F478652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 374 | 734 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300041404|Ga0439436_0003148|Ga0439436_0003148_4412_4975 |
| Length | 187 |
| Sequence | LRFARGRAKVRRTMSAIPNDPHPFPLEGGCTCRAVRYRMTTRPLFVHCCHCRWCQRETGSAFALNAMIEADRVQLLQCEIELVATPSASGKGQKIARCPHCRVALWSHYAGAGDAVCFVRVGTLDAPDHLPPDIHIFTMSKQPWVLLPPGTPAVAEYYSRAEHWPAESLARARALKASRPPAGPTAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 3 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 4 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 5 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 6 | 2906610324 | |||
| 7 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 229 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 230 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 237 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 238 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 239 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 240 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 243 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 244 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 245 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 246 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 249 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 252 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 253 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 254 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 255 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 256 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 257 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 258 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 364 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 367 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 0.27 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.33 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 85.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10055306 | 3300003203 | Bacteria | 1308 |
| 2 | JGI25404J52841_10018468 | 3300003659 | Bacteria | 1511 |
| 3 | Ga0055536_1008437 | 3300003781 | Bacteria | 4424 |
| 4 | Ga0055540_1001803 | 3300003792 | Bacteria | 12167 |
| 5 | JGI25405J52794_10060666 | 3300003911 | Bacteria | 818 |
| 6 | Ga0065704_10096637 | 3300005289 | Bacteria | 2431 |
| 7 | Ga0070658_10004903 | 3300005327 | Bacteria | 10905 |
| 8 | Ga0070658_10292523 | 3300005327 | Bacteria | 1388 |
| 9 | Ga0070676_10008737 | 3300005328 | Bacteria | 5466 |
| 10 | Ga0070683_100060012 | 3300005329 | Bacteria | 3534 |
| 11 | Ga0070683_100065267 | 3300005329 | Bacteria | 3389 |
| 12 | Ga0070683_100093284 | 3300005329 | Bacteria | 2828 |
| 13 | Ga0070690_100104351 | 3300005330 | Bacteria | 1883 |
| 14 | Ga0070670_100136543 | 3300005331 | Bacteria | 2119 |
| 15 | Ga0070670_100611844 | 3300005331 | Bacteria | 975 |
| 16 | Ga0070670_100932427 | 3300005331 | Bacteria | 788 |
| 17 | Ga0068869_100003076 | 3300005334 | Bacteria | 10155 |
| 18 | Ga0070666_10260613 | 3300005335 | Bacteria | 1229 |
| 19 | Ga0070680_100043420 | 3300005336 | Bacteria | 3652 |
| 20 | Ga0070680_100572697 | 3300005336 | Bacteria | 968 |
| 21 | Ga0070682_100022201 | 3300005337 | Bacteria | 3756 |
| 22 | Ga0070682_100434821 | 3300005337 | Bacteria | 1001 |
| 23 | Ga0070682_100605306 | 3300005337 | Bacteria | 866 |
| 24 | Ga0068868_100006730 | 3300005338 | Bacteria | 8160 |
| 25 | Ga0068868_100088596 | 3300005338 | Bacteria | 2491 |
| 26 | Ga0070660_100040061 | 3300005339 | Bacteria | 3564 |
| 27 | Ga0070660_100319412 | 3300005339 | Bacteria | 1275 |
| 28 | Ga0070687_100390302 | 3300005343 | Bacteria | 910 |
| 29 | Ga0070661_100008214 | 3300005344 | Bacteria | 7201 |
| 30 | Ga0070661_100069065 | 3300005344 | Bacteria | 2597 |
| 31 | Ga0070661_100116416 | 3300005344 | Bacteria | 1999 |
| 32 | Ga0070692_10311318 | 3300005345 | Bacteria | 965 |
| 33 | Ga0070668_100009361 | 3300005347 | Bacteria | 7266 |
| 34 | Ga0070668_100094910 | 3300005347 | Bacteria | 2355 |
| 35 | Ga0070668_100628639 | 3300005347 | Bacteria | 942 |
| 36 | Ga0070669_100032735 | 3300005353 | Bacteria | 3756 |
| 37 | Ga0070669_100449332 | 3300005353 | Bacteria | 1062 |
| 38 | Ga0070669_100581184 | 3300005353 | Bacteria | 937 |
| 39 | Ga0070675_100001332 | 3300005354 | Bacteria | 18063 |
| 40 | Ga0070675_100009544 | 3300005354 | Bacteria | 7549 |
| 41 | Ga0070675_100145716 | 3300005354 | Bacteria | 2027 |
| 42 | Ga0070671_100370767 | 3300005355 | Bacteria | 1223 |
| 43 | Ga0070671_100565684 | 3300005355 | Bacteria | 981 |
| 44 | Ga0070674_100617468 | 3300005356 | Bacteria | 918 |
| 45 | Ga0070674_100934981 | 3300005356 | Bacteria | 757 |
| 46 | Ga0070673_100019233 | 3300005364 | Bacteria | 4902 |
| 47 | Ga0070673_100274085 | 3300005364 | Bacteria | 1478 |
| 48 | Ga0070688_100156917 | 3300005365 | Bacteria | 1560 |
| 49 | Ga0070659_100006591 | 3300005366 | Bacteria | 8385 |
| 50 | Ga0070659_100021473 | 3300005366 | Bacteria | 4917 |
| 51 | Ga0070659_100029753 | 3300005366 | Bacteria | 4221 |
| 52 | Ga0070667_100151577 | 3300005367 | Bacteria | 2037 |
| 53 | Ga0070667_100184786 | 3300005367 | Bacteria | 1845 |
| 54 | Ga0070667_100222687 | 3300005367 | Bacteria | 1680 |
| 55 | Ga0070667_100331904 | 3300005367 | Bacteria | 1374 |
| 56 | Ga0070709_10154543 | 3300005434 | Bacteria | 1589 |
| 57 | Ga0070714_100179753 | 3300005435 | Bacteria | 1924 |
| 58 | Ga0070713_100094954 | 3300005436 | Bacteria | 2571 |
| 59 | Ga0070713_100229022 | 3300005436 | Bacteria | 1689 |
| 60 | Ga0070701_10155143 | 3300005438 | Bacteria | 1322 |
| 61 | Ga0070705_100389088 | 3300005440 | Bacteria | 1029 |
| 62 | Ga0070694_100444842 | 3300005444 | Bacteria | 1022 |
| 63 | Ga0070663_100004462 | 3300005455 | Bacteria | 8235 |
| 64 | Ga0070678_100020170 | 3300005456 | Bacteria | 4368 |
| 65 | Ga0070678_100200248 | 3300005456 | Bacteria | 1647 |
| 66 | Ga0070662_100001945 | 3300005457 | Bacteria | 12698 |
| 67 | Ga0070662_100074926 | 3300005457 | Bacteria | 2505 |
| 68 | Ga0070662_100087750 | 3300005457 | Bacteria | 2330 |
| 69 | Ga0070681_10001057 | 3300005458 | Bacteria | 23417 |
| 70 | Ga0070681_10043520 | 3300005458 | Bacteria | 4498 |
| 71 | Ga0070681_10235580 | 3300005458 | Bacteria | 1744 |
| 72 | Ga0070681_10339154 | 3300005458 | Bacteria | 1413 |
| 73 | Ga0070681_10361123 | 3300005458 | Bacteria | 1363 |
| 74 | Ga0070681_10420942 | 3300005458 | Bacteria | 1248 |
| 75 | Ga0068867_100224621 | 3300005459 | Bacteria | 1515 |
| 76 | Ga0068867_100698835 | 3300005459 | Bacteria | 895 |
| 77 | Ga0070706_100091293 | 3300005467 | Bacteria | 2824 |
| 78 | Ga0070698_100001208 | 3300005471 | Bacteria | 28691 |
| 79 | Ga0070699_100128414 | 3300005518 | Bacteria | 2234 |
| 80 | Ga0070679_100002239 | 3300005530 | Bacteria | 17474 |
| 81 | Ga0070679_100027302 | 3300005530 | Bacteria | 5617 |
| 82 | Ga0070679_100062734 | 3300005530 | Bacteria | 3705 |
| 83 | Ga0070679_100071601 | 3300005530 | Bacteria | 3457 |
| 84 | Ga0070679_100248698 | 3300005530 | Bacteria | 1734 |
| 85 | Ga0070684_100028635 | 3300005535 | Bacteria | 4713 |
| 86 | Ga0070684_100051865 | 3300005535 | Bacteria | 3565 |
| 87 | Ga0070684_100210190 | 3300005535 | Bacteria | 1773 |
| 88 | Ga0070684_101355003 | 3300005535 | Bacteria | 670 |
| 89 | Ga0070697_100275317 | 3300005536 | Bacteria | 1443 |
| 90 | Ga0068853_100030678 | 3300005539 | Bacteria | 4542 |
| 91 | Ga0068853_100034435 | 3300005539 | Bacteria | 4299 |
| 92 | Ga0068853_100073542 | 3300005539 | Bacteria | 2980 |
| 93 | Ga0068853_100199327 | 3300005539 | Bacteria | 1821 |
| 94 | Ga0068853_100691977 | 3300005539 | Bacteria | 972 |
| 95 | Ga0068853_100885602 | 3300005539 | Bacteria | 857 |
| 96 | Ga0070672_100008896 | 3300005543 | Bacteria | 6897 |
| 97 | Ga0070672_100062557 | 3300005543 | Bacteria | 2937 |
| 98 | Ga0070672_100070593 | 3300005543 | Bacteria | 2776 |
| 99 | Ga0070672_100851877 | 3300005543 | Bacteria | 804 |
| 100 | Ga0070695_100022143 | 3300005545 | Bacteria | 3896 |
| 101 | Ga0070693_100015270 | 3300005547 | Bacteria | 3952 |
| 102 | Ga0070665_100046991 | 3300005548 | Bacteria | 4333 |
| 103 | Ga0070665_101486032 | 3300005548 | Bacteria | 686 |
| 104 | Ga0070704_100457546 | 3300005549 | Bacteria | 1100 |
| 105 | Ga0068855_100008812 | 3300005563 | Bacteria | 12194 |
| 106 | Ga0068855_100031980 | 3300005563 | Bacteria | 6282 |
| 107 | Ga0068855_100049234 | 3300005563 | Bacteria | 4971 |
| 108 | Ga0068855_100051023 | 3300005563 | Bacteria | 4874 |
| 109 | Ga0068855_100118175 | 3300005563 | Bacteria | 3037 |
| 110 | Ga0068855_100379473 | 3300005563 | Bacteria | 1552 |
| 111 | Ga0068855_100831048 | 3300005563 | Bacteria | 980 |
| 112 | Ga0070664_100086137 | 3300005564 | Bacteria | 2714 |
| 113 | Ga0070664_100154124 | 3300005564 | Bacteria | 2029 |
| 114 | Ga0068857_100059280 | 3300005577 | Bacteria | 3400 |
| 115 | Ga0068857_100159007 | 3300005577 | Bacteria | 2050 |
| 116 | Ga0068854_100006691 | 3300005578 | Bacteria | 7347 |
| 117 | Ga0068854_100062380 | 3300005578 | Bacteria | 2702 |
| 118 | Ga0068856_100004796 | 3300005614 | Bacteria | 13406 |
| 119 | Ga0068856_100052398 | 3300005614 | Bacteria | 4024 |
| 120 | Ga0068856_100085508 | 3300005614 | Bacteria | 3133 |
| 121 | Ga0068856_100149251 | 3300005614 | Bacteria | 2346 |
| 122 | Ga0068856_100236682 | 3300005614 | Bacteria | 1841 |
| 123 | Ga0068856_100432497 | 3300005614 | Bacteria | 1336 |
| 124 | Ga0070702_100224909 | 3300005615 | Bacteria | 1257 |
| 125 | Ga0068852_100000615 | 3300005616 | Bacteria | 23368 |
| 126 | Ga0068852_100001686 | 3300005616 | Bacteria | 15048 |
| 127 | Ga0068852_100085852 | 3300005616 | Bacteria | 2804 |
| 128 | Ga0068852_100275740 | 3300005616 | Bacteria | 1620 |
| 129 | Ga0068852_100380885 | 3300005616 | Bacteria | 1384 |
| 130 | Ga0068852_101033626 | 3300005616 | Bacteria | 841 |
| 131 | Ga0068859_100219748 | 3300005617 | Bacteria | 1987 |
| 132 | Ga0068859_100305303 | 3300005617 | Bacteria | 1685 |
| 133 | Ga0068864_100028438 | 3300005618 | Bacteria | 4725 |
| 134 | Ga0068864_100806211 | 3300005618 | Bacteria | 923 |
| 135 | Ga0068861_100000384 | 3300005719 | Bacteria | 25460 |
| 136 | Ga0068861_100019833 | 3300005719 | Bacteria | 4806 |
| 137 | Ga0068861_100227768 | 3300005719 | Bacteria | 1579 |
| 138 | Ga0068851_10008669 | 3300005834 | Bacteria | 4709 |
| 139 | Ga0068851_10034847 | 3300005834 | Bacteria | 2514 |
| 140 | Ga0068870_10125636 | 3300005840 | Bacteria | 1483 |
| 141 | Ga0068858_100027002 | 3300005842 | Bacteria | 5333 |
| 142 | Ga0068858_100045670 | 3300005842 | Bacteria | 4060 |
| 143 | Ga0068860_100007870 | 3300005843 | Bacteria | 10641 |
| 144 | Ga0068860_100021841 | 3300005843 | Bacteria | 6192 |
| 145 | Ga0068860_100355931 | 3300005843 | Bacteria | 1441 |
| 146 | Ga0068862_100127742 | 3300005844 | Bacteria | 2246 |
| 147 | Ga0068862_100241341 | 3300005844 | Bacteria | 1643 |
| 148 | Ga0068862_100305993 | 3300005844 | Bacteria | 1464 |
| 149 | Ga0068862_101105251 | 3300005844 | Bacteria | 788 |
| 150 | Ga0081455_10001734 | 3300005937 | Bacteria | 26379 |
| 151 | Ga0081455_10017747 | 3300005937 | Bacteria | 6807 |
| 152 | Ga0081455_10063978 | 3300005937 | Bacteria | 3083 |
| 153 | Ga0081455_10667880 | 3300005937 | Bacteria | 666 |
| 154 | Ga0081540_1001682 | 3300005983 | Bacteria | 18799 |
| 155 | Ga0081540_1040152 | 3300005983 | Bacteria | 2443 |
| 156 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 157 | Ga0081539_10001294 | 3300005985 | Bacteria | 43916 |
| 158 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 159 | Ga0081539_10041426 | 3300005985 | Bacteria | 2692 |
| 160 | Ga0081539_10275840 | 3300005985 | Bacteria | 734 |
| 161 | Ga0070717_10056285 | 3300006028 | Bacteria | 3248 |
| 162 | Ga0070717_10826012 | 3300006028 | Bacteria | 843 |
| 163 | Ga0070717_11199538 | 3300006028 | Bacteria | 691 |
| 164 | Ga0075368_10192414 | 3300006042 | Bacteria | 862 |
| 165 | Ga0075362_10007616 | 3300006177 | Bacteria | 4113 |
| 166 | Ga0075362_10015283 | 3300006177 | Bacteria | 3119 |
| 167 | Ga0075362_10039087 | 3300006177 | Bacteria | 2085 |
| 168 | Ga0075362_10165403 | 3300006177 | Bacteria | 1067 |
| 169 | Ga0075367_10142406 | 3300006178 | Bacteria | 1485 |
| 170 | Ga0075367_10198578 | 3300006178 | Bacteria | 1253 |
| 171 | Ga0075369_10005411 | 3300006186 | Bacteria | 4770 |
| 172 | Ga0075369_10194647 | 3300006186 | Bacteria | 935 |
| 173 | Ga0097621_100190080 | 3300006237 | Bacteria | 1778 |
| 174 | Ga0097621_100524986 | 3300006237 | Bacteria | 1075 |
| 175 | Ga0097621_101206025 | 3300006237 | Bacteria | 713 |
| 176 | Ga0075370_10012362 | 3300006353 | Bacteria | 4510 |
| 177 | Ga0068871_100036905 | 3300006358 | Bacteria | 3894 |
| 178 | Ga0068871_100129082 | 3300006358 | Bacteria | 2142 |
