F478662

General Info

Members Datasets Scaffolds Average Seq Length
742 322 1484 98

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0001368|Ga0501032_0001368_5584_5877
Length 86
Sequence MWIGWLEFDLLLGDVRSLKQKRSVIRPIIAELHRRFAVSAAETGAHVVAGDHSHVVDVLDAAERLVAARPEVDLLSTRRGLSRSED

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
199 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
316 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
317 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
318 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
319 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
320 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
321 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
322 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.53
Nodule 0.13
Rhizoplane 11.59
Rhizosphere 70.08
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0001368 3300049569 Bacteria 19347
2 LJNas_1016272 3300000546 Bacteria 792
3 JGI24747J21853_1004154 3300001978 Bacteria 1285
4 JGI24739J22299_10159720 3300001989 Bacteria 665
5 JGI24739J22299_10215373 3300001989 Bacteria 563
6 JGI24743J22301_10007329 3300001991 Bacteria 1910
7 JGI24745J21846_1019444 3300002073 Bacteria 794
8 JGI24738J21930_10097526 3300002075 Bacteria 626
9 JGI24744J21845_10000384 3300002077 Bacteria 7564
10 JGI24744J21845_10002336 3300002077 Bacteria 3871
11 JGI24751J29686_10008471 3300002459 Bacteria 2105
12 Ga0055540_1000151 3300003792 Bacteria 68564
13 Ga0070658_11474406 3300005327 Bacteria 590
14 Ga0070676_10017906 3300005328 Bacteria 3922
15 Ga0070690_100011665 3300005330 Bacteria 5146
16 Ga0070677_10073524 3300005333 Bacteria 1444
17 Ga0068869_100010233 3300005334 Bacteria 6109
18 Ga0068869_100017567 3300005334 Bacteria 4852
19 Ga0070666_10017613 3300005335 Bacteria 4583
20 Ga0070666_10020122 3300005335 Bacteria 4312
21 Ga0070680_101221992 3300005336 Bacteria 650
22 Ga0070680_102002485 3300005336 Bacteria 502
23 Ga0070682_100027647 3300005337 Bacteria 3405
24 Ga0068868_100012630 3300005338 Bacteria 6176
25 Ga0068868_100143878 3300005338 Bacteria 1959
26 Ga0070689_100031258 3300005340 Bacteria 4045
27 Ga0070689_100199558 3300005340 Bacteria 1633
28 Ga0070691_10005559 3300005341 Bacteria 5735
29 Ga0070691_10093318 3300005341 Bacteria 1487
30 Ga0070687_100291126 3300005343 Bacteria 1032
31 Ga0070668_100005316 3300005347 Bacteria 9559
32 Ga0070668_100957921 3300005347 Bacteria 767
33 Ga0070668_101236270 3300005347 Bacteria 677
34 Ga0070669_100010040 3300005353 Bacteria 6729
35 Ga0070669_100936027 3300005353 Bacteria 741
36 Ga0070675_100267253 3300005354 Bacteria 1500
37 Ga0070671_100004714 3300005355 Bacteria 10833
38 Ga0070671_100098371 3300005355 Bacteria 2454
39 Ga0070671_100138641 3300005355 Bacteria 2051
40 Ga0070674_100000471 3300005356 Bacteria 20281
41 Ga0070674_100087597 3300005356 Bacteria 2239
42 Ga0070673_100270888 3300005364 Bacteria 1486
43 Ga0070688_100065365 3300005365 Bacteria 2312
44 Ga0070659_100032369 3300005366 Bacteria 4055
45 Ga0070659_100632852 3300005366 Bacteria 921
46 Ga0070667_100000274 3300005367 Bacteria 58415
47 Ga0070667_100000371 3300005367 Bacteria 49008
48 Ga0070667_100023387 3300005367 Bacteria 5126
49 Ga0070667_100039705 3300005367 Bacteria 3946
50 Ga0070709_10051871 3300005434 Bacteria 2576
51 Ga0070709_10263696 3300005434 Bacteria 1246
52 Ga0070709_10763967 3300005434 Bacteria 756
53 Ga0070714_100153459 3300005435 Bacteria 2077
54 Ga0070714_101413662 3300005435 Bacteria 679
55 Ga0070713_100124945 3300005436 Bacteria 2261
56 Ga0070710_10001183 3300005437 Bacteria 12311
57 Ga0070710_10008757 3300005437 Bacteria 4934
58 Ga0070710_10546937 3300005437 Bacteria 799
59 Ga0070701_10007743 3300005438 Bacteria 4610
60 Ga0070701_10129411 3300005438 Bacteria 1433
61 Ga0070711_100004159 3300005439 Bacteria 8506
62 Ga0070711_100005943 3300005439 Bacteria 7326
63 Ga0070711_102008686 3300005439 Bacteria 509
64 Ga0070705_100001938 3300005440 Bacteria 10609
65 Ga0070705_100030690 3300005440 Bacteria 2969
66 Ga0070700_100006503 3300005441 Bacteria 6254
67 Ga0070700_100019696 3300005441 Bacteria 3898
68 Ga0070663_100007373 3300005455 Bacteria 6690
69 Ga0070678_100000482 3300005456 Bacteria 19049
70 Ga0070662_100050287 3300005457 Bacteria 3007
71 Ga0070662_100076134 3300005457 Bacteria 2486
72 Ga0070662_100761558 3300005457 Bacteria 822
73 Ga0068867_100005184 3300005459 Bacteria 9193
74 Ga0070685_10018776 3300005466 Bacteria 3724
75 Ga0070685_10085626 3300005466 Bacteria 1898
76 Ga0070684_100800193 3300005535 Bacteria 881
77 Ga0070697_100426985 3300005536 Bacteria 1152
78 Ga0068853_100007782 3300005539 Bacteria 8593
79 Ga0068853_100074602 3300005539 Bacteria 2959
80 Ga0070672_100232890 3300005543 Bacteria 1548
81 Ga0070672_100267480 3300005543 Bacteria 1443
82 Ga0070695_100007308 3300005545 Bacteria 6547
83 Ga0070695_100961349 3300005545 Bacteria 693
84 Ga0070696_100003253 3300005546 Bacteria 10827
85 Ga0070696_100214684 3300005546 Bacteria 1441
86 Ga0070693_100062219 3300005547 Bacteria 2172
87 Ga0070665_100016700 3300005548 Bacteria 7357
88 Ga0070665_100018942 3300005548 Bacteria 6904
89 Ga0070665_100105520 3300005548 Bacteria 2820
90 Ga0070665_100222261 3300005548 Bacteria 1889
91 Ga0070704_100004128 3300005549 Bacteria 8382
92 Ga0070704_100076911 3300005549 Bacteria 2443
93 Ga0068855_100024963 3300005563 Bacteria 7153
94 Ga0068854_100022482 3300005578 Bacteria 4297
95 Ga0068854_100316159 3300005578 Bacteria 1268
96 Ga0068854_101534503 3300005578 Bacteria 605
97 Ga0068854_102148772 3300005578 Bacteria 516
98 Ga0068856_101849437 3300005614 Bacteria 615
99 Ga0070702_100054387 3300005615 Bacteria 2303
100 Ga0070702_100055367 3300005615 Bacteria 2287
101 Ga0068852_100095931 3300005616 Bacteria 2664
102 Ga0068852_100136563 3300005616 Bacteria 2265
103 Ga0068852_100665821 3300005616 Bacteria 1049
104 Ga0068859_100000403 3300005617 Bacteria 42941
105 Ga0068864_100462505 3300005618 Bacteria 1215
106 Ga0068864_100708051 3300005618 Bacteria 984
107 Ga0068866_10000543 3300005718 Bacteria 17242
108 Ga0068866_10827924 3300005718 Bacteria 645
109 Ga0068861_100000669 3300005719 Bacteria 20400
110 Ga0068861_100093855 3300005719 Bacteria 2373
111 Ga0068861_100135314 3300005719 Bacteria 2005
112 Ga0068851_10310356 3300005834 Bacteria 909
113 Ga0068870_10671972 3300005840 Bacteria 712
114 Ga0068863_100000819 3300005841 Bacteria 31119
115 Ga0068863_100015514 3300005841 Bacteria 7321
116 Ga0068858_100013168 3300005842 Bacteria 7795
117 Ga0068858_100019774 3300005842 Bacteria 6295
118 Ga0068858_100503856 3300005842 Bacteria 1170
119 Ga0068858_100611208 3300005842 Bacteria 1058
120 Ga0068860_100000021 3300005843 Bacteria 282612
121 Ga0068860_100013961 3300005843 Bacteria 7875
122 Ga0068860_100101360 3300005843 Bacteria 2747
123 Ga0068860_100252909 3300005843 Bacteria 1716
124 Ga0068862_100000015 3300005844 Bacteria 250184
125 Ga0068862_100018680 3300005844 Bacteria 5774
126 Ga0068862_100437353 3300005844 Bacteria 1230
127 Ga0068862_101654233 3300005844 Bacteria 648
128 Ga0081455_10042015 3300005937 Bacteria 4016
129 Ga0075365_10000912 3300006038 Bacteria 12420
130 Ga0075365_10042914 3300006038 Bacteria 2959
131 Ga0075365_10155264 3300006038 Bacteria 1593
132 Ga0075368_10083548 3300006042 Bacteria 1301
133 Ga0075368_10438905 3300006042 Bacteria 577
134 Ga0075363_100000562 3300006048 Bacteria 12115
135 Ga0075363_100001882 3300006048 Bacteria 8283
136 Ga0075363_100032046 3300006048 Bacteria 2728
137 Ga0075363_100044729 3300006048 Bacteria 2346
138 Ga0075363_100086478 3300006048 Bacteria 1721
139 Ga0075363_100201733 3300006048 Bacteria 1136
140 Ga0075363_100230445 3300006048 Bacteria 1063
141 Ga0075363_100263218 3300006048 Bacteria 995
142 Ga0075363_100282839 3300006048 Bacteria 960
143 Ga0075363_100529343 3300006048 Bacteria 702
144 Ga0075363_100792022 3300006048 Unclassified 576
145 Ga0075363_100815190 3300006048 Bacteria 568
146 Ga0075363_100828113 3300006048 Bacteria 564
147 Ga0075363_100976166 3300006048 Bacteria 521
148 Ga0075364_10001654 3300006051 Bacteria 12254
149 Ga0075364_10019122 3300006051 Bacteria 4297
150 Ga0075364_10026758 3300006051 Bacteria 3682
151 Ga0075364_10033924 3300006051 Bacteria 3289
152 Ga0070716_100037621 3300006173 Bacteria 2675
153 Ga0070716_100112731 3300006173 Bacteria 1688
154 Ga0070716_100598007 3300006173 Bacteria 829
155 Ga0070712_100007493 3300006175 Bacteria 6815
156 Ga0070712_100164111 3300006175 Bacteria 1718
157 Ga0070712_100501817 3300006175 Bacteria 1017
158 Ga0070712_101874362 3300006175 Bacteria 525
159 Ga0075362_10005080 3300006177 Bacteria 4784
160 Ga0075362_10017759 3300006177 Bacteria 2934
161 Ga0075362_10080687 3300006177 Bacteria 1499
162 Ga0075362_10237554 3300006177 Bacteria 894
163 Ga0075367_10054826 3300006178 Bacteria 2364
164 Ga0075367_10231110 3300006178 Bacteria 1158
165 Ga0075367_10368001 3300006178 Bacteria 908
166 Ga0075369_10020343 3300006186 Bacteria 2718
167 Ga0075369_10142741 3300006186 Bacteria 1092
168 Ga0075369_10153029 3300006186 Bacteria 1055
169 Ga0075369_10348430 3300006186 Bacteria 695
170 Ga0075369_10547981 3300006186 Bacteria 552
171 Ga0075369_10582440 3300006186 Bacteria 535
172 Ga0097621_100393930 3300006237 Bacteria 1239
173 Ga0097621_101133968 3300006237 Bacteria 735
174 Ga0075370_10096362 3300006353 Bacteria 1710
175 Ga0075370_10181310 3300006353 Bacteria 1239
176 Ga0068871_100121745 3300006358 Bacteria 2204
177 Ga0068871_100282175 3300006358 Bacteria 1453
178 Ga0075428_100011043 3300006844 Bacteria 10046
179 Ga0075430_100222984 3300006846 Bacteria 1564
180 Ga0075434_100777441 3300006871 Bacteria 974
181 Ga0068865_100007710 3300006881 Bacteria 6633
182 Ga0068865_100720282 3300006881 Bacteria 854
183 Ga0097620_100000403 3300006931 Bacteria 42941
184 Ga0105244_10323231 3300009036 Bacteria 712
185 Ga0105250_10055484 3300009092 Bacteria 1590
186 Ga0105250_10172611 3300009092 Bacteria 905
187 Ga0105240_10536423 3300009093 Bacteria 1296
188 Ga0111539_10456714 3300009094 Bacteria 1488
189 Ga0111539_10938170 3300009094 Bacteria 1006
190 Ga0111539_11649274 3300009094 Bacteria 744
191 Ga0105245_10016502 3300009098 Bacteria 6444
192 Ga0105245_10552727 3300009098 Bacteria 1173
193 Ga0105245_11611266 3300009098 Bacteria 701
194 Ga0105247_10000035 3300009101 Bacteria 178167
195 Ga0105247_10004239 3300009101 Bacteria 9194
196 Ga0105247_10023636 3300009101 Bacteria 3704
197 Ga0105247_10089184 3300009101 Bacteria 1955
198 Ga0105247_10468247 3300009101 Bacteria 912
199 Ga0105243_10015883 3300009148 Bacteria 5694
200 Ga0105243_10103835 3300009148 Bacteria 2364
201 Ga0105243_10156815 3300009148 Bacteria 1958
202 Ga0105241_10013618 3300009174 Bacteria 5960
203 Ga0105241_10091929 3300009174 Bacteria 2395
204 Ga0105242_10005281 3300009176 Bacteria 9973
205 Ga0105242_10235858 3300009176 Bacteria 1642
206 Ga0105248_10000068 3300009177 Bacteria 121237
207 Ga0105248_10023741 3300009177 Bacteria 6814
208 Ga0105248_10103663 3300009177 Bacteria 3207
209 Ga0105248_10267448 3300009177 Bacteria 1925
210 Ga0105237_10094190 3300009545 Bacteria 2984
211 Ga0105237_10117250 3300009545 Bacteria 2656
212 Ga0105237_10189429 3300009545 Bacteria 2057
213 Ga0105237_11417844 3300009545 Bacteria 701
214 Ga0105238_10445912 3300009551 Bacteria 1291
215 Ga0105249_10000071 3300009553 Bacteria 146512
216 Ga0105249_10006387 3300009553 Bacteria 10251
217 Ga0105249_10007034 3300009553 Bacteria 9817
218 Ga0105249_10076221 3300009553 Bacteria 3108
219 Ga0105249_11327463 3300009553 Bacteria 791
220 Ga0105033_106456 3300009986 Bacteria 1014
221 Ga0099796_10018948 3300010159 Bacteria 2077
222 Ga0105239_10021453 3300010375 Bacteria 7121
223 Ga0105239_10761823 3300010375 Bacteria 1108
224 Ga0105239_10785681 3300010375 Bacteria 1090
225 Ga0105239_10851455 3300010375 Bacteria 1046
226 Ga0105239_11535002 3300010375 Bacteria 770
227 Ga0105246_10007388 3300011119 Bacteria 6732
228 Ga0157371_10069766 3300013102 Bacteria 2489
229 Ga0157369_10743454 3300013105 Bacteria 1009
230 Ga0157369_12053153 3300013105 Bacteria 580
231 Ga0157374_10008857 3300013296 Bacteria 8617
232 Ga0157374_10220190 3300013296 Bacteria 1862
233 Ga0157378_10004183 3300013297 Bacteria 12744
234 Ga0157378_12727066 3300013297 Bacteria 547
235 Ga0163162_10016658 3300013306 Bacteria 7183
236 Ga0163162_10416658 3300013306 Bacteria 1475
237 Ga0163162_10925671 3300013306 Bacteria 984
238 Ga0163162_11665107 3300013306 Bacteria 728
239 Ga0157372_10014174 3300013307 Bacteria 8517
240 Ga0157372_10096426 3300013307 Bacteria 3370
241 Ga0157375_10006410 3300013308 Bacteria 10257
242 Ga0157375_10717883 3300013308 Bacteria 1152
243 Ga0157375_11061803 3300013308 Bacteria 947
244 Ga0163163_10031415 3300014325 Bacteria 5125
245 Ga0163163_10516494 3300014325 Bacteria 1257
246 Ga0163163_11004096 3300014325 Bacteria 898
247 Ga0163163_12082010 3300014325 Bacteria 627
248 Ga0157380_10005706 3300014326 Bacteria 8711
249 Ga0157380_10146739 3300014326 Bacteria 2034
250 Ga0157380_10309057 3300014326 Bacteria 1460
251 Ga0157377_10116608 3300014745 Bacteria 1613
252 Ga0157377_10150996 3300014745 Bacteria 1436
253 Ga0157379_10022652 3300014968 Bacteria 5566
254 Ga0157379_11079868 3300014968 Bacteria 768
255 Ga0157379_11156689 3300014968 Bacteria 743
256 Ga0157379_11752815 3300014968 Bacteria 609
257 Ga0157376_10798029 3300014969 Bacteria 956
258 Ga0163161_10006448 3300017792 Bacteria 8123
259 Ga0163161_10155188 3300017792 Bacteria 1742
260 Ga0163161_10202512 3300017792 Bacteria 1530
261 Ga0163161_10740278 3300017792 Bacteria 822
262 Ga0213876_10001986 3300021384 Bacteria 12231
263 Ga0213876_10083091 3300021384 Bacteria 1694
264 Ga0213875_10005978 3300021388 Bacteria 6451
265 Ga0209051_1000075 3300025303 Bacteria 205011
266 Ga0209051_1011850 3300025303 Bacteria 4268
267 Ga0207692_10008190 3300025898 Bacteria 4319
268 Ga0207692_10040326 3300025898 Bacteria 2303
269 Ga0207692_10348277 3300025898 Bacteria 913
270 Ga0207642_10003931 3300025899 Bacteria 4740
271 Ga0207642_10522069 3300025899 Bacteria 730
272 Ga0207710_10000056 3300025900 Bacteria 178147
273 Ga0207710_10002826 3300025900 Bacteria 7916
274 Ga0207710_10022529 3300025900 Bacteria 2704
275 Ga0207688_10005401 3300025901 Bacteria 6945
276 Ga0207688_10005445 3300025901 Bacteria 6918
277 Ga0207680_10029960 3300025903 Bacteria 3063
278 Ga0207680_10054129 3300025903 Bacteria 2413
279 Ga0207647_10168630 3300025904 Bacteria 1275
280 Ga0207685_10015524 3300025905 Bacteria 2415
281 Ga0207685_10039614 3300025905 Bacteria 1750
282 Ga0207685_10136969 3300025905 Bacteria 1093
283 Ga0207699_10026146 3300025906 Bacteria 3213
284 Ga0207699_10289509 3300025906 Bacteria 1141
285 Ga0207699_10570909 3300025906 Bacteria 822
286 Ga0207699_10773070 3300025906 Bacteria 705
287 Ga0207645_10122451 3300025907 Bacteria 1689
288 Ga0207645_10180653 3300025907 Bacteria 1384
289 Ga0207684_10677005 3300025910 Bacteria 878
290 Ga0207654_10246078 3300025911 Bacteria 1197
291 Ga0207671_10089879 3300025914 Bacteria 2312
292 Ga0207671_10096492 3300025914 Bacteria 2234
293 Ga0207671_10140690 3300025914 Bacteria 1859
294 Ga0207671_11154217 3300025914 Bacteria 607
295 Ga0207693_10002793 3300025915 Bacteria 15124
296 Ga0207693_10006050 3300025915 Bacteria 10024
297 Ga0207693_10594871 3300025915 Bacteria 861
298 Ga0207663_10792746 3300025916 Bacteria 754
299 Ga0207660_11174105 3300025917 Bacteria 625
300 Ga0207662_10058577 3300025918 Bacteria 2306
301 Ga0207646_10889284 3300025922 Bacteria 790
302 Ga0207681_10019336 3300025923 Bacteria 4303
303 Ga0207681_10039177 3300025923 Bacteria 3144
304 Ga0207681_10260816 3300025923 Bacteria 1357
305 Ga0207694_11842997 3300025924 Bacteria 508
306 Ga0207659_10047380 3300025926 Bacteria 3040
307 Ga0207659_10088520 3300025926 Bacteria 2306
308 Ga0207687_10010537 3300025927 Bacteria 6040
309 Ga0207687_10317744 3300025927 Bacteria 1260
310 Ga0207664_10011563 3300025929 Bacteria 6283
311 Ga0207664_11172360 3300025929 Bacteria 686
312 Ga0207644_10035412 3300025931 Bacteria 3497
313 Ga0207644_10481585 3300025931 Bacteria 1022
314 Ga0207644_10672646 3300025931 Bacteria 862
315 Ga0207690_10016924 3300025932 Bacteria 4446
316 Ga0207690_10445877 3300025932 Bacteria 1039
317 Ga0207706_10010136 3300025933 Bacteria 8624
318 Ga0207706_10591724 3300025933 Bacteria 953
319 Ga0207706_11083943 3300025933 Bacteria 670
320 Ga0207686_10085973 3300025934 Bacteria 2064
321 Ga0207686_10713252 3300025934 Bacteria 798
322 Ga0207709_10009385 3300025935 Bacteria 5383
323 Ga0207709_11131303 3300025935 Bacteria 644
324 Ga0207669_10004012 3300025937 Bacteria 6437
325 Ga0207669_11519240 3300025937 Bacteria 571
326 Ga0207704_10000983 3300025938 Bacteria 12653
327 Ga0207704_10063635 3300025938 Bacteria 2300
328 Ga0207704_11143546 3300025938 Bacteria 662
329 Ga0207665_10002392 3300025939 Bacteria 12678
330 Ga0207665_10066836 3300025939 Bacteria 2447
331 Ga0207691_10227694 3300025940 Bacteria 1615
332 Ga0207691_10239425 3300025940 Bacteria 1569
333 Ga0207711_10000148 3300025941 Bacteria 74104
334 Ga0207711_10046263 3300025941 Bacteria 3718
335 Ga0207711_10186838 3300025941 Bacteria 1887
336 Ga0207711_10828275 3300025941 Bacteria 861
337 Ga0207711_11214530 3300025941 Bacteria 695
338 Ga0207689_10009412 3300025942 Bacteria 8440
339 Ga0207689_10039864 3300025942 Bacteria 3888
340 Ga0207667_10062050 3300025949 Bacteria 3910
341 Ga0207667_10540811 3300025949 Bacteria 1179
342 Ga0207712_10000028 3300025961 Bacteria 250190
343 Ga0207712_10011053 3300025961 Bacteria 5747
344 Ga0207712_10251912 3300025961 Bacteria 1428
345 Ga0207712_10495393 3300025961 Bacteria 1044
346 Ga0207712_11382009 3300025961 Bacteria 630
347 Ga0207668_10000864 3300025972 Bacteria 18281
348 Ga0207668_10011975 3300025972 Bacteria 5292
349 Ga0207668_10515473 3300025972 Bacteria 1031
350 Ga0207668_10673282 3300025972 Bacteria 907
351 Ga0207668_10880239 3300025972 Bacteria 796
352 Ga0207640_10016693 3300025981 Bacteria 4278
353 Ga0207640_11333293 3300025981 Bacteria 641
354 Ga0207658_10000488 3300025986 Bacteria 36444
355 Ga0207658_10004684 3300025986 Bacteria 9477
356 Ga0207658_10018993 3300025986 Bacteria 4754
357 Ga0207658_10745848 3300025986 Bacteria 886
358 Ga0207677_10015951 3300026023 Bacteria 4435
359 Ga0207677_10143250 3300026023 Bacteria 1833
360 Ga0207703_10028567 3300026035 Bacteria 4397
361 Ga0207703_10041922 3300026035 Bacteria 3669
362 Ga0207703_10096255 3300026035 Bacteria 2499
363 Ga0207703_10416999 3300026035 Bacteria 1249
364 Ga0207639_10042258 3300026041 Bacteria 3415
365 Ga0207678_10045683 3300026067 Bacteria 3787
366 Ga0207678_10077643 3300026067 Bacteria 2844
367 Ga0207708_10010629 3300026075 Bacteria 6836
368 Ga0207641_10000791 3300026088 Bacteria 33778
369 Ga0207641_10465804 3300026088 Bacteria 1223
370 Ga0207641_10918362 3300026088 Bacteria 870
371 Ga0207648_10001183 3300026089 Bacteria 29207
372 Ga0207648_10010215 3300026089 Bacteria 8929
373 Ga0207676_10352239 3300026095 Bacteria 1362
374 Ga0207676_10544602 3300026095 Bacteria 1108
375 Ga0207675_100001210 3300026118 Bacteria 25719
376 Ga0207675_100035530 3300026118 Bacteria 4649
377 Ga0207675_100650431 3300026118 Bacteria 1060
378 Ga0207683_10000829 3300026121 Bacteria 28292
379 Ga0207683_10067401 3300026121 Bacteria 3157
380 Ga0207683_11308993 3300026121 Bacteria 671
381 Ga0207698_10033054 3300026142 Bacteria 3754
382 Ga0207698_10197010 3300026142 Bacteria 1800
383 Ga0209813_10027753 3300027866 Bacteria 1646
384 Ga0207428_10488222 3300027907 Bacteria 895
385 Ga0268266_10024879 3300028379 Bacteria 5094
386 Ga0268266_10057001 3300028379 Bacteria 3361
387 Ga0268266_10211631 3300028379 Bacteria 1778
388 Ga0268266_10591401 3300028379 Bacteria 1065
389 Ga0268265_10000023 3300028380 Bacteria 268530
390 Ga0268265_10131530 3300028380 Bacteria 2080
391 Ga0268264_10000099 3300028381 Bacteria 228666
392 Ga0268264_10010708 3300028381 Bacteria 7575
393 Ga0268264_10092926 3300028381 Bacteria 2605
394 Ga0268264_10408052 3300028381 Bacteria 1307
395 Ga0268264_11884714 3300028381 Bacteria 608
396 Ga0316575_10321069 3300031665 Bacteria 657
397 Ga0307413_10150098 3300031824 Bacteria 1623
398 Ga0307413_10181573 3300031824 Bacteria 1501
399 Ga0307410_10411494 3300031852 Bacteria 1095
400 Ga0307410_10826556 3300031852 Bacteria 789
401 Ga0307410_11029661 3300031852 Bacteria 711
402 Ga0307406_10652271 3300031901 Bacteria 874
403 Ga0307409_100150652 3300031995 Bacteria 2019
404 Ga0307409_100646408 3300031995 Bacteria 1051
405 Ga0307416_101787601 3300032002 Bacteria 719
406 Ga0307411_10318434 3300032005 Bacteria 1255
407 Ga0307411_12045117 3300032005 Bacteria 535
408 Ga0373949_0023602 3300035090 Bacteria 1425
409 Ga0373951_0166626 3300035091 Bacteria 626
410 Ga0373952_0070379 3300035092 Bacteria 874
411 Ga0373939_0264750 3300035114 Bacteria 674
412 Ga0373961_0446500 3300035241 Bacteria 504
413 Ga0373962_0105329 3300035242 Bacteria 884
414 Ga0316574_0469279 3300035398 Bacteria 787
415 Ga0373931_0017246 3300035691 Bacteria 3567
416 Ga0373931_0108923 3300035691 Bacteria 1569
417 Ga0373947_1035688 3300035725 Bacteria 560
418 Ga0373937_0811091 3300036401 Bacteria 884
419 Ga0316584_0089104 3300036712 Bacteria 2310
420 Ga0395900_1102949 3300037418 Bacteria 711
421 Ga0395898_1180656 3300037466 Bacteria 697
422 Ga0436364_0642997 3300037853 Bacteria 25535
423 Ga0436364_1150132 3300037853 Bacteria 3483
424 Ga0436365_0394011 3300039437 Bacteria 3611
425 Ga0436365_0909784 3300039437 Bacteria 46092
426 Ga0436361_0148105 3300039447 Bacteria 1078
427 Ga0436363_1168634 3300039450 Bacteria 1238
428 Ga0439461_0003355 3300041410 Bacteria 2630
429 Ga0439466_0014662 3300041411 Bacteria 2851
430 Ga0439466_0023181 3300041411 Bacteria 2185
431 Ga0439465_0000264 3300041413 Bacteria 14559
432 Ga0439465_0000787 3300041413 Bacteria 9903
433 Ga0439465_0014659 3300041413 Bacteria 2443
434 Ga0451802_0503932 3300041460 Bacteria 716
435 Ga0439431_0048379 3300041997 Bacteria 1098
436 Ga0439431_0222480 3300041997 Bacteria 554
437 Ga0439442_002003 3300042002 Bacteria 4006
438 Ga0439445_0001816 3300042004 Bacteria 4707
439 Ga0439445_0081522 3300042004 Bacteria 904
440 Ga0439448_0079711 3300042005 Bacteria 1098
441 Ga0439458_0186458 3300042157 Bacteria 564
442 Ga0439459_0008240 3300042438 Bacteria 1777
443 Ga0466969_0065621 3300044656 Bacteria 1754
444 Ga0466969_0158409 3300044656 Bacteria 1041
445 Ga0466972_0006727 3300044658 Bacteria 5770
446 Ga0466972_0055131 3300044658 Bacteria 1912
447 Ga0466965_0034163 3300044683 Bacteria 2487
448 Ga0466965_0099048 3300044683 Bacteria 1489
449 Ga0466965_0122295 3300044683 Bacteria 1345
450 Ga0466965_0547847 3300044683 Bacteria 653
451 Ga0466965_0692835 3300044683 Bacteria 584
452 Ga0466966_0003401 3300044684 Bacteria 10497
453 Ga0466966_0014397 3300044684 Bacteria 5236
454 Ga0466966_0251832 3300044684 Bacteria 1064
455 Ga0466961_0004337 3300044693 Bacteria 8885
456 Ga0466961_0006078 3300044693 Bacteria 7656
457 Ga0466961_0008790 3300044693 Bacteria 6442
458 Ga0466961_0044799 3300044693 Bacteria 2831
459 Ga0466963_0051800 3300044694 Bacteria 2722
460 Ga0466963_0068969 3300044694 Bacteria 2376
461 Ga0466963_0115525 3300044694 Bacteria 1844
462 Ga0466964_0106114 3300044706 Bacteria 1246
463 Ga0466964_0124006 3300044706 Bacteria 1168
464 Ga0466971_0054934 3300044719 Bacteria 1795
465 Ga0466971_0192764 3300044719 Bacteria 960
466 Ga0466971_0456594 3300044719 Bacteria 627
467 Ga0466968_0012840 3300044735 Bacteria 3286
468 Ga0466968_0023669 3300044735 Bacteria 2504
469 Ga0466968_0095492 3300044735 Bacteria 1323
470 Ga0466968_0250501 3300044735 Bacteria 841
471 Ga0466968_0263429 3300044735 Bacteria 821
472 Ga0466970_0012130 3300044765 Bacteria 4400
473 Ga0466970_0014825 3300044765 Bacteria 4005
474 Ga0466970_0030508 3300044765 Bacteria 2843
475 Ga0466970_0123881 3300044765 Bacteria 1417
476 Ga0466970_0706219 3300044765 Bacteria 588
477 Ga0466957_0008941 3300044842 Bacteria 5709
478 Ga0466957_0031991 3300044842 Bacteria 3147
479 Ga0466957_0120448 3300044842 Bacteria 1672
480 Ga0466957_0289480 3300044842 Bacteria 1098
481 Ga0466957_0520076 3300044842 Bacteria 827
482 Ga0466960_0013545 3300044901 Bacteria 3469
483 Ga0466960_0249708 3300044901 Bacteria 985
484 Ga0466960_0335664 3300044901 Bacteria 859
485 Ga0466959_0000580 3300045049 Bacteria 21292
486 Ga0466959_0011603 3300045049 Bacteria 6333
487 Ga0466959_0032062 3300045049 Bacteria 3889
488 Ga0466959_0034407 3300045049 Bacteria 3747
489 Ga0466959_0086113 3300045049 Bacteria 2261
490 Ga0466959_0687020 3300045049 Bacteria 686
491 Ga0466958_0007481 3300045836 Bacteria 6011
492 Ga0466958_0011253 3300045836 Bacteria 5036
493 Ga0466958_0032025 3300045836 Bacteria 3126
494 Ga0466958_0115749 3300045836 Bacteria 1675
495 Ga0466967_0116590 3300045976 Bacteria 2461
496 Ga0466967_0225567 3300045976 Bacteria 1782
497 Ga0466967_0279735 3300045976 Bacteria 1601
498 Ga0466967_0501164 3300045976 Bacteria 1192
499 Ga0466967_0765459 3300045976 Bacteria 958
500 Ga0466967_0944273 3300045976 Unclassified 858
501 Ga0466967_1656078 3300045976 Bacteria 637
502 Ga0466967_1812986 3300045976 Bacteria 607
503 Ga0466967_2082913 3300045976 Bacteria 564
504 Ga0495603_0080944 3300046455 Bacteria 1903
505 Ga0495629_0368608 3300046459 Bacteria 978
506 Ga0495638_0016738 3300046460 Bacteria 4902
507 Ga0495638_0021481 3300046460 Bacteria 4252
508 Ga0495641_0020349 3300046461 Bacteria 3368
509 Ga0495605_0490136 3300046474 Bacteria 503
510 Ga0495662_0181276 3300046476 Bacteria 1038
511 Ga0495664_0837713 3300046477 Bacteria 540
512 Ga0495594_0088283 3300046499 Bacteria 1736
513 Ga0495648_0002587 3300046524 Bacteria 16574
514 Ga0495665_0023610 3300046531 Bacteria 3303
515 Ga0495587_0376632 3300046536 Bacteria 790
516 Ga0495667_0593356 3300046559 Bacteria 690
517 Ga0495668_0013760 3300046616 Bacteria 4762
518 Ga0495668_0485841 3300046616 Bacteria 680
519 Ga0495611_0018048 3300046648 Bacteria 3023
520 Ga0495599_0882776 3300046678 Bacteria 507
521 Ga0495647_0350749 3300046681 Bacteria 672
522 Ga0495658_0025053 3300046683 Bacteria 3186
523 Ga0495624_0081501 3300046690 Bacteria 2004
524 Ga0495649_0229380 3300046694 Bacteria 959
525 Ga0495649_0229384 3300046694 Bacteria 959
526 Ga0495581_0031631 3300047315 Bacteria 3066
527 Ga0495672_0021390 3300047320 Bacteria 4220
528 Ga0495672_0029418 3300047320 Bacteria 3460
529 Ga0495672_0129564 3300047320 Bacteria 1329
530 Ga0495676_0739363 3300047321 Bacteria 635
531 Ga0495593_0011932 3300047673 Bacteria 4982
532 Ga0495614_0027546 3300048089 Bacteria 2450
533 Ga0496100_0000092 3300048903 Bacteria 50831
534 Ga0496100_0006517 3300048903 Bacteria 6368
535 Ga0496100_0029292 3300048903 Bacteria 3404
536 Ga0496100_0116386 3300048903 Bacteria 1865
537 Ga0496100_0143184 3300048903 Bacteria 1697
538 Ga0496101_0000018 3300048904 Bacteria 236102
539 Ga0496101_0000019 3300048904 Bacteria 220382
540 Ga0496101_0007988 3300048904 Bacteria 6895
541 Ga0496101_0092097 3300048904 Bacteria 2257
542 Ga0496101_0123725 3300048904 Bacteria 1958
543 Ga0496101_0608479 3300048904 Bacteria 864
544 Ga0496102_0000007 3300048905 Bacteria 417224
545 Ga0496102_0000899 3300048905 Bacteria 28205
546 Ga0496102_0011290 3300048905 Bacteria 7696
547 Ga0496102_0011416 3300048905 Bacteria 7657
548 Ga0496102_0022524 3300048905 Bacteria 5583
549 Ga0496102_0097079 3300048905 Bacteria 2732
550 Ga0496102_0100973 3300048905 Bacteria 2680
551 Ga0496102_0440745 3300048905 Bacteria 1222
552 Ga0496102_1016481 3300048905 Bacteria 749
553 Ga0496102_1601619 3300048905 Bacteria 569
554 Ga0496103_0000013 3300048906 Bacteria 297928
555 Ga0496103_0000628 3300048906 Bacteria 27041
556 Ga0496103_0001247 3300048906 Bacteria 17378
557 Ga0496103_0002674 3300048906 Bacteria 11148
558 Ga0496103_0073296 3300048906 Bacteria 2145
559 Ga0496103_0108455 3300048906 Bacteria 1762
560 Ga0496103_0360316 3300048906 Bacteria 935
561 Ga0496104_0005479 3300048907 Bacteria 11115
562 Ga0496104_0086248 3300048907 Bacteria 2997
563 Ga0496104_0729683 3300048907 Bacteria 898
564 Ga0496104_1408516 3300048907 Bacteria 600
565 Ga0496104_1711489 3300048907 Bacteria 531
566 Ga0496105_0051031 3300048908 Bacteria 3418
567 Ga0496105_0059238 3300048908 Bacteria 3160
568 Ga0496105_0370681 3300048908 Bacteria 1141
569 Ga0496106_0004521 3300048909 Bacteria 10301
570 Ga0496106_0005617 3300048909 Bacteria 9281
571 Ga0496106_0013092 3300048909 Bacteria 6122
572 Ga0496106_0016376 3300048909 Bacteria 5486
573 Ga0496106_0040603 3300048909 Bacteria 3485
574 Ga0496106_0373870 3300048909 Bacteria 1145
575 Ga0496106_0401759 3300048909 Bacteria 1101
576 Ga0496107_0002855 3300048910 Bacteria 11426
577 Ga0496107_0002921 3300048910 Bacteria 11302
578 Ga0496107_0004926 3300048910 Bacteria 9080
579 Ga0496107_0012604 3300048910 Bacteria 5904
580 Ga0496107_0072441 3300048910 Bacteria 2505
581 Ga0496107_0098037 3300048910 Bacteria 2147
582 Ga0496107_0524983 3300048910 Bacteria 878
583 Ga0496108_0015858 3300048911 Bacteria 6142
584 Ga0496108_0207729 3300048911 Bacteria 1699
585 Ga0496108_0294530 3300048911 Bacteria 1413
586 Ga0496108_0365744 3300048911 Bacteria 1259
587 Ga0496108_0682763 3300048911 Bacteria 891
588 Ga0496109_0001095 3300048912 Bacteria 22432
589 Ga0496109_0016533 3300048912 Bacteria 6452
590 Ga0496109_0118396 3300048912 Bacteria 2466
591 Ga0496109_0143510 3300048912 Bacteria 2233
592 Ga0496109_1069386 3300048912 Bacteria 744
593 Ga0496109_1335304 3300048912 Bacteria 653
594 Ga0496110_0184308 3300048913 Bacteria 1895
595 Ga0496110_0234021 3300048913 Bacteria 1671
596 Ga0496110_0336503 3300048913 Bacteria 1375
597 Ga0496111_0046738 3300048914 Bacteria 3117
598 Ga0496111_0590730 3300048914 Bacteria 813
599 Ga0496112_0059454 3300048915 Bacteria 3766
600 Ga0496112_0089501 3300048915 Bacteria 3046
601 Ga0496112_0097231 3300048915 Bacteria 2915
602 Ga0496112_0269747 3300048915 Bacteria 1650
603 Ga0496112_0425037 3300048915 Bacteria 1267
604 Ga0496113_0126330 3300048916 Bacteria 2003
605 Ga0496113_0226019 3300048916 Bacteria 1492
606 Ga0496113_0441334 3300048916 Bacteria 1046
607 Ga0496113_0446720 3300048916 Bacteria 1039
608 Ga0496114_0000914 3300048917 Bacteria 22111
609 Ga0496114_0002653 3300048917 Bacteria 13646
610 Ga0496114_0013296 3300048917 Bacteria 6597
611 Ga0496114_0201599 3300048917 Bacteria 1743
612 Ga0496114_0293913 3300048917 Bacteria 1434
613 Ga0496114_1361922 3300048917 Bacteria 597
614 Ga0496115_0002286 3300048918 Bacteria 13724
615 Ga0496115_0007649 3300048918 Bacteria 7961
616 Ga0496115_0014860 3300048918 Bacteria 5904
617 Ga0496115_1168681 3300048918 Bacteria 580
618 Ga0496116_0000033 3300048919 Bacteria 418191
619 Ga0496116_0002421 3300048919 Bacteria 19658
620 Ga0496116_0022715 3300048919 Bacteria 4693
621 Ga0496117_0000025 3300048920 Bacteria 418106
622 Ga0496117_0000383 3300048920 Bacteria 76197
623 Ga0496117_0013077 3300048920 Bacteria 7266
624 Ga0496118_0000023 3300048921 Bacteria 418106
625 Ga0496118_0003915 3300048921 Bacteria 18226
626 Ga0496118_0044630 3300048921 Bacteria 3468
627 Ga0496119_0000403 3300048922 Bacteria 59313
628 Ga0496119_0004838 3300048922 Bacteria 13193
629 Ga0496119_0006841 3300048922 Bacteria 10443
630 Ga0496120_0000798 3300048923 Bacteria 45360
631 Ga0496120_0005464 3300048923 Bacteria 10128
632 Ga0496120_0471730 3300048923 Bacteria 543
633 Ga0496121_0000023 3300048924 Bacteria 463448
634 Ga0496121_0000039 3300048924 Bacteria 351444
635 Ga0496121_0003281 3300048924 Bacteria 23223
636 Ga0496122_0000164 3300048925 Bacteria 158055
637 Ga0496123_0008548 3300048926 Bacteria 9387
638 Ga0496124_0000014 3300048927 Bacteria 463448
639 Ga0496124_0667132 3300048927 Bacteria 664
640 Ga0496125_0000020 3300048928 Bacteria 463448
641 Ga0496125_0043677 3300048928 Bacteria 3799
642 Ga0496125_0289468 3300048928 Bacteria 1010
643 Ga0496126_0000023 3300048929 Bacteria 463448
644 Ga0496126_0000405 3300048929 Bacteria 87676
645 Ga0496126_0002407 3300048929 Bacteria 25404
646 Ga0496126_0167307 3300048929 Bacteria 1875
647 Ga0496126_0270397 3300048929 Bacteria 1410
648 Ga0495682_0364786 3300049460 Bacteria 509
649 Ga0501032_0005263 3300049569 Bacteria 9625
650 Ga0501033_0042611 3300049570 Bacteria 3384
651 Ga0501033_0551050 3300049570 Bacteria 794
652 Ga0501033_1021025 3300049570 Bacteria 552
653 Ga0501034_0085055 3300049571 Bacteria 3164
654 Ga0501034_0396092 3300049571 Bacteria 1304
655 Ga0501036_0068453 3300049572 Bacteria 3004
656 Ga0501037_0001640 3300049573 Bacteria 16261
657 Ga0501037_0018843 3300049573 Bacteria 5085
658 Ga0501038_0070847 3300049574 Bacteria 2958
659 Ga0501038_0078441 3300049574 Bacteria 2787
660 Ga0501039_0000463 3300049575 Bacteria 29494
661 Ga0501039_0041233 3300049575 Bacteria 3564
662 Ga0501043_0000729 3300049579 Bacteria 29184
663 Ga0501043_0014082 3300049579 Bacteria 6258
664 Ga0501047_0115873 3300049581 Bacteria 2561
665 Ga0501069_0120060 3300049585 Bacteria 1501
666 Ga0501070_0019531 3300049586 Bacteria 5682
667 Ga0501070_0328335 3300049586 Bacteria 1244
668 Ga0501070_0634313 3300049586 Bacteria 849
669 Ga0501070_1146968 3300049586 Bacteria 598
670 Ga0501071_0635561 3300049587 Bacteria 821
671 Ga0501073_0954599 3300049589 Bacteria 590
672 Ga0501080_0034942 3300049742 Bacteria 4694
673 Ga0501044_0024666 3300049823 Bacteria 6380
674 Ga0501044_0043462 3300049823 Bacteria 4667
675 nmdc:mga03683_17350_c1 3300050489 Bacteria 2724
676 nmdc:mga03683_26353_c1 3300050489 Bacteria 2292
677 nmdc:mga03683_347874_c1 3300050489 Bacteria 701
678 nmdc:mga03683_56794_c1 3300050489 Bacteria 1646
679 nmdc:mga03n38_188060_c1 3300050490 Bacteria 1062
680 nmdc:mga03n38_210590_c1 3300050490 Bacteria 1010
681 nmdc:mga03n38_26976_c1 3300050490 Bacteria 2378
682 nmdc:mga03n38_30467_c1 3300050490 Bacteria 2269
683 nmdc:mga03n38_694759_c1 3300050490 Bacteria 586
684 nmdc:mga03n38_69481_c1 3300050490 Bacteria 1626
685 nmdc:mga03n38_77738_c1 3300050490 Bacteria 1552
686 nmdc:mga03n38_9881_c1 3300050490 Bacteria 3488
687 nmdc:mga00v17_224868_c1 3300050491 Bacteria 1215
688 nmdc:mga00v17_237543_c1 3300050491 Bacteria 1181
689 nmdc:mga00v17_3779_c1 3300050491 Bacteria 7820
690 nmdc:mga00v17_391107_c1 3300050491 Bacteria 904
691 nmdc:mga00v17_50490_c1 3300050491 Bacteria 2528
692 nmdc:mga00v17_55536_c1 3300050491 Bacteria 2419
693 nmdc:mga00v17_573174_c1 3300050491 Bacteria 729
694 nmdc:mga00v17_64300_c1 3300050491 Bacteria 2261
695 nmdc:mga0yw44_112789_c1 3300050492 Bacteria 1744
696 nmdc:mga0yw44_128165_c1 3300050492 Bacteria 1640
697 nmdc:mga0yw44_434757_c1 3300050492 Bacteria 889
698 nmdc:mga0yw44_974587_c1 3300050492 Bacteria 574
699 nmdc:mga06z11_2603_c1 3300050494 Bacteria 6914
700 nmdc:mga06z11_305566_c1 3300050494 Bacteria 946
701 nmdc:mga06z11_439795_c1 3300050494 Bacteria 787
702 nmdc:mga04h51_23934_c1 3300050495 Bacteria 1864
703 nmdc:mga07m45_194319_c1 3300050496 Bacteria 1180
704 nmdc:mga07m45_44007_c1 3300050496 Bacteria 2504
705 nmdc:mga05p37_907932_c1 3300050507 Bacteria 949
706 nmdc:mga0qj67_40755_c1 3300050509 Bacteria 3236
707 nmdc:mga0qj67_442911_c1 3300050509 Bacteria 1047
708 nmdc:mga08y16_1631717_c1 3300050511 Bacteria 602
709 nmdc:mga08y16_2179556_c1 3300050511 Bacteria 501
710 nmdc:mga08y16_282081_c1 3300050511 Bacteria 1713
711 nmdc:mga0sz30_11872_c2 3300050516 Bacteria 1594
712 nmdc:mga0sz30_126978_c1 3300050516 Bacteria 1123
713 nmdc:mga0sz30_17282_c1 3300050516 Bacteria 2875
714 nmdc:mga0sz30_28479_c1 3300050516 Bacteria 2300
715 nmdc:mga0sz30_353933_c1 3300050516 Bacteria 656
716 nmdc:mga0sz30_508170_c1 3300050516 Bacteria 542
717 nmdc:mga0sz30_8241_c1 3300050516 Bacteria 2529
718 Ga0500635_0039080 3300053080 Bacteria 1577
719 Ga0500635_0374954 3300053080 Bacteria 563
720 Ga0495655_0022479 3300053083 Bacteria 1442
721 Ga0500641_0032775 3300053096 Bacteria 2058
722 Ga0500650_0281304 3300053098 Bacteria 740
723 Ga0500650_0470797 3300053098 Bacteria 537
724 Ga0500556_0001822 3300053104 Bacteria 7819
725 Ga0500562_004987 3300053108 Bacteria 3343
726 Ga0500608_145283 3300053122 Bacteria 1046
727 Ga0500652_200106 3300053131 Bacteria 811
728 Ga0500568_0081761 3300053139 Bacteria 1226
729 Ga0500588_0152291 3300053146 Bacteria 837
730 Ga0500616_0018051 3300053153 Bacteria 3993
731 Ga0500620_260863 3300053155 Bacteria 573
732 Ga0500645_000054 3300053730 Bacteria 93914
733 Ga0501082_1755273 3300060353 Bacteria 541
734 Ga0466962_0012466 3300061719 Bacteria 4086
735 2738667603 2738541264 Bacteria 5935393
736 2739146673 2738541356 Bacteria 5935017
737 2791917317 2791354901 Bacteria 8322202
738 2795797515 2795385472 Bacteria 6627535
739 2842137629 2842134933 Bacteria 5847019
740 2891330416 2891326441 Bacteria 6439512
741 2929216188 2929212328 Bacteria 7708288
742 2939588285 2939582691 Bacteria 7088898
743 Ga0501032_0001368
744 LJNas_1016272
745 JGI24747J21853_1004154
746 JGI24739J22299_10159720
747 JGI24739J22299_10215373
748 JGI24743J22301_10007329
749 JGI24745J21846_1019444
750 JGI24738J21930_10097526
751 JGI24744J21845_10000384
752 JGI24744J21845_10002336
753 JGI24751J29686_10008471
754 Ga0055540_1000151
755 Ga0070658_11474406
756 Ga0070676_10017906
757 Ga0070690_100011665
758 Ga0070677_10073524
759 Ga0068869_100010233
760 Ga0068869_100017567
761 Ga0070666_10017613
762 Ga0070666_10020122
763 Ga0070680_101221992
764 Ga0070680_102002485
765 Ga0070682_100027647
766 Ga0068868_100012630
767 Ga0068868_100143878
768 Ga0070689_100031258
769 Ga0070689_100199558
770 Ga0070691_10005559
771 Ga0070691_10093318
772 Ga0070687_100291126
773 Ga0070668_100005316
774 Ga0070668_100957921
775 Ga0070668_101236270
776 Ga0070669_100010040
777 Ga0070669_100936027
778 Ga0070675_100267253
779 Ga0070671_100004714
780 Ga0070671_100098371
781 Ga0070671_100138641
782 Ga0070674_100000471
783 Ga0070674_100087597
784 Ga0070673_100270888
785 Ga0070688_100065365
786 Ga0070659_100032369
787 Ga0070659_100632852
788 Ga0070667_100000274
789 Ga0070667_100000371
790 Ga0070667_100023387
791 Ga0070667_100039705
792 Ga0070709_10051871
793 Ga0070709_10263696
794 Ga0070709_10763967
795 Ga0070714_100153459
796 Ga0070714_101413662
797 Ga0070713_100124945
798 Ga0070710_10001183
799 Ga0070710_10008757
800 Ga0070710_10546937
801 Ga0070701_10007743
802 Ga0070701_10129411
803 Ga0070711_100004159
804 Ga0070711_100005943
805 Ga0070711_102008686
806 Ga0070705_100001938
807 Ga0070705_100030690
808 Ga0070700_100006503
809 Ga0070700_100019696
810 Ga0070663_100007373
811 Ga0070678_100000482
812 Ga0070662_100050287
813 Ga0070662_100076134
814 Ga0070662_100761558
815 Ga0068867_100005184
816 Ga0070685_10018776
817 Ga0070685_10085626
818 Ga0070684_100800193
819 Ga0070697_100426985
820 Ga0068853_100007782
821 Ga0068853_100074602
822 Ga0070672_100232890
823 Ga0070672_100267480
824 Ga0070695_100007308
825 Ga0070695_100961349
826 Ga0070696_100003253
827 Ga0070696_100214684
828 Ga0070693_100062219
829 Ga0070665_100016700
830 Ga0070665_100018942
831 Ga0070665_100105520
832 Ga0070665_100222261
833 Ga0070704_100004128
834 Ga0070704_100076911
835 Ga0068855_100024963
836 Ga0068854_100022482
837 Ga0068854_100316159
838 Ga0068854_101534503
839 Ga0068854_102148772
840 Ga0068856_101849437
841 Ga0070702_100054387
842 Ga0070702_100055367
843 Ga0068852_100095931
844 Ga0068852_100136563
845 Ga0068852_100665821
846 Ga0068859_100000403
847 Ga0068864_100462505
848 Ga0068864_100708051
849 Ga0068866_10000543
850 Ga0068866_10827924
851 Ga0068861_100000669
852 Ga0068861_100093855
853 Ga0068861_100135314
854 Ga0068851_10310356
855 Ga0068870_10671972
856 Ga0068863_100000819
857 Ga0068863_100015514
858 Ga0068858_100013168
859 Ga0068858_100019774
860 Ga0068858_100503856
861 Ga0068858_100611208
862 Ga0068860_100000021
863 Ga0068860_100013961
864 Ga0068860_100101360
865 Ga0068860_100252909
866 Ga0068862_100000015
867 Ga0068862_100018680
868 Ga0068862_100437353
869 Ga0068862_101654233
870 Ga0081455_10042015
871 Ga0075365_10000912
872 Ga0075365_10042914
873 Ga0075365_10155264
874 Ga0075368_10083548
875 Ga0075368_10438905
876 Ga0075363_100000562
877 Ga0075363_100001882
878 Ga0075363_100032046
879 Ga0075363_100044729
880 Ga0075363_100086478
881 Ga0075363_100201733
882 Ga0075363_100230445
883 Ga0075363_100263218
884 Ga0075363_100282839
885 Ga0075363_100529343
886 Ga0075363_100792022
887 Ga0075363_100815190
888 Ga0075363_100828113
889 Ga0075363_100976166
890 Ga0075364_10001654
891 Ga0075364_10019122
892 Ga0075364_10026758
893 Ga0075364_10033924
894 Ga0070716_100037621
895 Ga0070716_100112731
896 Ga0070716_100598007
897 Ga0070712_100007493
898 Ga0070712_100164111
899 Ga0070712_100501817
900 Ga0070712_101874362
901 Ga0075362_10005080
902 Ga0075362_10017759
903 Ga0075362_10080687
904 Ga0075362_10237554
905 Ga0075367_10054826
906 Ga0075367_10231110
907 Ga0075367_10368001
908 Ga0075369_10020343
909 Ga0075369_10142741
910 Ga0075369_10153029
911 Ga0075369_10348430
912 Ga0075369_10547981
913 Ga0075369_10582440
914 Ga0097621_100393930
915 Ga0097621_101133968
916 Ga0075370_10096362
917 Ga0075370_10181310
918 Ga0068871_100121745
919 Ga0068871_100282175
920 Ga0075428_100011043
921 Ga0075430_100222984
922 Ga0075434_100777441
923 Ga0068865_100007710
924 Ga0068865_100720282
925 Ga0097620_100000403
926 Ga0105244_10323231
927 Ga0105250_10055484
928 Ga0105250_10172611
929 Ga0105240_10536423
930 Ga0111539_10456714
931 Ga0111539_10938170
932 Ga0111539_11649274
933 Ga0105245_10016502
934 Ga0105245_10552727
935 Ga0105245_11611266
936 Ga0105247_10000035
937 Ga0105247_10004239
938 Ga0105247_10023636
939 Ga0105247_10089184
940 Ga0105247_10468247
941 Ga0105243_10015883
942 Ga0105243_10103835
943 Ga0105243_10156815
944 Ga0105241_10013618
945 Ga0105241_10091929
946 Ga0105242_10005281
947 Ga0105242_10235858
948 Ga0105248_10000068
949 Ga0105248_10023741
950 Ga0105248_10103663
951 Ga0105248_10267448
952 Ga0105237_10094190
953 Ga0105237_10117250
954 Ga0105237_10189429
955 Ga0105237_11417844
956 Ga0105238_10445912
957 Ga0105249_10000071
958 Ga0105249_10006387
959 Ga0105249_10007034
960 Ga0105249_10076221
961 Ga0105249_11327463
962 Ga0105033_106456
963 Ga0099796_10018948
964 Ga0105239_10021453
965 Ga0105239_10761823
966 Ga0105239_10785681
967 Ga0105239_10851455
968 Ga0105239_11535002
969 Ga0105246_10007388
970 Ga0157371_10069766
971 Ga0157369_10743454
972 Ga0157369_12053153
973 Ga0157374_10008857
974 Ga0157374_10220190
975 Ga0157378_10004183
976 Ga0157378_12727066
977 Ga0163162_10016658
978 Ga0163162_10416658
979 Ga0163162_10925671
980 Ga0163162_11665107
981 Ga0157372_10014174
982 Ga0157372_10096426
983 Ga0157375_10006410
984 Ga0157375_10717883
985 Ga0157375_11061803
986 Ga0163163_10031415
987 Ga0163163_10516494
988 Ga0163163_11004096
989 Ga0163163_12082010
990 Ga0157380_10005706
991 Ga0157380_10146739
992 Ga0157380_10309057
993 Ga0157377_10116608
994 Ga0157377_10150996
995 Ga0157379_10022652
996 Ga0157379_11079868
997 Ga0157379_11156689
998 Ga0157379_11752815
999 Ga0157376_10798029
1000 Ga0163161_10006448
1001 Ga0163161_10155188
1002 Ga0163161_10202512
1003 Ga0163161_10740278
1004 Ga0213876_10001986
1005 Ga0213876_10083091
1006 Ga0213875_10005978
1007 Ga0209051_1000075
1008 Ga0209051_1011850
1009 Ga0207692_10008190
1010 Ga0207692_10040326
1011 Ga0207692_10348277
1012 Ga0207642_10003931
1013 Ga0207642_10522069
1014 Ga0207710_10000056
1015 Ga0207710_10002826
1016 Ga0207710_10022529
1017 Ga0207688_10005401
1018 Ga0207688_10005445
1019 Ga0207680_10029960
1020 Ga0207680_10054129
1021 Ga0207647_10168630
1022 Ga0207685_10015524
1023 Ga0207685_10039614
1024 Ga0207685_10136969
1025 Ga0207699_10026146
1026 Ga0207699_10289509
1027 Ga0207699_10570909
1028 Ga0207699_10773070
1029 Ga0207645_10122451
1030 Ga0207645_10180653
1031 Ga0207684_10677005
1032 Ga0207654_10246078
1033 Ga0207671_10089879
1034 Ga0207671_10096492
1035 Ga0207671_10140690
1036 Ga0207671_11154217
1037 Ga0207693_10002793
1038 Ga0207693_10006050
1039 Ga0207693_10594871
1040 Ga0207663_10792746
1041 Ga0207660_11174105
1042 Ga0207662_10058577
1043 Ga0207646_10889284
1044 Ga0207681_10019336
1045 Ga0207681_10039177
1046 Ga0207681_10260816
1047 Ga0207694_11842997
1048 Ga0207659_10047380
1049 Ga0207659_10088520
1050 Ga0207687_10010537
1051 Ga0207687_10317744
1052 Ga0207664_10011563
1053 Ga0207664_11172360
1054 Ga0207644_10035412
1055 Ga0207644_10481585
1056 Ga0207644_10672646
1057 Ga0207690_10016924
1058 Ga0207690_10445877
1059 Ga0207706_10010136
1060 Ga0207706_10591724
1061 Ga0207706_11083943
1062 Ga0207686_10085973
1063 Ga0207686_10713252
1064 Ga0207709_10009385
1065 Ga0207709_11131303
1066 Ga0207669_10004012
1067 Ga0207669_11519240
1068 Ga0207704_10000983
1069 Ga0207704_10063635
1070 Ga0207704_11143546
1071 Ga0207665_10002392
1072 Ga0207665_10066836
1073 Ga0207691_10227694
1074 Ga0207691_10239425
1075 Ga0207711_10000148
1076 Ga0207711_10046263
1077 Ga0207711_10186838
1078 Ga0207711_10828275
1079 Ga0207711_11214530
1080 Ga0207689_10009412
1081 Ga0207689_10039864
1082 Ga0207667_10062050
1083 Ga0207667_10540811
1084 Ga0207712_10000028
1085 Ga0207712_10011053
1086 Ga0207712_10251912
1087 Ga0207712_10495393
1088 Ga0207712_11382009
1089 Ga0207668_10000864
1090 Ga0207668_10011975
1091 Ga0207668_10515473
1092 Ga0207668_10673282
1093 Ga0207668_10880239
1094 Ga0207640_10016693
1095 Ga0207640_11333293
1096 Ga0207658_10000488
1097 Ga0207658_10004684
1098 Ga0207658_10018993
1099 Ga0207658_10745848
1100 Ga0207677_10015951
1101 Ga0207677_10143250
1102 Ga0207703_10028567
1103 Ga0207703_10041922
1104 Ga0207703_10096255
1105 Ga0207703_10416999
1106 Ga0207639_10042258
1107 Ga0207678_10045683
1108 Ga0207678_10077643
1109 Ga0207708_10010629
1110 Ga0207641_10000791
1111 Ga0207641_10465804
1112 Ga0207641_10918362
1113 Ga0207648_10001183
1114 Ga0207648_10010215
1115 Ga0207676_10352239
1116 Ga0207676_10544602
1117 Ga0207675_100001210
1118 Ga0207675_100035530
1119 Ga0207675_100650431
1120 Ga0207683_10000829
1121 Ga0207683_10067401
1122 Ga0207683_11308993
1123 Ga0207698_10033054
1124 Ga0207698_10197010
1125 Ga0209813_10027753
1126 Ga0207428_10488222
1127 Ga0268266_10024879
1128 Ga0268266_10057001
1129 Ga0268266_10211631
1130 Ga0268266_10591401
1131 Ga0268265_10000023
1132 Ga0268265_10131530
1133 Ga0268264_10000099
1134 Ga0268264_10010708
1135 Ga0268264_10092926
1136 Ga0268264_10408052
1137 Ga0268264_11884714
1138 Ga0316575_10321069
1139 Ga0307413_10150098
1140 Ga0307413_10181573
1141 Ga0307410_10411494
1142 Ga0307410_10826556
1143 Ga0307410_11029661
1144 Ga0307406_10652271
1145 Ga0307409_100150652
1146 Ga0307409_100646408
1147 Ga0307416_101787601
1148 Ga0307411_10318434
1149 Ga0307411_12045117
1150 Ga0373949_0023602
1151 Ga0373951_0166626
1152 Ga0373952_0070379
1153 Ga0373939_0264750
1154 Ga0373961_0446500
1155 Ga0373962_0105329
1156 Ga0316574_0469279
1157 Ga0373931_0017246
1158 Ga0373931_0108923
1159 Ga0373947_1035688
1160 Ga0373937_0811091
1161 Ga0316584_0089104
1162 Ga0395900_1102949
1163 Ga0395898_1180656
1164 Ga0436364_0642997
1165 Ga0436364_1150132
1166 Ga0436365_0394011
1167 Ga0436365_0909784
1168 Ga0436361_0148105
1169 Ga0436363_1168634
1170 Ga0439461_0003355
1171 Ga0439466_0014662
1172 Ga0439466_0023181
1173 Ga0439465_0000264
1174 Ga0439465_0000787
1175 Ga0439465_0014659
1176 Ga0451802_0503932
1177 Ga0439431_0048379
1178 Ga0439431_0222480
1179 Ga0439442_002003
1180 Ga0439445_0001816
1181 Ga0439445_0081522
1182 Ga0439448_0079711
1183 Ga0439458_0186458
1184 Ga0439459_0008240
1185 Ga0466969_0065621
1186 Ga0466969_0158409
1187 Ga0466972_0006727
1188 Ga0466972_0055131
1189 Ga0466965_0034163
1190 Ga0466965_0099048
1191 Ga0466965_0122295
1192 Ga0466965_0547847
1193 Ga0466965_0692835
1194 Ga0466966_0003401
1195 Ga0466966_0014397
1196 Ga0466966_0251832
1197 Ga0466961_0004337
1198 Ga0466961_0006078
1199 Ga0466961_0008790
1200 Ga0466961_0044799
1201 Ga0466963_0051800
1202 Ga0466963_0068969
1203 Ga0466963_0115525
1204 Ga0466964_0106114
1205 Ga0466964_0124006
1206 Ga0466971_0054934
1207 Ga0466971_0192764
1208 Ga0466971_0456594
1209 Ga0466968_0012840
1210 Ga0466968_0023669
1211 Ga0466968_0095492
1212 Ga0466968_0250501
1213 Ga0466968_0263429
1214 Ga0466970_0012130
1215 Ga0466970_0014825
1216 Ga0466970_0030508
1217 Ga0466970_0123881
1218 Ga0466970_0706219
1219 Ga0466957_0008941
1220 Ga0466957_0031991
1221 Ga0466957_0120448
1222 Ga0466957_0289480
1223 Ga0466957_0520076
1224 Ga0466960_0013545
1225 Ga0466960_0249708
1226 Ga0466960_0335664
1227 Ga0466959_0000580
1228 Ga0466959_0011603
1229 Ga0466959_0032062
1230 Ga0466959_0034407
1231 Ga0466959_0086113
1232 Ga0466959_0687020
1233 Ga0466958_0007481
1234 Ga0466958_0011253
1235 Ga0466958_0032025
1236 Ga0466958_0115749
1237 Ga0466967_0116590
1238 Ga0466967_0225567
1239 Ga0466967_0279735
1240 Ga0466967_0501164
1241 Ga0466967_0765459
1242 Ga0466967_0944273
1243 Ga0466967_1656078
1244 Ga0466967_1812986
1245 Ga0466967_2082913
1246 Ga0495603_0080944
1247 Ga0495629_0368608
1248 Ga0495638_0016738
1249 Ga0495638_0021481
1250 Ga0495641_0020349
1251 Ga0495605_0490136
1252 Ga0495662_0181276
1253 Ga0495664_0837713
1254 Ga0495594_0088283
1255 Ga0495648_0002587
1256 Ga0495665_0023610
1257 Ga0495587_0376632
1258 Ga0495667_0593356
1259 Ga0495668_0013760
1260 Ga0495668_0485841
1261 Ga0495611_0018048
1262 Ga0495599_0882776
1263 Ga0495647_0350749
1264 Ga0495658_0025053
1265 Ga0495624_0081501
1266 Ga0495649_0229380
1267 Ga0495649_0229384
1268 Ga0495581_0031631
1269 Ga0495672_0021390
1270 Ga0495672_0029418
1271 Ga0495672_0129564
1272 Ga0495676_0739363
1273 Ga0495593_0011932
1274 Ga0495614_0027546
1275 Ga0496100_0000092
1276 Ga0496100_0006517
1277 Ga0496100_0029292
1278 Ga0496100_0116386
1279 Ga0496100_0143184
1280 Ga0496101_0000018
1281 Ga0496101_0000019
1282 Ga0496101_0007988
1283 Ga0496101_0092097
1284 Ga0496101_0123725
1285 Ga0496101_0608479
1286 Ga0496102_0000007
1287 Ga0496102_0000899
1288 Ga0496102_0011290
1289 Ga0496102_0011416
1290 Ga0496102_0022524
1291 Ga0496102_0097079
1292 Ga0496102_0100973
1293 Ga0496102_0440745
1294 Ga0496102_1016481
1295 Ga0496102_1601619
1296 Ga0496103_0000013
1297 Ga0496103_0000628
1298 Ga0496103_0001247
1299 Ga0496103_0002674
1300 Ga0496103_0073296
1301 Ga0496103_0108455
1302 Ga0496103_0360316
1303 Ga0496104_0005479
1304 Ga0496104_0086248
1305 Ga0496104_0729683
1306 Ga0496104_1408516
1307 Ga0496104_1711489
1308 Ga0496105_0051031
1309 Ga0496105_0059238
1310 Ga0496105_0370681
1311 Ga0496106_0004521
1312 Ga0496106_0005617
1313 Ga0496106_0013092
1314 Ga0496106_0016376
1315 Ga0496106_0040603
1316 Ga0496106_0373870
1317 Ga0496106_0401759
1318 Ga0496107_0002855
1319 Ga0496107_0002921
1320 Ga0496107_0004926
1321 Ga0496107_0012604
1322 Ga0496107_0072441
1323 Ga0496107_0098037
1324 Ga0496107_0524983
1325 Ga0496108_0015858
1326 Ga0496108_0207729
1327 Ga0496108_0294530
1328 Ga0496108_0365744
1329 Ga0496108_0682763
1330 Ga0496109_0001095
1331 Ga0496109_0016533
1332 Ga0496109_0118396
1333 Ga0496109_0143510
1334 Ga0496109_1069386
1335 Ga0496109_1335304
1336 Ga0496110_0184308
1337 Ga0496110_0234021
1338 Ga0496110_0336503
1339 Ga0496111_0046738
1340 Ga0496111_0590730
1341 Ga0496112_0059454
1342 Ga0496112_0089501
1343 Ga0496112_0097231
1344 Ga0496112_0269747
1345 Ga0496112_0425037
1346 Ga0496113_0126330
1347 Ga0496113_0226019
1348 Ga0496113_0441334
1349 Ga0496113_0446720
1350 Ga0496114_0000914
1351 Ga0496114_0002653
1352 Ga0496114_0013296
1353 Ga0496114_0201599
1354 Ga0496114_0293913
1355 Ga0496114_1361922
1356 Ga0496115_0002286
1357 Ga0496115_0007649
1358 Ga0496115_0014860
1359 Ga0496115_1168681
1360 Ga0496116_0000033
1361 Ga0496116_0002421
1362 Ga0496116_0022715
1363 Ga0496117_0000025
1364 Ga0496117_0000383
1365 Ga0496117_0013077
1366 Ga0496118_0000023
1367 Ga0496118_0003915
1368 Ga0496118_0044630
1369 Ga0496119_0000403
1370 Ga0496119_0004838
1371 Ga0496119_0006841
1372 Ga0496120_0000798
1373 Ga0496120_0005464
1374 Ga0496120_0471730
1375 Ga0496121_0000023
1376 Ga0496121_0000039
1377 Ga0496121_0003281
1378 Ga0496122_0000164
1379 Ga0496123_0008548
1380 Ga0496124_0000014
1381 Ga0496124_0667132
1382 Ga0496125_0000020
1383 Ga0496125_0043677
1384 Ga0496125_0289468
1385 Ga0496126_0000023
1386 Ga0496126_0000405
1387 Ga0496126_0002407
1388 Ga0496126_0167307
1389 Ga0496126_0270397
1390 Ga0495682_0364786
1391 Ga0501032_0005263
1392 Ga0501033_0042611
1393 Ga0501033_0551050
1394 Ga0501033_1021025
1395 Ga0501034_0085055
1396 Ga0501034_0396092
1397 Ga0501036_0068453
1398 Ga0501037_0001640
1399 Ga0501037_0018843
1400 Ga0501038_0070847
1401 Ga0501038_0078441
1402 Ga0501039_0000463
1403 Ga0501039_0041233
1404 Ga0501043_0000729
1405 Ga0501043_0014082
1406 Ga0501047_0115873
1407 Ga0501069_0120060
1408 Ga0501070_0019531
1409 Ga0501070_0328335
1410 Ga0501070_0634313
1411 Ga0501070_1146968
1412 Ga0501071_0635561
1413 Ga0501073_0954599
1414 Ga0501080_0034942
1415 Ga0501044_0024666
1416 Ga0501044_0043462
1417 nmdc:mga03683_17350_c1
1418 nmdc:mga03683_26353_c1
1419 nmdc:mga03683_347874_c1
1420 nmdc:mga03683_56794_c1
1421 nmdc:mga03n38_188060_c1
1422 nmdc:mga03n38_210590_c1
1423 nmdc:mga03n38_26976_c1
1424 nmdc:mga03n38_30467_c1
1425 nmdc:mga03n38_694759_c1
1426 nmdc:mga03n38_69481_c1
1427 nmdc:mga03n38_77738_c1
1428 nmdc:mga03n38_9881_c1
1429 nmdc:mga00v17_224868_c1
1430 nmdc:mga00v17_237543_c1
1431 nmdc:mga00v17_3779_c1
1432 nmdc:mga00v17_391107_c1
1433 nmdc:mga00v17_50490_c1
1434 nmdc:mga00v17_55536_c1
1435 nmdc:mga00v17_573174_c1
1436 nmdc:mga00v17_64300_c1
1437 nmdc:mga0yw44_112789_c1
1438 nmdc:mga0yw44_128165_c1
1439 nmdc:mga0yw44_434757_c1
1440 nmdc:mga0yw44_974587_c1
1441 nmdc:mga06z11_2603_c1
1442 nmdc:mga06z11_305566_c1
1443 nmdc:mga06z11_439795_c1
1444 nmdc:mga04h51_23934_c1
1445 nmdc:mga07m45_194319_c1
1446 nmdc:mga07m45_44007_c1
1447 nmdc:mga05p37_907932_c1
1448 nmdc:mga0qj67_40755_c1
1449 nmdc:mga0qj67_442911_c1
1450 nmdc:mga08y16_1631717_c1
1451 nmdc:mga08y16_2179556_c1
1452 nmdc:mga08y16_282081_c1
1453 nmdc:mga0sz30_11872_c2
1454 nmdc:mga0sz30_126978_c1
1455 nmdc:mga0sz30_17282_c1
1456 nmdc:mga0sz30_28479_c1
1457 nmdc:mga0sz30_353933_c1
1458 nmdc:mga0sz30_508170_c1
1459 nmdc:mga0sz30_8241_c1
1460 Ga0500635_0039080
1461 Ga0500635_0374954
1462 Ga0495655_0022479
1463 Ga0500641_0032775
1464 Ga0500650_0281304
1465 Ga0500650_0470797
1466 Ga0500556_0001822
1467 Ga0500562_004987
1468 Ga0500608_145283
1469 Ga0500652_200106
1470 Ga0500568_0081761
1471 Ga0500588_0152291
1472 Ga0500616_0018051
1473 Ga0500620_260863
1474 Ga0500645_000054
1475 Ga0501082_1755273
1476 Ga0466962_0012466
1477 2738667603
1478 2739146673
1479 2791917317
1480 2795797515
1481 2842137629
1482 2891330416
1483 2929216188
1484 2939588285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

3

79

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.9535 2 93
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.888 2 93
7bfd-assembly1.cif.gz_K circular permutant of ribosomal protein s6, p54-55 truncated, y4a mutant. 0.7607 4 90
7bfg-assembly1.cif.gz_I circular permutant of ribosomal protein s6, p54-55 truncated, v37a mutant. 0.7591 4 90
3zzp-assembly1.cif.gz_A circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6. 0.7576 5 76
ID Description Score Start End Superfamily
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9831 1 97 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9731 1 97 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9536 2 93 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8881 2 93 3.30.70.1120
3zzpA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.7576 5 76 3.30.70.60
ID Description Score Start End GO Terms
AF-L7F587-F1-model_v4 DUF503 domain-containing protein 0.9944 2 93
AF-V7N371-F1-model_v4 deleted 0.9942 2 95
AF-A0A6A0CBM8-F1-model_v4 deleted 0.9942 2 93
AF-E3J040-F1-model_v4 DUF503 domain-containing protein 0.9918 1 94
AF-A0A2K4YCR0-F1-model_v4 DUF503 domain-containing protein 0.9889 2 95

Map