F478652

General Info

Members Datasets Scaffolds Average Seq Length
742 374 734 164

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0003148|Ga0439436_0003148_4412_4975
Length 187
Sequence LRFARGRAKVRRTMSAIPNDPHPFPLEGGCTCRAVRYRMTTRPLFVHCCHCRWCQRETGSAFALNAMIEADRVQLLQCEIELVATPSASGKGQKIARCPHCRVALWSHYAGAGDAVCFVRVGTLDAPDHLPPDIHIFTMSKQPWVLLPPGTPAVAEYYSRAEHWPAESLARARALKASRPPAGPTAA

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221652 Acidovorax sp. Root402 Isolate Unclassified
3 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
4 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
5 2904456579 Variovorax sp. 2002 Isolate Unclassified
6 2906610324
7 2929520902 Variovorax beijingensis 502 Isolate Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
229 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
234 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
235 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
236 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
237 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
238 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
239 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
240 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
243 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
244 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
249 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
252 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
253 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
254 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
255 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
256 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
257 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
361 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
364 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
371 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.27
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0
Rhizoplane 4.18
Rhizosphere 85.18
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10055306 3300003203 Bacteria 1308
2 JGI25404J52841_10018468 3300003659 Bacteria 1511
3 Ga0055536_1008437 3300003781 Bacteria 4424
4 Ga0055540_1001803 3300003792 Bacteria 12167
5 JGI25405J52794_10060666 3300003911 Bacteria 818
6 Ga0065704_10096637 3300005289 Bacteria 2431
7 Ga0070658_10004903 3300005327 Bacteria 10905
8 Ga0070658_10292523 3300005327 Bacteria 1388
9 Ga0070676_10008737 3300005328 Bacteria 5466
10 Ga0070683_100060012 3300005329 Bacteria 3534
11 Ga0070683_100065267 3300005329 Bacteria 3389
12 Ga0070683_100093284 3300005329 Bacteria 2828
13 Ga0070690_100104351 3300005330 Bacteria 1883
14 Ga0070670_100136543 3300005331 Bacteria 2119
15 Ga0070670_100611844 3300005331 Bacteria 975
16 Ga0070670_100932427 3300005331 Bacteria 788
17 Ga0068869_100003076 3300005334 Bacteria 10155
18 Ga0070666_10260613 3300005335 Bacteria 1229
19 Ga0070680_100043420 3300005336 Bacteria 3652
20 Ga0070680_100572697 3300005336 Bacteria 968
21 Ga0070682_100022201 3300005337 Bacteria 3756
22 Ga0070682_100434821 3300005337 Bacteria 1001
23 Ga0070682_100605306 3300005337 Bacteria 866
24 Ga0068868_100006730 3300005338 Bacteria 8160
25 Ga0068868_100088596 3300005338 Bacteria 2491
26 Ga0070660_100040061 3300005339 Bacteria 3564
27 Ga0070660_100319412 3300005339 Bacteria 1275
28 Ga0070687_100390302 3300005343 Bacteria 910
29 Ga0070661_100008214 3300005344 Bacteria 7201
30 Ga0070661_100069065 3300005344 Bacteria 2597
31 Ga0070661_100116416 3300005344 Bacteria 1999
32 Ga0070692_10311318 3300005345 Bacteria 965
33 Ga0070668_100009361 3300005347 Bacteria 7266
34 Ga0070668_100094910 3300005347 Bacteria 2355
35 Ga0070668_100628639 3300005347 Bacteria 942
36 Ga0070669_100032735 3300005353 Bacteria 3756
37 Ga0070669_100449332 3300005353 Bacteria 1062
38 Ga0070669_100581184 3300005353 Bacteria 937
39 Ga0070675_100001332 3300005354 Bacteria 18063
40 Ga0070675_100009544 3300005354 Bacteria 7549
41 Ga0070675_100145716 3300005354 Bacteria 2027
42 Ga0070671_100370767 3300005355 Bacteria 1223
43 Ga0070671_100565684 3300005355 Bacteria 981
44 Ga0070674_100617468 3300005356 Bacteria 918
45 Ga0070674_100934981 3300005356 Bacteria 757
46 Ga0070673_100019233 3300005364 Bacteria 4902
47 Ga0070673_100274085 3300005364 Bacteria 1478
48 Ga0070688_100156917 3300005365 Bacteria 1560
49 Ga0070659_100006591 3300005366 Bacteria 8385
50 Ga0070659_100021473 3300005366 Bacteria 4917
51 Ga0070659_100029753 3300005366 Bacteria 4221
52 Ga0070667_100151577 3300005367 Bacteria 2037
53 Ga0070667_100184786 3300005367 Bacteria 1845
54 Ga0070667_100222687 3300005367 Bacteria 1680
55 Ga0070667_100331904 3300005367 Bacteria 1374
56 Ga0070709_10154543 3300005434 Bacteria 1589
57 Ga0070714_100179753 3300005435 Bacteria 1924
58 Ga0070713_100094954 3300005436 Bacteria 2571
59 Ga0070713_100229022 3300005436 Bacteria 1689
60 Ga0070701_10155143 3300005438 Bacteria 1322
61 Ga0070705_100389088 3300005440 Bacteria 1029
62 Ga0070694_100444842 3300005444 Bacteria 1022
63 Ga0070663_100004462 3300005455 Bacteria 8235
64 Ga0070678_100020170 3300005456 Bacteria 4368
65 Ga0070678_100200248 3300005456 Bacteria 1647
66 Ga0070662_100001945 3300005457 Bacteria 12698
67 Ga0070662_100074926 3300005457 Bacteria 2505
68 Ga0070662_100087750 3300005457 Bacteria 2330
69 Ga0070681_10001057 3300005458 Bacteria 23417
70 Ga0070681_10043520 3300005458 Bacteria 4498
71 Ga0070681_10235580 3300005458 Bacteria 1744
72 Ga0070681_10339154 3300005458 Bacteria 1413
73 Ga0070681_10361123 3300005458 Bacteria 1363
74 Ga0070681_10420942 3300005458 Bacteria 1248
75 Ga0068867_100224621 3300005459 Bacteria 1515
76 Ga0068867_100698835 3300005459 Bacteria 895
77 Ga0070706_100091293 3300005467 Bacteria 2824
78 Ga0070698_100001208 3300005471 Bacteria 28691
79 Ga0070699_100128414 3300005518 Bacteria 2234
80 Ga0070679_100002239 3300005530 Bacteria 17474
81 Ga0070679_100027302 3300005530 Bacteria 5617
82 Ga0070679_100062734 3300005530 Bacteria 3705
83 Ga0070679_100071601 3300005530 Bacteria 3457
84 Ga0070679_100248698 3300005530 Bacteria 1734
85 Ga0070684_100028635 3300005535 Bacteria 4713
86 Ga0070684_100051865 3300005535 Bacteria 3565
87 Ga0070684_100210190 3300005535 Bacteria 1773
88 Ga0070684_101355003 3300005535 Bacteria 670
89 Ga0070697_100275317 3300005536 Bacteria 1443
90 Ga0068853_100030678 3300005539 Bacteria 4542
91 Ga0068853_100034435 3300005539 Bacteria 4299
92 Ga0068853_100073542 3300005539 Bacteria 2980
93 Ga0068853_100199327 3300005539 Bacteria 1821
94 Ga0068853_100691977 3300005539 Bacteria 972
95 Ga0068853_100885602 3300005539 Bacteria 857
96 Ga0070672_100008896 3300005543 Bacteria 6897
97 Ga0070672_100062557 3300005543 Bacteria 2937
98 Ga0070672_100070593 3300005543 Bacteria 2776
99 Ga0070672_100851877 3300005543 Bacteria 804
100 Ga0070695_100022143 3300005545 Bacteria 3896
101 Ga0070693_100015270 3300005547 Bacteria 3952
102 Ga0070665_100046991 3300005548 Bacteria 4333
103 Ga0070665_101486032 3300005548 Bacteria 686
104 Ga0070704_100457546 3300005549 Bacteria 1100
105 Ga0068855_100008812 3300005563 Bacteria 12194
106 Ga0068855_100031980 3300005563 Bacteria 6282
107 Ga0068855_100049234 3300005563 Bacteria 4971
108 Ga0068855_100051023 3300005563 Bacteria 4874
109 Ga0068855_100118175 3300005563 Bacteria 3037
110 Ga0068855_100379473 3300005563 Bacteria 1552
111 Ga0068855_100831048 3300005563 Bacteria 980
112 Ga0070664_100086137 3300005564 Bacteria 2714
113 Ga0070664_100154124 3300005564 Bacteria 2029
114 Ga0068857_100059280 3300005577 Bacteria 3400
115 Ga0068857_100159007 3300005577 Bacteria 2050
116 Ga0068854_100006691 3300005578 Bacteria 7347
117 Ga0068854_100062380 3300005578 Bacteria 2702
118 Ga0068856_100004796 3300005614 Bacteria 13406
119 Ga0068856_100052398 3300005614 Bacteria 4024
120 Ga0068856_100085508 3300005614 Bacteria 3133
121 Ga0068856_100149251 3300005614 Bacteria 2346
122 Ga0068856_100236682 3300005614 Bacteria 1841
123 Ga0068856_100432497 3300005614 Bacteria 1336
124 Ga0070702_100224909 3300005615 Bacteria 1257
125 Ga0068852_100000615 3300005616 Bacteria 23368
126 Ga0068852_100001686 3300005616 Bacteria 15048
127 Ga0068852_100085852 3300005616 Bacteria 2804
128 Ga0068852_100275740 3300005616 Bacteria 1620
129 Ga0068852_100380885 3300005616 Bacteria 1384
130 Ga0068852_101033626 3300005616 Bacteria 841
131 Ga0068859_100219748 3300005617 Bacteria 1987
132 Ga0068859_100305303 3300005617 Bacteria 1685
133 Ga0068864_100028438 3300005618 Bacteria 4725
134 Ga0068864_100806211 3300005618 Bacteria 923
135 Ga0068861_100000384 3300005719 Bacteria 25460
136 Ga0068861_100019833 3300005719 Bacteria 4806
137 Ga0068861_100227768 3300005719 Bacteria 1579
138 Ga0068851_10008669 3300005834 Bacteria 4709
139 Ga0068851_10034847 3300005834 Bacteria 2514
140 Ga0068870_10125636 3300005840 Bacteria 1483
141 Ga0068858_100027002 3300005842 Bacteria 5333
142 Ga0068858_100045670 3300005842 Bacteria 4060
143 Ga0068860_100007870 3300005843 Bacteria 10641
144 Ga0068860_100021841 3300005843 Bacteria 6192
145 Ga0068860_100355931 3300005843 Bacteria 1441
146 Ga0068862_100127742 3300005844 Bacteria 2246
147 Ga0068862_100241341 3300005844 Bacteria 1643
148 Ga0068862_100305993 3300005844 Bacteria 1464
149 Ga0068862_101105251 3300005844 Bacteria 788
150 Ga0081455_10001734 3300005937 Bacteria 26379
151 Ga0081455_10017747 3300005937 Bacteria 6807
152 Ga0081455_10063978 3300005937 Bacteria 3083
153 Ga0081455_10667880 3300005937 Bacteria 666
154 Ga0081540_1001682 3300005983 Bacteria 18799
155 Ga0081540_1040152 3300005983 Bacteria 2443
156 Ga0081539_10000001 3300005985 Bacteria 808331
157 Ga0081539_10001294 3300005985 Bacteria 43916
158 Ga0081539_10001470 3300005985 Bacteria 39952
159 Ga0081539_10041426 3300005985 Bacteria 2692
160 Ga0081539_10275840 3300005985 Bacteria 734
161 Ga0070717_10056285 3300006028 Bacteria 3248
162 Ga0070717_10826012 3300006028 Bacteria 843
163 Ga0070717_11199538 3300006028 Bacteria 691
164 Ga0075368_10192414 3300006042 Bacteria 862
165 Ga0075362_10007616 3300006177 Bacteria 4113
166 Ga0075362_10015283 3300006177 Bacteria 3119
167 Ga0075362_10039087 3300006177 Bacteria 2085
168 Ga0075362_10165403 3300006177 Bacteria 1067
169 Ga0075367_10142406 3300006178 Bacteria 1485
170 Ga0075367_10198578 3300006178 Bacteria 1253
171 Ga0075369_10005411 3300006186 Bacteria 4770
172 Ga0075369_10194647 3300006186 Bacteria 935
173 Ga0097621_100190080 3300006237 Bacteria 1778
174 Ga0097621_100524986 3300006237 Bacteria 1075
175 Ga0097621_101206025 3300006237 Bacteria 713
176 Ga0075370_10012362 3300006353 Bacteria 4510
177 Ga0068871_100036905 3300006358 Bacteria 3894
178 Ga0068871_100129082 3300006358 Bacteria 2142
179 Ga0068871_100192582 3300006358 Bacteria 1757
180 Ga0068871_101320468 3300006358 Bacteria 679
181 Ga0075428_100001751 3300006844 Bacteria 23186
182 Ga0075433_10099961 3300006852 Bacteria 2568
183 Ga0075433_10100388 3300006852 Bacteria 2562
184 Ga0075434_100000816 3300006871 Bacteria 24729
185 Ga0075434_100195892 3300006871 Bacteria 2040
186 Ga0075434_100419668 3300006871 Bacteria 1359
187 Ga0075434_100467802 3300006871 Unclassified 1282
188 Ga0068865_100019910 3300006881 Bacteria 4347
189 Ga0075436_100487470 3300006914 Bacteria 901
190 Ga0097620_100219755 3300006931 Bacteria 1987
191 Ga0097620_100305324 3300006931 Bacteria 1685
192 Ga0097620_101859227 3300006931 Bacteria 665
193 Ga0075435_100027706 3300007076 Bacteria 4435
194 Ga0075435_100484954 3300007076 Bacteria 1068
195 Ga0075435_100838637 3300007076 Bacteria 801
196 Ga0105251_10306120 3300009011 Bacteria 721
197 Ga0105244_10078389 3300009036 Bacteria 1638
198 Ga0105240_10004485 3300009093 Bacteria 21237
199 Ga0105240_10005388 3300009093 Bacteria 19075
200 Ga0105240_10520545 3300009093 Bacteria 1320
201 Ga0111539_10004025 3300009094 Bacteria 19296
202 Ga0111539_11133167 3300009094 Bacteria 909
203 Ga0105245_10021575 3300009098 Bacteria 5652
204 Ga0105247_10391516 3300009101 Bacteria 988
205 Ga0114129_10004052 3300009147 Bacteria 20681
206 Ga0105243_10001608 3300009148 Bacteria 19691
207 Ga0105241_10003669 3300009174 Bacteria 11403
208 Ga0105241_10067234 3300009174 Bacteria 2773
209 Ga0105241_10070482 3300009174 Bacteria 2712
210 Ga0105241_10279328 3300009174 Bacteria 1425
211 Ga0105248_10007485 3300009177 Bacteria 11977
212 Ga0105248_10251994 3300009177 Bacteria 1987
213 Ga0105237_10126533 3300009545 Bacteria 2550
214 Ga0105237_10223013 3300009545 Bacteria 1885
215 Ga0105237_10312041 3300009545 Bacteria 1576
216 Ga0105238_10005726 3300009551 Bacteria 12285
217 Ga0105238_10010115 3300009551 Bacteria 9456
218 Ga0105238_10027853 3300009551 Bacteria 5758
219 Ga0105238_10041404 3300009551 Bacteria 4665
220 Ga0105238_11012070 3300009551 Bacteria 852
221 Ga0105249_10113389 3300009553 Bacteria 2565
222 Ga0105030_100276 3300009987 Bacteria 4454
223 Ga0105239_10081049 3300010375 Bacteria 3572
224 Ga0157347_1011671 3300012502 Bacteria 937
225 Ga0157373_10010816 3300013100 Bacteria 6717
226 Ga0157373_10072075 3300013100 Bacteria 2439
227 Ga0157371_10054153 3300013102 Bacteria 2849
228 Ga0157371_10958005 3300013102 Bacteria 651
229 Ga0157370_10006388 3300013104 Bacteria 13010
230 Ga0157370_10010672 3300013104 Bacteria 9663
231 Ga0157370_10140960 3300013104 Bacteria 2246
232 Ga0157370_10749837 3300013104 Bacteria 890
233 Ga0157369_10022153 3300013105 Bacteria 7098
234 Ga0157369_10081473 3300013105 Bacteria 3464
235 Ga0157369_10135626 3300013105 Bacteria 2606
236 Ga0157369_10523144 3300013105 Bacteria 1227
237 Ga0157374_10078442 3300013296 Bacteria 3128
238 Ga0157374_10089163 3300013296 Bacteria 2938
239 Ga0163162_10000830 3300013306 Bacteria 28736
240 Ga0163162_11051101 3300013306 Bacteria 922
241 Ga0157372_10010331 3300013307 Bacteria 9920
242 Ga0157372_10015817 3300013307 Bacteria 8093
243 Ga0157372_10147351 3300013307 Bacteria 2714
244 Ga0157372_10192002 3300013307 Bacteria 2365
245 Ga0157372_10824481 3300013307 Bacteria 1077
246 Ga0157372_10867425 3300013307 Bacteria 1048
247 Ga0157375_10112491 3300013308 Bacteria 2823
248 Ga0157375_11103786 3300013308 Bacteria 929
249 Ga0157514_125748 3300013874 Bacteria 1492
250 Ga0157380_10008236 3300014326 Bacteria 7428
251 Ga0157380_10033720 3300014326 Bacteria 3944
252 Ga0157380_10245494 3300014326 Bacteria 1617
253 Ga0182008_10159318 3300014497 Bacteria 1135
254 Ga0182008_10262274 3300014497 Bacteria 894
255 Ga0182008_10419587 3300014497 Bacteria 722
256 Ga0157377_10112496 3300014745 Bacteria 1638
257 Ga0157379_10001870 3300014968 Bacteria 17410
258 Ga0157379_10014560 3300014968 Bacteria 6901
259 Ga0157376_10011825 3300014969 Bacteria 6453
260 Ga0157376_10808996 3300014969 Bacteria 950
261 Ga0182006_1023666 3300015261 Bacteria 2542
262 Ga0182006_1051890 3300015261 Bacteria 1577
263 Ga0182005_1052785 3300015265 Bacteria 1107
264 Ga0163161_10033820 3300017792 Bacteria 3653
265 Ga0163161_10849548 3300017792 Bacteria 770
266 Ga0197907_10899683 3300020069 Bacteria 604
267 Ga0206353_10916553 3300020082 Bacteria 3787
268 Ga0213873_10222063 3300021358 Bacteria 592
269 Ga0213876_10151763 3300021384 Bacteria 1232
270 Ga0209676_1000346 3300025292 Bacteria 87684
271 Ga0209676_1094387 3300025292 Bacteria 650
272 Ga0209051_1000284 3300025303 Bacteria 82589
273 Ga0209051_1000446 3300025303 Bacteria 55218
274 Ga0209257_1016774 3300025304 Bacteria 2937
275 Ga0207697_10050884 3300025315 Bacteria 1711
276 Ga0207697_10107830 3300025315 Bacteria 1191
277 Ga0207656_10023822 3300025321 Bacteria 2469
278 Ga0207656_10298542 3300025321 Bacteria 797
279 Ga0207710_10157475 3300025900 Bacteria 1104
280 Ga0207688_10047326 3300025901 Bacteria 2402
281 Ga0207680_10171283 3300025903 Bacteria 1462
282 Ga0207647_10135962 3300025904 Bacteria 1442
283 Ga0207645_10029005 3300025907 Bacteria 3567
284 Ga0207645_10034706 3300025907 Bacteria 3241
285 Ga0207645_10209618 3300025907 Bacteria 1283
286 Ga0207643_10030417 3300025908 Bacteria 3005
287 Ga0207705_10138462 3300025909 Bacteria 1816
288 Ga0207705_10180664 3300025909 Bacteria 1592
289 Ga0207654_10020632 3300025911 Bacteria 3496
290 Ga0207654_10038141 3300025911 Bacteria 2694
291 Ga0207654_10059670 3300025911 Bacteria 2226
292 Ga0207654_10087143 3300025911 Bacteria 1894
293 Ga0207707_10005989 3300025912 Bacteria 10642
294 Ga0207707_10198647 3300025912 Bacteria 1749
295 Ga0207707_10249186 3300025912 Bacteria 1543
296 Ga0207707_10305204 3300025912 Bacteria 1376
297 Ga0207707_10408934 3300025912 Bacteria 1164
298 Ga0207695_10006376 3300025913 Bacteria 15351
299 Ga0207695_10020075 3300025913 Bacteria 7667
300 Ga0207695_10023115 3300025913 Bacteria 7035
301 Ga0207671_10066078 3300025914 Bacteria 2691
302 Ga0207671_10131025 3300025914 Bacteria 1924
303 Ga0207671_10212401 3300025914 Bacteria 1514
304 Ga0207660_10089498 3300025917 Bacteria 2279
305 Ga0207660_10196334 3300025917 Bacteria 1574
306 Ga0207662_10157113 3300025918 Bacteria 1450
307 Ga0207657_10000142 3300025919 Bacteria 72309
308 Ga0207657_10032616 3300025919 Bacteria 4703
309 Ga0207657_10191922 3300025919 Bacteria 1647
310 Ga0207649_10025495 3300025920 Bacteria 3447
311 Ga0207649_10034563 3300025920 Bacteria 3030
312 Ga0207652_10021625 3300025921 Bacteria 5310
313 Ga0207652_10036122 3300025921 Bacteria 4176
314 Ga0207652_10075818 3300025921 Bacteria 2931
315 Ga0207652_10119723 3300025921 Bacteria 2341
316 Ga0207652_10622321 3300025921 Unclassified 967
317 Ga0207681_10043206 3300025923 Bacteria 3015
318 Ga0207681_10043214 3300025923 Bacteria 3015
319 Ga0207681_10078926 3300025923 Bacteria 2318
320 Ga0207694_10023532 3300025924 Bacteria 4676
321 Ga0207694_10023870 3300025924 Bacteria 4644
322 Ga0207694_10032630 3300025924 Bacteria 3987
323 Ga0207694_10109709 3300025924 Bacteria 2194
324 Ga0207694_10275402 3300025924 Bacteria 1381
325 Ga0207650_10646730 3300025925 Bacteria 891
326 Ga0207659_10004432 3300025926 Bacteria 8491
327 Ga0207659_10013115 3300025926 Bacteria 5299
328 Ga0207659_10052279 3300025926 Bacteria 2910
329 Ga0207700_10032738 3300025928 Bacteria 3712
330 Ga0207664_10031551 3300025929 Bacteria 4054
331 Ga0207664_10058301 3300025929 Bacteria 3071
332 Ga0207664_10087250 3300025929 Bacteria 2550
333 Ga0207664_10325607 3300025929 Bacteria 1356
334 Ga0207644_10117356 3300025931 Bacteria 2021
335 Ga0207644_10253898 3300025931 Bacteria 1404
336 Ga0207644_10322759 3300025931 Bacteria 1249
337 Ga0207644_11409404 3300025931 Bacteria 585
338 Ga0207690_10043611 3300025932 Bacteria 2953
339 Ga0207690_10094722 3300025932 Bacteria 2119
340 Ga0207690_10183883 3300025932 Bacteria 1576
341 Ga0207690_10234300 3300025932 Bacteria 1411
342 Ga0207706_10006991 3300025933 Bacteria 10429
343 Ga0207706_10130409 3300025933 Bacteria 2211
344 Ga0207706_10147178 3300025933 Bacteria 2072
345 Ga0207706_10212120 3300025933 Bacteria 1697
346 Ga0207686_10082791 3300025934 Bacteria 2099
347 Ga0207686_10127860 3300025934 Bacteria 1739
348 Ga0207709_10000540 3300025935 Bacteria 32468
349 Ga0207709_11299289 3300025935 Bacteria 601
350 Ga0207669_10155065 3300025937 Bacteria 1610
351 Ga0207704_10431593 3300025938 Bacteria 1047
352 Ga0207665_10094659 3300025939 Bacteria 2075
353 Ga0207691_10010913 3300025940 Bacteria 8721
354 Ga0207691_10022589 3300025940 Bacteria 5932
355 Ga0207691_10037814 3300025940 Bacteria 4467
356 Ga0207711_10013899 3300025941 Bacteria 6686
357 Ga0207689_10000856 3300025942 Bacteria 29352
358 Ga0207689_10044075 3300025942 Bacteria 3688
359 Ga0207661_10004542 3300025944 Bacteria 9725
360 Ga0207661_10172051 3300025944 Bacteria 1886
361 Ga0207661_10481505 3300025944 Bacteria 1133
362 Ga0207679_10037148 3300025945 Bacteria 3460
363 Ga0207679_10040785 3300025945 Bacteria 3326
364 Ga0207679_10264138 3300025945 Bacteria 1469
365 Ga0207667_10009529 3300025949 Bacteria 11427
366 Ga0207667_10009780 3300025949 Bacteria 11279
367 Ga0207667_10039768 3300025949 Bacteria 5009
368 Ga0207667_10061183 3300025949 Bacteria 3940
369 Ga0207667_10482506 3300025949 Bacteria 1258
370 Ga0207651_10061416 3300025960 Bacteria 2614
371 Ga0207651_10160284 3300025960 Bacteria 1763
372 Ga0207651_10250911 3300025960 Bacteria 1448
373 Ga0207712_10428723 3300025961 Bacteria 1117
374 Ga0207668_10021657 3300025972 Bacteria 4102
375 Ga0207668_10054598 3300025972 Bacteria 2774
376 Ga0207668_10264901 3300025972 Bacteria 1402
377 Ga0207668_10367953 3300025972 Bacteria 1206
378 Ga0207640_10018518 3300025981 Bacteria 4094
379 Ga0207640_10120090 3300025981 Bacteria 1881
380 Ga0207640_10290709 3300025981 Bacteria 1288
381 Ga0207658_10031259 3300025986 Bacteria 3779
382 Ga0207658_10155781 3300025986 Bacteria 1867
383 Ga0207658_10244428 3300025986 Bacteria 1522
384 Ga0207677_10010028 3300026023 Bacteria 5345
385 Ga0207677_10063012 3300026023 Bacteria 2575
386 Ga0207677_10646602 3300026023 Bacteria 933
387 Ga0207703_10036792 3300026035 Bacteria 3897
388 Ga0207703_10092359 3300026035 Bacteria 2547
389 Ga0207639_10011932 3300026041 Bacteria 6045
390 Ga0207639_10022769 3300026041 Bacteria 4516
391 Ga0207639_10060832 3300026041 Bacteria 2914
392 Ga0207639_10402480 3300026041 Bacteria 1233
393 Ga0207639_10930788 3300026041 Bacteria 813
394 Ga0207678_10002761 3300026067 Bacteria 15887
395 Ga0207708_11766791 3300026075 Bacteria 543
396 Ga0207702_10048315 3300026078 Bacteria 3588
397 Ga0207702_10087151 3300026078 Bacteria 2724
398 Ga0207702_10226326 3300026078 Bacteria 1745
399 Ga0207702_10252025 3300026078 Bacteria 1658
400 Ga0207702_10465458 3300026078 Bacteria 1228
401 Ga0207641_10024573 3300026088 Bacteria 4966
402 Ga0207641_10341124 3300026088 Bacteria 1426
403 Ga0207648_10342919 3300026089 Bacteria 1346
404 Ga0207648_10371813 3300026089 Bacteria 1291
405 Ga0207648_10402052 3300026089 Bacteria 1241
406 Ga0207676_10010625 3300026095 Bacteria 6563
407 Ga0207676_10459617 3300026095 Bacteria 1202
408 Ga0207674_10005503 3300026116 Bacteria 15037
409 Ga0207674_10021603 3300026116 Bacteria 6928
410 Ga0207674_10039387 3300026116 Bacteria 4899
411 Ga0207674_10041802 3300026116 Bacteria 4739
412 Ga0207674_11259224 3300026116 Bacteria 709
413 Ga0207675_100000879 3300026118 Bacteria 29982
414 Ga0207675_100052670 3300026118 Bacteria 3798
415 Ga0207675_100071229 3300026118 Bacteria 3250
416 Ga0207675_100293719 3300026118 Bacteria 1581
417 Ga0207683_10034658 3300026121 Bacteria 4388
418 Ga0207683_10052440 3300026121 Bacteria 3574
419 Ga0207683_10180203 3300026121 Bacteria 1915
420 Ga0207683_10272545 3300026121 Bacteria 1546
421 Ga0207698_10003937 3300026142 Bacteria 8993
422 Ga0207698_10033549 3300026142 Bacteria 3731
423 Ga0207698_10088288 3300026142 Bacteria 2528
424 Ga0207698_10104328 3300026142 Bacteria 2358
425 Ga0207698_10145649 3300026142 Bacteria 2048
426 Ga0207698_10279019 3300026142 Bacteria 1545
427 Ga0207698_10313335 3300026142 Bacteria 1466
428 Ga0209999_1029774 3300027543 Bacteria 1013
429 Ga0209983_1026658 3300027665 Bacteria 1223
430 Ga0209813_10093257 3300027866 Bacteria 1014
431 Ga0209813_10110162 3300027866 Bacteria 947
432 Ga0209974_10026407 3300027876 Bacteria 1922
433 Ga0207428_10000152 3300027907 Bacteria 94307
434 Ga0207428_10027374 3300027907 Bacteria 4747
435 Ga0268266_10163840 3300028379 Bacteria 2013
436 Ga0268266_11015477 3300028379 Bacteria 803
437 Ga0268265_10033763 3300028380 Bacteria 3723
438 Ga0268265_10067102 3300028380 Bacteria 2776
439 Ga0268265_10187744 3300028380 Bacteria 1782
440 Ga0268265_10548045 3300028380 Bacteria 1097
441 Ga0268265_10628508 3300028380 Bacteria 1030
442 Ga0268264_10060839 3300028381 Bacteria 3166
443 Ga0268264_10101594 3300028381 Bacteria 2500
444 Ga0268264_10394552 3300028381 Bacteria 1328
445 Ga0307515_10000034 3300028794 Bacteria 344640
446 Ga0307515_10018885 3300028794 Bacteria 12446
447 Ga0307515_10271307 3300028794 Bacteria 1417
448 Ga0307511_10028923 3300030521 Bacteria 5017
449 Ga0265320_10054034 3300031240 Bacteria 1939
450 Ga0265331_10068472 3300031250 Bacteria 1664
451 Ga0307513_10515171 3300031456 Bacteria 912
452 Ga0307408_100093008 3300031548 Bacteria 2280
453 Ga0307408_100329535 3300031548 Bacteria 1289
454 Ga0307408_100717860 3300031548 Bacteria 900
455 Ga0307408_100851507 3300031548 Bacteria 831
456 Ga0316576_10060513 3300031727 Bacteria 2774
457 Ga0307516_10003296 3300031730 Bacteria 20894
458 Ga0307516_10020560 3300031730 Bacteria 6817
459 Ga0307405_10085115 3300031731 Bacteria 2077
460 Ga0307406_10334983 3300031901 Bacteria 1176
461 Ga0307407_10007279 3300031903 Bacteria 5003
462 Ga0307412_11056780 3300031911 Bacteria 720
463 Ga0307416_100053978 3300032002 Bacteria 3228
464 Ga0307416_101032367 3300032002 Bacteria 926
465 Ga0307415_101211109 3300032126 Bacteria 712
466 Ga0373930_0010975 3300034816 Bacteria 1629
467 Ga0373940_0010835 3300035088 Bacteria 2153
468 Ga0373939_0049193 3300035114 Bacteria 1302
469 Ga0373946_0094085 3300035171 Bacteria 1333
470 Ga0373962_0007567 3300035242 Bacteria 2663
471 Ga0316574_0265126 3300035398 Bacteria 1096
472 Ga0373931_0006633 3300035691 Bacteria 5420
473 Ga0373931_0128858 3300035691 Bacteria 1454
474 Ga0373931_0494448 3300035691 Bacteria 788
475 Ga0373935_0861804 3300035692 Bacteria 670
476 Ga0373925_0040624 3300037068 Bacteria 3445
477 Ga0373925_0279482 3300037068 Bacteria 1344
478 Ga0395899_0012535 3300037312 Bacteria 6498
479 Ga0395899_0295694 3300037312 Bacteria 1097
480 Ga0395900_0009587 3300037418 Bacteria 9926
481 Ga0395900_0115638 3300037418 Bacteria 2752
482 Ga0395900_0145253 3300037418 Bacteria 2426
483 Ga0395900_0240303 3300037418 Bacteria 1817
484 Ga0395900_0707581 3300037418 Bacteria 940
485 Ga0395898_0191039 3300037466 Bacteria 1956
486 Ga0395898_0211074 3300037466 Bacteria 1852
487 Ga0395905_0000883 3300037471 Bacteria 39095
488 Ga0395905_0010764 3300037471 Bacteria 8867
489 Ga0395905_0020602 3300037471 Bacteria 6243
490 Ga0395905_0317436 3300037471 Bacteria 1447
491 Ga0395905_0415180 3300037471 Bacteria 1241
492 Ga0395905_0637139 3300037471 Unclassified 968
493 Ga0395901_0004759 3300038443 Bacteria 13696
494 Ga0395901_0015549 3300038443 Bacteria 7750
495 Ga0395901_1033885 3300038443 Bacteria 795
496 Ga0436365_0208379 3300039437 Bacteria 3000
497 Ga0436365_1016022 3300039437 Bacteria 3902
498 Ga0436363_0107667 3300039450 Bacteria 2144
499 Ga0436363_1649827 3300039450 Bacteria 893
500 Ga0439436_0003148 3300041404 Bacteria 5000
501 Ga0439436_0007708 3300041404 Bacteria 3312
502 Ga0439439_0012756 3300041406 Bacteria 2033
503 Ga0439439_0032576 3300041406 Bacteria 1331
504 Ga0439447_020102 3300041407 Bacteria 1775
505 Ga0439466_0004735 3300041411 Bacteria 5229
506 Ga0439466_0011107 3300041411 Bacteria 3336
507 Ga0439465_0035965 3300041413 Bacteria 1589
508 Ga0451793_0211241 3300041452 Bacteria 865
509 Ga0451797_0461082 3300041453 Bacteria 2806
510 Ga0451800_0593028 3300041459 Bacteria 838
511 Ga0451800_0767295 3300041459 Bacteria 831
512 Ga0451804_0103686 3300041463 Bacteria 855
513 Ga0451833_0809994 3300041491 Bacteria 648
514 Ga0451835_0946079 3300041492 Bacteria 1226
515 Ga0451841_0631142 3300041498 Bacteria 913
516 Ga0451845_0537950 3300041501 Bacteria 1158
517 Ga0451843_1764350 3300041509 Bacteria 1028
518 Ga0451853_2282553 3300041512 Bacteria 1049
519 Ga0439431_0005421 3300041997 Bacteria 2818
520 Ga0439433_0004518 3300041999 Bacteria 2997
521 Ga0439442_007850 3300042002 Bacteria 2154
522 Ga0439445_0003668 3300042004 Bacteria 3446
523 Ga0439445_0067481 3300042004 Bacteria 986
524 Ga0439432_017634 3300042006 Bacteria 2394
525 Ga0439432_038634 3300042006 Bacteria 1519
526 Ga0439449_0002894 3300042007 Bacteria 6676
527 Ga0439449_0029030 3300042007 Bacteria 2061
528 Ga0439449_0030220 3300042007 Bacteria 2018
529 Ga0439452_004744 3300042010 Bacteria 4497
530 Ga0439452_008152 3300042010 Bacteria 3169
531 Ga0439457_023486 3300042014 Bacteria 1364
532 Ga0439462_0005459 3300042015 Bacteria 3135
533 Ga0439462_0007022 3300042015 Bacteria 2814
534 Ga0439463_107213 3300042016 Bacteria 721
535 Ga0450911_000289 3300042115 Bacteria 18464
536 Ga0450923_020159 3300042125 Bacteria 1290
537 Ga0450897_000960 3300042128 Bacteria 1818
538 Ga0450899_028104 3300042135 Bacteria 677
539 Ga0450906_046895 3300042145 Bacteria 762
540 Ga0450907_022937 3300042146 Bacteria 1052
541 Ga0439446_0047533 3300042156 Bacteria 1276
542 Ga0439434_0065141 3300042435 Bacteria 1143
543 Ga0450893_0009616 3300042532 Bacteria 1580
544 Ga0451577_0101976 3300042876 Bacteria 2564
545 Ga0466972_0003747 3300044658 Bacteria 7561
546 Ga0466965_0005827 3300044683 Bacteria 5560
547 Ga0466965_0107847 3300044683 Bacteria 1429
548 Ga0466966_0010532 3300044684 Bacteria 6144
549 Ga0466963_0251649 3300044694 Bacteria 1240
550 Ga0466964_0008502 3300044706 Bacteria 3859
551 Ga0453684_1044128 3300044712 Bacteria 867
552 Ga0466968_0011304 3300044735 Bacteria 3476
553 Ga0466970_0289142 3300044765 Bacteria 923
554 Ga0451576_0072876 3300045051 Bacteria 3574
555 Ga0495627_009665 3300046453 Bacteria 3540
556 Ga0495592_0391866 3300046454 Bacteria 882
557 Ga0495629_0076852 3300046459 Bacteria 2331
558 Ga0495653_0395302 3300046463 Bacteria 880
559 Ga0495582_0234121 3300046473 Bacteria 1052
560 Ga0495639_0004103 3300046475 Bacteria 6238
561 Ga0495664_0200440 3300046477 Bacteria 1209
562 Ga0495610_0177203 3300046512 Bacteria 889
563 Ga0495620_0022193 3300046515 Bacteria 3064
564 Ga0495628_0480078 3300046516 Bacteria 900
565 Ga0495628_0485497 3300046516 Bacteria 894
566 Ga0495637_0021694 3300046520 Bacteria 2941
567 Ga0495642_0118147 3300046528 Bacteria 1137
568 Ga0495654_0002010 3300046530 Bacteria 13387
569 Ga0495621_0039969 3300046539 Bacteria 1642
570 Ga0495621_0171873 3300046539 Bacteria 861
571 Ga0495622_0063474 3300046557 Bacteria 1709
572 Ga0495633_0246467 3300046558 Bacteria 816
573 Ga0495656_0079131 3300046615 Bacteria 1479
574 Ga0495625_0154116 3300046660 Bacteria 1543
575 Ga0495661_0282655 3300046665 Bacteria 836
576 Ga0495588_0070315 3300046674 Bacteria 1819
577 Ga0495670_0120972 3300046691 Bacteria 1360
578 Ga0495671_0005355 3300046692 Bacteria 7529
579 Ga0495660_0374002 3300046810 Bacteria 629
580 Ga0495674_1201294 3300047319 Bacteria 573
581 Ga0495672_0166756 3300047320 Bacteria 1127
582 Ga0495676_0638229 3300047321 Bacteria 692
583 Ga0496100_0019573 3300048903 Bacteria 4042
584 Ga0496100_0026056 3300048903 Bacteria 3581
585 Ga0496101_0013253 3300048904 Bacteria 5521
586 Ga0496101_0053277 3300048904 Bacteria 2918
587 Ga0496102_0008824 3300048905 Bacteria 8648
588 Ga0496102_0068465 3300048905 Bacteria 3257
589 Ga0496103_0103431 3300048906 Bacteria 1804
590 Ga0496104_0049293 3300048907 Bacteria 3971
591 Ga0496105_0035902 3300048908 Bacteria 4082
592 Ga0496105_0148386 3300048908 Bacteria 1928
593 Ga0496106_0008083 3300048909 Bacteria 7771
594 Ga0496106_0015833 3300048909 Bacteria 5577
595 Ga0496107_0004328 3300048910 Bacteria 9610
596 Ga0496108_0104079 3300048911 Bacteria 2422
597 Ga0496108_0137221 3300048911 Bacteria 2105
598 Ga0496109_0095016 3300048912 Bacteria 2759
599 Ga0496109_0691489 3300048912 Bacteria 957
600 Ga0496109_0766675 3300048912 Bacteria 903
601 Ga0496110_0029184 3300048913 Bacteria 4744
602 Ga0496110_0299570 3300048913 Bacteria 1464
603 Ga0496111_0031530 3300048914 Bacteria 3776
604 Ga0496111_0092473 3300048914 Bacteria 2217
605 Ga0496111_0172260 3300048914 Bacteria 1608
606 Ga0496114_0044725 3300048917 Bacteria 3675
607 Ga0496114_0097804 3300048917 Bacteria 2501
608 Ga0496115_0033835 3300048918 Bacteria 4037
609 Ga0496121_0020745 3300048924 Bacteria 6479
610 Ga0496121_0239264 3300048924 Bacteria 1266
611 Ga0496121_0757043 3300048924 Bacteria 577
612 Ga0496122_0305092 3300048925 Bacteria 856
613 Ga0496124_0036939 3300048927 Bacteria 4254
614 Ga0496125_0005367 3300048928 Bacteria 14295
615 Ga0496125_0005937 3300048928 Bacteria 13381
616 Ga0496126_0014536 3300048929 Bacteria 7952
617 Ga0496126_0083272 3300048929 Bacteria 2824
618 Ga0496126_0207500 3300048929 Bacteria 1651
619 Ga0501034_0287736 3300049571 Bacteria 1582
620 Ga0501034_0514116 3300049571 Bacteria 1110
621 Ga0501036_0023593 3300049572 Bacteria 5184
622 Ga0501036_0163149 3300049572 Bacteria 1879
623 Ga0501037_0387929 3300049573 Bacteria 959
624 Ga0501037_0499091 3300049573 Bacteria 826
625 Ga0501038_0681013 3300049574 Bacteria 772
626 Ga0501039_0055156 3300049575 Bacteria 3077
627 Ga0501040_0001677 3300049576 Bacteria 14176
628 Ga0501040_0005535 3300049576 Bacteria 8178
629 Ga0501041_0003272 3300049577 Bacteria 9311
630 Ga0501041_0004599 3300049577 Bacteria 8006
631 Ga0501042_0018555 3300049578 Bacteria 4818
632 Ga0501042_0024465 3300049578 Bacteria 4235
633 Ga0501043_0000573 3300049579 Bacteria 32893
634 Ga0501043_0566612 3300049579 Bacteria 842
635 Ga0501046_0000752 3300049580 Bacteria 31319
636 Ga0501046_0014242 3300049580 Bacteria 6717
637 Ga0501046_0019277 3300049580 Bacteria 5659
638 Ga0501046_0805325 3300049580 Bacteria 658
639 Ga0501047_0000298 3300049581 Bacteria 57038
640 Ga0501047_0005437 3300049581 Bacteria 11984
641 Ga0501048_0003640 3300049582 Bacteria 11740
642 Ga0501048_0012421 3300049582 Bacteria 6335
643 Ga0501048_0134828 3300049582 Bacteria 1745
644 Ga0501048_0750661 3300049582 Bacteria 701
645 Ga0501068_0047704 3300049584 Bacteria 2584
646 Ga0501068_0192506 3300049584 Bacteria 1292
647 Ga0501068_0508668 3300049584 Bacteria 782
648 Ga0501069_0277742 3300049585 Bacteria 980
649 Ga0501070_0061210 3300049586 Bacteria 3119
650 Ga0501071_0048023 3300049587 Unclassified 3068
651 Ga0501071_0058241 3300049587 Bacteria 2793
652 Ga0501071_0164637 3300049587 Bacteria 1659
653 Ga0501072_0034140 3300049588 Bacteria 3986
654 Ga0501073_0109059 3300049589 Bacteria 1921
655 Ga0501073_0204780 3300049589 Bacteria 1364
656 Ga0501073_0245596 3300049589 Bacteria 1236
657 Ga0501074_0057744 3300049590 Bacteria 2796
658 Ga0501074_0078648 3300049590 Bacteria 2367
659 Ga0501074_0265037 3300049590 Bacteria 1221
660 Ga0501075_0009539 3300049591 Bacteria 6794
661 Ga0501075_0011038 3300049591 Bacteria 6376
662 Ga0501075_0026233 3300049591 Unclassified 4287
663 Ga0501076_0080875 3300049592 Bacteria 2608
664 Ga0501076_0085239 3300049592 Bacteria 2538
665 Ga0501076_0263667 3300049592 Bacteria 1411
666 Ga0501077_0013790 3300049593 Bacteria 5069
667 Ga0501077_0305422 3300049593 Bacteria 1014
668 Ga0501252_033465 3300049682 Bacteria 721
669 Ga0501079_0005863 3300049741 Bacteria 9192
670 Ga0501079_0278273 3300049741 Bacteria 1308
671 Ga0501079_0781858 3300049741 Bacteria 751
672 Ga0501080_0002090 3300049742 Bacteria 17331
673 Ga0501080_0010278 3300049742 Bacteria 8555
674 Ga0501080_0082448 3300049742 Unclassified 2987
675 Ga0501080_0123510 3300049742 Bacteria 2398
676 Ga0501080_0367905 3300049742 Bacteria 1297
677 Ga0501081_0005137 3300049743 Bacteria 8427
678 Ga0501081_0105990 3300049743 Bacteria 1992
679 Ga0501083_0064057 3300049744 Bacteria 2451
680 Ga0501035_0200872 3300049822 Bacteria 1710
681 Ga0501035_0776298 3300049822 Bacteria 767
682 Ga0501044_0117400 3300049823 Bacteria 2665
683 Ga0501045_0009696 3300049824 Bacteria 6736
684 Ga0501045_0017809 3300049824 Bacteria 5045
685 Ga0501045_0027684 3300049824 Bacteria 4087
686 Ga0501045_0042241 3300049824 Bacteria 3319
687 Ga0501045_0988830 3300049824 Bacteria 617
688 nmdc:mga03683_1140_c1 3300050489 Bacteria 5531
689 nmdc:mga03683_122698_c1 3300050489 Bacteria 1156
690 nmdc:mga03683_4303_c1 3300050489 Bacteria 4705
691 nmdc:mga03683_5158_c1 3300050489 Bacteria 4391
692 nmdc:mga03683_609841_c1 3300050489 Bacteria 535
693 nmdc:mga03n38_282687_c1 3300050490 Bacteria 886
694 nmdc:mga00v17_573807_c1 3300050491 Bacteria 728
695 nmdc:mga0yw44_350879_c1 3300050492 Bacteria 993
696 nmdc:mga06z11_334771_c1 3300050494 Bacteria 904
697 nmdc:mga06z11_564985_c1 3300050494 Bacteria 691
698 nmdc:mga04h51_31991_c1 3300050495 Bacteria 1665
699 nmdc:mga04h51_36159_c1 3300050495 Bacteria 1587
700 nmdc:mga07m45_9139_c1 3300050496 Bacteria 1936
701 nmdc:mga05p37_108188_c1 3300050507 Bacteria 3420
702 nmdc:mga05p37_229145_c1 3300050507 Bacteria 2239
703 nmdc:mga0qj67_791822_c1 3300050509 Bacteria 751
704 nmdc:mga08y16_37683_c1 3300050511 Bacteria 5076
705 nmdc:mga08y16_54_c1 3300050511 Bacteria 102957
706 nmdc:mga08y16_821575_c1 3300050511 Bacteria 921
707 nmdc:mga0n895_9679_c1 3300050512 Bacteria 8452
708 nmdc:mga0rr50_165557_c1 3300050513 Bacteria 1797
709 nmdc:mga0rr50_765905_c1 3300050513 Bacteria 824
710 nmdc:mga08x19_509528_c1 3300050514 Bacteria 850
711 nmdc:mga0a205_2327_c1 3300050515 Bacteria 16764
712 nmdc:mga0sz30_16457_c1 3300050516 Bacteria 2937
713 nmdc:mga0sz30_16817_c1 3300050516 Bacteria 2910
714 Ga0500610_0005742 3300053079 Bacteria 5125
715 Ga0500610_0018232 3300053079 Bacteria 3388
716 Ga0495619_0728934 3300053085 Bacteria 673
717 Ga0500651_0155396 3300053093 Bacteria 1371
718 Ga0500650_0284169 3300053098 Bacteria 735
719 Ga0500593_003920 3300053117 Bacteria 5704
720 Ga0500607_009966 3300053121 Bacteria 5692
721 Ga0500652_067867 3300053131 Bacteria 1475
722 Ga0500559_0016122 3300053136 Bacteria 3155
723 Ga0500559_0126437 3300053136 Unclassified 1192
724 Ga0500616_0002351 3300053153 Bacteria 15902
725 Ga0500634_0002047 3300053161 Bacteria 8295
726 Ga0500552_000821 3300053733 Bacteria 2913
727 Ga0501084_0011061 3300054114 Bacteria 7472
728 Ga0501084_0015960 3300054114 Bacteria 6232
729 Ga0501084_0367677 3300054114 Bacteria 1215
730 Ga0501082_0003668 3300060353 Bacteria 13416
731 Ga0501082_0555056 3300060353 Bacteria 1005
732 Ga0530510_0016521 3300061734 Bacteria 5226
733 Ga0530510_0054832 3300061734 Bacteria 2880
734 Ga0530510_0345218 3300061734 Bacteria 1118

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0289142 Ga0466970_0289142_442_894 140
2 3300049823 Ga0501044_0117400 Ga0501044_0117400_2182_2640 144
3 3300053136 Ga0500559_0016122 Ga0500559_0016122_2328_2786 144
4 3300005458 Ga0070681_10235580 Ga0070681_102355801 146
5 3300005530 Ga0070679_100002239 Ga0070679_10000223913 146
6 3300005563 Ga0068855_100049234 Ga0068855_1000492343 146
7 3300025912 Ga0207707_10198647 Ga0207707_101986474 146
8 3300025921 Ga0207652_10036122 Ga0207652_100361223 146
9 3300025949 Ga0207667_10061183 Ga0207667_100611833 146
10 3300041491 Ga0451833_0809994 Ga0451833_0809994_72_560 147
11 iso_pu_bacteria 2906610324 2906616518 149
12 3300005436 Ga0070713_100094954 Ga0070713_1000949542 151
13 3300006028 Ga0070717_10056285 Ga0070717_100562852 151
14 3300013308 Ga0157375_11103786 Ga0157375_111037862 151
15 3300025929 Ga0207664_10087250 Ga0207664_100872502 151
16 3300031727 Ga0316576_10060513 Ga0316576_100605132 151
17 3300035398 Ga0316574_0265126 Ga0316574_0265126_592_1086 151
18 3300039450 Ga0436363_1649827 Ga0436363_1649827_57_596 151
19 3300005289 Ga0065704_10096637 Ga0065704_100966373 152
20 3300005355 Ga0070671_100565684 Ga0070671_1005656842 152
21 3300005367 Ga0070667_100184786 Ga0070667_1001847862 152
22 3300005456 Ga0070678_100200248 Ga0070678_1002002482 152
23 3300005457 Ga0070662_100074926 Ga0070662_1000749264 152
24 3300005535 Ga0070684_101355003 Ga0070684_1013550031 152
25 3300005539 Ga0068853_100885602 Ga0068853_1008856022 152
26 3300005543 Ga0070672_100851877 Ga0070672_1008518771 152
27 3300005614 Ga0068856_100149251 Ga0068856_1001492513 152
28 3300005614 Ga0068856_100432497 Ga0068856_1004324972 152
29 3300005719 Ga0068861_100019833 Ga0068861_1000198334 152
30 3300006177 Ga0075362_10007616 Ga0075362_100076164 152
31 3300006186 Ga0075369_10194647 Ga0075369_101946472 152
32 3300006237 Ga0097621_100190080 Ga0097621_1001900803 152
33 3300006358 Ga0068871_100129082 Ga0068871_1001290823 152
34 3300006358 Ga0068871_100192582 Ga0068871_1001925822 152
35 3300009036 Ga0105244_10078389 Ga0105244_100783892 152
36 3300012502 Ga0157347_1011671 Ga0157347_10116712 152
37 3300013306 Ga0163162_11051101 Ga0163162_110511012 152
38 3300014497 Ga0182008_10262274 Ga0182008_102622742 152
39 3300015261 Ga0182006_1023666 Ga0182006_10236663 152
40 3300015261 Ga0182006_1051890 Ga0182006_10518902 152
41 3300015265 Ga0182005_1052785 Ga0182005_10527852 152
42 3300017792 Ga0163161_10033820 Ga0163161_100338202 152
43 3300025292 Ga0209676_1094387 Ga0209676_10943871 152
44 3300025303 Ga0209051_1000446 Ga0209051_100044632 152
45 3300025931 Ga0207644_10322759 Ga0207644_103227592 152
46 3300025933 Ga0207706_10130409 Ga0207706_101304094 152
47 3300025934 Ga0207686_10127860 Ga0207686_101278602 152
48 3300025944 Ga0207661_10481505 Ga0207661_104815051 152
49 3300025960 Ga0207651_10061416 Ga0207651_100614161 152
50 3300025961 Ga0207712_10428723 Ga0207712_104287232 152
51 3300025986 Ga0207658_10155781 Ga0207658_101557813 152
52 3300026023 Ga0207677_10646602 Ga0207677_106466022 152
53 3300026041 Ga0207639_10930788 Ga0207639_109307881 152
54 3300026118 Ga0207675_100071229 Ga0207675_1000712292 152
55 3300026121 Ga0207683_10180203 Ga0207683_101802033 152
56 3300026121 Ga0207683_10272545 Ga0207683_102725452 152
57 3300028380 Ga0268265_10067102 Ga0268265_100671024 152
58 3300031548 Ga0307408_100717860 Ga0307408_1007178602 152
59 3300031901 Ga0307406_10334983 Ga0307406_103349832 152
60 3300031911 Ga0307412_11056780 Ga0307412_110567801 152
61 3300037068 Ga0373925_0040624 Ga0373925_0040624_2440_2922 152
62 3300037471 Ga0395905_0637139 Ga0395905_0637139_76_549 152
63 3300042004 Ga0439445_0067481 Ga0439445_0067481_82_561 152
64 3300042016 Ga0439463_107213 Ga0439463_107213_66_545 152
65 3300042115 Ga0450911_000289 Ga0450911_000289_9591_10070 152
66 3300046459 Ga0495629_0076852 Ga0495629_0076852_846_1337 152
67 3300046473 Ga0495582_0234121 Ga0495582_0234121_40_531 152
68 3300046475 Ga0495639_0004103 Ga0495639_0004103_1680_2171 152
69 3300046528 Ga0495642_0118147 Ga0495642_0118147_361_852 152
70 3300046539 Ga0495621_0039969 Ga0495621_0039969_1041_1532 152
71 3300046539 Ga0495621_0171873 Ga0495621_0171873_45_536 152
72 3300046557 Ga0495622_0063474 Ga0495622_0063474_543_1034 152
73 3300046615 Ga0495656_0079131 Ga0495656_0079131_738_1229 152
74 3300046674 Ga0495588_0070315 Ga0495588_0070315_885_1376 152
75 3300046691 Ga0495670_0120972 Ga0495670_0120972_73_564 152
76 3300048903 Ga0496100_0026056 Ga0496100_0026056_2167_2658 152
77 3300048904 Ga0496101_0013253 Ga0496101_0013253_3269_3760 152
78 3300048905 Ga0496102_0008824 Ga0496102_0008824_7870_8361 152
79 3300048906 Ga0496103_0103431 Ga0496103_0103431_870_1361 152
80 3300048907 Ga0496104_0049293 Ga0496104_0049293_2552_3043 152
81 3300048908 Ga0496105_0035902 Ga0496105_0035902_502_993 152
82 3300048909 Ga0496106_0008083 Ga0496106_0008083_5942_6433 152
83 3300048911 Ga0496108_0137221 Ga0496108_0137221_260_751 152
84 3300048912 Ga0496109_0691489 Ga0496109_0691489_455_946 152
85 3300048913 Ga0496110_0029184 Ga0496110_0029184_3611_4102 152
86 3300048914 Ga0496111_0092473 Ga0496111_0092473_882_1373 152
87 3300048914 Ga0496111_0172260 Ga0496111_0172260_747_1238 152
88 3300048917 Ga0496114_0044725 Ga0496114_0044725_2503_2994 152
89 3300048924 Ga0496121_0020745 Ga0496121_0020745_4588_5067 152
90 3300048925 Ga0496122_0305092 Ga0496122_0305092_160_639 152
91 3300048927 Ga0496124_0036939 Ga0496124_0036939_3215_3694 152
92 3300048928 Ga0496125_0005367 Ga0496125_0005367_8422_8901 152
93 3300048928 Ga0496125_0005937 Ga0496125_0005937_4740_5219 152
94 3300048929 Ga0496126_0207500 Ga0496126_0207500_233_712 152
95 3300050489 nmdc:mga03683_4303_c1 nmdc:mga03683_4303_c1_3820_4332 152
96 3300050509 nmdc:mga0qj67_791822_c1 nmdc:mga0qj67_791822_c1_246_731 152
97 3300050516 nmdc:mga0sz30_16457_c1 nmdc:mga0sz30_16457_c1_2271_2783 152
98 3300053121 Ga0500607_009966 Ga0500607_009966_2922_3434 152
99 iso_pu_bacteria 2904449895 2904451648 152
100 iso_pu_bacteria 2904456579 2904461863 152
101 3300003659 JGI25404J52841_10018468 JGI25404J52841_100184682 153
102 3300003781 Ga0055536_1008437 Ga0055536_10084375 153
103 3300003792 Ga0055540_1001803 Ga0055540_100180311 153
104 3300003911 JGI25405J52794_10060666 JGI25405J52794_100606662 153
105 3300005327 Ga0070658_10004903 Ga0070658_100049034 153
106 3300005327 Ga0070658_10292523 Ga0070658_102925232 153
107 3300005328 Ga0070676_10008737 Ga0070676_100087378 153
108 3300005329 Ga0070683_100060012 Ga0070683_1000600124 153
109 3300005329 Ga0070683_100065267 Ga0070683_1000652671 153
110 3300005329 Ga0070683_100093284 Ga0070683_1000932842 153
111 3300005330 Ga0070690_100104351 Ga0070690_1001043512 153
112 3300005331 Ga0070670_100136543 Ga0070670_1001365433 153
113 3300005331 Ga0070670_100611844 Ga0070670_1006118442 153
114 3300005331 Ga0070670_100932427 Ga0070670_1009324272 153
115 3300005334 Ga0068869_100003076 Ga0068869_1000030767 153
116 3300005335 Ga0070666_10260613 Ga0070666_102606132 153
117 3300005336 Ga0070680_100043420 Ga0070680_1000434204 153
118 3300005336 Ga0070680_100572697 Ga0070680_1005726972 153
119 3300005337 Ga0070682_100022201 Ga0070682_1000222016 153
120 3300005337 Ga0070682_100434821 Ga0070682_1004348211 153
121 3300005337 Ga0070682_100605306 Ga0070682_1006053061 153
122 3300005338 Ga0068868_100006730 Ga0068868_1000067308 153
123 3300005338 Ga0068868_100088596 Ga0068868_1000885962 153
124 3300005339 Ga0070660_100040061 Ga0070660_1000400612 153
125 3300005339 Ga0070660_100319412 Ga0070660_1003194122 153
126 3300005343 Ga0070687_100390302 Ga0070687_1003903021 153
127 3300005344 Ga0070661_100008214 Ga0070661_1000082144 153
128 3300005344 Ga0070661_100069065 Ga0070661_1000690652 153
129 3300005344 Ga0070661_100116416 Ga0070661_1001164164 153
130 3300005345 Ga0070692_10311318 Ga0070692_103113182 153
131 3300005347 Ga0070668_100009361 Ga0070668_1000093615 153
132 3300005347 Ga0070668_100094910 Ga0070668_1000949102 153
133 3300005347 Ga0070668_100628639 Ga0070668_1006286392 153
134 3300005353 Ga0070669_100032735 Ga0070669_1000327355 153
135 3300005353 Ga0070669_100449332 Ga0070669_1004493322 153
136 3300005353 Ga0070669_100581184 Ga0070669_1005811842 153
137 3300005354 Ga0070675_100001332 Ga0070675_10000133219 153
138 3300005354 Ga0070675_100009544 Ga0070675_1000095448 153
139 3300005354 Ga0070675_100145716 Ga0070675_1001457163 153
140 3300005355 Ga0070671_100370767 Ga0070671_1003707673 153
141 3300005356 Ga0070674_100617468 Ga0070674_1006174681 153
142 3300005356 Ga0070674_100934981 Ga0070674_1009349811 153
143 3300005364 Ga0070673_100019233 Ga0070673_1000192332 153
144 3300005364 Ga0070673_100274085 Ga0070673_1002740851 153
145 3300005365 Ga0070688_100156917 Ga0070688_1001569172 153
146 3300005366 Ga0070659_100006591 Ga0070659_1000065913 153
147 3300005366 Ga0070659_100021473 Ga0070659_1000214737 153
148 3300005366 Ga0070659_100029753 Ga0070659_1000297536 153
149 3300005367 Ga0070667_100151577 Ga0070667_1001515773 153
150 3300005367 Ga0070667_100222687 Ga0070667_1002226872 153
151 3300005367 Ga0070667_100331904 Ga0070667_1003319042 153
152 3300005434 Ga0070709_10154543 Ga0070709_101545433 153
153 3300005435 Ga0070714_100179753 Ga0070714_1001797534 153
154 3300005436 Ga0070713_100229022 Ga0070713_1002290222 153
155 3300005438 Ga0070701_10155143 Ga0070701_101551431 153
156 3300005440 Ga0070705_100389088 Ga0070705_1003890882 153
157 3300005444 Ga0070694_100444842 Ga0070694_1004448422 153
158 3300005455 Ga0070663_100004462 Ga0070663_1000044625 153
159 3300005456 Ga0070678_100020170 Ga0070678_1000201702 153
160 3300005457 Ga0070662_100001945 Ga0070662_1000019458 153
161 3300005457 Ga0070662_100087750 Ga0070662_1000877504 153
162 3300005458 Ga0070681_10001057 Ga0070681_1000105718 153
163 3300005458 Ga0070681_10043520 Ga0070681_100435204 153
164 3300005458 Ga0070681_10339154 Ga0070681_103391542 153
165 3300005458 Ga0070681_10361123 Ga0070681_103611232 153
166 3300005458 Ga0070681_10420942 Ga0070681_104209421 153
167 3300005459 Ga0068867_100224621 Ga0068867_1002246212 153
168 3300005459 Ga0068867_100698835 Ga0068867_1006988351 153
169 3300005467 Ga0070706_100091293 Ga0070706_1000912934 153
170 3300005471 Ga0070698_100001208 Ga0070698_10000120833 153
171 3300005518 Ga0070699_100128414 Ga0070699_1001284142 153
172 3300005530 Ga0070679_100027302 Ga0070679_1000273025 153
173 3300005530 Ga0070679_100062734 Ga0070679_1000627346 153
174 3300005530 Ga0070679_100071601 Ga0070679_1000716013 153
175 3300005530 Ga0070679_100248698 Ga0070679_1002486981 153
176 3300005535 Ga0070684_100028635 Ga0070684_1000286357 153
177 3300005535 Ga0070684_100051865 Ga0070684_1000518652 153
178 3300005535 Ga0070684_100210190 Ga0070684_1002101904 153
179 3300005536 Ga0070697_100275317 Ga0070697_1002753171 153
180 3300005539 Ga0068853_100030678 Ga0068853_1000306783 153
181 3300005539 Ga0068853_100034435 Ga0068853_1000344357 153
182 3300005539 Ga0068853_100073542 Ga0068853_1000735426 153
183 3300005539 Ga0068853_100199327 Ga0068853_1001993274 153
184 3300005539 Ga0068853_100691977 Ga0068853_1006919772 153
185 3300005543 Ga0070672_100008896 Ga0070672_1000088967 153
186 3300005543 Ga0070672_100062557 Ga0070672_1000625572 153
187 3300005543 Ga0070672_100070593 Ga0070672_1000705933 153
188 3300005545 Ga0070695_100022143 Ga0070695_1000221432 153
189 3300005547 Ga0070693_100015270 Ga0070693_1000152704 153
190 3300005548 Ga0070665_100046991 Ga0070665_1000469912 153
191 3300005548 Ga0070665_101486032 Ga0070665_1014860321 153
192 3300005549 Ga0070704_100457546 Ga0070704_1004575462 153
193 3300005563 Ga0068855_100008812 Ga0068855_1000088128 153
194 3300005563 Ga0068855_100031980 Ga0068855_1000319804 153
195 3300005563 Ga0068855_100051023 Ga0068855_1000510238 153
196 3300005563 Ga0068855_100118175 Ga0068855_1001181753 153
197 3300005563 Ga0068855_100379473 Ga0068855_1003794731 153
198 3300005563 Ga0068855_100831048 Ga0068855_1008310482 153
199 3300005564 Ga0070664_100086137 Ga0070664_1000861372 153
200 3300005564 Ga0070664_100154124 Ga0070664_1001541242 153
201 3300005577 Ga0068857_100059280 Ga0068857_1000592805 153
202 3300005577 Ga0068857_100159007 Ga0068857_1001590073 153
203 3300005578 Ga0068854_100006691 Ga0068854_1000066914 153
204 3300005578 Ga0068854_100062380 Ga0068854_1000623805 153
205 3300005614 Ga0068856_100004796 Ga0068856_1000047968 153
206 3300005614 Ga0068856_100052398 Ga0068856_1000523987 153
207 3300005614 Ga0068856_100085508 Ga0068856_1000855082 153
208 3300005614 Ga0068856_100236682 Ga0068856_1002366822 153
209 3300005615 Ga0070702_100224909 Ga0070702_1002249092 153
210 3300005616 Ga0068852_100000615 Ga0068852_10000061520 153
211 3300005616 Ga0068852_100001686 Ga0068852_1000016868 153
212 3300005616 Ga0068852_100085852 Ga0068852_1000858525 153
213 3300005616 Ga0068852_100275740 Ga0068852_1002757403 153
214 3300005616 Ga0068852_100380885 Ga0068852_1003808852 153
215 3300005616 Ga0068852_101033626 Ga0068852_1010336261 153
216 3300005617 Ga0068859_100219748 Ga0068859_1002197483 153
217 3300005617 Ga0068859_100305303 Ga0068859_1003053031 153
218 3300005618 Ga0068864_100028438 Ga0068864_1000284384 153
219 3300005618 Ga0068864_100806211 Ga0068864_1008062112 153
220 3300005719 Ga0068861_100000384 Ga0068861_10000038419 153
221 3300005719 Ga0068861_100227768 Ga0068861_1002277683 153
222 3300005834 Ga0068851_10008669 Ga0068851_100086694 153
223 3300005834 Ga0068851_10034847 Ga0068851_100348473 153
224 3300005840 Ga0068870_10125636 Ga0068870_101256361 153
225 3300005842 Ga0068858_100027002 Ga0068858_1000270025 153
226 3300005842 Ga0068858_100045670 Ga0068858_1000456707 153
227 3300005843 Ga0068860_100007870 Ga0068860_1000078706 153
228 3300005843 Ga0068860_100021841 Ga0068860_1000218417 153
229 3300005843 Ga0068860_100355931 Ga0068860_1003559311 153
230 3300005844 Ga0068862_100127742 Ga0068862_1001277425 153
231 3300005844 Ga0068862_100241341 Ga0068862_1002413412 153
232 3300005844 Ga0068862_100305993 Ga0068862_1003059933 153
233 3300005844 Ga0068862_101105251 Ga0068862_1011052511 153
234 3300005937 Ga0081455_10001734 Ga0081455_1000173421 153
235 3300005937 Ga0081455_10017747 Ga0081455_100177477 153
236 3300005937 Ga0081455_10063978 Ga0081455_100639782 153
237 3300005937 Ga0081455_10667880 Ga0081455_106678801 153
238 3300005983 Ga0081540_1001682 Ga0081540_100168210 153
239 3300005985 Ga0081539_10000001 Ga0081539_10000001559 153
240 3300005985 Ga0081539_10001294 Ga0081539_1000129412 153
241 3300005985 Ga0081539_10041426 Ga0081539_100414262 153
242 3300006028 Ga0070717_10826012 Ga0070717_108260122 153
243 3300006028 Ga0070717_11199538 Ga0070717_111995381 153
244 3300006042 Ga0075368_10192414 Ga0075368_101924142 153
245 3300006177 Ga0075362_10015283 Ga0075362_100152833 153
246 3300006177 Ga0075362_10039087 Ga0075362_100390873 153
247 3300006177 Ga0075362_10165403 Ga0075362_101654032 153
248 3300006178 Ga0075367_10142406 Ga0075367_101424063 153
249 3300006178 Ga0075367_10198578 Ga0075367_101985782 153
250 3300006186 Ga0075369_10005411 Ga0075369_100054116 153
251 3300006237 Ga0097621_100524986 Ga0097621_1005249862 153
252 3300006237 Ga0097621_101206025 Ga0097621_1012060251 153
253 3300006353 Ga0075370_10012362 Ga0075370_100123622 153
254 3300006358 Ga0068871_100036905 Ga0068871_1000369057 153
255 3300006358 Ga0068871_101320468 Ga0068871_1013204681 153
256 3300006844 Ga0075428_100001751 Ga0075428_10000175123 153
257 3300006852 Ga0075433_10099961 Ga0075433_100999613 153
258 3300006852 Ga0075433_10100388 Ga0075433_101003883 153
259 3300006871 Ga0075434_100000816 Ga0075434_10000081615 153
260 3300006871 Ga0075434_100195892 Ga0075434_1001958922 153
261 3300006871 Ga0075434_100419668 Ga0075434_1004196682 153
262 3300006871 Ga0075434_100467802 Ga0075434_1004678022 153
263 3300006881 Ga0068865_100019910 Ga0068865_1000199103 153
264 3300006914 Ga0075436_100487470 Ga0075436_1004874702 153
265 3300006931 Ga0097620_100219755 Ga0097620_1002197552 153
266 3300006931 Ga0097620_100305324 Ga0097620_1003053244 153
267 3300006931 Ga0097620_101859227 Ga0097620_1018592272 153
268 3300007076 Ga0075435_100027706 Ga0075435_1000277063 153
269 3300007076 Ga0075435_100484954 Ga0075435_1004849542 153
270 3300007076 Ga0075435_100838637 Ga0075435_1008386371 153
271 3300009011 Ga0105251_10306120 Ga0105251_103061202 153
272 3300009093 Ga0105240_10004485 Ga0105240_100044858 153
273 3300009093 Ga0105240_10005388 Ga0105240_100053883 153
274 3300009093 Ga0105240_10520545 Ga0105240_105205452 153
275 3300009094 Ga0111539_10004025 Ga0111539_1000402512 153
276 3300009094 Ga0111539_11133167 Ga0111539_111331671 153
277 3300009098 Ga0105245_10021575 Ga0105245_100215752 153
278 3300009101 Ga0105247_10391516 Ga0105247_103915162 153
279 3300009147 Ga0114129_10004052 Ga0114129_1000405211 153
280 3300009148 Ga0105243_10001608 Ga0105243_100016089 153
281 3300009174 Ga0105241_10003669 Ga0105241_100036694 153
282 3300009174 Ga0105241_10067234 Ga0105241_100672342 153
283 3300009174 Ga0105241_10070482 Ga0105241_100704823 153
284 3300009174 Ga0105241_10279328 Ga0105241_102793282 153
285 3300009177 Ga0105248_10007485 Ga0105248_100074853 153
286 3300009177 Ga0105248_10251994 Ga0105248_102519941 153
287 3300009545 Ga0105237_10126533 Ga0105237_101265334 153
288 3300009545 Ga0105237_10223013 Ga0105237_102230132 153
289 3300009545 Ga0105237_10312041 Ga0105237_103120414 153
290 3300009551 Ga0105238_10005726 Ga0105238_100057269 153
291 3300009551 Ga0105238_10010115 Ga0105238_100101154 153
292 3300009551 Ga0105238_10027853 Ga0105238_100278537 153
293 3300009551 Ga0105238_10041404 Ga0105238_100414043 153
294 3300009551 Ga0105238_11012070 Ga0105238_110120702 153
295 3300009553 Ga0105249_10113389 Ga0105249_101133896 153
296 3300009987 Ga0105030_100276 Ga0105030_1002767 153
297 3300010375 Ga0105239_10081049 Ga0105239_100810495 153
298 3300013100 Ga0157373_10010816 Ga0157373_100108163 153
299 3300013100 Ga0157373_10072075 Ga0157373_100720752 153
300 3300013102 Ga0157371_10054153 Ga0157371_100541532 153
301 3300013102 Ga0157371_10958005 Ga0157371_109580051 153
302 3300013104 Ga0157370_10006388 Ga0157370_100063886 153
303 3300013104 Ga0157370_10010672 Ga0157370_100106728 153
304 3300013104 Ga0157370_10140960 Ga0157370_101409602 153
305 3300013104 Ga0157370_10749837 Ga0157370_107498372 153
306 3300013105 Ga0157369_10022153 Ga0157369_100221536 153
307 3300013105 Ga0157369_10081473 Ga0157369_100814734 153
308 3300013105 Ga0157369_10135626 Ga0157369_101356265 153
309 3300013105 Ga0157369_10523144 Ga0157369_105231442 153
310 3300013296 Ga0157374_10078442 Ga0157374_100784425 153
311 3300013296 Ga0157374_10089163 Ga0157374_100891632 153
312 3300013306 Ga0163162_10000830 Ga0163162_1000083020 153
313 3300013307 Ga0157372_10010331 Ga0157372_100103315 153
314 3300013307 Ga0157372_10015817 Ga0157372_100158175 153
315 3300013307 Ga0157372_10147351 Ga0157372_101473513 153
316 3300013307 Ga0157372_10192002 Ga0157372_101920022 153
317 3300013307 Ga0157372_10824481 Ga0157372_108244812 153
318 3300013307 Ga0157372_10867425 Ga0157372_108674252 153
319 3300013308 Ga0157375_10112491 Ga0157375_101124916 153
320 3300013874 Ga0157514_125748 Ga0157514_1257482 153
321 3300014326 Ga0157380_10008236 Ga0157380_100082364 153
322 3300014326 Ga0157380_10033720 Ga0157380_100337205 153
323 3300014326 Ga0157380_10245494 Ga0157380_102454943 153
324 3300014497 Ga0182008_10159318 Ga0182008_101593182 153
325 3300014497 Ga0182008_10419587 Ga0182008_104195872 153
326 3300014745 Ga0157377_10112496 Ga0157377_101124962 153
327 3300014968 Ga0157379_10001870 Ga0157379_1000187013 153
328 3300014968 Ga0157379_10014560 Ga0157379_100145604 153
329 3300014969 Ga0157376_10011825 Ga0157376_100118258 153
330 3300014969 Ga0157376_10808996 Ga0157376_108089962 153
331 3300017792 Ga0163161_10849548 Ga0163161_108495481 153
332 3300020069 Ga0197907_10899683 Ga0197907_108996832 153
333 3300020082 Ga0206353_10916553 Ga0206353_109165534 153
334 3300021358 Ga0213873_10222063 Ga0213873_102220631 153
335 3300021384 Ga0213876_10151763 Ga0213876_101517631 153
336 3300025292 Ga0209676_1000346 Ga0209676_100034679 153
337 3300025303 Ga0209051_1000284 Ga0209051_10002848 153
338 3300025304 Ga0209257_1016774 Ga0209257_10167744 153
339 3300025315 Ga0207697_10050884 Ga0207697_100508843 153
340 3300025315 Ga0207697_10107830 Ga0207697_101078303 153
341 3300025321 Ga0207656_10023822 Ga0207656_100238224 153
342 3300025321 Ga0207656_10298542 Ga0207656_102985422 153
343 3300025900 Ga0207710_10157475 Ga0207710_101574753 153
344 3300025901 Ga0207688_10047326 Ga0207688_100473262 153
345 3300025903 Ga0207680_10171283 Ga0207680_101712832 153
346 3300025904 Ga0207647_10135962 Ga0207647_101359622 153
347 3300025907 Ga0207645_10029005 Ga0207645_100290057 153
348 3300025907 Ga0207645_10034706 Ga0207645_100347064 153
349 3300025907 Ga0207645_10209618 Ga0207645_102096182 153
350 3300025908 Ga0207643_10030417 Ga0207643_100304174 153
351 3300025909 Ga0207705_10138462 Ga0207705_101384622 153
352 3300025909 Ga0207705_10180664 Ga0207705_101806641 153
353 3300025911 Ga0207654_10020632 Ga0207654_100206322 153
354 3300025911 Ga0207654_10038141 Ga0207654_100381412 153
355 3300025911 Ga0207654_10059670 Ga0207654_100596702 153
356 3300025911 Ga0207654_10087143 Ga0207654_100871433 153
357 3300025912 Ga0207707_10005989 Ga0207707_100059894 153
358 3300025912 Ga0207707_10249186 Ga0207707_102491862 153
359 3300025912 Ga0207707_10305204 Ga0207707_103052042 153
360 3300025912 Ga0207707_10408934 Ga0207707_104089342 153
361 3300025913 Ga0207695_10006376 Ga0207695_100063763 153
362 3300025913 Ga0207695_10020075 Ga0207695_100200758 153
363 3300025913 Ga0207695_10023115 Ga0207695_100231156 153
364 3300025914 Ga0207671_10066078 Ga0207671_100660782 153
365 3300025914 Ga0207671_10131025 Ga0207671_101310252 153
366 3300025914 Ga0207671_10212401 Ga0207671_102124012 153
367 3300025917 Ga0207660_10089498 Ga0207660_100894983 153
368 3300025917 Ga0207660_10196334 Ga0207660_101963342 153
369 3300025918 Ga0207662_10157113 Ga0207662_101571132 153
370 3300025919 Ga0207657_10000142 Ga0207657_1000014251 153
371 3300025919 Ga0207657_10032616 Ga0207657_100326168 153
372 3300025919 Ga0207657_10191922 Ga0207657_101919222 153
373 3300025920 Ga0207649_10025495 Ga0207649_100254957 153
374 3300025920 Ga0207649_10034563 Ga0207649_100345635 153
375 3300025921 Ga0207652_10021625 Ga0207652_100216257 153
376 3300025921 Ga0207652_10075818 Ga0207652_100758182 153
377 3300025921 Ga0207652_10119723 Ga0207652_101197232 153
378 3300025921 Ga0207652_10622321 Ga0207652_106223212 153
379 3300025923 Ga0207681_10043206 Ga0207681_100432065 153
380 3300025923 Ga0207681_10043214 Ga0207681_100432143 153
381 3300025923 Ga0207681_10078926 Ga0207681_100789264 153
382 3300025924 Ga0207694_10023532 Ga0207694_100235327 153
383 3300025924 Ga0207694_10023870 Ga0207694_100238704 153
384 3300025924 Ga0207694_10032630 Ga0207694_100326303 153
385 3300025924 Ga0207694_10109709 Ga0207694_101097092 153
386 3300025924 Ga0207694_10275402 Ga0207694_102754022 153
387 3300025925 Ga0207650_10646730 Ga0207650_106467302 153
388 3300025926 Ga0207659_10004432 Ga0207659_1000443210 153
389 3300025926 Ga0207659_10013115 Ga0207659_1001311510 153
390 3300025926 Ga0207659_10052279 Ga0207659_100522792 153
391 3300025928 Ga0207700_10032738 Ga0207700_100327385 153
392 3300025929 Ga0207664_10031551 Ga0207664_100315512 153
393 3300025929 Ga0207664_10058301 Ga0207664_100583014 153
394 3300025929 Ga0207664_10325607 Ga0207664_103256072 153
395 3300025931 Ga0207644_10117356 Ga0207644_101173563 153
396 3300025931 Ga0207644_10253898 Ga0207644_102538982 153
397 3300025931 Ga0207644_11409404 Ga0207644_114094041 153
398 3300025932 Ga0207690_10043611 Ga0207690_100436111 153
399 3300025932 Ga0207690_10094722 Ga0207690_100947223 153
400 3300025932 Ga0207690_10183883 Ga0207690_101838832 153
401 3300025932 Ga0207690_10234300 Ga0207690_102343001 153
402 3300025933 Ga0207706_10006991 Ga0207706_1000699110 153
403 3300025933 Ga0207706_10147178 Ga0207706_101471782 153
404 3300025933 Ga0207706_10212120 Ga0207706_102121203 153
405 3300025934 Ga0207686_10082791 Ga0207686_100827913 153
406 3300025935 Ga0207709_10000540 Ga0207709_1000054013 153
407 3300025935 Ga0207709_11299289 Ga0207709_112992891 153
408 3300025937 Ga0207669_10155065 Ga0207669_101550653 153
409 3300025938 Ga0207704_10431593 Ga0207704_104315932 153
410 3300025939 Ga0207665_10094659 Ga0207665_100946592 153
411 3300025940 Ga0207691_10010913 Ga0207691_1001091313 153
412 3300025940 Ga0207691_10022589 Ga0207691_100225893 153
413 3300025940 Ga0207691_10037814 Ga0207691_100378143 153
414 3300025941 Ga0207711_10013899 Ga0207711_100138993 153
415 3300025942 Ga0207689_10000856 Ga0207689_1000085611 153
416 3300025942 Ga0207689_10044075 Ga0207689_100440752 153
417 3300025944 Ga0207661_10004542 Ga0207661_100045426 153
418 3300025944 Ga0207661_10172051 Ga0207661_101720512 153
419 3300025945 Ga0207679_10037148 Ga0207679_100371482 153
420 3300025945 Ga0207679_10040785 Ga0207679_100407855 153
421 3300025945 Ga0207679_10264138 Ga0207679_102641382 153
422 3300025949 Ga0207667_10009529 Ga0207667_100095294 153
423 3300025949 Ga0207667_10009780 Ga0207667_100097809 153
424 3300025949 Ga0207667_10039768 Ga0207667_100397682 153
425 3300025949 Ga0207667_10482506 Ga0207667_104825062 153
426 3300025960 Ga0207651_10160284 Ga0207651_101602842 153
427 3300025960 Ga0207651_10250911 Ga0207651_102509112 153
428 3300025972 Ga0207668_10021657 Ga0207668_100216573 153
429 3300025972 Ga0207668_10054598 Ga0207668_100545983 153
430 3300025972 Ga0207668_10264901 Ga0207668_102649012 153
431 3300025972 Ga0207668_10367953 Ga0207668_103679532 153
432 3300025981 Ga0207640_10018518 Ga0207640_100185181 153
433 3300025981 Ga0207640_10120090 Ga0207640_101200903 153
434 3300025981 Ga0207640_10290709 Ga0207640_102907092 153
435 3300025986 Ga0207658_10031259 Ga0207658_100312597 153
436 3300025986 Ga0207658_10244428 Ga0207658_102444283 153
437 3300026023 Ga0207677_10010028 Ga0207677_100100286 153
438 3300026023 Ga0207677_10063012 Ga0207677_100630122 153
439 3300026035 Ga0207703_10036792 Ga0207703_100367926 153
440 3300026035 Ga0207703_10092359 Ga0207703_100923595 153
441 3300026041 Ga0207639_10011932 Ga0207639_100119325 153
442 3300026041 Ga0207639_10022769 Ga0207639_100227691 153
443 3300026041 Ga0207639_10060832 Ga0207639_100608324 153
444 3300026041 Ga0207639_10402480 Ga0207639_104024803 153
445 3300026067 Ga0207678_10002761 Ga0207678_100027614 153
446 3300026075 Ga0207708_11766791 Ga0207708_117667911 153
447 3300026078 Ga0207702_10048315 Ga0207702_100483152 153
448 3300026078 Ga0207702_10087151 Ga0207702_100871515 153
449 3300026078 Ga0207702_10226326 Ga0207702_102263261 153
450 3300026078 Ga0207702_10252025 Ga0207702_102520254 153
451 3300026078 Ga0207702_10465458 Ga0207702_104654582 153
452 3300026088 Ga0207641_10024573 Ga0207641_100245738 153
453 3300026088 Ga0207641_10341124 Ga0207641_103411242 153
454 3300026089 Ga0207648_10342919 Ga0207648_103429193 153
455 3300026089 Ga0207648_10371813 Ga0207648_103718132 153
456 3300026089 Ga0207648_10402052 Ga0207648_104020522 153
457 3300026095 Ga0207676_10010625 Ga0207676_100106255 153
458 3300026095 Ga0207676_10459617 Ga0207676_104596172 153
459 3300026116 Ga0207674_10005503 Ga0207674_100055031 153
460 3300026116 Ga0207674_10021603 Ga0207674_100216032 153
461 3300026116 Ga0207674_10039387 Ga0207674_100393878 153
462 3300026116 Ga0207674_10041802 Ga0207674_100418027 153
463 3300026116 Ga0207674_11259224 Ga0207674_112592242 153
464 3300026118 Ga0207675_100000879 Ga0207675_10000087919 153
465 3300026118 Ga0207675_100052670 Ga0207675_1000526705 153
466 3300026118 Ga0207675_100293719 Ga0207675_1002937192 153
467 3300026121 Ga0207683_10034658 Ga0207683_100346585 153
468 3300026121 Ga0207683_10052440 Ga0207683_100524404 153
469 3300026142 Ga0207698_10003937 Ga0207698_1000393710 153
470 3300026142 Ga0207698_10033549 Ga0207698_100335496 153
471 3300026142 Ga0207698_10088288 Ga0207698_100882883 153
472 3300026142 Ga0207698_10104328 Ga0207698_101043285 153
473 3300026142 Ga0207698_10145649 Ga0207698_101456493 153
474 3300026142 Ga0207698_10279019 Ga0207698_102790192 153
475 3300026142 Ga0207698_10313335 Ga0207698_103133353 153
476 3300027543 Ga0209999_1029774 Ga0209999_10297742 153
477 3300027665 Ga0209983_1026658 Ga0209983_10266582 153
478 3300027866 Ga0209813_10093257 Ga0209813_100932572 153
479 3300027866 Ga0209813_10110162 Ga0209813_101101622 153
480 3300027876 Ga0209974_10026407 Ga0209974_100264073 153
481 3300027907 Ga0207428_10000152 Ga0207428_1000015234 153
482 3300027907 Ga0207428_10027374 Ga0207428_100273746 153
483 3300028379 Ga0268266_10163840 Ga0268266_101638404 153
484 3300028379 Ga0268266_11015477 Ga0268266_110154772 153
485 3300028380 Ga0268265_10033763 Ga0268265_100337635 153
486 3300028380 Ga0268265_10187744 Ga0268265_101877442 153
487 3300028380 Ga0268265_10548045 Ga0268265_105480453 153
488 3300028380 Ga0268265_10628508 Ga0268265_106285082 153
489 3300028381 Ga0268264_10060839 Ga0268264_100608393 153
490 3300028381 Ga0268264_10101594 Ga0268264_101015944 153
491 3300028381 Ga0268264_10394552 Ga0268264_103945522 153
492 3300028794 Ga0307515_10000034 Ga0307515_10000034316 153
493 3300028794 Ga0307515_10018885 Ga0307515_100188858 153
494 3300028794 Ga0307515_10271307 Ga0307515_102713072 153
495 3300030521 Ga0307511_10028923 Ga0307511_100289234 153
496 3300031240 Ga0265320_10054034 Ga0265320_100540342 153
497 3300031250 Ga0265331_10068472 Ga0265331_100684722 153
498 3300031456 Ga0307513_10515171 Ga0307513_105151712 153
499 3300031548 Ga0307408_100093008 Ga0307408_1000930083 153
500 3300031548 Ga0307408_100329535 Ga0307408_1003295352 153
501 3300031548 Ga0307408_100851507 Ga0307408_1008515072 153
502 3300031730 Ga0307516_10003296 Ga0307516_100032966 153
503 3300031730 Ga0307516_10020560 Ga0307516_100205604 153
504 3300031731 Ga0307405_10085115 Ga0307405_100851153 153
505 3300031903 Ga0307407_10007279 Ga0307407_100072792 153
506 3300032002 Ga0307416_100053978 Ga0307416_1000539785 153
507 3300032002 Ga0307416_101032367 Ga0307416_1010323672 153
508 3300032126 Ga0307415_101211109 Ga0307415_1012111091 153
509 3300034816 Ga0373930_0010975 Ga0373930_0010975_789_1289 153
510 3300035088 Ga0373940_0010835 Ga0373940_0010835_421_921 153
511 3300035114 Ga0373939_0049193 Ga0373939_0049193_225_725 153
512 3300035171 Ga0373946_0094085 Ga0373946_0094085_75_557 153
513 3300035242 Ga0373962_0007567 Ga0373962_0007567_478_978 153
514 3300035691 Ga0373931_0006633 Ga0373931_0006633_1361_1861 153
515 3300035691 Ga0373931_0128858 Ga0373931_0128858_847_1320 153
516 3300035691 Ga0373931_0494448 Ga0373931_0494448_234_728 153
517 3300035692 Ga0373935_0861804 Ga0373935_0861804_157_639 153
518 3300037068 Ga0373925_0279482 Ga0373925_0279482_842_1315 153
519 3300037312 Ga0395899_0012535 Ga0395899_0012535_865_1347 153
520 3300037312 Ga0395899_0295694 Ga0395899_0295694_194_682 153
521 3300037418 Ga0395900_0009587 Ga0395900_0009587_5035_5577 153
522 3300037418 Ga0395900_0115638 Ga0395900_0115638_675_1157 153
523 3300037418 Ga0395900_0145253 Ga0395900_0145253_1614_2096 153
524 3300037418 Ga0395900_0240303 Ga0395900_0240303_1073_1561 153
525 3300037418 Ga0395900_0707581 Ga0395900_0707581_33_521 153
526 3300037466 Ga0395898_0191039 Ga0395898_0191039_1126_1614 153
527 3300037466 Ga0395898_0211074 Ga0395898_0211074_935_1417 153
528 3300037471 Ga0395905_0000883 Ga0395905_0000883_3352_3834 153
529 3300037471 Ga0395905_0010764 Ga0395905_0010764_4994_5494 153
530 3300037471 Ga0395905_0020602 Ga0395905_0020602_2464_2949 153
531 3300037471 Ga0395905_0317436 Ga0395905_0317436_253_735 153
532 3300037471 Ga0395905_0415180 Ga0395905_0415180_23_526 153
533 3300038443 Ga0395901_0004759 Ga0395901_0004759_686_1174 153
534 3300038443 Ga0395901_0015549 Ga0395901_0015549_2048_2530 153
535 3300038443 Ga0395901_1033885 Ga0395901_1033885_156_644 153
536 3300039437 Ga0436365_0208379 Ga0436365_0208379_650_1132 153
537 3300039437 Ga0436365_1016022 Ga0436365_1016022_1730_2233 153
538 3300039450 Ga0436363_0107667 Ga0436363_0107667_1497_1970 153
539 3300041404 Ga0439436_0003148 Ga0439436_0003148_4412_4975 153
540 3300041404 Ga0439436_0007708 Ga0439436_0007708_2593_3093 153
541 3300041406 Ga0439439_0012756 Ga0439439_0012756_517_1017 153
542 3300041406 Ga0439439_0032576 Ga0439439_0032576_42_605 153
543 3300041407 Ga0439447_020102 Ga0439447_020102_339_902 153
544 3300041411 Ga0439466_0004735 Ga0439466_0004735_4512_5075 153
545 3300041411 Ga0439466_0011107 Ga0439466_0011107_2263_2763 153
546 3300041413 Ga0439465_0035965 Ga0439465_0035965_990_1472 153
547 3300041452 Ga0451793_0211241 Ga0451793_0211241_220_717 153
548 3300041453 Ga0451797_0461082 Ga0451797_0461082_1707_2204 153
549 3300041459 Ga0451800_0593028 Ga0451800_0593028_177_650 153
550 3300041459 Ga0451800_0767295 Ga0451800_0767295_260_751 153
551 3300041463 Ga0451804_0103686 Ga0451804_0103686_242_739 153
552 3300041492 Ga0451835_0946079 Ga0451835_0946079_313_810 153
553 3300041498 Ga0451841_0631142 Ga0451841_0631142_220_717 153
554 3300041501 Ga0451845_0537950 Ga0451845_0537950_269_766 153
555 3300041509 Ga0451843_1764350 Ga0451843_1764350_284_781 153
556 3300041512 Ga0451853_2282553 Ga0451853_2282553_297_791 153
557 3300041997 Ga0439431_0005421 Ga0439431_0005421_1490_2053 153
558 3300041999 Ga0439433_0004518 Ga0439433_0004518_1411_1974 153
559 3300042002 Ga0439442_007850 Ga0439442_007850_1479_2036 153
560 3300042004 Ga0439445_0003668 Ga0439445_0003668_1807_2370 153
561 3300042006 Ga0439432_017634 Ga0439432_017634_838_1401 153
562 3300042006 Ga0439432_038634 Ga0439432_038634_863_1363 153
563 3300042007 Ga0439449_0002894 Ga0439449_0002894_4428_4991 153
564 3300042007 Ga0439449_0029030 Ga0439449_0029030_360_872 153
565 3300042007 Ga0439449_0030220 Ga0439449_0030220_427_927 153
566 3300042010 Ga0439452_004744 Ga0439452_004744_505_1005 153
567 3300042010 Ga0439452_008152 Ga0439452_008152_1312_1875 153
568 3300042014 Ga0439457_023486 Ga0439457_023486_473_1036 153
569 3300042015 Ga0439462_0005459 Ga0439462_0005459_2269_2769 153
570 3300042015 Ga0439462_0007022 Ga0439462_0007022_2058_2621 153
571 3300042125 Ga0450923_020159 Ga0450923_020159_206_706 153
572 3300042128 Ga0450897_000960 Ga0450897_000960_816_1316 153
573 3300042135 Ga0450899_028104 Ga0450899_028104_139_639 153
574 3300042145 Ga0450906_046895 Ga0450906_046895_118_618 153
575 3300042146 Ga0450907_022937 Ga0450907_022937_48_548 153
576 3300042156 Ga0439446_0047533 Ga0439446_0047533_199_699 153
577 3300042435 Ga0439434_0065141 Ga0439434_0065141_320_820 153
578 3300042532 Ga0450893_0009616 Ga0450893_0009616_800_1300 153
579 3300042876 Ga0451577_0101976 Ga0451577_0101976_1438_1914 153
580 3300044658 Ga0466972_0003747 Ga0466972_0003747_840_1355 153
581 3300044683 Ga0466965_0005827 Ga0466965_0005827_2001_2516 153
582 3300044683 Ga0466965_0107847 Ga0466965_0107847_706_1194 153
583 3300044684 Ga0466966_0010532 Ga0466966_0010532_4610_5098 153
584 3300044694 Ga0466963_0251649 Ga0466963_0251649_174_653 153
585 3300044706 Ga0466964_0008502 Ga0466964_0008502_1554_2069 153
586 3300044712 Ga0453684_1044128 Ga0453684_1044128_17_508 153
587 3300044735 Ga0466968_0011304 Ga0466968_0011304_2383_2898 153
588 3300045051 Ga0451576_0072876 Ga0451576_0072876_2569_3051 153
589 3300046453 Ga0495627_009665 Ga0495627_009665_2933_3457 153
590 3300046454 Ga0495592_0391866 Ga0495592_0391866_39_518 153
591 3300046463 Ga0495653_0395302 Ga0495653_0395302_326_805 153
592 3300046477 Ga0495664_0200440 Ga0495664_0200440_285_800 153
593 3300046512 Ga0495610_0177203 Ga0495610_0177203_233_757 153
594 3300046515 Ga0495620_0022193 Ga0495620_0022193_2397_2921 153
595 3300046516 Ga0495628_0480078 Ga0495628_0480078_227_706 153
596 3300046516 Ga0495628_0485497 Ga0495628_0485497_102_587 153
597 3300046520 Ga0495637_0021694 Ga0495637_0021694_1025_1549 153
598 3300046530 Ga0495654_0002010 Ga0495654_0002010_9670_10179 153
599 3300046558 Ga0495633_0246467 Ga0495633_0246467_232_756 153
600 3300046660 Ga0495625_0154116 Ga0495625_0154116_375_899 153
601 3300046665 Ga0495661_0282655 Ga0495661_0282655_250_774 153
602 3300046692 Ga0495671_0005355 Ga0495671_0005355_2719_3243 153
603 3300046810 Ga0495660_0374002 Ga0495660_0374002_24_548 153
604 3300047319 Ga0495674_1201294 Ga0495674_1201294_56_553 153
605 3300047320 Ga0495672_0166756 Ga0495672_0166756_314_793 153
606 3300047321 Ga0495676_0638229 Ga0495676_0638229_49_534 153
607 3300048903 Ga0496100_0019573 Ga0496100_0019573_3144_3644 153
608 3300048904 Ga0496101_0053277 Ga0496101_0053277_1781_2281 153
609 3300048905 Ga0496102_0068465 Ga0496102_0068465_2354_2854 153
610 3300048908 Ga0496105_0148386 Ga0496105_0148386_567_1067 153
611 3300048909 Ga0496106_0015833 Ga0496106_0015833_2916_3416 153
612 3300048910 Ga0496107_0004328 Ga0496107_0004328_6428_6928 153
613 3300048911 Ga0496108_0104079 Ga0496108_0104079_1218_1718 153
614 3300048912 Ga0496109_0095016 Ga0496109_0095016_484_984 153
615 3300048912 Ga0496109_0766675 Ga0496109_0766675_323_823 153
616 3300048913 Ga0496110_0299570 Ga0496110_0299570_16_516 153
617 3300048914 Ga0496111_0031530 Ga0496111_0031530_2152_2652 153
618 3300048917 Ga0496114_0097804 Ga0496114_0097804_1361_1861 153
619 3300048918 Ga0496115_0033835 Ga0496115_0033835_596_1096 153
620 3300048924 Ga0496121_0239264 Ga0496121_0239264_734_1207 153
621 3300048924 Ga0496121_0757043 Ga0496121_0757043_10_486 153
622 3300048929 Ga0496126_0014536 Ga0496126_0014536_6572_7045 153
623 3300048929 Ga0496126_0083272 Ga0496126_0083272_385_873 153
624 3300049571 Ga0501034_0287736 Ga0501034_0287736_726_1205 153
625 3300049571 Ga0501034_0514116 Ga0501034_0514116_227_694 153
626 3300049572 Ga0501036_0023593 Ga0501036_0023593_199_666 153
627 3300049572 Ga0501036_0163149 Ga0501036_0163149_1224_1724 153
628 3300049573 Ga0501037_0387929 Ga0501037_0387929_91_558 153
629 3300049573 Ga0501037_0499091 Ga0501037_0499091_174_677 153
630 3300049574 Ga0501038_0681013 Ga0501038_0681013_31_498 153
631 3300049575 Ga0501039_0055156 Ga0501039_0055156_33_536 153
632 3300049576 Ga0501040_0001677 Ga0501040_0001677_13378_13881 153
633 3300049576 Ga0501040_0005535 Ga0501040_0005535_2668_3135 153
634 3300049577 Ga0501041_0003272 Ga0501041_0003272_7777_8280 153
635 3300049577 Ga0501041_0004599 Ga0501041_0004599_2086_2553 153
636 3300049578 Ga0501042_0018555 Ga0501042_0018555_1093_1560 153
637 3300049578 Ga0501042_0024465 Ga0501042_0024465_3273_3776 153
638 3300049579 Ga0501043_0000573 Ga0501043_0000573_2340_2849 153
639 3300049579 Ga0501043_0566612 Ga0501043_0566612_149_616 153
640 3300049580 Ga0501046_0000752 Ga0501046_0000752_2388_2897 153
641 3300049580 Ga0501046_0014242 Ga0501046_0014242_868_1371 153
642 3300049580 Ga0501046_0019277 Ga0501046_0019277_4059_4526 153
643 3300049580 Ga0501046_0805325 Ga0501046_0805325_111_611 153
644 3300049581 Ga0501047_0000298 Ga0501047_0000298_2287_2796 153
645 3300049581 Ga0501047_0005437 Ga0501047_0005437_5104_5589 153
646 3300049582 Ga0501048_0003640 Ga0501048_0003640_2476_2985 153
647 3300049582 Ga0501048_0012421 Ga0501048_0012421_2423_2890 153
648 3300049582 Ga0501048_0134828 Ga0501048_0134828_870_1370 153
649 3300049582 Ga0501048_0750661 Ga0501048_0750661_166_663 153
650 3300049584 Ga0501068_0047704 Ga0501068_0047704_931_1398 153
651 3300049584 Ga0501068_0192506 Ga0501068_0192506_179_670 153
652 3300049584 Ga0501068_0508668 Ga0501068_0508668_223_726 153
653 3300049585 Ga0501069_0277742 Ga0501069_0277742_241_729 153
654 3300049586 Ga0501070_0061210 Ga0501070_0061210_584_1069 153
655 3300049587 Ga0501071_0048023 Ga0501071_0048023_2558_3046 153
656 3300049587 Ga0501071_0058241 Ga0501071_0058241_789_1286 153
657 3300049587 Ga0501071_0164637 Ga0501071_0164637_971_1471 153
658 3300049588 Ga0501072_0034140 Ga0501072_0034140_2313_2816 153
659 3300049589 Ga0501073_0109059 Ga0501073_0109059_170_673 153
660 3300049589 Ga0501073_0204780 Ga0501073_0204780_143_610 153
661 3300049589 Ga0501073_0245596 Ga0501073_0245596_45_539 153
662 3300049590 Ga0501074_0057744 Ga0501074_0057744_688_1191 153
663 3300049590 Ga0501074_0078648 Ga0501074_0078648_1624_2103 153
664 3300049590 Ga0501074_0265037 Ga0501074_0265037_632_1099 153
665 3300049591 Ga0501075_0009539 Ga0501075_0009539_6235_6738 153
666 3300049591 Ga0501075_0011038 Ga0501075_0011038_2773_3273 153
667 3300049591 Ga0501075_0026233 Ga0501075_0026233_3144_3611 153
668 3300049592 Ga0501076_0080875 Ga0501076_0080875_1681_2148 153
669 3300049592 Ga0501076_0085239 Ga0501076_0085239_1583_2086 153
670 3300049592 Ga0501076_0263667 Ga0501076_0263667_824_1312 153
671 3300049593 Ga0501077_0013790 Ga0501077_0013790_874_1362 153
672 3300049593 Ga0501077_0305422 Ga0501077_0305422_203_706 153
673 3300049682 Ga0501252_033465 Ga0501252_033465_199_693 153
674 3300049741 Ga0501079_0005863 Ga0501079_0005863_7611_8078 153
675 3300049741 Ga0501079_0278273 Ga0501079_0278273_453_956 153
676 3300049741 Ga0501079_0781858 Ga0501079_0781858_272_736 153
677 3300049742 Ga0501080_0002090 Ga0501080_0002090_1971_2456 153
678 3300049742 Ga0501080_0010278 Ga0501080_0010278_3743_4231 153
679 3300049742 Ga0501080_0082448 Ga0501080_0082448_217_684 153
680 3300049742 Ga0501080_0123510 Ga0501080_0123510_341_844 153
681 3300049742 Ga0501080_0367905 Ga0501080_0367905_458_958 153
682 3300049743 Ga0501081_0005137 Ga0501081_0005137_1732_2199 153
683 3300049743 Ga0501081_0105990 Ga0501081_0105990_201_701 153
684 3300049744 Ga0501083_0064057 Ga0501083_0064057_507_974 153
685 3300049822 Ga0501035_0200872 Ga0501035_0200872_824_1309 153
686 3300049822 Ga0501035_0776298 Ga0501035_0776298_15_482 153
687 3300049824 Ga0501045_0009696 Ga0501045_0009696_4112_4621 153
688 3300049824 Ga0501045_0017809 Ga0501045_0017809_418_885 153
689 3300049824 Ga0501045_0027684 Ga0501045_0027684_2355_2858 153
690 3300049824 Ga0501045_0042241 Ga0501045_0042241_2505_3005 153
691 3300049824 Ga0501045_0988830 Ga0501045_0988830_23_514 153
692 3300050489 nmdc:mga03683_1140_c1 nmdc:mga03683_1140_c1_1412_1894 153
693 3300050489 nmdc:mga03683_122698_c1 nmdc:mga03683_122698_c1_618_1100 153
694 3300050489 nmdc:mga03683_5158_c1 nmdc:mga03683_5158_c1_2413_2913 153
695 3300050489 nmdc:mga03683_609841_c1 nmdc:mga03683_609841_c1_46_525 153
696 3300050490 nmdc:mga03n38_282687_c1 nmdc:mga03n38_282687_c1_369_869 153
697 3300050491 nmdc:mga00v17_573807_c1 nmdc:mga00v17_573807_c1_236_718 153
698 3300050492 nmdc:mga0yw44_350879_c1 nmdc:mga0yw44_350879_c1_39_521 153
699 3300050494 nmdc:mga06z11_334771_c1 nmdc:mga06z11_334771_c1_128_610 153
700 3300050494 nmdc:mga06z11_564985_c1 nmdc:mga06z11_564985_c1_87_575 153
701 3300050495 nmdc:mga04h51_31991_c1 nmdc:mga04h51_31991_c1_432_914 153
702 3300050495 nmdc:mga04h51_36159_c1 nmdc:mga04h51_36159_c1_232_714 153
703 3300050496 nmdc:mga07m45_9139_c1 nmdc:mga07m45_9139_c1_1169_1651 153
704 3300050507 nmdc:mga05p37_108188_c1 nmdc:mga05p37_108188_c1_2111_2602 153
705 3300050507 nmdc:mga05p37_229145_c1 nmdc:mga05p37_229145_c1_1388_1861 153
706 3300050511 nmdc:mga08y16_37683_c1 nmdc:mga08y16_37683_c1_2759_3250 153
707 3300050511 nmdc:mga08y16_54_c1 nmdc:mga08y16_54_c1_71448_71942 153
708 3300050511 nmdc:mga08y16_821575_c1 nmdc:mga08y16_821575_c1_382_873 153
709 3300050512 nmdc:mga0n895_9679_c1 nmdc:mga0n895_9679_c1_4370_4861 153
710 3300050513 nmdc:mga0rr50_165557_c1 nmdc:mga0rr50_165557_c1_438_929 153
711 3300050513 nmdc:mga0rr50_765905_c1 nmdc:mga0rr50_765905_c1_272_772 153
712 3300050514 nmdc:mga08x19_509528_c1 nmdc:mga08x19_509528_c1_119_604 153
713 3300050515 nmdc:mga0a205_2327_c1 nmdc:mga0a205_2327_c1_8580_9071 153
714 3300050516 nmdc:mga0sz30_16817_c1 nmdc:mga0sz30_16817_c1_1561_2043 153
715 3300050516 nmdc:mga0sz30_16817_c1 nmdc:mga0sz30_16817_c1_868_1350 153
716 3300053079 Ga0500610_0005742 Ga0500610_0005742_1943_2467 153
717 3300053079 Ga0500610_0018232 Ga0500610_0018232_197_721 153
718 3300053085 Ga0495619_0728934 Ga0495619_0728934_163_642 153
719 3300053093 Ga0500651_0155396 Ga0500651_0155396_422_904 153
720 3300053098 Ga0500650_0284169 Ga0500650_0284169_129_617 153
721 3300053117 Ga0500593_003920 Ga0500593_003920_2031_2555 153
722 3300053131 Ga0500652_067867 Ga0500652_067867_227_751 153
723 3300053136 Ga0500559_0126437 Ga0500559_0126437_95_610 153
724 3300053153 Ga0500616_0002351 Ga0500616_0002351_573_1055 153
725 3300053161 Ga0500634_0002047 Ga0500634_0002047_2291_2815 153
726 3300053733 Ga0500552_000821 Ga0500552_000821_347_829 153
727 3300054114 Ga0501084_0011061 Ga0501084_0011061_50_553 153
728 3300054114 Ga0501084_0015960 Ga0501084_0015960_4718_5185 153
729 3300054114 Ga0501084_0367677 Ga0501084_0367677_710_1195 153
730 3300060353 Ga0501082_0003668 Ga0501082_0003668_11950_12417 153
731 3300060353 Ga0501082_0555056 Ga0501082_0555056_379_870 153
732 3300061734 Ga0530510_0016521 Ga0530510_0016521_994_1497 153
733 3300061734 Ga0530510_0054832 Ga0530510_0054832_1584_2051 153
734 3300061734 Ga0530510_0345218 Ga0530510_0345218_326_823 153
735 iso_pu_bacteria 2585428062 2587758082 153
736 iso_pu_bacteria 2643221652 2644291967 153
737 iso_pu_bacteria 2885192300 2885194328 153
738 iso_pu_bacteria 2929520902 2929526566 153
739 3300003203 JGI25406J46586_10055306 JGI25406J46586_100553062 154
740 3300005983 Ga0081540_1040152 Ga0081540_10401523 154
741 3300005985 Ga0081539_10001470 Ga0081539_1000147021 154
742 3300005985 Ga0081539_10275840 Ga0081539_102758402 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

47

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8601 2 135
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7813 2 135
4zgr-assembly1.cif.gz_A structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with t-antigen. 0.7595 54 85
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.7574 54 83
6loq-assembly1.cif.gz_A crystal structure of alpha-momorcharin in complex with camp 0.7534 54 85
ID Description Score Start End Superfamily
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7473 54 85 3.40.420.10
4z8sA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7444 54 83 3.40.420.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7435 1 101 2.170.150.70
2k7iB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.7387 56 83 3.30.160.160
1j1qA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7243 53 85 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A175WBH7-F1-model_v4 Putative glutathione-dependent formaldehyde-activating enzyme 0.9879 1 134 GO:0016846
GO:0046872
AF-A0A0R3M6V1-F1-model_v4 Aldehyde-activating protein 0.9861 1 153 GO:0016846
GO:0046872
AF-A0A2S7K7D9-F1-model_v4 Aldehyde-activating protein 0.9848 2 153 GO:0016846
GO:0046872
AF-A0A534BLW2-F1-model_v4 GFA family protein 0.9845 2 122 GO:0016846
GO:0046872
AF-A0A848H3V4-F1-model_v4 GFA family protein 0.9815 2 152 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map