| 179 | Ga0068871_100192582 | 3300006358 | Bacteria | 1757 |
| 180 | Ga0068871_101320468 | 3300006358 | Bacteria | 679 |
| 181 | Ga0075428_100001751 | 3300006844 | Bacteria | 23186 |
| 182 | Ga0075433_10099961 | 3300006852 | Bacteria | 2568 |
| 183 | Ga0075433_10100388 | 3300006852 | Bacteria | 2562 |
| 184 | Ga0075434_100000816 | 3300006871 | Bacteria | 24729 |
| 185 | Ga0075434_100195892 | 3300006871 | Bacteria | 2040 |
| 186 | Ga0075434_100419668 | 3300006871 | Bacteria | 1359 |
| 187 | Ga0075434_100467802 | 3300006871 | Unclassified | 1282 |
| 188 | Ga0068865_100019910 | 3300006881 | Bacteria | 4347 |
| 189 | Ga0075436_100487470 | 3300006914 | Bacteria | 901 |
| 190 | Ga0097620_100219755 | 3300006931 | Bacteria | 1987 |
| 191 | Ga0097620_100305324 | 3300006931 | Bacteria | 1685 |
| 192 | Ga0097620_101859227 | 3300006931 | Bacteria | 665 |
| 193 | Ga0075435_100027706 | 3300007076 | Bacteria | 4435 |
| 194 | Ga0075435_100484954 | 3300007076 | Bacteria | 1068 |
| 195 | Ga0075435_100838637 | 3300007076 | Bacteria | 801 |
| 196 | Ga0105251_10306120 | 3300009011 | Bacteria | 721 |
| 197 | Ga0105244_10078389 | 3300009036 | Bacteria | 1638 |
| 198 | Ga0105240_10004485 | 3300009093 | Bacteria | 21237 |
| 199 | Ga0105240_10005388 | 3300009093 | Bacteria | 19075 |
| 200 | Ga0105240_10520545 | 3300009093 | Bacteria | 1320 |
| 201 | Ga0111539_10004025 | 3300009094 | Bacteria | 19296 |
| 202 | Ga0111539_11133167 | 3300009094 | Bacteria | 909 |
| 203 | Ga0105245_10021575 | 3300009098 | Bacteria | 5652 |
| 204 | Ga0105247_10391516 | 3300009101 | Bacteria | 988 |
| 205 | Ga0114129_10004052 | 3300009147 | Bacteria | 20681 |
| 206 | Ga0105243_10001608 | 3300009148 | Bacteria | 19691 |
| 207 | Ga0105241_10003669 | 3300009174 | Bacteria | 11403 |
| 208 | Ga0105241_10067234 | 3300009174 | Bacteria | 2773 |
| 209 | Ga0105241_10070482 | 3300009174 | Bacteria | 2712 |
| 210 | Ga0105241_10279328 | 3300009174 | Bacteria | 1425 |
| 211 | Ga0105248_10007485 | 3300009177 | Bacteria | 11977 |
| 212 | Ga0105248_10251994 | 3300009177 | Bacteria | 1987 |
| 213 | Ga0105237_10126533 | 3300009545 | Bacteria | 2550 |
| 214 | Ga0105237_10223013 | 3300009545 | Bacteria | 1885 |
| 215 | Ga0105237_10312041 | 3300009545 | Bacteria | 1576 |
| 216 | Ga0105238_10005726 | 3300009551 | Bacteria | 12285 |
| 217 | Ga0105238_10010115 | 3300009551 | Bacteria | 9456 |
| 218 | Ga0105238_10027853 | 3300009551 | Bacteria | 5758 |
| 219 | Ga0105238_10041404 | 3300009551 | Bacteria | 4665 |
| 220 | Ga0105238_11012070 | 3300009551 | Bacteria | 852 |
| 221 | Ga0105249_10113389 | 3300009553 | Bacteria | 2565 |
| 222 | Ga0105030_100276 | 3300009987 | Bacteria | 4454 |
| 223 | Ga0105239_10081049 | 3300010375 | Bacteria | 3572 |
| 224 | Ga0157347_1011671 | 3300012502 | Bacteria | 937 |
| 225 | Ga0157373_10010816 | 3300013100 | Bacteria | 6717 |
| 226 | Ga0157373_10072075 | 3300013100 | Bacteria | 2439 |
| 227 | Ga0157371_10054153 | 3300013102 | Bacteria | 2849 |
| 228 | Ga0157371_10958005 | 3300013102 | Bacteria | 651 |
| 229 | Ga0157370_10006388 | 3300013104 | Bacteria | 13010 |
| 230 | Ga0157370_10010672 | 3300013104 | Bacteria | 9663 |
| 231 | Ga0157370_10140960 | 3300013104 | Bacteria | 2246 |
| 232 | Ga0157370_10749837 | 3300013104 | Bacteria | 890 |
| 233 | Ga0157369_10022153 | 3300013105 | Bacteria | 7098 |
| 234 | Ga0157369_10081473 | 3300013105 | Bacteria | 3464 |
| 235 | Ga0157369_10135626 | 3300013105 | Bacteria | 2606 |
| 236 | Ga0157369_10523144 | 3300013105 | Bacteria | 1227 |
| 237 | Ga0157374_10078442 | 3300013296 | Bacteria | 3128 |
| 238 | Ga0157374_10089163 | 3300013296 | Bacteria | 2938 |
| 239 | Ga0163162_10000830 | 3300013306 | Bacteria | 28736 |
| 240 | Ga0163162_11051101 | 3300013306 | Bacteria | 922 |
| 241 | Ga0157372_10010331 | 3300013307 | Bacteria | 9920 |
| 242 | Ga0157372_10015817 | 3300013307 | Bacteria | 8093 |
| 243 | Ga0157372_10147351 | 3300013307 | Bacteria | 2714 |
| 244 | Ga0157372_10192002 | 3300013307 | Bacteria | 2365 |
| 245 | Ga0157372_10824481 | 3300013307 | Bacteria | 1077 |
| 246 | Ga0157372_10867425 | 3300013307 | Bacteria | 1048 |
| 247 | Ga0157375_10112491 | 3300013308 | Bacteria | 2823 |
| 248 | Ga0157375_11103786 | 3300013308 | Bacteria | 929 |
| 249 | Ga0157514_125748 | 3300013874 | Bacteria | 1492 |
| 250 | Ga0157380_10008236 | 3300014326 | Bacteria | 7428 |
| 251 | Ga0157380_10033720 | 3300014326 | Bacteria | 3944 |
| 252 | Ga0157380_10245494 | 3300014326 | Bacteria | 1617 |
| 253 | Ga0182008_10159318 | 3300014497 | Bacteria | 1135 |
| 254 | Ga0182008_10262274 | 3300014497 | Bacteria | 894 |
| 255 | Ga0182008_10419587 | 3300014497 | Bacteria | 722 |
| 256 | Ga0157377_10112496 | 3300014745 | Bacteria | 1638 |
| 257 | Ga0157379_10001870 | 3300014968 | Bacteria | 17410 |
| 258 | Ga0157379_10014560 | 3300014968 | Bacteria | 6901 |
| 259 | Ga0157376_10011825 | 3300014969 | Bacteria | 6453 |
| 260 | Ga0157376_10808996 | 3300014969 | Bacteria | 950 |
| 261 | Ga0182006_1023666 | 3300015261 | Bacteria | 2542 |
| 262 | Ga0182006_1051890 | 3300015261 | Bacteria | 1577 |
| 263 | Ga0182005_1052785 | 3300015265 | Bacteria | 1107 |
| 264 | Ga0163161_10033820 | 3300017792 | Bacteria | 3653 |
| 265 | Ga0163161_10849548 | 3300017792 | Bacteria | 770 |
| 266 | Ga0197907_10899683 | 3300020069 | Bacteria | 604 |
| 267 | Ga0206353_10916553 | 3300020082 | Bacteria | 3787 |
| 268 | Ga0213873_10222063 | 3300021358 | Bacteria | 592 |
| 269 | Ga0213876_10151763 | 3300021384 | Bacteria | 1232 |
| 270 | Ga0209676_1000346 | 3300025292 | Bacteria | 87684 |
| 271 | Ga0209676_1094387 | 3300025292 | Bacteria | 650 |
| 272 | Ga0209051_1000284 | 3300025303 | Bacteria | 82589 |
| 273 | Ga0209051_1000446 | 3300025303 | Bacteria | 55218 |
| 274 | Ga0209257_1016774 | 3300025304 | Bacteria | 2937 |
| 275 | Ga0207697_10050884 | 3300025315 | Bacteria | 1711 |
| 276 | Ga0207697_10107830 | 3300025315 | Bacteria | 1191 |
| 277 | Ga0207656_10023822 | 3300025321 | Bacteria | 2469 |
| 278 | Ga0207656_10298542 | 3300025321 | Bacteria | 797 |
| 279 | Ga0207710_10157475 | 3300025900 | Bacteria | 1104 |
| 280 | Ga0207688_10047326 | 3300025901 | Bacteria | 2402 |
| 281 | Ga0207680_10171283 | 3300025903 | Bacteria | 1462 |
| 282 | Ga0207647_10135962 | 3300025904 | Bacteria | 1442 |
| 283 | Ga0207645_10029005 | 3300025907 | Bacteria | 3567 |
| 284 | Ga0207645_10034706 | 3300025907 | Bacteria | 3241 |
| 285 | Ga0207645_10209618 | 3300025907 | Bacteria | 1283 |
| 286 | Ga0207643_10030417 | 3300025908 | Bacteria | 3005 |
| 287 | Ga0207705_10138462 | 3300025909 | Bacteria | 1816 |
| 288 | Ga0207705_10180664 | 3300025909 | Bacteria | 1592 |
| 289 | Ga0207654_10020632 | 3300025911 | Bacteria | 3496 |
| 290 | Ga0207654_10038141 | 3300025911 | Bacteria | 2694 |
| 291 | Ga0207654_10059670 | 3300025911 | Bacteria | 2226 |
| 292 | Ga0207654_10087143 | 3300025911 | Bacteria | 1894 |
| 293 | Ga0207707_10005989 | 3300025912 | Bacteria | 10642 |
| 294 | Ga0207707_10198647 | 3300025912 | Bacteria | 1749 |
| 295 | Ga0207707_10249186 | 3300025912 | Bacteria | 1543 |
| 296 | Ga0207707_10305204 | 3300025912 | Bacteria | 1376 |
| 297 | Ga0207707_10408934 | 3300025912 | Bacteria | 1164 |
| 298 | Ga0207695_10006376 | 3300025913 | Bacteria | 15351 |
| 299 | Ga0207695_10020075 | 3300025913 | Bacteria | 7667 |
| 300 | Ga0207695_10023115 | 3300025913 | Bacteria | 7035 |
| 301 | Ga0207671_10066078 | 3300025914 | Bacteria | 2691 |
| 302 | Ga0207671_10131025 | 3300025914 | Bacteria | 1924 |
| 303 | Ga0207671_10212401 | 3300025914 | Bacteria | 1514 |
| 304 | Ga0207660_10089498 | 3300025917 | Bacteria | 2279 |
| 305 | Ga0207660_10196334 | 3300025917 | Bacteria | 1574 |
| 306 | Ga0207662_10157113 | 3300025918 | Bacteria | 1450 |
| 307 | Ga0207657_10000142 | 3300025919 | Bacteria | 72309 |
| 308 | Ga0207657_10032616 | 3300025919 | Bacteria | 4703 |
| 309 | Ga0207657_10191922 | 3300025919 | Bacteria | 1647 |
| 310 | Ga0207649_10025495 | 3300025920 | Bacteria | 3447 |
| 311 | Ga0207649_10034563 | 3300025920 | Bacteria | 3030 |
| 312 | Ga0207652_10021625 | 3300025921 | Bacteria | 5310 |
| 313 | Ga0207652_10036122 | 3300025921 | Bacteria | 4176 |
| 314 | Ga0207652_10075818 | 3300025921 | Bacteria | 2931 |
| 315 | Ga0207652_10119723 | 3300025921 | Bacteria | 2341 |
| 316 | Ga0207652_10622321 | 3300025921 | Unclassified | 967 |
| 317 | Ga0207681_10043206 | 3300025923 | Bacteria | 3015 |
| 318 | Ga0207681_10043214 | 3300025923 | Bacteria | 3015 |
| 319 | Ga0207681_10078926 | 3300025923 | Bacteria | 2318 |
| 320 | Ga0207694_10023532 | 3300025924 | Bacteria | 4676 |
| 321 | Ga0207694_10023870 | 3300025924 | Bacteria | 4644 |
| 322 | Ga0207694_10032630 | 3300025924 | Bacteria | 3987 |
| 323 | Ga0207694_10109709 | 3300025924 | Bacteria | 2194 |
| 324 | Ga0207694_10275402 | 3300025924 | Bacteria | 1381 |
| 325 | Ga0207650_10646730 | 3300025925 | Bacteria | 891 |
| 326 | Ga0207659_10004432 | 3300025926 | Bacteria | 8491 |
| 327 | Ga0207659_10013115 | 3300025926 | Bacteria | 5299 |
| 328 | Ga0207659_10052279 | 3300025926 | Bacteria | 2910 |
| 329 | Ga0207700_10032738 | 3300025928 | Bacteria | 3712 |
| 330 | Ga0207664_10031551 | 3300025929 | Bacteria | 4054 |
| 331 | Ga0207664_10058301 | 3300025929 | Bacteria | 3071 |
| 332 | Ga0207664_10087250 | 3300025929 | Bacteria | 2550 |
| 333 | Ga0207664_10325607 | 3300025929 | Bacteria | 1356 |
| 334 | Ga0207644_10117356 | 3300025931 | Bacteria | 2021 |
| 335 | Ga0207644_10253898 | 3300025931 | Bacteria | 1404 |
| 336 | Ga0207644_10322759 | 3300025931 | Bacteria | 1249 |
| 337 | Ga0207644_11409404 | 3300025931 | Bacteria | 585 |
| 338 | Ga0207690_10043611 | 3300025932 | Bacteria | 2953 |
| 339 | Ga0207690_10094722 | 3300025932 | Bacteria | 2119 |
| 340 | Ga0207690_10183883 | 3300025932 | Bacteria | 1576 |
| 341 | Ga0207690_10234300 | 3300025932 | Bacteria | 1411 |
| 342 | Ga0207706_10006991 | 3300025933 | Bacteria | 10429 |
| 343 | Ga0207706_10130409 | 3300025933 | Bacteria | 2211 |
| 344 | Ga0207706_10147178 | 3300025933 | Bacteria | 2072 |
| 345 | Ga0207706_10212120 | 3300025933 | Bacteria | 1697 |
| 346 | Ga0207686_10082791 | 3300025934 | Bacteria | 2099 |
| 347 | Ga0207686_10127860 | 3300025934 | Bacteria | 1739 |
| 348 | Ga0207709_10000540 | 3300025935 | Bacteria | 32468 |
| 349 | Ga0207709_11299289 | 3300025935 | Bacteria | 601 |
| 350 | Ga0207669_10155065 | 3300025937 | Bacteria | 1610 |
| 351 | Ga0207704_10431593 | 3300025938 | Bacteria | 1047 |
| 352 | Ga0207665_10094659 | 3300025939 | Bacteria | 2075 |
| 353 | Ga0207691_10010913 | 3300025940 | Bacteria | 8721 |
| 354 | Ga0207691_10022589 | 3300025940 | Bacteria | 5932 |
| 355 | Ga0207691_10037814 | 3300025940 | Bacteria | 4467 |
| 356 | Ga0207711_10013899 | 3300025941 | Bacteria | 6686 |
| 357 | Ga0207689_10000856 | 3300025942 | Bacteria | 29352 |
| 358 | Ga0207689_10044075 | 3300025942 | Bacteria | 3688 |
| 359 | Ga0207661_10004542 | 3300025944 | Bacteria | 9725 |
| 360 | Ga0207661_10172051 | 3300025944 | Bacteria | 1886 |
| 361 | Ga0207661_10481505 | 3300025944 | Bacteria | 1133 |
| 362 | Ga0207679_10037148 | 3300025945 | Bacteria | 3460 |
| 363 | Ga0207679_10040785 | 3300025945 | Bacteria | 3326 |
| 364 | Ga0207679_10264138 | 3300025945 | Bacteria | 1469 |
| 365 | Ga0207667_10009529 | 3300025949 | Bacteria | 11427 |
| 366 | Ga0207667_10009780 | 3300025949 | Bacteria | 11279 |
| 367 | Ga0207667_10039768 | 3300025949 | Bacteria | 5009 |
| 368 | Ga0207667_10061183 | 3300025949 | Bacteria | 3940 |
| 369 | Ga0207667_10482506 | 3300025949 | Bacteria | 1258 |
| 370 | Ga0207651_10061416 | 3300025960 | Bacteria | 2614 |
| 371 | Ga0207651_10160284 | 3300025960 | Bacteria | 1763 |
| 372 | Ga0207651_10250911 | 3300025960 | Bacteria | 1448 |
| 373 | Ga0207712_10428723 | 3300025961 | Bacteria | 1117 |
| 374 | Ga0207668_10021657 | 3300025972 | Bacteria | 4102 |
| 375 | Ga0207668_10054598 | 3300025972 | Bacteria | 2774 |
| 376 | Ga0207668_10264901 | 3300025972 | Bacteria | 1402 |
| 377 | Ga0207668_10367953 | 3300025972 | Bacteria | 1206 |
| 378 | Ga0207640_10018518 | 3300025981 | Bacteria | 4094 |
| 379 | Ga0207640_10120090 | 3300025981 | Bacteria | 1881 |
| 380 | Ga0207640_10290709 | 3300025981 | Bacteria | 1288 |
| 381 | Ga0207658_10031259 | 3300025986 | Bacteria | 3779 |
| 382 | Ga0207658_10155781 | 3300025986 | Bacteria | 1867 |
| 383 | Ga0207658_10244428 | 3300025986 | Bacteria | 1522 |
| 384 | Ga0207677_10010028 | 3300026023 | Bacteria | 5345 |
| 385 | Ga0207677_10063012 | 3300026023 | Bacteria | 2575 |
| 386 | Ga0207677_10646602 | 3300026023 | Bacteria | 933 |
| 387 | Ga0207703_10036792 | 3300026035 | Bacteria | 3897 |
| 388 | Ga0207703_10092359 | 3300026035 | Bacteria | 2547 |
| 389 | Ga0207639_10011932 | 3300026041 | Bacteria | 6045 |
| 390 | Ga0207639_10022769 | 3300026041 | Bacteria | 4516 |
| 391 | Ga0207639_10060832 | 3300026041 | Bacteria | 2914 |
| 392 | Ga0207639_10402480 | 3300026041 | Bacteria | 1233 |
| 393 | Ga0207639_10930788 | 3300026041 | Bacteria | 813 |
| 394 | Ga0207678_10002761 | 3300026067 | Bacteria | 15887 |
| 395 | Ga0207708_11766791 | 3300026075 | Bacteria | 543 |
| 396 | Ga0207702_10048315 | 3300026078 | Bacteria | 3588 |
| 397 | Ga0207702_10087151 | 3300026078 | Bacteria | 2724 |
| 398 | Ga0207702_10226326 | 3300026078 | Bacteria | 1745 |
| 399 | Ga0207702_10252025 | 3300026078 | Bacteria | 1658 |
| 400 | Ga0207702_10465458 | 3300026078 | Bacteria | 1228 |
| 401 | Ga0207641_10024573 | 3300026088 | Bacteria | 4966 |
| 402 | Ga0207641_10341124 | 3300026088 | Bacteria | 1426 |
| 403 | Ga0207648_10342919 | 3300026089 | Bacteria | 1346 |
| 404 | Ga0207648_10371813 | 3300026089 | Bacteria | 1291 |
| 405 | Ga0207648_10402052 | 3300026089 | Bacteria | 1241 |
| 406 | Ga0207676_10010625 | 3300026095 | Bacteria | 6563 |
| 407 | Ga0207676_10459617 | 3300026095 | Bacteria | 1202 |
| 408 | Ga0207674_10005503 | 3300026116 | Bacteria | 15037 |
| 409 | Ga0207674_10021603 | 3300026116 | Bacteria | 6928 |
| 410 | Ga0207674_10039387 | 3300026116 | Bacteria | 4899 |
| 411 | Ga0207674_10041802 | 3300026116 | Bacteria | 4739 |
| 412 | Ga0207674_11259224 | 3300026116 | Bacteria | 709 |
| 413 | Ga0207675_100000879 | 3300026118 | Bacteria | 29982 |
| 414 | Ga0207675_100052670 | 3300026118 | Bacteria | 3798 |
| 415 | Ga0207675_100071229 | 3300026118 | Bacteria | 3250 |
| 416 | Ga0207675_100293719 | 3300026118 | Bacteria | 1581 |
| 417 | Ga0207683_10034658 | 3300026121 | Bacteria | 4388 |
| 418 | Ga0207683_10052440 | 3300026121 | Bacteria | 3574 |
| 419 | Ga0207683_10180203 | 3300026121 | Bacteria | 1915 |
| 420 | Ga0207683_10272545 | 3300026121 | Bacteria | 1546 |
| 421 | Ga0207698_10003937 | 3300026142 | Bacteria | 8993 |
| 422 | Ga0207698_10033549 | 3300026142 | Bacteria | 3731 |
| 423 | Ga0207698_10088288 | 3300026142 | Bacteria | 2528 |
| 424 | Ga0207698_10104328 | 3300026142 | Bacteria | 2358 |
| 425 | Ga0207698_10145649 | 3300026142 | Bacteria | 2048 |
| 426 | Ga0207698_10279019 | 3300026142 | Bacteria | 1545 |
| 427 | Ga0207698_10313335 | 3300026142 | Bacteria | 1466 |
| 428 | Ga0209999_1029774 | 3300027543 | Bacteria | 1013 |
| 429 | Ga0209983_1026658 | 3300027665 | Bacteria | 1223 |
| 430 | Ga0209813_10093257 | 3300027866 | Bacteria | 1014 |
| 431 | Ga0209813_10110162 | 3300027866 | Bacteria | 947 |
| 432 | Ga0209974_10026407 | 3300027876 | Bacteria | 1922 |
| 433 | Ga0207428_10000152 | 3300027907 | Bacteria | 94307 |
| 434 | Ga0207428_10027374 | 3300027907 | Bacteria | 4747 |
| 435 | Ga0268266_10163840 | 3300028379 | Bacteria | 2013 |
| 436 | Ga0268266_11015477 | 3300028379 | Bacteria | 803 |
| 437 | Ga0268265_10033763 | 3300028380 | Bacteria | 3723 |
| 438 | Ga0268265_10067102 | 3300028380 | Bacteria | 2776 |
| 439 | Ga0268265_10187744 | 3300028380 | Bacteria | 1782 |
| 440 | Ga0268265_10548045 | 3300028380 | Bacteria | 1097 |
| 441 | Ga0268265_10628508 | 3300028380 | Bacteria | 1030 |
| 442 | Ga0268264_10060839 | 3300028381 | Bacteria | 3166 |
| 443 | Ga0268264_10101594 | 3300028381 | Bacteria | 2500 |
| 444 | Ga0268264_10394552 | 3300028381 | Bacteria | 1328 |
| 445 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 446 | Ga0307515_10018885 | 3300028794 | Bacteria | 12446 |
| 447 | Ga0307515_10271307 | 3300028794 | Bacteria | 1417 |
| 448 | Ga0307511_10028923 | 3300030521 | Bacteria | 5017 |
| 449 | Ga0265320_10054034 | 3300031240 | Bacteria | 1939 |
| 450 | Ga0265331_10068472 | 3300031250 | Bacteria | 1664 |
| 451 | Ga0307513_10515171 | 3300031456 | Bacteria | 912 |
| 452 | Ga0307408_100093008 | 3300031548 | Bacteria | 2280 |
| 453 | Ga0307408_100329535 | 3300031548 | Bacteria | 1289 |
| 454 | Ga0307408_100717860 | 3300031548 | Bacteria | 900 |
| 455 | Ga0307408_100851507 | 3300031548 | Bacteria | 831 |
| 456 | Ga0316576_10060513 | 3300031727 | Bacteria | 2774 |
| 457 | Ga0307516_10003296 | 3300031730 | Bacteria | 20894 |
| 458 | Ga0307516_10020560 | 3300031730 | Bacteria | 6817 |
| 459 | Ga0307405_10085115 | 3300031731 | Bacteria | 2077 |
| 460 | Ga0307406_10334983 | 3300031901 | Bacteria | 1176 |
| 461 | Ga0307407_10007279 | 3300031903 | Bacteria | 5003 |
| 462 | Ga0307412_11056780 | 3300031911 | Bacteria | 720 |
| 463 | Ga0307416_100053978 | 3300032002 | Bacteria | 3228 |
| 464 | Ga0307416_101032367 | 3300032002 | Bacteria | 926 |
| 465 | Ga0307415_101211109 | 3300032126 | Bacteria | 712 |
| 466 | Ga0373930_0010975 | 3300034816 | Bacteria | 1629 |
| 467 | Ga0373940_0010835 | 3300035088 | Bacteria | 2153 |
| 468 | Ga0373939_0049193 | 3300035114 | Bacteria | 1302 |
| 469 | Ga0373946_0094085 | 3300035171 | Bacteria | 1333 |
| 470 | Ga0373962_0007567 | 3300035242 | Bacteria | 2663 |
| 471 | Ga0316574_0265126 | 3300035398 | Bacteria | 1096 |
| 472 | Ga0373931_0006633 | 3300035691 | Bacteria | 5420 |
| 473 | Ga0373931_0128858 | 3300035691 | Bacteria | 1454 |
| 474 | Ga0373931_0494448 | 3300035691 | Bacteria | 788 |
| 475 | Ga0373935_0861804 | 3300035692 | Bacteria | 670 |
| 476 | Ga0373925_0040624 | 3300037068 | Bacteria | 3445 |
| 477 | Ga0373925_0279482 | 3300037068 | Bacteria | 1344 |
| 478 | Ga0395899_0012535 | 3300037312 | Bacteria | 6498 |
| 479 | Ga0395899_0295694 | 3300037312 | Bacteria | 1097 |
| 480 | Ga0395900_0009587 | 3300037418 | Bacteria | 9926 |
| 481 | Ga0395900_0115638 | 3300037418 | Bacteria | 2752 |
| 482 | Ga0395900_0145253 | 3300037418 | Bacteria | 2426 |
| 483 | Ga0395900_0240303 | 3300037418 | Bacteria | 1817 |
| 484 | Ga0395900_0707581 | 3300037418 | Bacteria | 940 |
| 485 | Ga0395898_0191039 | 3300037466 | Bacteria | 1956 |
| 486 | Ga0395898_0211074 | 3300037466 | Bacteria | 1852 |
| 487 | Ga0395905_0000883 | 3300037471 | Bacteria | 39095 |
| 488 | Ga0395905_0010764 | 3300037471 | Bacteria | 8867 |
| 489 | Ga0395905_0020602 | 3300037471 | Bacteria | 6243 |
| 490 | Ga0395905_0317436 | 3300037471 | Bacteria | 1447 |
| 491 | Ga0395905_0415180 | 3300037471 | Bacteria | 1241 |
| 492 | Ga0395905_0637139 | 3300037471 | Unclassified | 968 |
| 493 | Ga0395901_0004759 | 3300038443 | Bacteria | 13696 |
| 494 | Ga0395901_0015549 | 3300038443 | Bacteria | 7750 |
| 495 | Ga0395901_1033885 | 3300038443 | Bacteria | 795 |
| 496 | Ga0436365_0208379 | 3300039437 | Bacteria | 3000 |
| 497 | Ga0436365_1016022 | 3300039437 | Bacteria | 3902 |
| 498 | Ga0436363_0107667 | 3300039450 | Bacteria | 2144 |
| 499 | Ga0436363_1649827 | 3300039450 | Bacteria | 893 |
| 500 | Ga0439436_0003148 | 3300041404 | Bacteria | 5000 |
| 501 | Ga0439436_0007708 | 3300041404 | Bacteria | 3312 |
| 502 | Ga0439439_0012756 | 3300041406 | Bacteria | 2033 |
| 503 | Ga0439439_0032576 | 3300041406 | Bacteria | 1331 |
| 504 | Ga0439447_020102 | 3300041407 | Bacteria | 1775 |
| 505 | Ga0439466_0004735 | 3300041411 | Bacteria | 5229 |
| 506 | Ga0439466_0011107 | 3300041411 | Bacteria | 3336 |
| 507 | Ga0439465_0035965 | 3300041413 | Bacteria | 1589 |
| 508 | Ga0451793_0211241 | 3300041452 | Bacteria | 865 |
| 509 | Ga0451797_0461082 | 3300041453 | Bacteria | 2806 |
| 510 | Ga0451800_0593028 | 3300041459 | Bacteria | 838 |
| 511 | Ga0451800_0767295 | 3300041459 | Bacteria | 831 |
| 512 | Ga0451804_0103686 | 3300041463 | Bacteria | 855 |
| 513 | Ga0451833_0809994 | 3300041491 | Bacteria | 648 |
| 514 | Ga0451835_0946079 | 3300041492 | Bacteria | 1226 |
| 515 | Ga0451841_0631142 | 3300041498 | Bacteria | 913 |
| 516 | Ga0451845_0537950 | 3300041501 | Bacteria | 1158 |
| 517 | Ga0451843_1764350 | 3300041509 | Bacteria | 1028 |
| 518 | Ga0451853_2282553 | 3300041512 | Bacteria | 1049 |
| 519 | Ga0439431_0005421 | 3300041997 | Bacteria | 2818 |
| 520 | Ga0439433_0004518 | 3300041999 | Bacteria | 2997 |
| 521 | Ga0439442_007850 | 3300042002 | Bacteria | 2154 |
| 522 | Ga0439445_0003668 | 3300042004 | Bacteria | 3446 |
| 523 | Ga0439445_0067481 | 3300042004 | Bacteria | 986 |
| 524 | Ga0439432_017634 | 3300042006 | Bacteria | 2394 |
| 525 | Ga0439432_038634 | 3300042006 | Bacteria | 1519 |
| 526 | Ga0439449_0002894 | 3300042007 | Bacteria | 6676 |
| 527 | Ga0439449_0029030 | 3300042007 | Bacteria | 2061 |
| 528 | Ga0439449_0030220 | 3300042007 | Bacteria | 2018 |
| 529 | Ga0439452_004744 | 3300042010 | Bacteria | 4497 |
| 530 | Ga0439452_008152 | 3300042010 | Bacteria | 3169 |
| 531 | Ga0439457_023486 | 3300042014 | Bacteria | 1364 |
| 532 | Ga0439462_0005459 | 3300042015 | Bacteria | 3135 |
| 533 | Ga0439462_0007022 | 3300042015 | Bacteria | 2814 |
| 534 | Ga0439463_107213 | 3300042016 | Bacteria | 721 |
| 535 | Ga0450911_000289 | 3300042115 | Bacteria | 18464 |
| 536 | Ga0450923_020159 | 3300042125 | Bacteria | 1290 |
| 537 | Ga0450897_000960 | 3300042128 | Bacteria | 1818 |
| 538 | Ga0450899_028104 | 3300042135 | Bacteria | 677 |
| 539 | Ga0450906_046895 | 3300042145 | Bacteria | 762 |
| 540 | Ga0450907_022937 | 3300042146 | Bacteria | 1052 |
| 541 | Ga0439446_0047533 | 3300042156 | Bacteria | 1276 |
| 542 | Ga0439434_0065141 | 3300042435 | Bacteria | 1143 |
| 543 | Ga0450893_0009616 | 3300042532 | Bacteria | 1580 |
| 544 | Ga0451577_0101976 | 3300042876 | Bacteria | 2564 |
| 545 | Ga0466972_0003747 | 3300044658 | Bacteria | 7561 |
| 546 | Ga0466965_0005827 | 3300044683 | Bacteria | 5560 |
| 547 | Ga0466965_0107847 | 3300044683 | Bacteria | 1429 |
| 548 | Ga0466966_0010532 | 3300044684 | Bacteria | 6144 |
| 549 | Ga0466963_0251649 | 3300044694 | Bacteria | 1240 |
| 550 | Ga0466964_0008502 | 3300044706 | Bacteria | 3859 |
| 551 | Ga0453684_1044128 | 3300044712 | Bacteria | 867 |
| 552 | Ga0466968_0011304 | 3300044735 | Bacteria | 3476 |
| 553 | Ga0466970_0289142 | 3300044765 | Bacteria | 923 |
| 554 | Ga0451576_0072876 | 3300045051 | Bacteria | 3574 |
| 555 | Ga0495627_009665 | 3300046453 | Bacteria | 3540 |
| 556 | Ga0495592_0391866 | 3300046454 | Bacteria | 882 |
| 557 | Ga0495629_0076852 | 3300046459 | Bacteria | 2331 |
| 558 | Ga0495653_0395302 | 3300046463 | Bacteria | 880 |
| 559 | Ga0495582_0234121 | 3300046473 | Bacteria | 1052 |
| 560 | Ga0495639_0004103 | 3300046475 | Bacteria | 6238 |
| 561 | Ga0495664_0200440 | 3300046477 | Bacteria | 1209 |
| 562 | Ga0495610_0177203 | 3300046512 | Bacteria | 889 |
| 563 | Ga0495620_0022193 | 3300046515 | Bacteria | 3064 |
| 564 | Ga0495628_0480078 | 3300046516 | Bacteria | 900 |
| 565 | Ga0495628_0485497 | 3300046516 | Bacteria | 894 |
| 566 | Ga0495637_0021694 | 3300046520 | Bacteria | 2941 |
| 567 | Ga0495642_0118147 | 3300046528 | Bacteria | 1137 |
| 568 | Ga0495654_0002010 | 3300046530 | Bacteria | 13387 |
| 569 | Ga0495621_0039969 | 3300046539 | Bacteria | 1642 |
| 570 | Ga0495621_0171873 | 3300046539 | Bacteria | 861 |
| 571 | Ga0495622_0063474 | 3300046557 | Bacteria | 1709 |
| 572 | Ga0495633_0246467 | 3300046558 | Bacteria | 816 |
| 573 | Ga0495656_0079131 | 3300046615 | Bacteria | 1479 |
| 574 | Ga0495625_0154116 | 3300046660 | Bacteria | 1543 |
| 575 | Ga0495661_0282655 | 3300046665 | Bacteria | 836 |
| 576 | Ga0495588_0070315 | 3300046674 | Bacteria | 1819 |
| 577 | Ga0495670_0120972 | 3300046691 | Bacteria | 1360 |
| 578 | Ga0495671_0005355 | 3300046692 | Bacteria | 7529 |
| 579 | Ga0495660_0374002 | 3300046810 | Bacteria | 629 |
| 580 | Ga0495674_1201294 | 3300047319 | Bacteria | 573 |
| 581 | Ga0495672_0166756 | 3300047320 | Bacteria | 1127 |
| 582 | Ga0495676_0638229 | 3300047321 | Bacteria | 692 |
| 583 | Ga0496100_0019573 | 3300048903 | Bacteria | 4042 |
| 584 | Ga0496100_0026056 | 3300048903 | Bacteria | 3581 |
| 585 | Ga0496101_0013253 | 3300048904 | Bacteria | 5521 |
| 586 | Ga0496101_0053277 | 3300048904 | Bacteria | 2918 |
| 587 | Ga0496102_0008824 | 3300048905 | Bacteria | 8648 |
| 588 | Ga0496102_0068465 | 3300048905 | Bacteria | 3257 |
| 589 | Ga0496103_0103431 | 3300048906 | Bacteria | 1804 |
| 590 | Ga0496104_0049293 | 3300048907 | Bacteria | 3971 |
| 591 | Ga0496105_0035902 | 3300048908 | Bacteria | 4082 |
| 592 | Ga0496105_0148386 | 3300048908 | Bacteria | 1928 |
| 593 | Ga0496106_0008083 | 3300048909 | Bacteria | 7771 |
| 594 | Ga0496106_0015833 | 3300048909 | Bacteria | 5577 |
| 595 | Ga0496107_0004328 | 3300048910 | Bacteria | 9610 |
| 596 | Ga0496108_0104079 | 3300048911 | Bacteria | 2422 |
| 597 | Ga0496108_0137221 | 3300048911 | Bacteria | 2105 |
| 598 | Ga0496109_0095016 | 3300048912 | Bacteria | 2759 |
| 599 | Ga0496109_0691489 | 3300048912 | Bacteria | 957 |
| 600 | Ga0496109_0766675 | 3300048912 | Bacteria | 903 |
| 601 | Ga0496110_0029184 | 3300048913 | Bacteria | 4744 |
| 602 | Ga0496110_0299570 | 3300048913 | Bacteria | 1464 |
| 603 | Ga0496111_0031530 | 3300048914 | Bacteria | 3776 |
| 604 | Ga0496111_0092473 | 3300048914 | Bacteria | 2217 |
| 605 | Ga0496111_0172260 | 3300048914 | Bacteria | 1608 |
| 606 | Ga0496114_0044725 | 3300048917 | Bacteria | 3675 |
| 607 | Ga0496114_0097804 | 3300048917 | Bacteria | 2501 |
| 608 | Ga0496115_0033835 | 3300048918 | Bacteria | 4037 |
| 609 | Ga0496121_0020745 | 3300048924 | Bacteria | 6479 |
| 610 | Ga0496121_0239264 | 3300048924 | Bacteria | 1266 |
| 611 | Ga0496121_0757043 | 3300048924 | Bacteria | 577 |
| 612 | Ga0496122_0305092 | 3300048925 | Bacteria | 856 |
| 613 | Ga0496124_0036939 | 3300048927 | Bacteria | 4254 |
| 614 | Ga0496125_0005367 | 3300048928 | Bacteria | 14295 |
| 615 | Ga0496125_0005937 | 3300048928 | Bacteria | 13381 |
| 616 | Ga0496126_0014536 | 3300048929 | Bacteria | 7952 |
| 617 | Ga0496126_0083272 | 3300048929 | Bacteria | 2824 |
| 618 | Ga0496126_0207500 | 3300048929 | Bacteria | 1651 |
| 619 | Ga0501034_0287736 | 3300049571 | Bacteria | 1582 |
| 620 | Ga0501034_0514116 | 3300049571 | Bacteria | 1110 |
| 621 | Ga0501036_0023593 | 3300049572 | Bacteria | 5184 |
| 622 | Ga0501036_0163149 | 3300049572 | Bacteria | 1879 |
| 623 | Ga0501037_0387929 | 3300049573 | Bacteria | 959 |
| 624 | Ga0501037_0499091 | 3300049573 | Bacteria | 826 |
| 625 | Ga0501038_0681013 | 3300049574 | Bacteria | 772 |
| 626 | Ga0501039_0055156 | 3300049575 | Bacteria | 3077 |
| 627 | Ga0501040_0001677 | 3300049576 | Bacteria | 14176 |
| 628 | Ga0501040_0005535 | 3300049576 | Bacteria | 8178 |
| 629 | Ga0501041_0003272 | 3300049577 | Bacteria | 9311 |
| 630 | Ga0501041_0004599 | 3300049577 | Bacteria | 8006 |
| 631 | Ga0501042_0018555 | 3300049578 | Bacteria | 4818 |
| 632 | Ga0501042_0024465 | 3300049578 | Bacteria | 4235 |
| 633 | Ga0501043_0000573 | 3300049579 | Bacteria | 32893 |
| 634 | Ga0501043_0566612 | 3300049579 | Bacteria | 842 |
| 635 | Ga0501046_0000752 | 3300049580 | Bacteria | 31319 |
| 636 | Ga0501046_0014242 | 3300049580 | Bacteria | 6717 |
| 637 | Ga0501046_0019277 | 3300049580 | Bacteria | 5659 |
| 638 | Ga0501046_0805325 | 3300049580 | Bacteria | 658 |
| 639 | Ga0501047_0000298 | 3300049581 | Bacteria | 57038 |
| 640 | Ga0501047_0005437 | 3300049581 | Bacteria | 11984 |
| 641 | Ga0501048_0003640 | 3300049582 | Bacteria | 11740 |
| 642 | Ga0501048_0012421 | 3300049582 | Bacteria | 6335 |
| 643 | Ga0501048_0134828 | 3300049582 | Bacteria | 1745 |
| 644 | Ga0501048_0750661 | 3300049582 | Bacteria | 701 |
| 645 | Ga0501068_0047704 | 3300049584 | Bacteria | 2584 |
| 646 | Ga0501068_0192506 | 3300049584 | Bacteria | 1292 |
| 647 | Ga0501068_0508668 | 3300049584 | Bacteria | 782 |
| 648 | Ga0501069_0277742 | 3300049585 | Bacteria | 980 |
| 649 | Ga0501070_0061210 | 3300049586 | Bacteria | 3119 |
| 650 | Ga0501071_0048023 | 3300049587 | Unclassified | 3068 |
| 651 | Ga0501071_0058241 | 3300049587 | Bacteria | 2793 |
| 652 | Ga0501071_0164637 | 3300049587 | Bacteria | 1659 |
| 653 | Ga0501072_0034140 | 3300049588 | Bacteria | 3986 |
| 654 | Ga0501073_0109059 | 3300049589 | Bacteria | 1921 |
| 655 | Ga0501073_0204780 | 3300049589 | Bacteria | 1364 |
| 656 | Ga0501073_0245596 | 3300049589 | Bacteria | 1236 |
| 657 | Ga0501074_0057744 | 3300049590 | Bacteria | 2796 |
| 658 | Ga0501074_0078648 | 3300049590 | Bacteria | 2367 |
| 659 | Ga0501074_0265037 | 3300049590 | Bacteria | 1221 |
| 660 | Ga0501075_0009539 | 3300049591 | Bacteria | 6794 |
| 661 | Ga0501075_0011038 | 3300049591 | Bacteria | 6376 |
| 662 | Ga0501075_0026233 | 3300049591 | Unclassified | 4287 |
| 663 | Ga0501076_0080875 | 3300049592 | Bacteria | 2608 |
| 664 | Ga0501076_0085239 | 3300049592 | Bacteria | 2538 |
| 665 | Ga0501076_0263667 | 3300049592 | Bacteria | 1411 |
| 666 | Ga0501077_0013790 | 3300049593 | Bacteria | 5069 |
| 667 | Ga0501077_0305422 | 3300049593 | Bacteria | 1014 |
| 668 | Ga0501252_033465 | 3300049682 | Bacteria | 721 |
| 669 | Ga0501079_0005863 | 3300049741 | Bacteria | 9192 |
| 670 | Ga0501079_0278273 | 3300049741 | Bacteria | 1308 |
| 671 | Ga0501079_0781858 | 3300049741 | Bacteria | 751 |
| 672 | Ga0501080_0002090 | 3300049742 | Bacteria | 17331 |
| 673 | Ga0501080_0010278 | 3300049742 | Bacteria | 8555 |
| 674 | Ga0501080_0082448 | 3300049742 | Unclassified | 2987 |
| 675 | Ga0501080_0123510 | 3300049742 | Bacteria | 2398 |
| 676 | Ga0501080_0367905 | 3300049742 | Bacteria | 1297 |
| 677 | Ga0501081_0005137 | 3300049743 | Bacteria | 8427 |
| 678 | Ga0501081_0105990 | 3300049743 | Bacteria | 1992 |
| 679 | Ga0501083_0064057 | 3300049744 | Bacteria | 2451 |
| 680 | Ga0501035_0200872 | 3300049822 | Bacteria | 1710 |
| 681 | Ga0501035_0776298 | 3300049822 | Bacteria | 767 |
| 682 | Ga0501044_0117400 | 3300049823 | Bacteria | 2665 |
| 683 | Ga0501045_0009696 | 3300049824 | Bacteria | 6736 |
| 684 | Ga0501045_0017809 | 3300049824 | Bacteria | 5045 |
| 685 | Ga0501045_0027684 | 3300049824 | Bacteria | 4087 |
| 686 | Ga0501045_0042241 | 3300049824 | Bacteria | 3319 |
| 687 | Ga0501045_0988830 | 3300049824 | Bacteria | 617 |
| 688 | nmdc:mga03683_1140_c1 | 3300050489 | Bacteria | 5531 |
| 689 | nmdc:mga03683_122698_c1 | 3300050489 | Bacteria | 1156 |
| 690 | nmdc:mga03683_4303_c1 | 3300050489 | Bacteria | 4705 |
| 691 | nmdc:mga03683_5158_c1 | 3300050489 | Bacteria | 4391 |
| 692 | nmdc:mga03683_609841_c1 | 3300050489 | Bacteria | 535 |
| 693 | nmdc:mga03n38_282687_c1 | 3300050490 | Bacteria | 886 |
| 694 | nmdc:mga00v17_573807_c1 | 3300050491 | Bacteria | 728 |
| 695 | nmdc:mga0yw44_350879_c1 | 3300050492 | Bacteria | 993 |
| 696 | nmdc:mga06z11_334771_c1 | 3300050494 | Bacteria | 904 |
| 697 | nmdc:mga06z11_564985_c1 | 3300050494 | Bacteria | 691 |
| 698 | nmdc:mga04h51_31991_c1 | 3300050495 | Bacteria | 1665 |
| 699 | nmdc:mga04h51_36159_c1 | 3300050495 | Bacteria | 1587 |
| 700 | nmdc:mga07m45_9139_c1 | 3300050496 | Bacteria | 1936 |
| 701 | nmdc:mga05p37_108188_c1 | 3300050507 | Bacteria | 3420 |
| 702 | nmdc:mga05p37_229145_c1 | 3300050507 | Bacteria | 2239 |
| 703 | nmdc:mga0qj67_791822_c1 | 3300050509 | Bacteria | 751 |
| 704 | nmdc:mga08y16_37683_c1 | 3300050511 | Bacteria | 5076 |
| 705 | nmdc:mga08y16_54_c1 | 3300050511 | Bacteria | 102957 |
| 706 | nmdc:mga08y16_821575_c1 | 3300050511 | Bacteria | 921 |
| 707 | nmdc:mga0n895_9679_c1 | 3300050512 | Bacteria | 8452 |
| 708 | nmdc:mga0rr50_165557_c1 | 3300050513 | Bacteria | 1797 |
| 709 | nmdc:mga0rr50_765905_c1 | 3300050513 | Bacteria | 824 |
| 710 | nmdc:mga08x19_509528_c1 | 3300050514 | Bacteria | 850 |
| 711 | nmdc:mga0a205_2327_c1 | 3300050515 | Bacteria | 16764 |
| 712 | nmdc:mga0sz30_16457_c1 | 3300050516 | Bacteria | 2937 |
| 713 | nmdc:mga0sz30_16817_c1 | 3300050516 | Bacteria | 2910 |
| 714 | Ga0500610_0005742 | 3300053079 | Bacteria | 5125 |
| 715 | Ga0500610_0018232 | 3300053079 | Bacteria | 3388 |
| 716 | Ga0495619_0728934 | 3300053085 | Bacteria | 673 |
| 717 | Ga0500651_0155396 | 3300053093 | Bacteria | 1371 |
| 718 | Ga0500650_0284169 | 3300053098 | Bacteria | 735 |
| 719 | Ga0500593_003920 | 3300053117 | Bacteria | 5704 |
| 720 | Ga0500607_009966 | 3300053121 | Bacteria | 5692 |
| 721 | Ga0500652_067867 | 3300053131 | Bacteria | 1475 |
| 722 | Ga0500559_0016122 | 3300053136 | Bacteria | 3155 |
| 723 | Ga0500559_0126437 | 3300053136 | Unclassified | 1192 |
| 724 | Ga0500616_0002351 | 3300053153 | Bacteria | 15902 |
| 725 | Ga0500634_0002047 | 3300053161 | Bacteria | 8295 |
| 726 | Ga0500552_000821 | 3300053733 | Bacteria | 2913 |
| 727 | Ga0501084_0011061 | 3300054114 | Bacteria | 7472 |
| 728 | Ga0501084_0015960 | 3300054114 | Bacteria | 6232 |
| 729 | Ga0501084_0367677 | 3300054114 | Bacteria | 1215 |
| 730 | Ga0501082_0003668 | 3300060353 | Bacteria | 13416 |
| 731 | Ga0501082_0555056 | 3300060353 | Bacteria | 1005 |
| 732 | Ga0530510_0016521 | 3300061734 | Bacteria | 5226 |
| 733 | Ga0530510_0054832 | 3300061734 | Bacteria | 2880 |
| 734 | Ga0530510_0345218 | 3300061734 | Bacteria | 1118 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0289142 | Ga0466970_0289142_442_894 | 140 |
| 2 | 3300049823 | Ga0501044_0117400 | Ga0501044_0117400_2182_2640 | 144 |
| 3 | 3300053136 | Ga0500559_0016122 | Ga0500559_0016122_2328_2786 | 144 |
| 4 | 3300005458 | Ga0070681_10235580 | Ga0070681_102355801 | 146 |
| 5 | 3300005530 | Ga0070679_100002239 | Ga0070679_10000223913 | 146 |
| 6 | 3300005563 | Ga0068855_100049234 | Ga0068855_1000492343 | 146 |
| 7 | 3300025912 | Ga0207707_10198647 | Ga0207707_101986474 | 146 |
| 8 | 3300025921 | Ga0207652_10036122 | Ga0207652_100361223 | 146 |
| 9 | 3300025949 | Ga0207667_10061183 | Ga0207667_100611833 | 146 |
| 10 | 3300041491 | Ga0451833_0809994 | Ga0451833_0809994_72_560 | 147 |
| 11 | iso_pu_bacteria | 2906610324 | 2906616518 | 149 |
| 12 | 3300005436 | Ga0070713_100094954 | Ga0070713_1000949542 | 151 |
| 13 | 3300006028 | Ga0070717_10056285 | Ga0070717_100562852 | 151 |
| 14 | 3300013308 | Ga0157375_11103786 | Ga0157375_111037862 | 151 |
| 15 | 3300025929 | Ga0207664_10087250 | Ga0207664_100872502 | 151 |
| 16 | 3300031727 | Ga0316576_10060513 | Ga0316576_100605132 | 151 |
| 17 | 3300035398 | Ga0316574_0265126 | Ga0316574_0265126_592_1086 | 151 |
| 18 | 3300039450 | Ga0436363_1649827 | Ga0436363_1649827_57_596 | 151 |
| 19 | 3300005289 | Ga0065704_10096637 | Ga0065704_100966373 | 152 |
| 20 | 3300005355 | Ga0070671_100565684 | Ga0070671_1005656842 | 152 |
| 21 | 3300005367 | Ga0070667_100184786 | Ga0070667_1001847862 | 152 |
| 22 | 3300005456 | Ga0070678_100200248 | Ga0070678_1002002482 | 152 |
| 23 | 3300005457 | Ga0070662_100074926 | Ga0070662_1000749264 | 152 |
| 24 | 3300005535 | Ga0070684_101355003 | Ga0070684_1013550031 | 152 |
| 25 | 3300005539 | Ga0068853_100885602 | Ga0068853_1008856022 | 152 |
| 26 | 3300005543 | Ga0070672_100851877 | Ga0070672_1008518771 | 152 |
| 27 | 3300005614 | Ga0068856_100149251 | Ga0068856_1001492513 | 152 |
| 28 | 3300005614 | Ga0068856_100432497 | Ga0068856_1004324972 | 152 |
| 29 | 3300005719 | Ga0068861_100019833 | Ga0068861_1000198334 | 152 |
| 30 | 3300006177 | Ga0075362_10007616 | Ga0075362_100076164 | 152 |
| 31 | 3300006186 | Ga0075369_10194647 | Ga0075369_101946472 | 152 |
| 32 | 3300006237 | Ga0097621_100190080 | Ga0097621_1001900803 | 152 |
| 33 | 3300006358 | Ga0068871_100129082 | Ga0068871_1001290823 | 152 |
| 34 | 3300006358 | Ga0068871_100192582 | Ga0068871_1001925822 | 152 |
| 35 | 3300009036 | Ga0105244_10078389 | Ga0105244_100783892 | 152 |
| 36 | 3300012502 | Ga0157347_1011671 | Ga0157347_10116712 | 152 |
| 37 | 3300013306 | Ga0163162_11051101 | Ga0163162_110511012 | 152 |
| 38 | 3300014497 | Ga0182008_10262274 | Ga0182008_102622742 | 152 |
| 39 | 3300015261 | Ga0182006_1023666 | Ga0182006_10236663 | 152 |
| 40 | 3300015261 | Ga0182006_1051890 | Ga0182006_10518902 | 152 |
| 41 | 3300015265 | Ga0182005_1052785 | Ga0182005_10527852 | 152 |
| 42 | 3300017792 | Ga0163161_10033820 | Ga0163161_100338202 | 152 |
| 43 | 3300025292 | Ga0209676_1094387 | Ga0209676_10943871 | 152 |
| 44 | 3300025303 | Ga0209051_1000446 | Ga0209051_100044632 | 152 |
| 45 | 3300025931 | Ga0207644_10322759 | Ga0207644_103227592 | 152 |
| 46 | 3300025933 | Ga0207706_10130409 | Ga0207706_101304094 | 152 |
| 47 | 3300025934 | Ga0207686_10127860 | Ga0207686_101278602 | 152 |
| 48 | 3300025944 | Ga0207661_10481505 | Ga0207661_104815051 | 152 |
| 49 | 3300025960 | Ga0207651_10061416 | Ga0207651_100614161 | 152 |
| 50 | 3300025961 | Ga0207712_10428723 | Ga0207712_104287232 | 152 |
| 51 | 3300025986 | Ga0207658_10155781 | Ga0207658_101557813 | 152 |
| 52 | 3300026023 | Ga0207677_10646602 | Ga0207677_106466022 | 152 |
| 53 | 3300026041 | Ga0207639_10930788 | Ga0207639_109307881 | 152 |
| 54 | 3300026118 | Ga0207675_100071229 | Ga0207675_1000712292 | 152 |
| 55 | 3300026121 | Ga0207683_10180203 | Ga0207683_101802033 | 152 |
| 56 | 3300026121 | Ga0207683_10272545 | Ga0207683_102725452 | 152 |
| 57 | 3300028380 | Ga0268265_10067102 | Ga0268265_100671024 | 152 |
| 58 | 3300031548 | Ga0307408_100717860 | Ga0307408_1007178602 | 152 |
| 59 | 3300031901 | Ga0307406_10334983 | Ga0307406_103349832 | 152 |
| 60 | 3300031911 | Ga0307412_11056780 | Ga0307412_110567801 | 152 |
| 61 | 3300037068 | Ga0373925_0040624 | Ga0373925_0040624_2440_2922 | 152 |
| 62 | 3300037471 | Ga0395905_0637139 | Ga0395905_0637139_76_549 | 152 |
| 63 | 3300042004 | Ga0439445_0067481 | Ga0439445_0067481_82_561 | 152 |
| 64 | 3300042016 | Ga0439463_107213 | Ga0439463_107213_66_545 | 152 |
| 65 | 3300042115 | Ga0450911_000289 | Ga0450911_000289_9591_10070 | 152 |
| 66 | 3300046459 | Ga0495629_0076852 | Ga0495629_0076852_846_1337 | 152 |
| 67 | 3300046473 | Ga0495582_0234121 | Ga0495582_0234121_40_531 | 152 |
| 68 | 3300046475 | Ga0495639_0004103 | Ga0495639_0004103_1680_2171 | 152 |
| 69 | 3300046528 | Ga0495642_0118147 | Ga0495642_0118147_361_852 | 152 |
| 70 | 3300046539 | Ga0495621_0039969 | Ga0495621_0039969_1041_1532 | 152 |
| 71 | 3300046539 | Ga0495621_0171873 | Ga0495621_0171873_45_536 | 152 |
| 72 | 3300046557 | Ga0495622_0063474 | Ga0495622_0063474_543_1034 | 152 |
| 73 | 3300046615 | Ga0495656_0079131 | Ga0495656_0079131_738_1229 | 152 |
| 74 | 3300046674 | Ga0495588_0070315 | Ga0495588_0070315_885_1376 | 152 |
| 75 | 3300046691 | Ga0495670_0120972 | Ga0495670_0120972_73_564 | 152 |
| 76 | 3300048903 | Ga0496100_0026056 | Ga0496100_0026056_2167_2658 | 152 |
| 77 | 3300048904 | Ga0496101_0013253 | Ga0496101_0013253_3269_3760 | 152 |
| 78 | 3300048905 | Ga0496102_0008824 | Ga0496102_0008824_7870_8361 | 152 |
| 79 | 3300048906 | Ga0496103_0103431 | Ga0496103_0103431_870_1361 | 152 |
| 80 | 3300048907 | Ga0496104_0049293 | Ga0496104_0049293_2552_3043 | 152 |
| 81 | 3300048908 | Ga0496105_0035902 | Ga0496105_0035902_502_993 | 152 |
| 82 | 3300048909 | Ga0496106_0008083 | Ga0496106_0008083_5942_6433 | 152 |
| 83 | 3300048911 | Ga0496108_0137221 | Ga0496108_0137221_260_751 | 152 |
| 84 | 3300048912 | Ga0496109_0691489 | Ga0496109_0691489_455_946 | 152 |
| 85 | 3300048913 | Ga0496110_0029184 | Ga0496110_0029184_3611_4102 | 152 |
| 86 | 3300048914 | Ga0496111_0092473 | Ga0496111_0092473_882_1373 | 152 |
| 87 | 3300048914 | Ga0496111_0172260 | Ga0496111_0172260_747_1238 | 152 |
| 88 | 3300048917 | Ga0496114_0044725 | Ga0496114_0044725_2503_2994 | 152 |
| 89 | 3300048924 | Ga0496121_0020745 | Ga0496121_0020745_4588_5067 | 152 |
| 90 | 3300048925 | Ga0496122_0305092 | Ga0496122_0305092_160_639 | 152 |
| 91 | 3300048927 | Ga0496124_0036939 | Ga0496124_0036939_3215_3694 | 152 |
| 92 | 3300048928 | Ga0496125_0005367 | Ga0496125_0005367_8422_8901 | 152 |
| 93 | 3300048928 | Ga0496125_0005937 | Ga0496125_0005937_4740_5219 | 152 |
| 94 | 3300048929 | Ga0496126_0207500 | Ga0496126_0207500_233_712 | 152 |
| 95 | 3300050489 | nmdc:mga03683_4303_c1 | nmdc:mga03683_4303_c1_3820_4332 | 152 |
| 96 | 3300050509 | nmdc:mga0qj67_791822_c1 | nmdc:mga0qj67_791822_c1_246_731 | 152 |
| 97 | 3300050516 | nmdc:mga0sz30_16457_c1 | nmdc:mga0sz30_16457_c1_2271_2783 | 152 |
| 98 | 3300053121 | Ga0500607_009966 | Ga0500607_009966_2922_3434 | 152 |
| 99 | iso_pu_bacteria | 2904449895 | 2904451648 | 152 |
| 100 | iso_pu_bacteria | 2904456579 | 2904461863 | 152 |
| 101 | 3300003659 | JGI25404J52841_10018468 | JGI25404J52841_100184682 | 153 |
| 102 | 3300003781 | Ga0055536_1008437 | Ga0055536_10084375 | 153 |
| 103 | 3300003792 | Ga0055540_1001803 | Ga0055540_100180311 | 153 |
| 104 | 3300003911 | JGI25405J52794_10060666 | JGI25405J52794_100606662 | 153 |
| 105 | 3300005327 | Ga0070658_10004903 | Ga0070658_100049034 | 153 |
| 106 | 3300005327 | Ga0070658_10292523 | Ga0070658_102925232 | 153 |
| 107 | 3300005328 | Ga0070676_10008737 | Ga0070676_100087378 | 153 |
| 108 | 3300005329 | Ga0070683_100060012 | Ga0070683_1000600124 | 153 |
| 109 | 3300005329 | Ga0070683_100065267 | Ga0070683_1000652671 | 153 |
| 110 | 3300005329 | Ga0070683_100093284 | Ga0070683_1000932842 | 153 |
| 111 | 3300005330 | Ga0070690_100104351 | Ga0070690_1001043512 | 153 |
| 112 | 3300005331 | Ga0070670_100136543 | Ga0070670_1001365433 | 153 |
| 113 | 3300005331 | Ga0070670_100611844 | Ga0070670_1006118442 | 153 |
| 114 | 3300005331 | Ga0070670_100932427 | Ga0070670_1009324272 | 153 |
| 115 | 3300005334 | Ga0068869_100003076 | Ga0068869_1000030767 | 153 |
| 116 | 3300005335 | Ga0070666_10260613 | Ga0070666_102606132 | 153 |
| 117 | 3300005336 | Ga0070680_100043420 | Ga0070680_1000434204 | 153 |
| 118 | 3300005336 | Ga0070680_100572697 | Ga0070680_1005726972 | 153 |
| 119 | 3300005337 | Ga0070682_100022201 | Ga0070682_1000222016 | 153 |
| 120 | 3300005337 | Ga0070682_100434821 | Ga0070682_1004348211 | 153 |
| 121 | 3300005337 | Ga0070682_100605306 | Ga0070682_1006053061 | 153 |
| 122 | 3300005338 | Ga0068868_100006730 | Ga0068868_1000067308 | 153 |
| 123 | 3300005338 | Ga0068868_100088596 | Ga0068868_1000885962 | 153 |
| 124 | 3300005339 | Ga0070660_100040061 | Ga0070660_1000400612 | 153 |
| 125 | 3300005339 | Ga0070660_100319412 | Ga0070660_1003194122 | 153 |
| 126 | 3300005343 | Ga0070687_100390302 | Ga0070687_1003903021 | 153 |
| 127 | 3300005344 | Ga0070661_100008214 | Ga0070661_1000082144 | 153 |
| 128 | 3300005344 | Ga0070661_100069065 | Ga0070661_1000690652 | 153 |
| 129 | 3300005344 | Ga0070661_100116416 | Ga0070661_1001164164 | 153 |
| 130 | 3300005345 | Ga0070692_10311318 | Ga0070692_103113182 | 153 |
| 131 | 3300005347 | Ga0070668_100009361 | Ga0070668_1000093615 | 153 |
| 132 | 3300005347 | Ga0070668_100094910 | Ga0070668_1000949102 | 153 |
| 133 | 3300005347 | Ga0070668_100628639 | Ga0070668_1006286392 | 153 |
| 134 | 3300005353 | Ga0070669_100032735 | Ga0070669_1000327355 | 153 |
| 135 | 3300005353 | Ga0070669_100449332 | Ga0070669_1004493322 | 153 |
| 136 | 3300005353 | Ga0070669_100581184 | Ga0070669_1005811842 | 153 |
| 137 | 3300005354 | Ga0070675_100001332 | Ga0070675_10000133219 | 153 |
| 138 | 3300005354 | Ga0070675_100009544 | Ga0070675_1000095448 | 153 |
| 139 | 3300005354 | Ga0070675_100145716 | Ga0070675_1001457163 | 153 |
| 140 | 3300005355 | Ga0070671_100370767 | Ga0070671_1003707673 | 153 |
| 141 | 3300005356 | Ga0070674_100617468 | Ga0070674_1006174681 | 153 |
| 142 | 3300005356 | Ga0070674_100934981 | Ga0070674_1009349811 | 153 |
| 143 | 3300005364 | Ga0070673_100019233 | Ga0070673_1000192332 | 153 |
| 144 | 3300005364 | Ga0070673_100274085 | Ga0070673_1002740851 | 153 |
| 145 | 3300005365 | Ga0070688_100156917 | Ga0070688_1001569172 | 153 |
| 146 | 3300005366 | Ga0070659_100006591 | Ga0070659_1000065913 | 153 |
| 147 | 3300005366 | Ga0070659_100021473 | Ga0070659_1000214737 | 153 |
| 148 | 3300005366 | Ga0070659_100029753 | Ga0070659_1000297536 | 153 |
| 149 | 3300005367 | Ga0070667_100151577 | Ga0070667_1001515773 | 153 |
| 150 | 3300005367 | Ga0070667_100222687 | Ga0070667_1002226872 | 153 |
| 151 | 3300005367 | Ga0070667_100331904 | Ga0070667_1003319042 | 153 |
| 152 | 3300005434 | Ga0070709_10154543 | Ga0070709_101545433 | 153 |
| 153 | 3300005435 | Ga0070714_100179753 | Ga0070714_1001797534 | 153 |
| 154 | 3300005436 | Ga0070713_100229022 | Ga0070713_1002290222 | 153 |
| 155 | 3300005438 | Ga0070701_10155143 | Ga0070701_101551431 | 153 |
| 156 | 3300005440 | Ga0070705_100389088 | Ga0070705_1003890882 | 153 |
| 157 | 3300005444 | Ga0070694_100444842 | Ga0070694_1004448422 | 153 |
| 158 | 3300005455 | Ga0070663_100004462 | Ga0070663_1000044625 | 153 |
| 159 | 3300005456 | Ga0070678_100020170 | Ga0070678_1000201702 | 153 |
| 160 | 3300005457 | Ga0070662_100001945 | Ga0070662_1000019458 | 153 |
| 161 | 3300005457 | Ga0070662_100087750 | Ga0070662_1000877504 | 153 |
| 162 | 3300005458 | Ga0070681_10001057 | Ga0070681_1000105718 | 153 |
| 163 | 3300005458 | Ga0070681_10043520 | Ga0070681_100435204 | 153 |
| 164 | 3300005458 | Ga0070681_10339154 | Ga0070681_103391542 | 153 |
| 165 | 3300005458 | Ga0070681_10361123 | Ga0070681_103611232 | 153 |
| 166 | 3300005458 | Ga0070681_10420942 | Ga0070681_104209421 | 153 |
| 167 | 3300005459 | Ga0068867_100224621 | Ga0068867_1002246212 | 153 |
| 168 | 3300005459 | Ga0068867_100698835 | Ga0068867_1006988351 | 153 |
| 169 | 3300005467 | Ga0070706_100091293 | Ga0070706_1000912934 | 153 |
| 170 | 3300005471 | Ga0070698_100001208 | Ga0070698_10000120833 | 153 |
| 171 | 3300005518 | Ga0070699_100128414 | Ga0070699_1001284142 | 153 |
| 172 | 3300005530 | Ga0070679_100027302 | Ga0070679_1000273025 | 153 |
| 173 | 3300005530 | Ga0070679_100062734 | Ga0070679_1000627346 | 153 |
| 174 | 3300005530 | Ga0070679_100071601 | Ga0070679_1000716013 | 153 |
| 175 | 3300005530 | Ga0070679_100248698 | Ga0070679_1002486981 | 153 |
| 176 | 3300005535 | Ga0070684_100028635 | Ga0070684_1000286357 | 153 |
| 177 | 3300005535 | Ga0070684_100051865 | Ga0070684_1000518652 | 153 |
| 178 | 3300005535 | Ga0070684_100210190 | Ga0070684_1002101904 | 153 |
| 179 | 3300005536 | Ga0070697_100275317 | Ga0070697_1002753171 | 153 |
| 180 | 3300005539 | Ga0068853_100030678 | Ga0068853_1000306783 | 153 |
| 181 | 3300005539 | Ga0068853_100034435 | Ga0068853_1000344357 | 153 |
| 182 | 3300005539 | Ga0068853_100073542 | Ga0068853_1000735426 | 153 |
| 183 | 3300005539 | Ga0068853_100199327 | Ga0068853_1001993274 | 153 |
| 184 | 3300005539 | Ga0068853_100691977 | Ga0068853_1006919772 | 153 |
| 185 | 3300005543 | Ga0070672_100008896 | Ga0070672_1000088967 | 153 |
| 186 | 3300005543 | Ga0070672_100062557 | Ga0070672_1000625572 | 153 |
| 187 | 3300005543 | Ga0070672_100070593 | Ga0070672_1000705933 | 153 |
| 188 | 3300005545 | Ga0070695_100022143 | Ga0070695_1000221432 | 153 |
| 189 | 3300005547 | Ga0070693_100015270 | Ga0070693_1000152704 | 153 |
| 190 | 3300005548 | Ga0070665_100046991 | Ga0070665_1000469912 | 153 |
| 191 | 3300005548 | Ga0070665_101486032 | Ga0070665_1014860321 | 153 |
| 192 | 3300005549 | Ga0070704_100457546 | Ga0070704_1004575462 | 153 |
| 193 | 3300005563 | Ga0068855_100008812 | Ga0068855_1000088128 | 153 |
| 194 | 3300005563 | Ga0068855_100031980 | Ga0068855_1000319804 | 153 |
| 195 | 3300005563 | Ga0068855_100051023 | Ga0068855_1000510238 | 153 |
| 196 | 3300005563 | Ga0068855_100118175 | Ga0068855_1001181753 | 153 |
| 197 | 3300005563 | Ga0068855_100379473 | Ga0068855_1003794731 | 153 |
| 198 | 3300005563 | Ga0068855_100831048 | Ga0068855_1008310482 | 153 |
| 199 | 3300005564 | Ga0070664_100086137 | Ga0070664_1000861372 | 153 |
| 200 | 3300005564 | Ga0070664_100154124 | Ga0070664_1001541242 | 153 |
| 201 | 3300005577 | Ga0068857_100059280 | Ga0068857_1000592805 | 153 |
| 202 | 3300005577 | Ga0068857_100159007 | Ga0068857_1001590073 | 153 |
| 203 | 3300005578 | Ga0068854_100006691 | Ga0068854_1000066914 | 153 |
| 204 | 3300005578 | Ga0068854_100062380 | Ga0068854_1000623805 | 153 |
| 205 | 3300005614 | Ga0068856_100004796 | Ga0068856_1000047968 | 153 |
| 206 | 3300005614 | Ga0068856_100052398 | Ga0068856_1000523987 | 153 |
| 207 | 3300005614 | Ga0068856_100085508 | Ga0068856_1000855082 | 153 |
| 208 | 3300005614 | Ga0068856_100236682 | Ga0068856_1002366822 | 153 |
| 209 | 3300005615 | Ga0070702_100224909 | Ga0070702_1002249092 | 153 |
| 210 | 3300005616 | Ga0068852_100000615 | Ga0068852_10000061520 | 153 |
| 211 | 3300005616 | Ga0068852_100001686 | Ga0068852_1000016868 | 153 |
| 212 | 3300005616 | Ga0068852_100085852 | Ga0068852_1000858525 | 153 |
| 213 | 3300005616 | Ga0068852_100275740 | Ga0068852_1002757403 | 153 |
| 214 | 3300005616 | Ga0068852_100380885 | Ga0068852_1003808852 | 153 |
| 215 | 3300005616 | Ga0068852_101033626 | Ga0068852_1010336261 | 153 |
| 216 | 3300005617 | Ga0068859_100219748 | Ga0068859_1002197483 | 153 |
| 217 | 3300005617 | Ga0068859_100305303 | Ga0068859_1003053031 | 153 |
| 218 | 3300005618 | Ga0068864_100028438 | Ga0068864_1000284384 | 153 |
| 219 | 3300005618 | Ga0068864_100806211 | Ga0068864_1008062112 | 153 |
| 220 | 3300005719 | Ga0068861_100000384 | Ga0068861_10000038419 | 153 |
| 221 | 3300005719 | Ga0068861_100227768 | Ga0068861_1002277683 | 153 |
| 222 | 3300005834 | Ga0068851_10008669 | Ga0068851_100086694 | 153 |
| 223 | 3300005834 | Ga0068851_10034847 | Ga0068851_100348473 | 153 |
| 224 | 3300005840 | Ga0068870_10125636 | Ga0068870_101256361 | 153 |
| 225 | 3300005842 | Ga0068858_100027002 | Ga0068858_1000270025 | 153 |
| 226 | 3300005842 | Ga0068858_100045670 | Ga0068858_1000456707 | 153 |
| 227 | 3300005843 | Ga0068860_100007870 | Ga0068860_1000078706 | 153 |
| 228 | 3300005843 | Ga0068860_100021841 | Ga0068860_1000218417 | 153 |
| 229 | 3300005843 | Ga0068860_100355931 | Ga0068860_1003559311 | 153 |
| 230 | 3300005844 | Ga0068862_100127742 | Ga0068862_1001277425 | 153 |
| 231 | 3300005844 | Ga0068862_100241341 | Ga0068862_1002413412 | 153 |
| 232 | 3300005844 | Ga0068862_100305993 | Ga0068862_1003059933 | 153 |
| 233 | 3300005844 | Ga0068862_101105251 | Ga0068862_1011052511 | 153 |
| 234 | 3300005937 | Ga0081455_10001734 | Ga0081455_1000173421 | 153 |
| 235 | 3300005937 | Ga0081455_10017747 | Ga0081455_100177477 | 153 |
| 236 | 3300005937 | Ga0081455_10063978 | Ga0081455_100639782 | 153 |
| 237 | 3300005937 | Ga0081455_10667880 | Ga0081455_106678801 | 153 |
| 238 | 3300005983 | Ga0081540_1001682 | Ga0081540_100168210 | 153 |
| 239 | 3300005985 | Ga0081539_10000001 | Ga0081539_10000001559 | 153 |
| 240 | 3300005985 | Ga0081539_10001294 | Ga0081539_1000129412 | 153 |
| 241 | 3300005985 | Ga0081539_10041426 | Ga0081539_100414262 | 153 |
| 242 | 3300006028 | Ga0070717_10826012 | Ga0070717_108260122 | 153 |
| 243 | 3300006028 | Ga0070717_11199538 | Ga0070717_111995381 | 153 |
| 244 | 3300006042 | Ga0075368_10192414 | Ga0075368_101924142 | 153 |
| 245 | 3300006177 | Ga0075362_10015283 | Ga0075362_100152833 | 153 |
| 246 | 3300006177 | Ga0075362_10039087 | Ga0075362_100390873 | 153 |
| 247 | 3300006177 | Ga0075362_10165403 | Ga0075362_101654032 | 153 |
| 248 | 3300006178 | Ga0075367_10142406 | Ga0075367_101424063 | 153 |
| 249 | 3300006178 | Ga0075367_10198578 | Ga0075367_101985782 | 153 |
| 250 | 3300006186 | Ga0075369_10005411 | Ga0075369_100054116 | 153 |
| 251 | 3300006237 | Ga0097621_100524986 | Ga0097621_1005249862 | 153 |
| 252 | 3300006237 | Ga0097621_101206025 | Ga0097621_1012060251 | 153 |
| 253 | 3300006353 | Ga0075370_10012362 | Ga0075370_100123622 | 153 |
| 254 | 3300006358 | Ga0068871_100036905 | Ga0068871_1000369057 | 153 |
| 255 | 3300006358 | Ga0068871_101320468 | Ga0068871_1013204681 | 153 |
| 256 | 3300006844 | Ga0075428_100001751 | Ga0075428_10000175123 | 153 |
| 257 | 3300006852 | Ga0075433_10099961 | Ga0075433_100999613 | 153 |
| 258 | 3300006852 | Ga0075433_10100388 | Ga0075433_101003883 | 153 |
| 259 | 3300006871 | Ga0075434_100000816 | Ga0075434_10000081615 | 153 |
| 260 | 3300006871 | Ga0075434_100195892 | Ga0075434_1001958922 | 153 |
| 261 | 3300006871 | Ga0075434_100419668 | Ga0075434_1004196682 | 153 |
| 262 | 3300006871 | Ga0075434_100467802 | Ga0075434_1004678022 | 153 |
| 263 | 3300006881 | Ga0068865_100019910 | Ga0068865_1000199103 | 153 |
| 264 | 3300006914 | Ga0075436_100487470 | Ga0075436_1004874702 | 153 |
| 265 | 3300006931 | Ga0097620_100219755 | Ga0097620_1002197552 | 153 |
| 266 | 3300006931 | Ga0097620_100305324 | Ga0097620_1003053244 | 153 |
| 267 | 3300006931 | Ga0097620_101859227 | Ga0097620_1018592272 | 153 |
| 268 | 3300007076 | Ga0075435_100027706 | Ga0075435_1000277063 | 153 |
| 269 | 3300007076 | Ga0075435_100484954 | Ga0075435_1004849542 | 153 |
| 270 | 3300007076 | Ga0075435_100838637 | Ga0075435_1008386371 | 153 |
| 271 | 3300009011 | Ga0105251_10306120 | Ga0105251_103061202 | 153 |
| 272 | 3300009093 | Ga0105240_10004485 | Ga0105240_100044858 | 153 |
| 273 | 3300009093 | Ga0105240_10005388 | Ga0105240_100053883 | 153 |
| 274 | 3300009093 | Ga0105240_10520545 | Ga0105240_105205452 | 153 |
| 275 | 3300009094 | Ga0111539_10004025 | Ga0111539_1000402512 | 153 |
| 276 | 3300009094 | Ga0111539_11133167 | Ga0111539_111331671 | 153 |
| 277 | 3300009098 | Ga0105245_10021575 | Ga0105245_100215752 | 153 |
| 278 | 3300009101 | Ga0105247_10391516 | Ga0105247_103915162 | 153 |
| 279 | 3300009147 | Ga0114129_10004052 | Ga0114129_1000405211 | 153 |
| 280 | 3300009148 | Ga0105243_10001608 | Ga0105243_100016089 | 153 |
| 281 | 3300009174 | Ga0105241_10003669 | Ga0105241_100036694 | 153 |
| 282 | 3300009174 | Ga0105241_10067234 | Ga0105241_100672342 | 153 |
| 283 | 3300009174 | Ga0105241_10070482 | Ga0105241_100704823 | 153 |
| 284 | 3300009174 | Ga0105241_10279328 | Ga0105241_102793282 | 153 |
| 285 | 3300009177 | Ga0105248_10007485 | Ga0105248_100074853 | 153 |
| 286 | 3300009177 | Ga0105248_10251994 | Ga0105248_102519941 | 153 |
| 287 | 3300009545 | Ga0105237_10126533 | Ga0105237_101265334 | 153 |
| 288 | 3300009545 | Ga0105237_10223013 | Ga0105237_102230132 | 153 |
| 289 | 3300009545 | Ga0105237_10312041 | Ga0105237_103120414 | 153 |
| 290 | 3300009551 | Ga0105238_10005726 | Ga0105238_100057269 | 153 |
| 291 | 3300009551 | Ga0105238_10010115 | Ga0105238_100101154 | 153 |
| 292 | 3300009551 | Ga0105238_10027853 | Ga0105238_100278537 | 153 |
| 293 | 3300009551 | Ga0105238_10041404 | Ga0105238_100414043 | 153 |
| 294 | 3300009551 | Ga0105238_11012070 | Ga0105238_110120702 | 153 |
| 295 | 3300009553 | Ga0105249_10113389 | Ga0105249_101133896 | 153 |
| 296 | 3300009987 | Ga0105030_100276 | Ga0105030_1002767 | 153 |
| 297 | 3300010375 | Ga0105239_10081049 | Ga0105239_100810495 | 153 |
| 298 | 3300013100 | Ga0157373_10010816 | Ga0157373_100108163 | 153 |
| 299 | 3300013100 | Ga0157373_10072075 | Ga0157373_100720752 | 153 |
| 300 | 3300013102 | Ga0157371_10054153 | Ga0157371_100541532 | 153 |
| 301 | 3300013102 | Ga0157371_10958005 | Ga0157371_109580051 | 153 |
| 302 | 3300013104 | Ga0157370_10006388 | Ga0157370_100063886 | 153 |
| 303 | 3300013104 | Ga0157370_10010672 | Ga0157370_100106728 | 153 |
| 304 | 3300013104 | Ga0157370_10140960 | Ga0157370_101409602 | 153 |
| 305 | 3300013104 | Ga0157370_10749837 | Ga0157370_107498372 | 153 |
| 306 | 3300013105 | Ga0157369_10022153 | Ga0157369_100221536 | 153 |
| 307 | 3300013105 | Ga0157369_10081473 | Ga0157369_100814734 | 153 |
| 308 | 3300013105 | Ga0157369_10135626 | Ga0157369_101356265 | 153 |
| 309 | 3300013105 | Ga0157369_10523144 | Ga0157369_105231442 | 153 |
| 310 | 3300013296 | Ga0157374_10078442 | Ga0157374_100784425 | 153 |
| 311 | 3300013296 | Ga0157374_10089163 | Ga0157374_100891632 | 153 |
| 312 | 3300013306 | Ga0163162_10000830 | Ga0163162_1000083020 | 153 |
| 313 | 3300013307 | Ga0157372_10010331 | Ga0157372_100103315 | 153 |
| 314 | 3300013307 | Ga0157372_10015817 | Ga0157372_100158175 | 153 |
| 315 | 3300013307 | Ga0157372_10147351 | Ga0157372_101473513 | 153 |
| 316 | 3300013307 | Ga0157372_10192002 | Ga0157372_101920022 | 153 |
| 317 | 3300013307 | Ga0157372_10824481 | Ga0157372_108244812 | 153 |
| 318 | 3300013307 | Ga0157372_10867425 | Ga0157372_108674252 | 153 |
| 319 | 3300013308 | Ga0157375_10112491 | Ga0157375_101124916 | 153 |
| 320 | 3300013874 | Ga0157514_125748 | Ga0157514_1257482 | 153 |
| 321 | 3300014326 | Ga0157380_10008236 | Ga0157380_100082364 | 153 |
| 322 | 3300014326 | Ga0157380_10033720 | Ga0157380_100337205 | 153 |
| 323 | 3300014326 | Ga0157380_10245494 | Ga0157380_102454943 | 153 |
| 324 | 3300014497 | Ga0182008_10159318 | Ga0182008_101593182 | 153 |
| 325 | 3300014497 | Ga0182008_10419587 | Ga0182008_104195872 | 153 |
| 326 | 3300014745 | Ga0157377_10112496 | Ga0157377_101124962 | 153 |
| 327 | 3300014968 | Ga0157379_10001870 | Ga0157379_1000187013 | 153 |
| 328 | 3300014968 | Ga0157379_10014560 | Ga0157379_100145604 | 153 |
| 329 | 3300014969 | Ga0157376_10011825 | Ga0157376_100118258 | 153 |
| 330 | 3300014969 | Ga0157376_10808996 | Ga0157376_108089962 | 153 |
| 331 | 3300017792 | Ga0163161_10849548 | Ga0163161_108495481 | 153 |
| 332 | 3300020069 | Ga0197907_10899683 | Ga0197907_108996832 | 153 |
| 333 | 3300020082 | Ga0206353_10916553 | Ga0206353_109165534 | 153 |
| 334 | 3300021358 | Ga0213873_10222063 | Ga0213873_102220631 | 153 |
| 335 | 3300021384 | Ga0213876_10151763 | Ga0213876_101517631 | 153 |
| 336 | 3300025292 | Ga0209676_1000346 | Ga0209676_100034679 | 153 |
| 337 | 3300025303 | Ga0209051_1000284 | Ga0209051_10002848 | 153 |
| 338 | 3300025304 | Ga0209257_1016774 | Ga0209257_10167744 | 153 |
| 339 | 3300025315 | Ga0207697_10050884 | Ga0207697_100508843 | 153 |
| 340 | 3300025315 | Ga0207697_10107830 | Ga0207697_101078303 | 153 |
| 341 | 3300025321 | Ga0207656_10023822 | Ga0207656_100238224 | 153 |
| 342 | 3300025321 | Ga0207656_10298542 | Ga0207656_102985422 | 153 |
| 343 | 3300025900 | Ga0207710_10157475 | Ga0207710_101574753 | 153 |
| 344 | 3300025901 | Ga0207688_10047326 | Ga0207688_100473262 | 153 |
| 345 | 3300025903 | Ga0207680_10171283 | Ga0207680_101712832 | 153 |
| 346 | 3300025904 | Ga0207647_10135962 | Ga0207647_101359622 | 153 |
| 347 | 3300025907 | Ga0207645_10029005 | Ga0207645_100290057 | 153 |
| 348 | 3300025907 | Ga0207645_10034706 | Ga0207645_100347064 | 153 |
| 349 | 3300025907 | Ga0207645_10209618 | Ga0207645_102096182 | 153 |
| 350 | 3300025908 | Ga0207643_10030417 | Ga0207643_100304174 | 153 |
| 351 | 3300025909 | Ga0207705_10138462 | Ga0207705_101384622 | 153 |
| 352 | 3300025909 | Ga0207705_10180664 | Ga0207705_101806641 | 153 |
| 353 | 3300025911 | Ga0207654_10020632 | Ga0207654_100206322 | 153 |
| 354 | 3300025911 | Ga0207654_10038141 | Ga0207654_100381412 | 153 |
| 355 | 3300025911 | Ga0207654_10059670 | Ga0207654_100596702 | 153 |
| 356 | 3300025911 | Ga0207654_10087143 | Ga0207654_100871433 | 153 |
| 357 | 3300025912 | Ga0207707_10005989 | Ga0207707_100059894 | 153 |
| 358 | 3300025912 | Ga0207707_10249186 | Ga0207707_102491862 | 153 |
| 359 | 3300025912 | Ga0207707_10305204 | Ga0207707_103052042 | 153 |
| 360 | 3300025912 | Ga0207707_10408934 | Ga0207707_104089342 | 153 |
| 361 | 3300025913 | Ga0207695_10006376 | Ga0207695_100063763 | 153 |
| 362 | 3300025913 | Ga0207695_10020075 | Ga0207695_100200758 | 153 |
| 363 | 3300025913 | Ga0207695_10023115 | Ga0207695_100231156 | 153 |
| 364 | 3300025914 | Ga0207671_10066078 | Ga0207671_100660782 | 153 |
| 365 | 3300025914 | Ga0207671_10131025 | Ga0207671_101310252 | 153 |
| 366 | 3300025914 | Ga0207671_10212401 | Ga0207671_102124012 | 153 |
| 367 | 3300025917 | Ga0207660_10089498 | Ga0207660_100894983 | 153 |
| 368 | 3300025917 | Ga0207660_10196334 | Ga0207660_101963342 | 153 |
| 369 | 3300025918 | Ga0207662_10157113 | Ga0207662_101571132 | 153 |
| 370 | 3300025919 | Ga0207657_10000142 | Ga0207657_1000014251 | 153 |
| 371 | 3300025919 | Ga0207657_10032616 | Ga0207657_100326168 | 153 |
| 372 | 3300025919 | Ga0207657_10191922 | Ga0207657_101919222 | 153 |
| 373 | 3300025920 | Ga0207649_10025495 | Ga0207649_100254957 | 153 |
| 374 | 3300025920 | Ga0207649_10034563 | Ga0207649_100345635 | 153 |
| 375 | 3300025921 | Ga0207652_10021625 | Ga0207652_100216257 | 153 |
| 376 | 3300025921 | Ga0207652_10075818 | Ga0207652_100758182 | 153 |
| 377 | 3300025921 | Ga0207652_10119723 | Ga0207652_101197232 | 153 |
| 378 | 3300025921 | Ga0207652_10622321 | Ga0207652_106223212 | 153 |
| 379 | 3300025923 | Ga0207681_10043206 | Ga0207681_100432065 | 153 |
| 380 | 3300025923 | Ga0207681_10043214 | Ga0207681_100432143 | 153 |
| 381 | 3300025923 | Ga0207681_10078926 | Ga0207681_100789264 | 153 |
| 382 | 3300025924 | Ga0207694_10023532 | Ga0207694_100235327 | 153 |
| 383 | 3300025924 | Ga0207694_10023870 | Ga0207694_100238704 | 153 |
| 384 | 3300025924 | Ga0207694_10032630 | Ga0207694_100326303 | 153 |
| 385 | 3300025924 | Ga0207694_10109709 | Ga0207694_101097092 | 153 |
| 386 | 3300025924 | Ga0207694_10275402 | Ga0207694_102754022 | 153 |
| 387 | 3300025925 | Ga0207650_10646730 | Ga0207650_106467302 | 153 |
| 388 | 3300025926 | Ga0207659_10004432 | Ga0207659_1000443210 | 153 |
| 389 | 3300025926 | Ga0207659_10013115 | Ga0207659_1001311510 | 153 |
| 390 | 3300025926 | Ga0207659_10052279 | Ga0207659_100522792 | 153 |
| 391 | 3300025928 | Ga0207700_10032738 | Ga0207700_100327385 | 153 |
| 392 | 3300025929 | Ga0207664_10031551 | Ga0207664_100315512 | 153 |
| 393 | 3300025929 | Ga0207664_10058301 | Ga0207664_100583014 | 153 |
| 394 | 3300025929 | Ga0207664_10325607 | Ga0207664_103256072 | 153 |
| 395 | 3300025931 | Ga0207644_10117356 | Ga0207644_101173563 | 153 |
| 396 | 3300025931 | Ga0207644_10253898 | Ga0207644_102538982 | 153 |
| 397 | 3300025931 | Ga0207644_11409404 | Ga0207644_114094041 | 153 |
| 398 | 3300025932 | Ga0207690_10043611 | Ga0207690_100436111 | 153 |
| 399 | 3300025932 | Ga0207690_10094722 | Ga0207690_100947223 | 153 |
| 400 | 3300025932 | Ga0207690_10183883 | Ga0207690_101838832 | 153 |
| 401 | 3300025932 | Ga0207690_10234300 | Ga0207690_102343001 | 153 |
| 402 | 3300025933 | Ga0207706_10006991 | Ga0207706_1000699110 | 153 |
| 403 | 3300025933 | Ga0207706_10147178 | Ga0207706_101471782 | 153 |
| 404 | 3300025933 | Ga0207706_10212120 | Ga0207706_102121203 | 153 |
| 405 | 3300025934 | Ga0207686_10082791 | Ga0207686_100827913 | 153 |
| 406 | 3300025935 | Ga0207709_10000540 | Ga0207709_1000054013 | 153 |
| 407 | 3300025935 | Ga0207709_11299289 | Ga0207709_112992891 | 153 |
| 408 | 3300025937 | Ga0207669_10155065 | Ga0207669_101550653 | 153 |
| 409 | 3300025938 | Ga0207704_10431593 | Ga0207704_104315932 | 153 |
| 410 | 3300025939 | Ga0207665_10094659 | Ga0207665_100946592 | 153 |
| 411 | 3300025940 | Ga0207691_10010913 | Ga0207691_1001091313 | 153 |
| 412 | 3300025940 | Ga0207691_10022589 | Ga0207691_100225893 | 153 |
| 413 | 3300025940 | Ga0207691_10037814 | Ga0207691_100378143 | 153 |
| 414 | 3300025941 | Ga0207711_10013899 | Ga0207711_100138993 | 153 |
| 415 | 3300025942 | Ga0207689_10000856 | Ga0207689_1000085611 | 153 |
| 416 | 3300025942 | Ga0207689_10044075 | Ga0207689_100440752 | 153 |
| 417 | 3300025944 | Ga0207661_10004542 | Ga0207661_100045426 | 153 |
| 418 | 3300025944 | Ga0207661_10172051 | Ga0207661_101720512 | 153 |
| 419 | 3300025945 | Ga0207679_10037148 | Ga0207679_100371482 | 153 |
| 420 | 3300025945 | Ga0207679_10040785 | Ga0207679_100407855 | 153 |
| 421 | 3300025945 | Ga0207679_10264138 | Ga0207679_102641382 | 153 |
| 422 | 3300025949 | Ga0207667_10009529 | Ga0207667_100095294 | 153 |
| 423 | 3300025949 | Ga0207667_10009780 | Ga0207667_100097809 | 153 |
| 424 | 3300025949 | Ga0207667_10039768 | Ga0207667_100397682 | 153 |
| 425 | 3300025949 | Ga0207667_10482506 | Ga0207667_104825062 | 153 |
| 426 | 3300025960 | Ga0207651_10160284 | Ga0207651_101602842 | 153 |
| 427 | 3300025960 | Ga0207651_10250911 | Ga0207651_102509112 | 153 |
| 428 | 3300025972 | Ga0207668_10021657 | Ga0207668_100216573 | 153 |
| 429 | 3300025972 | Ga0207668_10054598 | Ga0207668_100545983 | 153 |
| 430 | 3300025972 | Ga0207668_10264901 | Ga0207668_102649012 | 153 |
| 431 | 3300025972 | Ga0207668_10367953 | Ga0207668_103679532 | 153 |
| 432 | 3300025981 | Ga0207640_10018518 | Ga0207640_100185181 | 153 |
| 433 | 3300025981 | Ga0207640_10120090 | Ga0207640_101200903 | 153 |
| 434 | 3300025981 | Ga0207640_10290709 | Ga0207640_102907092 | 153 |
| 435 | 3300025986 | Ga0207658_10031259 | Ga0207658_100312597 | 153 |
| 436 | 3300025986 | Ga0207658_10244428 | Ga0207658_102444283 | 153 |
| 437 | 3300026023 | Ga0207677_10010028 | Ga0207677_100100286 | 153 |
| 438 | 3300026023 | Ga0207677_10063012 | Ga0207677_100630122 | 153 |
| 439 | 3300026035 | Ga0207703_10036792 | Ga0207703_100367926 | 153 |
| 440 | 3300026035 | Ga0207703_10092359 | Ga0207703_100923595 | 153 |
| 441 | 3300026041 | Ga0207639_10011932 | Ga0207639_100119325 | 153 |
| 442 | 3300026041 | Ga0207639_10022769 | Ga0207639_100227691 | 153 |
| 443 | 3300026041 | Ga0207639_10060832 | Ga0207639_100608324 | 153 |
| 444 | 3300026041 | Ga0207639_10402480 | Ga0207639_104024803 | 153 |
| 445 | 3300026067 | Ga0207678_10002761 | Ga0207678_100027614 | 153 |
| 446 | 3300026075 | Ga0207708_11766791 | Ga0207708_117667911 | 153 |
| 447 | 3300026078 | Ga0207702_10048315 | Ga0207702_100483152 | 153 |
| 448 | 3300026078 | Ga0207702_10087151 | Ga0207702_100871515 | 153 |
| 449 | 3300026078 | Ga0207702_10226326 | Ga0207702_102263261 | 153 |
| 450 | 3300026078 | Ga0207702_10252025 | Ga0207702_102520254 | 153 |
| 451 | 3300026078 | Ga0207702_10465458 | Ga0207702_104654582 | 153 |
| 452 | 3300026088 | Ga0207641_10024573 | Ga0207641_100245738 | 153 |
| 453 | 3300026088 | Ga0207641_10341124 | Ga0207641_103411242 | 153 |
| 454 | 3300026089 | Ga0207648_10342919 | Ga0207648_103429193 | 153 |
| 455 | 3300026089 | Ga0207648_10371813 | Ga0207648_103718132 | 153 |
| 456 | 3300026089 | Ga0207648_10402052 | Ga0207648_104020522 | 153 |
| 457 | 3300026095 | Ga0207676_10010625 | Ga0207676_100106255 | 153 |
| 458 | 3300026095 | Ga0207676_10459617 | Ga0207676_104596172 | 153 |
| 459 | 3300026116 | Ga0207674_10005503 | Ga0207674_100055031 | 153 |
| 460 | 3300026116 | Ga0207674_10021603 | Ga0207674_100216032 | 153 |
| 461 | 3300026116 | Ga0207674_10039387 | Ga0207674_100393878 | 153 |
| 462 | 3300026116 | Ga0207674_10041802 | Ga0207674_100418027 | 153 |
| 463 | 3300026116 | Ga0207674_11259224 | Ga0207674_112592242 | 153 |
| 464 | 3300026118 | Ga0207675_100000879 | Ga0207675_10000087919 | 153 |
| 465 | 3300026118 | Ga0207675_100052670 | Ga0207675_1000526705 | 153 |
| 466 | 3300026118 | Ga0207675_100293719 | Ga0207675_1002937192 | 153 |
| 467 | 3300026121 | Ga0207683_10034658 | Ga0207683_100346585 | 153 |
| 468 | 3300026121 | Ga0207683_10052440 | Ga0207683_100524404 | 153 |
| 469 | 3300026142 | Ga0207698_10003937 | Ga0207698_1000393710 | 153 |
| 470 | 3300026142 | Ga0207698_10033549 | Ga0207698_100335496 | 153 |
| 471 | 3300026142 | Ga0207698_10088288 | Ga0207698_100882883 | 153 |
| 472 | 3300026142 | Ga0207698_10104328 | Ga0207698_101043285 | 153 |
| 473 | 3300026142 | Ga0207698_10145649 | Ga0207698_101456493 | 153 |
| 474 | 3300026142 | Ga0207698_10279019 | Ga0207698_102790192 | 153 |
| 475 | 3300026142 | Ga0207698_10313335 | Ga0207698_103133353 | 153 |
| 476 | 3300027543 | Ga0209999_1029774 | Ga0209999_10297742 | 153 |
| 477 | 3300027665 | Ga0209983_1026658 | Ga0209983_10266582 | 153 |
| 478 | 3300027866 | Ga0209813_10093257 | Ga0209813_100932572 | 153 |
| 479 | 3300027866 | Ga0209813_10110162 | Ga0209813_101101622 | 153 |
| 480 | 3300027876 | Ga0209974_10026407 | Ga0209974_100264073 | 153 |
| 481 | 3300027907 | Ga0207428_10000152 | Ga0207428_1000015234 | 153 |
| 482 | 3300027907 | Ga0207428_10027374 | Ga0207428_100273746 | 153 |
| 483 | 3300028379 | Ga0268266_10163840 | Ga0268266_101638404 | 153 |
| 484 | 3300028379 | Ga0268266_11015477 | Ga0268266_110154772 | 153 |
| 485 | 3300028380 | Ga0268265_10033763 | Ga0268265_100337635 | 153 |
| 486 | 3300028380 | Ga0268265_10187744 | Ga0268265_101877442 | 153 |
| 487 | 3300028380 | Ga0268265_10548045 | Ga0268265_105480453 | 153 |
| 488 | 3300028380 | Ga0268265_10628508 | Ga0268265_106285082 | 153 |
| 489 | 3300028381 | Ga0268264_10060839 | Ga0268264_100608393 | 153 |
| 490 | 3300028381 | Ga0268264_10101594 | Ga0268264_101015944 | 153 |
| 491 | 3300028381 | Ga0268264_10394552 | Ga0268264_103945522 | 153 |
| 492 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034316 | 153 |
| 493 | 3300028794 | Ga0307515_10018885 | Ga0307515_100188858 | 153 |
| 494 | 3300028794 | Ga0307515_10271307 | Ga0307515_102713072 | 153 |
| 495 | 3300030521 | Ga0307511_10028923 | Ga0307511_100289234 | 153 |
| 496 | 3300031240 | Ga0265320_10054034 | Ga0265320_100540342 | 153 |
| 497 | 3300031250 | Ga0265331_10068472 | Ga0265331_100684722 | 153 |
| 498 | 3300031456 | Ga0307513_10515171 | Ga0307513_105151712 | 153 |
| 499 | 3300031548 | Ga0307408_100093008 | Ga0307408_1000930083 | 153 |
| 500 | 3300031548 | Ga0307408_100329535 | Ga0307408_1003295352 | 153 |
| 501 | 3300031548 | Ga0307408_100851507 | Ga0307408_1008515072 | 153 |
| 502 | 3300031730 | Ga0307516_10003296 | Ga0307516_100032966 | 153 |
| 503 | 3300031730 | Ga0307516_10020560 | Ga0307516_100205604 | 153 |
| 504 | 3300031731 | Ga0307405_10085115 | Ga0307405_100851153 | 153 |
| 505 | 3300031903 | Ga0307407_10007279 | Ga0307407_100072792 | 153 |
| 506 | 3300032002 | Ga0307416_100053978 | Ga0307416_1000539785 | 153 |
| 507 | 3300032002 | Ga0307416_101032367 | Ga0307416_1010323672 | 153 |
| 508 | 3300032126 | Ga0307415_101211109 | Ga0307415_1012111091 | 153 |
| 509 | 3300034816 | Ga0373930_0010975 | Ga0373930_0010975_789_1289 | 153 |
| 510 | 3300035088 | Ga0373940_0010835 | Ga0373940_0010835_421_921 | 153 |
| 511 | 3300035114 | Ga0373939_0049193 | Ga0373939_0049193_225_725 | 153 |
| 512 | 3300035171 | Ga0373946_0094085 | Ga0373946_0094085_75_557 | 153 |
| 513 | 3300035242 | Ga0373962_0007567 | Ga0373962_0007567_478_978 | 153 |
| 514 | 3300035691 | Ga0373931_0006633 | Ga0373931_0006633_1361_1861 | 153 |
| 515 | 3300035691 | Ga0373931_0128858 | Ga0373931_0128858_847_1320 | 153 |
| 516 | 3300035691 | Ga0373931_0494448 | Ga0373931_0494448_234_728 | 153 |
| 517 | 3300035692 | Ga0373935_0861804 | Ga0373935_0861804_157_639 | 153 |
| 518 | 3300037068 | Ga0373925_0279482 | Ga0373925_0279482_842_1315 | 153 |
| 519 | 3300037312 | Ga0395899_0012535 | Ga0395899_0012535_865_1347 | 153 |
| 520 | 3300037312 | Ga0395899_0295694 | Ga0395899_0295694_194_682 | 153 |
| 521 | 3300037418 | Ga0395900_0009587 | Ga0395900_0009587_5035_5577 | 153 |
| 522 | 3300037418 | Ga0395900_0115638 | Ga0395900_0115638_675_1157 | 153 |
| 523 | 3300037418 | Ga0395900_0145253 | Ga0395900_0145253_1614_2096 | 153 |
| 524 | 3300037418 | Ga0395900_0240303 | Ga0395900_0240303_1073_1561 | 153 |
| 525 | 3300037418 | Ga0395900_0707581 | Ga0395900_0707581_33_521 | 153 |
| 526 | 3300037466 | Ga0395898_0191039 | Ga0395898_0191039_1126_1614 | 153 |
| 527 | 3300037466 | Ga0395898_0211074 | Ga0395898_0211074_935_1417 | 153 |
| 528 | 3300037471 | Ga0395905_0000883 | Ga0395905_0000883_3352_3834 | 153 |
| 529 | 3300037471 | Ga0395905_0010764 | Ga0395905_0010764_4994_5494 | 153 |
| 530 | 3300037471 | Ga0395905_0020602 | Ga0395905_0020602_2464_2949 | 153 |
| 531 | 3300037471 | Ga0395905_0317436 | Ga0395905_0317436_253_735 | 153 |
| 532 | 3300037471 | Ga0395905_0415180 | Ga0395905_0415180_23_526 | 153 |
| 533 | 3300038443 | Ga0395901_0004759 | Ga0395901_0004759_686_1174 | 153 |
| 534 | 3300038443 | Ga0395901_0015549 | Ga0395901_0015549_2048_2530 | 153 |
| 535 | 3300038443 | Ga0395901_1033885 | Ga0395901_1033885_156_644 | 153 |
| 536 | 3300039437 | Ga0436365_0208379 | Ga0436365_0208379_650_1132 | 153 |
| 537 | 3300039437 | Ga0436365_1016022 | Ga0436365_1016022_1730_2233 | 153 |
| 538 | 3300039450 | Ga0436363_0107667 | Ga0436363_0107667_1497_1970 | 153 |
| 539 | 3300041404 | Ga0439436_0003148 | Ga0439436_0003148_4412_4975 | 153 |
| 540 | 3300041404 | Ga0439436_0007708 | Ga0439436_0007708_2593_3093 | 153 |
| 541 | 3300041406 | Ga0439439_0012756 | Ga0439439_0012756_517_1017 | 153 |
| 542 | 3300041406 | Ga0439439_0032576 | Ga0439439_0032576_42_605 | 153 |
| 543 | 3300041407 | Ga0439447_020102 | Ga0439447_020102_339_902 | 153 |
| 544 | 3300041411 | Ga0439466_0004735 | Ga0439466_0004735_4512_5075 | 153 |
| 545 | 3300041411 | Ga0439466_0011107 | Ga0439466_0011107_2263_2763 | 153 |
| 546 | 3300041413 | Ga0439465_0035965 | Ga0439465_0035965_990_1472 | 153 |
| 547 | 3300041452 | Ga0451793_0211241 | Ga0451793_0211241_220_717 | 153 |
| 548 | 3300041453 | Ga0451797_0461082 | Ga0451797_0461082_1707_2204 | 153 |
| 549 | 3300041459 | Ga0451800_0593028 | Ga0451800_0593028_177_650 | 153 |
| 550 | 3300041459 | Ga0451800_0767295 | Ga0451800_0767295_260_751 | 153 |
| 551 | 3300041463 | Ga0451804_0103686 | Ga0451804_0103686_242_739 | 153 |
| 552 | 3300041492 | Ga0451835_0946079 | Ga0451835_0946079_313_810 | 153 |
| 553 | 3300041498 | Ga0451841_0631142 | Ga0451841_0631142_220_717 | 153 |
| 554 | 3300041501 | Ga0451845_0537950 | Ga0451845_0537950_269_766 | 153 |
| 555 | 3300041509 | Ga0451843_1764350 | Ga0451843_1764350_284_781 | 153 |
| 556 | 3300041512 | Ga0451853_2282553 | Ga0451853_2282553_297_791 | 153 |
| 557 | 3300041997 | Ga0439431_0005421 | Ga0439431_0005421_1490_2053 | 153 |
| 558 | 3300041999 | Ga0439433_0004518 | Ga0439433_0004518_1411_1974 | 153 |
| 559 | 3300042002 | Ga0439442_007850 | Ga0439442_007850_1479_2036 | 153 |
| 560 | 3300042004 | Ga0439445_0003668 | Ga0439445_0003668_1807_2370 | 153 |
| 561 | 3300042006 | Ga0439432_017634 | Ga0439432_017634_838_1401 | 153 |
| 562 | 3300042006 | Ga0439432_038634 | Ga0439432_038634_863_1363 | 153 |
| 563 | 3300042007 | Ga0439449_0002894 | Ga0439449_0002894_4428_4991 | 153 |
| 564 | 3300042007 | Ga0439449_0029030 | Ga0439449_0029030_360_872 | 153 |
| 565 | 3300042007 | Ga0439449_0030220 | Ga0439449_0030220_427_927 | 153 |
| 566 | 3300042010 | Ga0439452_004744 | Ga0439452_004744_505_1005 | 153 |
| 567 | 3300042010 | Ga0439452_008152 | Ga0439452_008152_1312_1875 | 153 |
| 568 | 3300042014 | Ga0439457_023486 | Ga0439457_023486_473_1036 | 153 |
| 569 | 3300042015 | Ga0439462_0005459 | Ga0439462_0005459_2269_2769 | 153 |
| 570 | 3300042015 | Ga0439462_0007022 | Ga0439462_0007022_2058_2621 | 153 |
| 571 | 3300042125 | Ga0450923_020159 | Ga0450923_020159_206_706 | 153 |
| 572 | 3300042128 | Ga0450897_000960 | Ga0450897_000960_816_1316 | 153 |
| 573 | 3300042135 | Ga0450899_028104 | Ga0450899_028104_139_639 | 153 |
| 574 | 3300042145 | Ga0450906_046895 | Ga0450906_046895_118_618 | 153 |
| 575 | 3300042146 | Ga0450907_022937 | Ga0450907_022937_48_548 | 153 |
| 576 | 3300042156 | Ga0439446_0047533 | Ga0439446_0047533_199_699 | 153 |
| 577 | 3300042435 | Ga0439434_0065141 | Ga0439434_0065141_320_820 | 153 |
| 578 | 3300042532 | Ga0450893_0009616 | Ga0450893_0009616_800_1300 | 153 |
| 579 | 3300042876 | Ga0451577_0101976 | Ga0451577_0101976_1438_1914 | 153 |
| 580 | 3300044658 | Ga0466972_0003747 | Ga0466972_0003747_840_1355 | 153 |
| 581 | 3300044683 | Ga0466965_0005827 | Ga0466965_0005827_2001_2516 | 153 |
| 582 | 3300044683 | Ga0466965_0107847 | Ga0466965_0107847_706_1194 | 153 |
| 583 | 3300044684 | Ga0466966_0010532 | Ga0466966_0010532_4610_5098 | 153 |
| 584 | 3300044694 | Ga0466963_0251649 | Ga0466963_0251649_174_653 | 153 |
| 585 | 3300044706 | Ga0466964_0008502 | Ga0466964_0008502_1554_2069 | 153 |
| 586 | 3300044712 | Ga0453684_1044128 | Ga0453684_1044128_17_508 | 153 |
| 587 | 3300044735 | Ga0466968_0011304 | Ga0466968_0011304_2383_2898 | 153 |
| 588 | 3300045051 | Ga0451576_0072876 | Ga0451576_0072876_2569_3051 | 153 |
| 589 | 3300046453 | Ga0495627_009665 | Ga0495627_009665_2933_3457 | 153 |
| 590 | 3300046454 | Ga0495592_0391866 | Ga0495592_0391866_39_518 | 153 |
| 591 | 3300046463 | Ga0495653_0395302 | Ga0495653_0395302_326_805 | 153 |
| 592 | 3300046477 | Ga0495664_0200440 | Ga0495664_0200440_285_800 | 153 |
| 593 | 3300046512 | Ga0495610_0177203 | Ga0495610_0177203_233_757 | 153 |
| 594 | 3300046515 | Ga0495620_0022193 | Ga0495620_0022193_2397_2921 | 153 |
| 595 | 3300046516 | Ga0495628_0480078 | Ga0495628_0480078_227_706 | 153 |
| 596 | 3300046516 | Ga0495628_0485497 | Ga0495628_0485497_102_587 | 153 |
| 597 | 3300046520 | Ga0495637_0021694 | Ga0495637_0021694_1025_1549 | 153 |
| 598 | 3300046530 | Ga0495654_0002010 | Ga0495654_0002010_9670_10179 | 153 |
| 599 | 3300046558 | Ga0495633_0246467 | Ga0495633_0246467_232_756 | 153 |
| 600 | 3300046660 | Ga0495625_0154116 | Ga0495625_0154116_375_899 | 153 |
| 601 | 3300046665 | Ga0495661_0282655 | Ga0495661_0282655_250_774 | 153 |
| 602 | 3300046692 | Ga0495671_0005355 | Ga0495671_0005355_2719_3243 | 153 |
| 603 | 3300046810 | Ga0495660_0374002 | Ga0495660_0374002_24_548 | 153 |
| 604 | 3300047319 | Ga0495674_1201294 | Ga0495674_1201294_56_553 | 153 |
| 605 | 3300047320 | Ga0495672_0166756 | Ga0495672_0166756_314_793 | 153 |
| 606 | 3300047321 | Ga0495676_0638229 | Ga0495676_0638229_49_534 | 153 |
| 607 | 3300048903 | Ga0496100_0019573 | Ga0496100_0019573_3144_3644 | 153 |
| 608 | 3300048904 | Ga0496101_0053277 | Ga0496101_0053277_1781_2281 | 153 |
| 609 | 3300048905 | Ga0496102_0068465 | Ga0496102_0068465_2354_2854 | 153 |
| 610 | 3300048908 | Ga0496105_0148386 | Ga0496105_0148386_567_1067 | 153 |
| 611 | 3300048909 | Ga0496106_0015833 | Ga0496106_0015833_2916_3416 | 153 |
| 612 | 3300048910 | Ga0496107_0004328 | Ga0496107_0004328_6428_6928 | 153 |
| 613 | 3300048911 | Ga0496108_0104079 | Ga0496108_0104079_1218_1718 | 153 |
| 614 | 3300048912 | Ga0496109_0095016 | Ga0496109_0095016_484_984 | 153 |
| 615 | 3300048912 | Ga0496109_0766675 | Ga0496109_0766675_323_823 | 153 |
| 616 | 3300048913 | Ga0496110_0299570 | Ga0496110_0299570_16_516 | 153 |
| 617 | 3300048914 | Ga0496111_0031530 | Ga0496111_0031530_2152_2652 | 153 |
| 618 | 3300048917 | Ga0496114_0097804 | Ga0496114_0097804_1361_1861 | 153 |
| 619 | 3300048918 | Ga0496115_0033835 | Ga0496115_0033835_596_1096 | 153 |
| 620 | 3300048924 | Ga0496121_0239264 | Ga0496121_0239264_734_1207 | 153 |
| 621 | 3300048924 | Ga0496121_0757043 | Ga0496121_0757043_10_486 | 153 |
| 622 | 3300048929 | Ga0496126_0014536 | Ga0496126_0014536_6572_7045 | 153 |
| 623 | 3300048929 | Ga0496126_0083272 | Ga0496126_0083272_385_873 | 153 |
| 624 | 3300049571 | Ga0501034_0287736 | Ga0501034_0287736_726_1205 | 153 |
| 625 | 3300049571 | Ga0501034_0514116 | Ga0501034_0514116_227_694 | 153 |
| 626 | 3300049572 | Ga0501036_0023593 | Ga0501036_0023593_199_666 | 153 |
| 627 | 3300049572 | Ga0501036_0163149 | Ga0501036_0163149_1224_1724 | 153 |
| 628 | 3300049573 | Ga0501037_0387929 | Ga0501037_0387929_91_558 | 153 |
| 629 | 3300049573 | Ga0501037_0499091 | Ga0501037_0499091_174_677 | 153 |
| 630 | 3300049574 | Ga0501038_0681013 | Ga0501038_0681013_31_498 | 153 |
| 631 | 3300049575 | Ga0501039_0055156 | Ga0501039_0055156_33_536 | 153 |
| 632 | 3300049576 | Ga0501040_0001677 | Ga0501040_0001677_13378_13881 | 153 |
| 633 | 3300049576 | Ga0501040_0005535 | Ga0501040_0005535_2668_3135 | 153 |
| 634 | 3300049577 | Ga0501041_0003272 | Ga0501041_0003272_7777_8280 | 153 |
| 635 | 3300049577 | Ga0501041_0004599 | Ga0501041_0004599_2086_2553 | 153 |
| 636 | 3300049578 | Ga0501042_0018555 | Ga0501042_0018555_1093_1560 | 153 |
| 637 | 3300049578 | Ga0501042_0024465 | Ga0501042_0024465_3273_3776 | 153 |
| 638 | 3300049579 | Ga0501043_0000573 | Ga0501043_0000573_2340_2849 | 153 |
| 639 | 3300049579 | Ga0501043_0566612 | Ga0501043_0566612_149_616 | 153 |
| 640 | 3300049580 | Ga0501046_0000752 | Ga0501046_0000752_2388_2897 | 153 |
| 641 | 3300049580 | Ga0501046_0014242 | Ga0501046_0014242_868_1371 | 153 |
| 642 | 3300049580 | Ga0501046_0019277 | Ga0501046_0019277_4059_4526 | 153 |
| 643 | 3300049580 | Ga0501046_0805325 | Ga0501046_0805325_111_611 | 153 |
| 644 | 3300049581 | Ga0501047_0000298 | Ga0501047_0000298_2287_2796 | 153 |
| 645 | 3300049581 | Ga0501047_0005437 | Ga0501047_0005437_5104_5589 | 153 |
| 646 | 3300049582 | Ga0501048_0003640 | Ga0501048_0003640_2476_2985 | 153 |
| 647 | 3300049582 | Ga0501048_0012421 | Ga0501048_0012421_2423_2890 | 153 |
| 648 | 3300049582 | Ga0501048_0134828 | Ga0501048_0134828_870_1370 | 153 |
| 649 | 3300049582 | Ga0501048_0750661 | Ga0501048_0750661_166_663 | 153 |
| 650 | 3300049584 | Ga0501068_0047704 | Ga0501068_0047704_931_1398 | 153 |
| 651 | 3300049584 | Ga0501068_0192506 | Ga0501068_0192506_179_670 | 153 |
| 652 | 3300049584 | Ga0501068_0508668 | Ga0501068_0508668_223_726 | 153 |
| 653 | 3300049585 | Ga0501069_0277742 | Ga0501069_0277742_241_729 | 153 |
| 654 | 3300049586 | Ga0501070_0061210 | Ga0501070_0061210_584_1069 | 153 |
| 655 | 3300049587 | Ga0501071_0048023 | Ga0501071_0048023_2558_3046 | 153 |
| 656 | 3300049587 | Ga0501071_0058241 | Ga0501071_0058241_789_1286 | 153 |
| 657 | 3300049587 | Ga0501071_0164637 | Ga0501071_0164637_971_1471 | 153 |
| 658 | 3300049588 | Ga0501072_0034140 | Ga0501072_0034140_2313_2816 | 153 |
| 659 | 3300049589 | Ga0501073_0109059 | Ga0501073_0109059_170_673 | 153 |
| 660 | 3300049589 | Ga0501073_0204780 | Ga0501073_0204780_143_610 | 153 |
| 661 | 3300049589 | Ga0501073_0245596 | Ga0501073_0245596_45_539 | 153 |
| 662 | 3300049590 | Ga0501074_0057744 | Ga0501074_0057744_688_1191 | 153 |
| 663 | 3300049590 | Ga0501074_0078648 | Ga0501074_0078648_1624_2103 | 153 |
| 664 | 3300049590 | Ga0501074_0265037 | Ga0501074_0265037_632_1099 | 153 |
| 665 | 3300049591 | Ga0501075_0009539 | Ga0501075_0009539_6235_6738 | 153 |
| 666 | 3300049591 | Ga0501075_0011038 | Ga0501075_0011038_2773_3273 | 153 |
| 667 | 3300049591 | Ga0501075_0026233 | Ga0501075_0026233_3144_3611 | 153 |
| 668 | 3300049592 | Ga0501076_0080875 | Ga0501076_0080875_1681_2148 | 153 |
| 669 | 3300049592 | Ga0501076_0085239 | Ga0501076_0085239_1583_2086 | 153 |
| 670 | 3300049592 | Ga0501076_0263667 | Ga0501076_0263667_824_1312 | 153 |
| 671 | 3300049593 | Ga0501077_0013790 | Ga0501077_0013790_874_1362 | 153 |
| 672 | 3300049593 | Ga0501077_0305422 | Ga0501077_0305422_203_706 | 153 |
| 673 | 3300049682 | Ga0501252_033465 | Ga0501252_033465_199_693 | 153 |
| 674 | 3300049741 | Ga0501079_0005863 | Ga0501079_0005863_7611_8078 | 153 |
| 675 | 3300049741 | Ga0501079_0278273 | Ga0501079_0278273_453_956 | 153 |
| 676 | 3300049741 | Ga0501079_0781858 | Ga0501079_0781858_272_736 | 153 |
| 677 | 3300049742 | Ga0501080_0002090 | Ga0501080_0002090_1971_2456 | 153 |
| 678 | 3300049742 | Ga0501080_0010278 | Ga0501080_0010278_3743_4231 | 153 |
| 679 | 3300049742 | Ga0501080_0082448 | Ga0501080_0082448_217_684 | 153 |
| 680 | 3300049742 | Ga0501080_0123510 | Ga0501080_0123510_341_844 | 153 |
| 681 | 3300049742 | Ga0501080_0367905 | Ga0501080_0367905_458_958 | 153 |
| 682 | 3300049743 | Ga0501081_0005137 | Ga0501081_0005137_1732_2199 | 153 |
| 683 | 3300049743 | Ga0501081_0105990 | Ga0501081_0105990_201_701 | 153 |
| 684 | 3300049744 | Ga0501083_0064057 | Ga0501083_0064057_507_974 | 153 |
| 685 | 3300049822 | Ga0501035_0200872 | Ga0501035_0200872_824_1309 | 153 |
| 686 | 3300049822 | Ga0501035_0776298 | Ga0501035_0776298_15_482 | 153 |
| 687 | 3300049824 | Ga0501045_0009696 | Ga0501045_0009696_4112_4621 | 153 |
| 688 | 3300049824 | Ga0501045_0017809 | Ga0501045_0017809_418_885 | 153 |
| 689 | 3300049824 | Ga0501045_0027684 | Ga0501045_0027684_2355_2858 | 153 |
| 690 | 3300049824 | Ga0501045_0042241 | Ga0501045_0042241_2505_3005 | 153 |
| 691 | 3300049824 | Ga0501045_0988830 | Ga0501045_0988830_23_514 | 153 |
| 692 | 3300050489 | nmdc:mga03683_1140_c1 | nmdc:mga03683_1140_c1_1412_1894 | 153 |
| 693 | 3300050489 | nmdc:mga03683_122698_c1 | nmdc:mga03683_122698_c1_618_1100 | 153 |
| 694 | 3300050489 | nmdc:mga03683_5158_c1 | nmdc:mga03683_5158_c1_2413_2913 | 153 |
| 695 | 3300050489 | nmdc:mga03683_609841_c1 | nmdc:mga03683_609841_c1_46_525 | 153 |
| 696 | 3300050490 | nmdc:mga03n38_282687_c1 | nmdc:mga03n38_282687_c1_369_869 | 153 |
| 697 | 3300050491 | nmdc:mga00v17_573807_c1 | nmdc:mga00v17_573807_c1_236_718 | 153 |
| 698 | 3300050492 | nmdc:mga0yw44_350879_c1 | nmdc:mga0yw44_350879_c1_39_521 | 153 |
| 699 | 3300050494 | nmdc:mga06z11_334771_c1 | nmdc:mga06z11_334771_c1_128_610 | 153 |
| 700 | 3300050494 | nmdc:mga06z11_564985_c1 | nmdc:mga06z11_564985_c1_87_575 | 153 |
| 701 | 3300050495 | nmdc:mga04h51_31991_c1 | nmdc:mga04h51_31991_c1_432_914 | 153 |
| 702 | 3300050495 | nmdc:mga04h51_36159_c1 | nmdc:mga04h51_36159_c1_232_714 | 153 |
| 703 | 3300050496 | nmdc:mga07m45_9139_c1 | nmdc:mga07m45_9139_c1_1169_1651 | 153 |
| 704 | 3300050507 | nmdc:mga05p37_108188_c1 | nmdc:mga05p37_108188_c1_2111_2602 | 153 |
| 705 | 3300050507 | nmdc:mga05p37_229145_c1 | nmdc:mga05p37_229145_c1_1388_1861 | 153 |
| 706 | 3300050511 | nmdc:mga08y16_37683_c1 | nmdc:mga08y16_37683_c1_2759_3250 | 153 |
| 707 | 3300050511 | nmdc:mga08y16_54_c1 | nmdc:mga08y16_54_c1_71448_71942 | 153 |
| 708 | 3300050511 | nmdc:mga08y16_821575_c1 | nmdc:mga08y16_821575_c1_382_873 | 153 |
| 709 | 3300050512 | nmdc:mga0n895_9679_c1 | nmdc:mga0n895_9679_c1_4370_4861 | 153 |
| 710 | 3300050513 | nmdc:mga0rr50_165557_c1 | nmdc:mga0rr50_165557_c1_438_929 | 153 |
| 711 | 3300050513 | nmdc:mga0rr50_765905_c1 | nmdc:mga0rr50_765905_c1_272_772 | 153 |
| 712 | 3300050514 | nmdc:mga08x19_509528_c1 | nmdc:mga08x19_509528_c1_119_604 | 153 |
| 713 | 3300050515 | nmdc:mga0a205_2327_c1 | nmdc:mga0a205_2327_c1_8580_9071 | 153 |
| 714 | 3300050516 | nmdc:mga0sz30_16817_c1 | nmdc:mga0sz30_16817_c1_1561_2043 | 153 |
| 715 | 3300050516 | nmdc:mga0sz30_16817_c1 | nmdc:mga0sz30_16817_c1_868_1350 | 153 |
| 716 | 3300053079 | Ga0500610_0005742 | Ga0500610_0005742_1943_2467 | 153 |
| 717 | 3300053079 | Ga0500610_0018232 | Ga0500610_0018232_197_721 | 153 |
| 718 | 3300053085 | Ga0495619_0728934 | Ga0495619_0728934_163_642 | 153 |
| 719 | 3300053093 | Ga0500651_0155396 | Ga0500651_0155396_422_904 | 153 |
| 720 | 3300053098 | Ga0500650_0284169 | Ga0500650_0284169_129_617 | 153 |
| 721 | 3300053117 | Ga0500593_003920 | Ga0500593_003920_2031_2555 | 153 |
| 722 | 3300053131 | Ga0500652_067867 | Ga0500652_067867_227_751 | 153 |
| 723 | 3300053136 | Ga0500559_0126437 | Ga0500559_0126437_95_610 | 153 |
| 724 | 3300053153 | Ga0500616_0002351 | Ga0500616_0002351_573_1055 | 153 |
| 725 | 3300053161 | Ga0500634_0002047 | Ga0500634_0002047_2291_2815 | 153 |
| 726 | 3300053733 | Ga0500552_000821 | Ga0500552_000821_347_829 | 153 |
| 727 | 3300054114 | Ga0501084_0011061 | Ga0501084_0011061_50_553 | 153 |
| 728 | 3300054114 | Ga0501084_0015960 | Ga0501084_0015960_4718_5185 | 153 |
| 729 | 3300054114 | Ga0501084_0367677 | Ga0501084_0367677_710_1195 | 153 |
| 730 | 3300060353 | Ga0501082_0003668 | Ga0501082_0003668_11950_12417 | 153 |
| 731 | 3300060353 | Ga0501082_0555056 | Ga0501082_0555056_379_870 | 153 |
| 732 | 3300061734 | Ga0530510_0016521 | Ga0530510_0016521_994_1497 | 153 |
| 733 | 3300061734 | Ga0530510_0054832 | Ga0530510_0054832_1584_2051 | 153 |
| 734 | 3300061734 | Ga0530510_0345218 | Ga0530510_0345218_326_823 | 153 |
| 735 | iso_pu_bacteria | 2585428062 | 2587758082 | 153 |
| 736 | iso_pu_bacteria | 2643221652 | 2644291967 | 153 |
| 737 | iso_pu_bacteria | 2885192300 | 2885194328 | 153 |
| 738 | iso_pu_bacteria | 2929520902 | 2929526566 | 153 |
| 739 | 3300003203 | JGI25406J46586_10055306 | JGI25406J46586_100553062 | 154 |
| 740 | 3300005983 | Ga0081540_1040152 | Ga0081540_10401523 | 154 |
| 741 | 3300005985 | Ga0081539_10001470 | Ga0081539_1000147021 | 154 |
| 742 | 3300005985 | Ga0081539_10275840 | Ga0081539_102758402 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.8601 | 2 | 135 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.7813 | 2 | 135 |
| 4zgr-assembly1.cif.gz_A | structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with t-antigen. | 0.7595 | 54 | 85 |
| 2jjr-assembly1.cif.gz_A | v232k, n236d-trichosanthin | 0.7574 | 54 | 83 |
| 6loq-assembly1.cif.gz_A | crystal structure of alpha-momorcharin in complex with camp | 0.7534 | 54 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ahbA01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.7473 | 54 | 85 | 3.40.420.10 |
| 4z8sA01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.7444 | 54 | 83 | 3.40.420.10 |
| af_A0A1D6EPM0_14_114_2.170.150.70 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.7435 | 1 | 101 | 2.170.150.70 |
| 2k7iB01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like | 0.7387 | 56 | 83 | 3.30.160.160 |
| 1j1qA01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.7243 | 53 | 85 | 3.40.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A175WBH7-F1-model_v4 | Putative glutathione-dependent formaldehyde-activating enzyme | 0.9879 | 1 | 134 |
GO:0016846
GO:0046872 |
| AF-A0A0R3M6V1-F1-model_v4 | Aldehyde-activating protein | 0.9861 | 1 | 153 |
GO:0016846
GO:0046872 |
| AF-A0A2S7K7D9-F1-model_v4 | Aldehyde-activating protein | 0.9848 | 2 | 153 |
GO:0016846
GO:0046872 |
| AF-A0A534BLW2-F1-model_v4 | GFA family protein | 0.9845 | 2 | 122 |
GO:0016846
GO:0046872 |
| AF-A0A848H3V4-F1-model_v4 | GFA family protein | 0.9815 | 2 | 152 |
GO:0016846
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar