 832 |
| 260 | 3300005367 | Ga0070667_100003113 | Ga0070667_1000031138 | 832 |
| 261 | 3300025263 | Ga0209565_1000172 | Ga0209565_100017219 | 832 |
| 262 | 3300025273 | Ga0209673_1001352 | Ga0209673_100135215 | 832 |
| 263 | 3300025297 | Ga0209758_1010218 | Ga0209758_10102184 | 832 |
| 264 | 3300025299 | Ga0209256_1001634 | Ga0209256_10016344 | 832 |
| 265 | 3300028786 | Ga0307517_10004144 | Ga0307517_1000414414 | 832 |
| 266 | 3300031251 | Ga0265327_10000110 | Ga0265327_1000011070 | 832 |
| 267 | 3300031456 | Ga0307513_10004370 | Ga0307513_1000437015 | 832 |
| 268 | 3300035170 | Ga0373943_0015049 | Ga0373943_0015049_767_3340 | 832 |
| 269 | 3300035724 | Ga0373933_0008975 | Ga0373933_0008975_1824_4430 | 832 |
| 270 | 3300036401 | Ga0373937_0013690 | Ga0373937_0013690_192_2798 | 832 |
| 271 | 3300037312 | Ga0395899_0006100 | Ga0395899_0006100_3731_6304 | 832 |
| 272 | 3300037418 | Ga0395900_0069631 | Ga0395900_0069631_502_3075 | 832 |
| 273 | 3300038443 | Ga0395901_0017012 | Ga0395901_0017012_1385_3958 | 832 |
| 274 | 3300046457 | Ga0495590_0002453 | Ga0495590_0002453_3493_6192 | 832 |
| 275 | 3300048918 | Ga0496115_0002048 | Ga0496115_0002048_1249_3948 | 832 |
| 276 | 3300001990 | JGI24737J22298_10003453 | JGI24737J22298_100034532 | 833 |
| 277 | 3300002075 | JGI24738J21930_10000018 | JGI24738J21930_1000001822 | 833 |
| 278 | 3300005330 | Ga0070690_100020446 | Ga0070690_1000204462 | 833 |
| 279 | 3300005331 | Ga0070670_100010209 | Ga0070670_1000102094 | 833 |
| 280 | 3300005334 | Ga0068869_100000415 | Ga0068869_1000004158 | 833 |
| 281 | 3300005340 | Ga0070689_100012545 | Ga0070689_1000125452 | 833 |
| 282 | 3300005347 | Ga0070668_100023246 | Ga0070668_1000232463 | 833 |
| 283 | 3300005353 | Ga0070669_100000613 | Ga0070669_10000061318 | 833 |
| 284 | 3300005354 | Ga0070675_100010635 | Ga0070675_1000106352 | 833 |
| 285 | 3300005355 | Ga0070671_100000068 | Ga0070671_10000006825 | 833 |
| 286 | 3300005367 | Ga0070667_100066131 | Ga0070667_1000661312 | 833 |
| 287 | 3300005457 | Ga0070662_100000723 | Ga0070662_1000007233 | 833 |
| 288 | 3300005539 | Ga0068853_100000570 | Ga0068853_1000005703 | 833 |
| 289 | 3300009177 | Ga0105248_10022678 | Ga0105248_100226783 | 833 |
| 290 | 3300013102 | Ga0157371_10001392 | Ga0157371_1000139217 | 833 |
| 291 | 3300013297 | Ga0157378_10002066 | Ga0157378_100020669 | 833 |
| 292 | 3300025941 | Ga0207711_10003449 | Ga0207711_100034492 | 833 |
| 293 | 3300025986 | Ga0207658_10009750 | Ga0207658_100097503 | 833 |
| 294 | 3300026067 | Ga0207678_10004268 | Ga0207678_100042687 | 833 |
| 295 | 3300031911 | Ga0307412_10004529 | Ga0307412_100045292 | 833 |
| 296 | 3300032005 | Ga0307411_10006075 | Ga0307411_100060753 | 833 |
| 297 | 3300032005 | Ga0307411_10021437 | Ga0307411_100214372 | 833 |
| 298 | 3300037466 | Ga0395898_0000054 | Ga0395898_0000054_27488_30061 | 833 |
| 299 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_546175_548748 | 833 |
| 300 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_464637_467336 | 833 |
| 301 | 3300053085 | Ga0495619_0032876 | Ga0495619_0032876_91_2700 | 833 |
| 302 | 3300053156 | Ga0500622_0000840 | Ga0500622_0000840_3679_6378 | 833 |
| 303 | 3300005347 | Ga0070668_100000007 | Ga0070668_10000000742 | 834 |
| 304 | 3300005548 | Ga0070665_100000303 | Ga0070665_10000030369 | 834 |
| 305 | 3300005614 | Ga0068856_100029278 | Ga0068856_1000292782 | 834 |
| 306 | 3300005617 | Ga0068859_100000685 | Ga0068859_10000068532 | 834 |
| 307 | 3300005618 | Ga0068864_100000706 | Ga0068864_10000070617 | 834 |
| 308 | 3300005843 | Ga0068860_100001106 | Ga0068860_10000110623 | 834 |
| 309 | 3300006028 | Ga0070717_10003094 | Ga0070717_100030946 | 834 |
| 310 | 3300006931 | Ga0097620_100000685 | Ga0097620_1000006851 | 834 |
| 311 | 3300009553 | Ga0105249_10001126 | Ga0105249_100011267 | 834 |
| 312 | 3300014325 | Ga0163163_10008590 | Ga0163163_100085904 | 834 |
| 313 | 3300025941 | Ga0207711_10000831 | Ga0207711_1000083126 | 834 |
| 314 | 3300025960 | Ga0207651_10011884 | Ga0207651_100118843 | 834 |
| 315 | 3300026088 | Ga0207641_10000887 | Ga0207641_100008879 | 834 |
| 316 | 3300026095 | Ga0207676_10001717 | Ga0207676_100017177 | 834 |
| 317 | 3300028379 | Ga0268266_10000130 | Ga0268266_10000130124 | 834 |
| 318 | 3300028381 | Ga0268264_10000410 | Ga0268264_1000041063 | 834 |
| 319 | 3300028381 | Ga0268264_10000418 | Ga0268264_1000041857 | 834 |
| 320 | 3300031903 | Ga0307407_10006133 | Ga0307407_100061332 | 834 |
| 321 | 3300032004 | Ga0307414_10001122 | Ga0307414_1000112210 | 834 |
| 322 | 3300053134 | Ga0500658_0000150 | Ga0500658_0000150_14294_16891 | 834 |
| 323 | 3300005577 | Ga0068857_100024974 | Ga0068857_1000249742 | 835 |
| 324 | 3300021388 | Ga0213875_10000380 | Ga0213875_1000038025 | 835 |
| 325 | 3300025933 | Ga0207706_10006444 | Ga0207706_100064444 | 835 |
| 326 | 3300037312 | Ga0395899_0015562 | Ga0395899_0015562_1892_4471 | 835 |
| 327 | 3300037471 | Ga0395905_0009087 | Ga0395905_0009087_4030_6699 | 835 |
| 328 | 3300037853 | Ga0436364_0424934 | Ga0436364_0424934_22923_25610 | 835 |
| 329 | 3300038443 | Ga0395901_0002597 | Ga0395901_0002597_8577_11198 | 835 |
| 330 | 3300038443 | Ga0395901_0018581 | Ga0395901_0018581_3420_6089 | 835 |
| 331 | 3300046524 | Ga0495648_0000107 | Ga0495648_0000107_85868_88567 | 835 |
| 332 | 3300047469 | Ga0495673_0000209 | Ga0495673_0000209_82940_85639 | 835 |
| 333 | 3300053088 | Ga0500644_0000305 | Ga0500644_0000305_14201_16900 | 835 |
| 334 | 3300005334 | Ga0068869_100014747 | Ga0068869_1000147473 | 836 |
| 335 | 3300005355 | Ga0070671_100014195 | Ga0070671_1000141953 | 836 |
| 336 | 3300010159 | Ga0099796_10000460 | Ga0099796_100004605 | 836 |
| 337 | 3300025919 | Ga0207657_10006412 | Ga0207657_100064124 | 836 |
| 338 | 3300025942 | Ga0207689_10010796 | Ga0207689_100107963 | 836 |
| 339 | 3300037466 | Ga0395898_0007122 | Ga0395898_0007122_8358_10979 | 836 |
| 340 | 3300038443 | Ga0395901_0048039 | Ga0395901_0048039_1108_3690 | 836 |
| 341 | 3300005327 | Ga0070658_10010136 | Ga0070658_100101362 | 837 |
| 342 | 3300005329 | Ga0070683_100004124 | Ga0070683_1000041242 | 837 |
| 343 | 3300005336 | Ga0070680_100003391 | Ga0070680_1000033915 | 837 |
| 344 | 3300005339 | Ga0070660_100000116 | Ga0070660_1000001168 | 837 |
| 345 | 3300005530 | Ga0070679_100001280 | Ga0070679_10000128010 | 837 |
| 346 | 3300005563 | Ga0068855_100006747 | Ga0068855_1000067474 | 837 |
| 347 | 3300005614 | Ga0068856_100007786 | Ga0068856_1000077863 | 837 |
| 348 | 3300025904 | Ga0207647_10006311 | Ga0207647_100063113 | 837 |
| 349 | 3300025909 | Ga0207705_10000123 | Ga0207705_1000012358 | 837 |
| 350 | 3300025909 | Ga0207705_10001768 | Ga0207705_100017689 | 837 |
| 351 | 3300025917 | Ga0207660_10001036 | Ga0207660_100010363 | 837 |
| 352 | 3300025919 | Ga0207657_10005014 | Ga0207657_100050143 | 837 |
| 353 | 3300025921 | Ga0207652_10000034 | Ga0207652_1000003456 | 837 |
| 354 | 3300025944 | Ga0207661_10001415 | Ga0207661_100014154 | 837 |
| 355 | 3300025949 | Ga0207667_10005579 | Ga0207667_100055795 | 837 |
| 356 | 3300026067 | Ga0207678_10000530 | Ga0207678_1000053029 | 837 |
| 357 | 3300031824 | Ga0307413_10000129 | Ga0307413_1000012912 | 837 |
| 358 | 3300031903 | Ga0307407_10011200 | Ga0307407_100112002 | 837 |
| 359 | 3300031995 | Ga0307409_100006316 | Ga0307409_1000063161 | 837 |
| 360 | 3300032005 | Ga0307411_10000313 | Ga0307411_100003138 | 837 |
| 361 | 3300037312 | Ga0395899_0002771 | Ga0395899_0002771_9318_11939 | 837 |
| 362 | 3300006847 | Ga0075431_100013027 | Ga0075431_1000130274 | 838 |
| 363 | 3300013308 | Ga0157375_10005011 | Ga0157375_100050118 | 838 |
| 364 | 3300025928 | Ga0207700_10047881 | Ga0207700_100478812 | 838 |
| 365 | 3300031731 | Ga0307405_10014302 | Ga0307405_100143022 | 838 |
| 366 | 3300032004 | Ga0307414_10043457 | Ga0307414_100434572 | 838 |
| 367 | 3300046460 | Ga0495638_0001762 | Ga0495638_0001762_2507_5206 | 838 |
| 368 | 3300048913 | Ga0496110_0004595 | Ga0496110_0004595_4579_7146 | 838 |
| 369 | 3300048914 | Ga0496111_0005030 | Ga0496111_0005030_3177_5813 | 838 |
| 370 | 3300050510 | nmdc:mga06r32_2074_c1 | nmdc:mga06r32_2074_c1_241_2847 | 838 |
| 371 | 3300053086 | Ga0500578_0000015 | Ga0500578_0000015_70471_73170 | 838 |
| 372 | 3300053118 | Ga0500594_0000064 | Ga0500594_0000064_27505_30204 | 838 |
| 373 | 3300005435 | Ga0070714_100009413 | Ga0070714_1000094131 | 839 |
| 374 | 3300005564 | Ga0070664_100011633 | Ga0070664_1000116332 | 839 |
| 375 | 3300005842 | Ga0068858_100001171 | Ga0068858_10000117110 | 839 |
| 376 | 3300006358 | Ga0068871_100019293 | Ga0068871_1000192932 | 839 |
| 377 | 3300009177 | Ga0105248_10001775 | Ga0105248_1000177510 | 839 |
| 378 | 3300009177 | Ga0105248_10007989 | Ga0105248_100079894 | 839 |
| 379 | 3300013306 | Ga0163162_10001622 | Ga0163162_100016229 | 839 |
| 380 | 3300025907 | Ga0207645_10024979 | Ga0207645_100249793 | 839 |
| 381 | 3300025933 | Ga0207706_10000253 | Ga0207706_100002533 | 839 |
| 382 | 3300025945 | Ga0207679_10018481 | Ga0207679_100184812 | 839 |
| 383 | 3300026116 | Ga0207674_10000086 | Ga0207674_1000008692 | 839 |
| 384 | 3300037418 | Ga0395900_0007902 | Ga0395900_0007902_27_2675 | 839 |
| 385 | 3300037418 | Ga0395900_0019399 | Ga0395900_0019399_898_3552 | 839 |
| 386 | 3300037471 | Ga0395905_0002081 | Ga0395905_0002081_7750_10398 | 839 |
| 387 | 3300037471 | Ga0395905_0004286 | Ga0395905_0004286_6672_9326 | 839 |
| 388 | 3300037471 | Ga0395905_0022741 | Ga0395905_0022741_363_2936 | 839 |
| 389 | 3300038443 | Ga0395901_0037788 | Ga0395901_0037788_1045_3693 | 839 |
| 390 | 3300044694 | Ga0466963_0008594 | Ga0466963_0008594_1123_3720 | 839 |
| 391 | 3300045836 | Ga0466958_0006502 | Ga0466958_0006502_464_3061 | 839 |
| 392 | 3300048912 | Ga0496109_0006868 | Ga0496109_0006868_6938_9511 | 839 |
| 393 | 3300048913 | Ga0496110_0009854 | Ga0496110_0009854_1774_4347 | 839 |
| 394 | 3300048915 | Ga0496112_0002054 | Ga0496112_0002054_6547_9120 | 839 |
| 395 | 3300048915 | Ga0496112_0012487 | Ga0496112_0012487_4139_6721 | 839 |
| 396 | 3300005843 | Ga0068860_100059698 | Ga0068860_1000596982 | 840 |
| 397 | 3300009177 | Ga0105248_10011330 | Ga0105248_100113303 | 840 |
| 398 | 3300025909 | Ga0207705_10002020 | Ga0207705_100020202 | 840 |
| 399 | 3300025941 | Ga0207711_10008412 | Ga0207711_100084122 | 840 |
| 400 | 3300028381 | Ga0268264_10063658 | Ga0268264_100636582 | 840 |
| 401 | 3300037471 | Ga0395905_0000226 | Ga0395905_0000226_75413_77986 | 840 |
| 402 | 3300037471 | Ga0395905_0023106 | Ga0395905_0023106_775_3420 | 840 |
| 403 | 3300042157 | Ga0439458_0000539 | Ga0439458_0000539_3234_5903 | 840 |
| 404 | 3300046460 | Ga0495638_0021069 | Ga0495638_0021069_1293_3974 | 840 |
| 405 | 3300046684 | Ga0495669_0006670 | Ga0495669_0006670_596_3169 | 840 |
| 406 | 3300048918 | Ga0496115_0001058 | Ga0496115_0001058_9882_12620 | 840 |
| 407 | 3300005336 | Ga0070680_100002229 | Ga0070680_1000022297 | 841 |
| 408 | 3300005355 | Ga0070671_100001153 | Ga0070671_10000115310 | 841 |
| 409 | 3300005530 | Ga0070679_100000001 | Ga0070679_100000001361 | 841 |
| 410 | 3300005618 | Ga0068864_100001341 | Ga0068864_1000013418 | 841 |
| 411 | 3300009177 | Ga0105248_10000660 | Ga0105248_1000066012 | 841 |
| 412 | 3300025917 | Ga0207660_10001792 | Ga0207660_100017927 | 841 |
| 413 | 3300025919 | Ga0207657_10004176 | Ga0207657_1000417611 | 841 |
| 414 | 3300025921 | Ga0207652_10000274 | Ga0207652_1000027411 | 841 |
| 415 | 3300025931 | Ga0207644_10004273 | Ga0207644_100042733 | 841 |
| 416 | 3300025941 | Ga0207711_10007812 | Ga0207711_100078122 | 841 |
| 417 | 3300025944 | Ga0207661_10028679 | Ga0207661_100286792 | 841 |
| 418 | 3300025945 | Ga0207679_10026459 | Ga0207679_100264592 | 841 |
| 419 | 3300026095 | Ga0207676_10000253 | Ga0207676_1000025319 | 841 |
| 420 | 3300046684 | Ga0495669_0000829 | Ga0495669_0000829_4533_7106 | 841 |
| 421 | 3300046684 | Ga0495669_0007965 | Ga0495669_0007965_803_3448 | 841 |
| 422 | 3300048904 | Ga0496101_0023614 | Ga0496101_0023614_1273_3918 | 841 |
| 423 | 3300048910 | Ga0496107_0001479 | Ga0496107_0001479_3850_6495 | 841 |
| 424 | 3300048915 | Ga0496112_0002179 | Ga0496112_0002179_4774_7419 | 841 |
| 425 | 3300048916 | Ga0496113_0003949 | Ga0496113_0003949_4370_7015 | 841 |
| 426 | 3300005339 | Ga0070660_100002258 | Ga0070660_1000022585 | 842 |
| 427 | 3300005563 | Ga0068855_100010689 | Ga0068855_1000106893 | 842 |
| 428 | 3300005578 | Ga0068854_100001986 | Ga0068854_1000019862 | 842 |
| 429 | 3300005616 | Ga0068852_100023324 | Ga0068852_1000233242 | 842 |
| 430 | 3300005618 | Ga0068864_100004090 | Ga0068864_1000040903 | 842 |
| 431 | 3300005841 | Ga0068863_100047769 | Ga0068863_1000477692 | 842 |
| 432 | 3300005842 | Ga0068858_100000971 | Ga0068858_10000097114 | 842 |
| 433 | 3300005844 | Ga0068862_100011671 | Ga0068862_1000116712 | 842 |
| 434 | 3300009177 | Ga0105248_10001290 | Ga0105248_100012902 | 842 |
| 435 | 3300014968 | Ga0157379_10000566 | Ga0157379_1000056622 | 842 |
| 436 | 3300021388 | Ga0213875_10000166 | Ga0213875_1000016611 | 842 |
| 437 | 3300025901 | Ga0207688_10009969 | Ga0207688_100099692 | 842 |
| 438 | 3300025904 | Ga0207647_10000968 | Ga0207647_1000096818 | 842 |
| 439 | 3300025919 | Ga0207657_10005448 | Ga0207657_100054485 | 842 |
| 440 | 3300025920 | Ga0207649_10037838 | Ga0207649_100378381 | 842 |
| 441 | 3300025925 | Ga0207650_10003264 | Ga0207650_100032641 | 842 |
| 442 | 3300025927 | Ga0207687_10000745 | Ga0207687_1000074515 | 842 |
| 443 | 3300025931 | Ga0207644_10000098 | Ga0207644_100000981 | 842 |
| 444 | 3300025932 | Ga0207690_10006517 | Ga0207690_100065173 | 842 |
| 445 | 3300025940 | Ga0207691_10000563 | Ga0207691_1000056310 | 842 |
| 446 | 3300025949 | Ga0207667_10008667 | Ga0207667_100086672 | 842 |
| 447 | 3300025972 | Ga0207668_10005448 | Ga0207668_100054482 | 842 |
| 448 | 3300026035 | Ga0207703_10021870 | Ga0207703_100218703 | 842 |
| 449 | 3300026041 | Ga0207639_10002528 | Ga0207639_100025283 | 842 |
| 450 | 3300026095 | Ga0207676_10035629 | Ga0207676_100356292 | 842 |
| 451 | 3300026116 | Ga0207674_10001715 | Ga0207674_100017153 | 842 |
| 452 | 3300037312 | Ga0395899_0029071 | Ga0395899_0029071_24_2597 | 842 |
| 453 | 3300037471 | Ga0395905_0002414 | Ga0395905_0002414_14664_17237 | 842 |
| 454 | 3300037853 | Ga0436364_0545952 | Ga0436364_0545952_8853_11465 | 842 |
| 455 | 3300038443 | Ga0395901_0004994 | Ga0395901_0004994_5120_7693 | 842 |
| 456 | 3300038443 | Ga0395901_0015929 | Ga0395901_0015929_1745_4318 | 842 |
| 457 | 3300048913 | Ga0496110_0001178 | Ga0496110_0001178_11747_14347 | 842 |
| 458 | 3300053087 | Ga0500643_000843 | Ga0500643_000843_9140_11821 | 842 |
| 459 | 3300005548 | Ga0070665_100025783 | Ga0070665_1000257832 | 843 |
| 460 | 3300005841 | Ga0068863_100000027 | Ga0068863_10000002786 | 843 |
| 461 | 3300005844 | Ga0068862_100024878 | Ga0068862_1000248782 | 843 |
| 462 | 3300025972 | Ga0207668_10000054 | Ga0207668_1000005416 | 843 |
| 463 | 3300026088 | Ga0207641_10000045 | Ga0207641_1000004590 | 843 |
| 464 | 3300028381 | Ga0268264_10001183 | Ga0268264_100011832 | 843 |
| 465 | 3300037418 | Ga0395900_0114751 | Ga0395900_0114751_66_2663 | 843 |
| 466 | 3300044694 | Ga0466963_0016743 | Ga0466963_0016743_1582_4185 | 843 |
| 467 | 3300044719 | Ga0466971_0002121 | Ga0466971_0002121_3345_5948 | 843 |
| 468 | 3300045049 | Ga0466959_0045773 | Ga0466959_0045773_202_2805 | 843 |
| 469 | 3300048925 | Ga0496122_0002027 | Ga0496122_0002027_8754_11348 | 843 |
| 470 | 3300048927 | Ga0496124_0044753 | Ga0496124_0044753_105_2699 | 843 |
| 471 | 3300005338 | Ga0068868_100005223 | Ga0068868_1000052234 | 844 |
| 472 | 3300005842 | Ga0068858_100016331 | Ga0068858_1000163312 | 844 |
| 473 | 3300006178 | Ga0075367_10000329 | Ga0075367_100003292 | 844 |
| 474 | 3300009093 | Ga0105240_10018195 | Ga0105240_100181952 | 844 |
| 475 | 3300009177 | Ga0105248_10013432 | Ga0105248_100134325 | 844 |
| 476 | 3300021384 | Ga0213876_10000257 | Ga0213876_1000025718 | 844 |
| 477 | 3300025903 | Ga0207680_10000328 | Ga0207680_1000032813 | 844 |
| 478 | 3300025931 | Ga0207644_10015213 | Ga0207644_100152132 | 844 |
| 479 | 3300025941 | Ga0207711_10007702 | Ga0207711_100077022 | 844 |
| 480 | 3300025960 | Ga0207651_10001030 | Ga0207651_100010302 | 844 |
| 481 | 3300025986 | Ga0207658_10002652 | Ga0207658_100026528 | 844 |
| 482 | 3300025986 | Ga0207658_10015630 | Ga0207658_100156302 | 844 |
| 483 | 3300026023 | Ga0207677_10002148 | Ga0207677_100021482 | 844 |
| 484 | 3300026035 | Ga0207703_10003816 | Ga0207703_100038163 | 844 |
| 485 | 3300027866 | Ga0209813_10000029 | Ga0209813_1000002912 | 844 |
| 486 | 3300037418 | Ga0395900_0001102 | Ga0395900_0001102_15748_18312 | 844 |
| 487 | 3300038443 | Ga0395901_0001088 | Ga0395901_0001088_16798_19362 | 844 |
| 488 | 3300039437 | Ga0436365_1884511 | Ga0436365_1884511_82593_85289 | 844 |
| 489 | 3300046616 | Ga0495668_0033131 | Ga0495668_0033131_194_2791 | 844 |
| 490 | 3300050494 | nmdc:mga06z11_112_c1 | nmdc:mga06z11_112_c1_15863_18505 | 844 |
| 491 | 3300050495 | nmdc:mga04h51_89_c1 | nmdc:mga04h51_89_c1_11201_13843 | 844 |
| 492 | 3300005327 | Ga0070658_10003546 | Ga0070658_100035462 | 845 |
| 493 | 3300005333 | Ga0070677_10002908 | Ga0070677_100029083 | 845 |
| 494 | 3300005344 | Ga0070661_100010064 | Ga0070661_1000100642 | 845 |
| 495 | 3300005364 | Ga0070673_100003335 | Ga0070673_1000033353 | 845 |
| 496 | 3300005366 | Ga0070659_100026671 | Ga0070659_1000266712 | 845 |
| 497 | 3300005367 | Ga0070667_100007351 | Ga0070667_1000073514 | 845 |
| 498 | 3300005456 | Ga0070678_100035758 | Ga0070678_1000357582 | 845 |
| 499 | 3300005614 | Ga0068856_100035110 | Ga0068856_1000351102 | 845 |
| 500 | 3300005617 | Ga0068859_100039659 | Ga0068859_1000396592 | 845 |
| 501 | 3300005618 | Ga0068864_100040491 | Ga0068864_1000404912 | 845 |
| 502 | 3300005834 | Ga0068851_10011140 | Ga0068851_100111402 | 845 |
| 503 | 3300005841 | Ga0068863_100006973 | Ga0068863_1000069733 | 845 |
| 504 | 3300005843 | Ga0068860_100011638 | Ga0068860_1000116383 | 845 |
| 505 | 3300006931 | Ga0097620_100039658 | Ga0097620_1000396582 | 845 |
| 506 | 3300009094 | Ga0111539_10026357 | Ga0111539_100263573 | 845 |
| 507 | 3300009098 | Ga0105245_10062817 | Ga0105245_100628172 | 845 |
| 508 | 3300009551 | Ga0105238_10043610 | Ga0105238_100436102 | 845 |
| 509 | 3300013306 | Ga0163162_10018777 | Ga0163162_100187772 | 845 |
| 510 | 3300025903 | Ga0207680_10004458 | Ga0207680_100044582 | 845 |
| 511 | 3300025909 | Ga0207705_10003236 | Ga0207705_100032362 | 845 |
| 512 | 3300025924 | Ga0207694_10027856 | Ga0207694_100278562 | 845 |
| 513 | 3300025931 | Ga0207644_10000358 | Ga0207644_100003587 | 845 |
| 514 | 3300025933 | Ga0207706_10003800 | Ga0207706_1000380010 | 845 |
| 515 | 3300025934 | Ga0207686_10014056 | Ga0207686_100140562 | 845 |
| 516 | 3300025940 | Ga0207691_10005229 | Ga0207691_1000522910 | 845 |
| 517 | 3300025941 | Ga0207711_10013720 | Ga0207711_100137203 | 845 |
| 518 | 3300025945 | Ga0207679_10040630 | Ga0207679_100406301 | 845 |
| 519 | 3300025960 | Ga0207651_10000785 | Ga0207651_100007854 | 845 |
| 520 | 3300025981 | Ga0207640_10027401 | Ga0207640_100274012 | 845 |
| 521 | 3300026035 | Ga0207703_10018840 | Ga0207703_100188402 | 845 |
| 522 | 3300026089 | Ga0207648_10016665 | Ga0207648_100166652 | 845 |
| 523 | 3300026121 | Ga0207683_10002667 | Ga0207683_100026673 | 845 |
| 524 | 3300026142 | Ga0207698_10003524 | Ga0207698_100035244 | 845 |
| 525 | 3300048911 | Ga0496108_0001787 | Ga0496108_0001787_7323_9923 | 845 |
| 526 | 3300048912 | Ga0496109_0009460 | Ga0496109_0009460_3416_6016 | 845 |
| 527 | 3300048915 | Ga0496112_0004926 | Ga0496112_0004926_4773_7373 | 845 |
| 528 | 3300003781 | Ga0055536_1008392 | Ga0055536_10083923 | 846 |
| 529 | 3300005539 | Ga0068853_100053302 | Ga0068853_1000533022 | 846 |
| 530 | 3300005577 | Ga0068857_100066943 | Ga0068857_1000669432 | 846 |
| 531 | 3300013102 | Ga0157371_10045796 | Ga0157371_100457962 | 846 |
| 532 | 3300013104 | Ga0157370_10000497 | Ga0157370_1000049715 | 846 |
| 533 | 3300013104 | Ga0157370_10031202 | Ga0157370_100312023 | 846 |
| 534 | 3300013105 | Ga0157369_10013100 | Ga0157369_100131002 | 846 |
| 535 | 3300026067 | Ga0207678_10030016 | Ga0207678_100300162 | 846 |
| 536 | 3300026116 | Ga0207674_10026884 | Ga0207674_100268843 | 846 |
| 537 | 3300042144 | Ga0450889_000104 | Ga0450889_000104_431_3001 | 846 |
| 538 | 3300046471 | Ga0495650_0000468 | Ga0495650_0000468_56165_58864 | 846 |
| 539 | 3300046794 | Ga0495589_0003393 | Ga0495589_0003393_2635_5346 | 846 |
| 540 | 3300047469 | Ga0495673_0001113 | Ga0495673_0001113_11215_13926 | 846 |
| 541 | 3300050511 | nmdc:mga08y16_34088_c1 | nmdc:mga08y16_34088_c1_261_2831 | 846 |
| 542 | 3300005331 | Ga0070670_100023106 | Ga0070670_1000231062 | 847 |
| 543 | 3300005338 | Ga0068868_100000734 | Ga0068868_1000007349 | 847 |
| 544 | 3300005344 | Ga0070661_100007737 | Ga0070661_1000077372 | 847 |
| 545 | 3300005345 | Ga0070692_10005845 | Ga0070692_100058452 | 847 |
| 546 | 3300005354 | Ga0070675_100001980 | Ga0070675_1000019802 | 847 |
| 547 | 3300005355 | Ga0070671_100001512 | Ga0070671_10000151210 | 847 |
| 548 | 3300005364 | Ga0070673_100000858 | Ga0070673_1000008583 | 847 |
| 549 | 3300005366 | Ga0070659_100004639 | Ga0070659_1000046393 | 847 |
| 550 | 3300005367 | Ga0070667_100021092 | Ga0070667_1000210921 | 847 |
| 551 | 3300005548 | Ga0070665_100021320 | Ga0070665_1000213202 | 847 |
| 552 | 3300005577 | Ga0068857_100003085 | Ga0068857_1000030857 | 847 |
| 553 | 3300009098 | Ga0105245_10000128 | Ga0105245_100001285 | 847 |
| 554 | 3300025909 | Ga0207705_10011779 | Ga0207705_100117793 | 847 |
| 555 | 3300025909 | Ga0207705_10014165 | Ga0207705_100141652 | 847 |
| 556 | 3300025919 | Ga0207657_10014259 | Ga0207657_100142592 | 847 |
| 557 | 3300025919 | Ga0207657_10026695 | Ga0207657_100266952 | 847 |
| 558 | 3300025919 | Ga0207657_10041100 | Ga0207657_100411002 | 847 |
| 559 | 3300025933 | Ga0207706_10001436 | Ga0207706_100014362 | 847 |
| 560 | 3300025933 | Ga0207706_10024797 | Ga0207706_100247973 | 847 |
| 561 | 3300025933 | Ga0207706_10034375 | Ga0207706_100343752 | 847 |
| 562 | 3300025940 | Ga0207691_10001958 | Ga0207691_100019589 | 847 |
| 563 | 3300025945 | Ga0207679_10057252 | Ga0207679_100572522 | 847 |
| 564 | 3300028379 | Ga0268266_10016486 | Ga0268266_100164862 | 847 |
| 565 | 3300037312 | Ga0395899_0003740 | Ga0395899_0003740_2256_4829 | 847 |
| 566 | 3300037471 | Ga0395905_0083913 | Ga0395905_0083913_63_2636 | 847 |
| 567 | 3300037471 | Ga0395905_0086430 | Ga0395905_0086430_235_2808 | 847 |
| 568 | 3300038443 | Ga0395901_0053704 | Ga0395901_0053704_1057_3702 | 847 |
| 569 | 3300038443 | Ga0395901_0056701 | Ga0395901_0056701_1148_3724 | 847 |
| 570 | 3300046539 | Ga0495621_0000851 | Ga0495621_0000851_2439_5012 | 847 |
| 571 | 3300048917 | Ga0496114_0000016 | Ga0496114_0000016_239516_242089 | 847 |
| 572 | 3300005355 | Ga0070671_100004025 | Ga0070671_1000040256 | 848 |
| 573 | 3300005367 | Ga0070667_100001661 | Ga0070667_1000016613 | 848 |
| 574 | 3300005457 | Ga0070662_100002417 | Ga0070662_1000024176 | 848 |
| 575 | 3300005458 | Ga0070681_10091110 | Ga0070681_100911101 | 848 |
| 576 | 3300005618 | Ga0068864_100003892 | Ga0068864_1000038922 | 848 |
| 577 | 3300005841 | Ga0068863_100074369 | Ga0068863_1000743692 | 848 |
| 578 | 3300014325 | Ga0163163_10000890 | Ga0163163_100008909 | 848 |
| 579 | 3300025931 | Ga0207644_10000415 | Ga0207644_1000041523 | 848 |
| 580 | 3300025941 | Ga0207711_10002381 | Ga0207711_100023813 | 848 |
| 581 | 3300026095 | Ga0207676_10001727 | Ga0207676_100017277 | 848 |
| 582 | 3300037418 | Ga0395900_0031497 | Ga0395900_0031497_985_3654 | 848 |
| 583 | 3300037466 | Ga0395898_0010930 | Ga0395898_0010930_838_3507 | 848 |
| 584 | 3300001990 | JGI24737J22298_10000206 | JGI24737J22298_1000020618 | 849 |
| 585 | 3300037418 | Ga0395900_0032603 | Ga0395900_0032603_369_2969 | 849 |
| 586 | 3300046525 | Ga0495663_0002800 | Ga0495663_0002800_1480_4059 | 849 |
| 587 | 3300005455 | Ga0070663_100033850 | Ga0070663_1000338502 | 850 |
| 588 | 3300005617 | Ga0068859_100016680 | Ga0068859_1000166802 | 850 |
| 589 | 3300005842 | Ga0068858_100003773 | Ga0068858_1000037736 | 850 |
| 590 | 3300005843 | Ga0068860_100001606 | Ga0068860_1000016069 | 850 |
| 591 | 3300009545 | Ga0105237_10019701 | Ga0105237_100197013 | 850 |
| 592 | 3300025913 | Ga0207695_10037772 | Ga0207695_100377723 | 850 |
| 593 | 3300025917 | Ga0207660_10004827 | Ga0207660_100048272 | 850 |
| 594 | 3300025919 | Ga0207657_10002179 | Ga0207657_1000217916 | 850 |
| 595 | 3300025942 | Ga0207689_10011804 | Ga0207689_100118041 | 850 |
| 596 | 3300025949 | Ga0207667_10019982 | Ga0207667_100199823 | 850 |
| 597 | 3300026035 | Ga0207703_10003645 | Ga0207703_100036456 | 850 |
| 598 | 3300026088 | Ga0207641_10001862 | Ga0207641_100018627 | 850 |
| 599 | 3300026095 | Ga0207676_10001070 | Ga0207676_100010707 | 850 |
| 600 | 3300026116 | Ga0207674_10005045 | Ga0207674_100050455 | 850 |
| 601 | 3300028381 | Ga0268264_10013454 | Ga0268264_100134542 | 850 |
| 602 | 3300031901 | Ga0307406_10009749 | Ga0307406_100097492 | 850 |
| 603 | 3300044694 | Ga0466963_0001562 | Ga0466963_0001562_5926_8523 | 850 |
| 604 | 3300044842 | Ga0466957_0000705 | Ga0466957_0000705_5144_7741 | 850 |
| 605 | 3300045976 | Ga0466967_0000571 | Ga0466967_0000571_9349_11946 | 850 |
| 606 | 3300005355 | Ga0070671_100055446 | Ga0070671_1000554462 | 851 |
| 607 | 3300013308 | Ga0157375_10019356 | Ga0157375_100193562 | 851 |
| 608 | 3300017792 | Ga0163161_10042600 | Ga0163161_100426002 | 851 |
| 609 | 3300031901 | Ga0307406_10021704 | Ga0307406_100217042 | 851 |
| 610 | 3300048910 | Ga0496107_0019433 | Ga0496107_0019433_298_2892 | 851 |
| 611 | 3300048912 | Ga0496109_0042375 | Ga0496109_0042375_507_3101 | 851 |
| 612 | 3300048917 | Ga0496114_0007398 | Ga0496114_0007398_5659_8253 | 851 |
| 613 | 3300053087 | Ga0500643_000190 | Ga0500643_000190_21408_24062 | 851 |
| 614 | 3300053116 | Ga0500592_000146 | Ga0500592_000146_638_3286 | 851 |
| 615 | 3300053158 | Ga0500627_0000232 | Ga0500627_0000232_8643_11291 | 851 |
| 616 | 3300046684 | Ga0495669_0004057 | Ga0495669_0004057_1224_3821 | 852 |
| 617 | iso_pu_bacteria | 2885427238 | 2885429148 | 852 |
| 618 | 3300005328 | Ga0070676_10014345 | Ga0070676_100143451 | 853 |
| 619 | 3300005331 | Ga0070670_100003772 | Ga0070670_1000037729 | 853 |
| 620 | 3300005355 | Ga0070671_100001973 | Ga0070671_10000197310 | 853 |
| 621 | 3300005364 | Ga0070673_100023532 | Ga0070673_1000235322 | 853 |
| 622 | 3300005367 | Ga0070667_100017456 | Ga0070667_1000174563 | 853 |
| 623 | 3300005441 | Ga0070700_100021864 | Ga0070700_1000218642 | 853 |
| 624 | 3300005457 | Ga0070662_100013671 | Ga0070662_1000136712 | 853 |
| 625 | 3300005458 | Ga0070681_10019776 | Ga0070681_100197762 | 853 |
| 626 | 3300005459 | Ga0068867_100018169 | Ga0068867_1000181692 | 853 |
| 627 | 3300005543 | Ga0070672_100004663 | Ga0070672_1000046633 | 853 |
| 628 | 3300013102 | Ga0157371_10007119 | Ga0157371_100071192 | 853 |
| 629 | 3300020082 | Ga0206353_10722721 | Ga0206353_107227212 | 853 |
| 630 | 3300025893 | Ga0207682_10000177 | Ga0207682_1000017717 | 853 |
| 631 | 3300025917 | Ga0207660_10005438 | Ga0207660_100054383 | 853 |
| 632 | 3300028381 | Ga0268264_10034425 | Ga0268264_100344252 | 853 |
| 633 | 3300046525 | Ga0495663_0001162 | Ga0495663_0001162_852_3461 | 853 |
| 634 | 3300046539 | Ga0495621_0000447 | Ga0495621_0000447_4949_7558 | 853 |
| 635 | 3300046691 | Ga0495670_0023372 | Ga0495670_0023372_392_2998 | 853 |
| 636 | 3300005535 | Ga0070684_100002224 | Ga0070684_10000222411 | 854 |
| 637 | 3300005549 | Ga0070704_100028454 | Ga0070704_1000284541 | 854 |
| 638 | 3300005564 | Ga0070664_100000848 | Ga0070664_1000008483 | 854 |
| 639 | 3300005843 | Ga0068860_100021760 | Ga0068860_1000217602 | 854 |
| 640 | 3300014745 | Ga0157377_10013175 | Ga0157377_100131752 | 854 |
| 641 | 3300014968 | Ga0157379_10001895 | Ga0157379_100018954 | 854 |
| 642 | 3300025904 | Ga0207647_10001938 | Ga0207647_100019383 | 854 |
| 643 | 3300025904 | Ga0207647_10004569 | Ga0207647_100045695 | 854 |
| 644 | 3300026035 | Ga0207703_10002174 | Ga0207703_100021746 | 854 |
| 645 | 3300028380 | Ga0268265_10017478 | Ga0268265_100174783 | 854 |
| 646 | 3300028381 | Ga0268264_10002893 | Ga0268264_100028936 | 854 |
| 647 | 3300031995 | Ga0307409_100020915 | Ga0307409_1000209152 | 854 |
| 648 | 3300050515 | nmdc:mga0a205_2537_c1 | nmdc:mga0a205_2537_c1_9821_12463 | 854 |
| 649 | 3300005366 | Ga0070659_100005141 | Ga0070659_1000051413 | 855 |
| 650 | 3300005458 | Ga0070681_10022891 | Ga0070681_100228912 | 855 |
| 651 | 3300005546 | Ga0070696_100003345 | Ga0070696_1000033455 | 855 |
| 652 | 3300005564 | Ga0070664_100015527 | Ga0070664_1000155272 | 855 |
| 653 | 3300025909 | Ga0207705_10003465 | Ga0207705_100034653 | 855 |
| 654 | 3300025919 | Ga0207657_10002077 | Ga0207657_100020772 | 855 |
| 655 | 3300025919 | Ga0207657_10006813 | Ga0207657_100068135 | 855 |
| 656 | 3300025919 | Ga0207657_10008867 | Ga0207657_100088674 | 855 |
| 657 | 3300025932 | Ga0207690_10004007 | Ga0207690_100040073 | 855 |
| 658 | 3300025945 | Ga0207679_10012365 | Ga0207679_100123653 | 855 |
| 659 | 3300026142 | Ga0207698_10000774 | Ga0207698_100007746 | 855 |
| 660 | 3300044693 | Ga0466961_0003951 | Ga0466961_0003951_406_3009 | 855 |
| 661 | 3300044694 | Ga0466963_0005918 | Ga0466963_0005918_4331_6934 | 855 |
| 662 | 3300044842 | Ga0466957_0030216 | Ga0466957_0030216_116_2719 | 855 |
| 663 | 3300045976 | Ga0466967_0022346 | Ga0466967_0022346_1274_3871 | 855 |
| 664 | iso_pu_bacteria | 2512564014 | 2512641716 | 855 |
| 665 | 3300001979 | JGI24740J21852_10000664 | JGI24740J21852_100006646 | 856 |
| 666 | 3300002067 | JGI24735J21928_10002271 | JGI24735J21928_100022714 | 856 |
| 667 | 3300002077 | JGI24744J21845_10002247 | JGI24744J21845_100022472 | 856 |
| 668 | 3300005331 | Ga0070670_100037887 | Ga0070670_1000378872 | 856 |
| 669 | 3300005335 | Ga0070666_10019939 | Ga0070666_100199392 | 856 |
| 670 | 3300005338 | Ga0068868_100004915 | Ga0068868_1000049152 | 856 |
| 671 | 3300005344 | Ga0070661_100026191 | Ga0070661_1000261912 | 856 |
| 672 | 3300005356 | Ga0070674_100001041 | Ga0070674_1000010413 | 856 |
| 673 | 3300005366 | Ga0070659_100005351 | Ga0070659_1000053513 | 856 |
| 674 | 3300005456 | Ga0070678_100010042 | Ga0070678_1000100423 | 856 |
| 675 | 3300005457 | Ga0070662_100000513 | Ga0070662_10000051311 | 856 |
| 676 | 3300005459 | Ga0068867_100027521 | Ga0068867_1000275212 | 856 |
| 677 | 3300005564 | Ga0070664_100001296 | Ga0070664_10000129618 | 856 |
| 678 | 3300005617 | Ga0068859_100001592 | Ga0068859_10000159220 | 856 |
| 679 | 3300005618 | Ga0068864_100005288 | Ga0068864_1000052884 | 856 |
| 680 | 3300005719 | Ga0068861_100031870 | Ga0068861_1000318703 | 856 |
| 681 | 3300005834 | Ga0068851_10010640 | Ga0068851_100106402 | 856 |
| 682 | 3300005842 | Ga0068858_100001863 | Ga0068858_10000186313 | 856 |
| 683 | 3300006931 | Ga0097620_100001592 | Ga0097620_10000159220 | 856 |
| 684 | 3300009098 | Ga0105245_10013215 | Ga0105245_100132154 | 856 |
| 685 | 3300013105 | Ga0157369_10095327 | Ga0157369_100953272 | 856 |
| 686 | 3300013297 | Ga0157378_10013139 | Ga0157378_100131392 | 856 |
| 687 | 3300013308 | Ga0157375_10015938 | Ga0157375_100159383 | 856 |
| 688 | 3300025315 | Ga0207697_10000059 | Ga0207697_1000005925 | 856 |
| 689 | 3300025893 | Ga0207682_10002081 | Ga0207682_100020815 | 856 |
| 690 | 3300025904 | Ga0207647_10015394 | Ga0207647_100153942 | 856 |
| 691 | 3300025909 | Ga0207705_10004136 | Ga0207705_100041363 | 856 |
| 692 | 3300025909 | Ga0207705_10024163 | Ga0207705_100241631 | 856 |
| 693 | 3300025919 | Ga0207657_10078768 | Ga0207657_100787681 | 856 |
| 694 | 3300025921 | Ga0207652_10035188 | Ga0207652_100351882 | 856 |
| 695 | 3300025923 | Ga0207681_10000737 | Ga0207681_1000073711 | 856 |
| 696 | 3300025925 | Ga0207650_10008777 | Ga0207650_100087772 | 856 |
| 697 | 3300025932 | Ga0207690_10002179 | Ga0207690_100021793 | 856 |
| 698 | 3300025933 | Ga0207706_10000426 | Ga0207706_1000042625 | 856 |
| 699 | 3300025933 | Ga0207706_10012889 | Ga0207706_100128894 | 856 |
| 700 | 3300025933 | Ga0207706_10032157 | Ga0207706_100321572 | 856 |
| 701 | 3300025936 | Ga0207670_10005825 | Ga0207670_100058253 | 856 |
| 702 | 3300025937 | Ga0207669_10008626 | Ga0207669_100086262 | 856 |
| 703 | 3300025940 | Ga0207691_10037280 | Ga0207691_100372802 | 856 |
| 704 | 3300025941 | Ga0207711_10002712 | Ga0207711_100027123 | 856 |
| 705 | 3300025942 | Ga0207689_10000128 | Ga0207689_1000012839 | 856 |
| 706 | 3300025945 | Ga0207679_10021199 | Ga0207679_100211992 | 856 |
| 707 | 3300025981 | Ga0207640_10000589 | Ga0207640_100005897 | 856 |
| 708 | 3300025981 | Ga0207640_10015445 | Ga0207640_100154452 | 856 |
| 709 | 3300025986 | Ga0207658_10006879 | Ga0207658_100068793 | 856 |
| 710 | 3300026023 | Ga0207677_10003209 | Ga0207677_100032092 | 856 |
| 711 | 3300026089 | Ga0207648_10008301 | Ga0207648_100083015 | 856 |
| 712 | 3300026089 | Ga0207648_10066836 | Ga0207648_100668362 | 856 |
| 713 | 3300026116 | Ga0207674_10000827 | Ga0207674_100008277 | 856 |
| 714 | 3300026116 | Ga0207674_10004040 | Ga0207674_100040404 | 856 |
| 715 | 3300026118 | Ga0207675_100032620 | Ga0207675_1000326202 | 856 |
| 716 | 3300026121 | Ga0207683_10005397 | Ga0207683_100053974 | 856 |
| 717 | 3300026121 | Ga0207683_10008598 | Ga0207683_100085983 | 856 |
| 718 | 3300026142 | Ga0207698_10000913 | Ga0207698_1000091310 | 856 |
| 719 | 3300028379 | Ga0268266_10012792 | Ga0268266_100127922 | 856 |
| 720 | 3300031731 | Ga0307405_10001874 | Ga0307405_100018742 | 856 |
| 721 | 3300031731 | Ga0307405_10016247 | Ga0307405_100162472 | 856 |
| 722 | 3300031824 | Ga0307413_10008169 | Ga0307413_100081692 | 856 |
| 723 | 3300031852 | Ga0307410_10005261 | Ga0307410_100052612 | 856 |
| 724 | 3300031852 | Ga0307410_10013947 | Ga0307410_100139472 | 856 |
| 725 | 3300031903 | Ga0307407_10003822 | Ga0307407_100038222 | 856 |
| 726 | 3300031903 | Ga0307407_10012733 | Ga0307407_100127332 | 856 |
| 727 | 3300032002 | Ga0307416_100002293 | Ga0307416_1000022936 | 856 |
| 728 | 3300032004 | Ga0307414_10005424 | Ga0307414_100054242 | 856 |
| 729 | 3300032004 | Ga0307414_10010955 | Ga0307414_100109552 | 856 |
| 730 | 3300032005 | Ga0307411_10022233 | Ga0307411_100222332 | 856 |
| 731 | 3300032126 | Ga0307415_100003377 | Ga0307415_1000033773 | 856 |
| 732 | 3300032126 | Ga0307415_100016430 | Ga0307415_1000164302 | 856 |
| 733 | 3300037418 | Ga0395900_0013724 | Ga0395900_0013724_2042_4645 | 856 |
| 734 | 3300037853 | Ga0436364_0501064 | Ga0436364_0501064_6096_8696 | 856 |
| 735 | 3300038443 | Ga0395901_0000375 | Ga0395901_0000375_26349_28952 | 856 |
| 736 | 3300038443 | Ga0395901_0021576 | Ga0395901_0021576_1746_4346 | 856 |
| 737 | 3300044656 | Ga0466969_0006530 | Ga0466969_0006530_2314_4968 | 856 |
| 738 | 3300044684 | Ga0466966_0002429 | Ga0466966_0002429_6655_9309 | 856 |
| 739 | 3300044735 | Ga0466968_0011715 | Ga0466968_0011715_390_2993 | 856 |
| 740 | 3300046539 | Ga0495621_0005616 | Ga0495621_0005616_996_3596 | 856 |
| 741 | 3300046558 | Ga0495633_0003389 | Ga0495633_0003389_5549_8149 | 856 |
| 742 | 3300046665 | Ga0495661_0009776 | Ga0495661_0009776_3370_5970 | 856 |
| 743 | 3300046684 | Ga0495669_0016859 | Ga0495669_0016859_440_3040 | 856 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6i5f-assembly1.cif.gz_B | crystal structure of dna-free e.coli muts p839e dimer mutant | 0.8893 | 5 | 792 |
| 7ou0-assembly1.cif.gz_A | the structure of muts bound to two molecules of adp-vanadate | 0.8858 | 7 | 792 |
| 6i5f-assembly1.cif.gz_B | crystal structure of dna-free e.coli muts p839e dimer mutant | 0.8851 | 5 | 792 |
| 7ou0-assembly1.cif.gz_A | the structure of muts bound to two molecules of adp-vanadate | 0.8822 | 7 | 792 |
| 7ou4-assembly1.cif.gz_B | the structure of muts bound to one molecule of atp and one molecule of adp | 0.8819 | 11 | 791 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zljA05 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9604 | 558 | 792 | 3.40.50.300 |
| 1ewqB05 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.955 | 558 | 787 | 3.40.50.300 |
| af_A0A1D8PSP4_685_923_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9513 | 561 | 787 | 3.40.50.300 |
| af_Q9TXR4_592_846_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9486 | 560 | 791 | 3.40.50.300 |
| 3zljA05 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9473 | 558 | 792 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520H136-F1-model_v4 | DNA mismatch repair protein MutS | 0.9898 | 10 | 176 |
GO:0005524
GO:0006298 GO:0030983 |
| AF-D5LU65-F1-model_v4 | Methyl-directed mismatch repair protein | 0.9864 | 570 | 738 |
GO:0005524
GO:0005829 GO:0006298 GO:0030983 GO:0140664 |
| AF-A0A1B1GFK4-F1-model_v4 | DNA mismatch repair protein MutS | 0.984 | 590 | 770 |
GO:0005524
GO:0005829 GO:0006298 GO:0030983 GO:0140664 |
| AF-K1U212-F1-model_v4 | DNA mismatch repair protein MutS domain protein | 0.9796 | 587 | 759 |
GO:0005524
GO:0005829 GO:0006298 GO:0030983 GO:0140664 |
| AF-A0A3P7KV04-F1-model_v4 | DNA mismatch repair proteins mutS family domain-containing protein | 0.9784 | 603 | 727 |
GO:0005524
GO:0005634 GO:0005739 GO:0006298 GO:0030983 GO:0043504 GO:0140664 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar