F478646

General Info

Members Datasets Scaffolds Average Seq Length
742 300 742 391

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10190204|Ga0307405_101902041
Length 419
Sequence LAPLLRGGPPMATSASDPTTVETEELALLFGPHAASAFPTDALVGKMLDYGPGISDLVFSPGRPPQVEQDGELTPVPIAGLEKLSAAHTAVIARHLVAGQPQAVRALRDQGACDLSFVLGERARFRVNVFRQRGTFAIVMRLIATKVPTLQELGLPPYLARIAALKSGIVLVTGPTGSGKSSTLAAMIDLINDTRAEHILTIEDPVEYLHEHKKATVHQRELHSDTPTFALALRAALRQAPKVILVGEMRDRDTMEIALTAAETGHLVLSTLHTIDAARTVDRVIGAFDVGDQQAIRIRLAATFRAFISQRLVPKKGGGRIALLEILTSTMRTREYIEKGDSEGRSLLDAMRDGALDGMQHFDGEIERLVRAGVISGRVGLLNATNPGNLRVMMADISLDDEPVASGVVEGLEHGLITQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
197 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
276 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 4.18
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6047714 2162886012 Bacteria 2922
2 JGI24748J21848_1000002 3300002074 Bacteria 426946
3 JGI24034J26672_10000004 3300002239 Bacteria 426946
4 JGI24751J29686_10000396 3300002459 Bacteria 14487
5 JGI25406J46586_10009109 3300003203 Bacteria 4455
6 JGI25406J46586_10015284 3300003203 Bacteria 3242
7 JGI25406J46586_10027247 3300003203 Bacteria 2194
8 Ga0058862_12841824 3300004803 Bacteria 1413
9 Ga0065704_10110498 3300005289 Bacteria 1978
10 Ga0065712_10000112 3300005290 Bacteria 340011
11 Ga0065715_10090735 3300005293 Bacteria 6548
12 Ga0065715_10117371 3300005293 Bacteria 2350
13 Ga0065707_10014710 3300005295 Bacteria 2498
14 Ga0070690_100087672 3300005330 Bacteria 2044
15 Ga0070670_100031878 3300005331 Bacteria 4538
16 Ga0070670_100124788 3300005331 Bacteria 2222
17 Ga0070666_10030297 3300005335 Bacteria 3563
18 Ga0070666_10049576 3300005335 Bacteria 2822
19 Ga0070680_100005685 3300005336 Bacteria 9458
20 Ga0070680_100149110 3300005336 Bacteria 1963
21 Ga0070682_100000056 3300005337 Bacteria 108991
22 Ga0070682_100016607 3300005337 Bacteria 4283
23 Ga0068868_100006717 3300005338 Bacteria 8165
24 Ga0068868_100006836 3300005338 Bacteria 8100
25 Ga0070660_100018690 3300005339 Bacteria 5068
26 Ga0070661_100007054 3300005344 Bacteria 7751
27 Ga0070661_100008680 3300005344 Bacteria 7032
28 Ga0070661_100071815 3300005344 Bacteria 2547
29 Ga0070692_10045858 3300005345 Bacteria 2256
30 Ga0070668_100028991 3300005347 Bacteria 4202
31 Ga0070668_100052769 3300005347 Bacteria 3135
32 Ga0070669_100001011 3300005353 Bacteria 20483
33 Ga0070669_100005910 3300005353 Bacteria 8831
34 Ga0070669_100058514 3300005353 Bacteria 2828
35 Ga0070675_100026566 3300005354 Bacteria 4647
36 Ga0070675_100165470 3300005354 Bacteria 1904
37 Ga0070671_100003105 3300005355 Bacteria 12935
38 Ga0070671_100035239 3300005355 Bacteria 4146
39 Ga0070659_100011777 3300005366 Bacteria 6473
40 Ga0070659_100016405 3300005366 Bacteria 5561
41 Ga0070703_10004410 3300005406 Bacteria 3960
42 Ga0070709_10003180 3300005434 Bacteria 8807
43 Ga0070713_100000926 3300005436 Bacteria 18731
44 Ga0070713_100002231 3300005436 Bacteria 12564
45 Ga0070713_100010269 3300005436 Bacteria 6760
46 Ga0070713_100045422 3300005436 Bacteria 3599
47 Ga0070701_10034925 3300005438 Bacteria 2522
48 Ga0070701_10040709 3300005438 Bacteria 2363
49 Ga0070701_10061021 3300005438 Bacteria 1987
50 Ga0070711_100004103 3300005439 Bacteria 8560
51 Ga0070711_100098003 3300005439 Bacteria 2127
52 Ga0070705_100035200 3300005440 Bacteria 2805
53 Ga0070705_100048739 3300005440 Bacteria 2455
54 Ga0070705_100186829 3300005440 Bacteria 1409
55 Ga0070700_100000116 3300005441 Bacteria 51075
56 Ga0070700_100000765 3300005441 Bacteria 15886
57 Ga0070700_100022151 3300005441 Bacteria 3702
58 Ga0070694_100060353 3300005444 Bacteria 2586
59 Ga0070694_100087851 3300005444 Bacteria 2176
60 Ga0070708_100000527 3300005445 Bacteria 28842
61 Ga0070708_100003856 3300005445 Bacteria 11769
62 Ga0070708_100016466 3300005445 Bacteria 6135
63 Ga0070708_100020824 3300005445 Bacteria 5536
64 Ga0070708_100091004 3300005445 Bacteria 2778
65 Ga0070708_100110153 3300005445 Bacteria 2530
66 Ga0070708_100127313 3300005445 Bacteria 2355
67 Ga0070708_100142988 3300005445 Bacteria 2220
68 Ga0070663_100027656 3300005455 Bacteria 3853
69 Ga0070678_100021305 3300005456 Bacteria 4272
70 Ga0070662_100018503 3300005457 Bacteria 4713
71 Ga0070662_100118836 3300005457 Bacteria 2023
72 Ga0070681_10000011 3300005458 Bacteria 139059
73 Ga0070681_10002186 3300005458 Bacteria 17794
74 Ga0070681_10004490 3300005458 Bacteria 13310
75 Ga0070681_10098747 3300005458 Bacteria 2866
76 Ga0068867_100077006 3300005459 Bacteria 2505
77 Ga0068867_100113581 3300005459 Bacteria 2084
78 Ga0070706_100000257 3300005467 Bacteria 64534
79 Ga0070706_100000991 3300005467 Bacteria 30868
80 Ga0070706_100008068 3300005467 Bacteria 9823
81 Ga0070706_100014025 3300005467 Bacteria 7405
82 Ga0070707_100002670 3300005468 Bacteria 16959
83 Ga0070707_100007569 3300005468 Bacteria 10084
84 Ga0070707_100018287 3300005468 Bacteria 6595
85 Ga0070707_100039494 3300005468 Bacteria 4511
86 Ga0070707_100050511 3300005468 Bacteria 3986
87 Ga0070707_100104228 3300005468 Bacteria 2749
88 Ga0070707_100158710 3300005468 Bacteria 2203
89 Ga0070698_100000182 3300005471 Bacteria 59279
90 Ga0070698_100002898 3300005471 Bacteria 18889
91 Ga0070698_100008240 3300005471 Bacteria 11272
92 Ga0070698_100011225 3300005471 Bacteria 9516
93 Ga0070698_100012602 3300005471 Bacteria 8955
94 Ga0070698_100020887 3300005471 Bacteria 6862
95 Ga0070699_100000852 3300005518 Bacteria 28306
96 Ga0070699_100010712 3300005518 Bacteria 7933
97 Ga0070699_100019382 3300005518 Bacteria 5856
98 Ga0070699_100022524 3300005518 Bacteria 5430
99 Ga0070699_100043476 3300005518 Bacteria 3888
100 Ga0070699_100059115 3300005518 Bacteria 3322
101 Ga0070699_100088237 3300005518 Bacteria 2709
102 Ga0070699_100124573 3300005518 Bacteria 2268
103 Ga0070699_100128010 3300005518 Bacteria 2237
104 Ga0070699_100151537 3300005518 Bacteria 2051
105 Ga0070699_100230021 3300005518 Bacteria 1653
106 Ga0070679_100000082 3300005530 Bacteria 71054
107 Ga0070679_100004782 3300005530 Bacteria 12488
108 Ga0070679_100007014 3300005530 Bacteria 10511
109 Ga0070679_100007738 3300005530 Bacteria 10062
110 Ga0070679_100023469 3300005530 Bacteria 6038
111 Ga0070679_100332694 3300005530 Bacteria 1467
112 Ga0070684_100033500 3300005535 Bacteria 4386
113 Ga0070684_100158318 3300005535 Bacteria 2054
114 Ga0070697_100000128 3300005536 Bacteria 60251
115 Ga0070697_100002229 3300005536 Bacteria 14862
116 Ga0070697_100002841 3300005536 Bacteria 13321
117 Ga0070697_100002898 3300005536 Bacteria 13190
118 Ga0070697_100019042 3300005536 Bacteria 5417
119 Ga0070697_100019610 3300005536 Bacteria 5342
120 Ga0070697_100020567 3300005536 Bacteria 5222
121 Ga0070697_100083795 3300005536 Bacteria 2629
122 Ga0070697_100247593 3300005536 Bacteria 1523
123 Ga0070697_100262053 3300005536 Bacteria 1480
124 Ga0068853_100018006 3300005539 Bacteria 5839
125 Ga0068853_100031297 3300005539 Bacteria 4500
126 Ga0070686_100089327 3300005544 Bacteria 2058
127 Ga0070695_100040732 3300005545 Bacteria 2942
128 Ga0070695_100067461 3300005545 Bacteria 2333
129 Ga0070696_100000725 3300005546 Bacteria 21101
130 Ga0070696_100010498 3300005546 Bacteria 6206
131 Ga0070696_100014326 3300005546 Bacteria 5318
132 Ga0070696_100048327 3300005546 Bacteria 2953
133 Ga0070696_100092362 3300005546 Bacteria 2157
134 Ga0070696_100207386 3300005546 Bacteria 1466
135 Ga0070693_100000712 3300005547 Bacteria 14666
136 Ga0070665_100033884 3300005548 Bacteria 5137
137 Ga0070704_100000356 3300005549 Bacteria 20762
138 Ga0070704_100063279 3300005549 Bacteria 2655
139 Ga0070704_100076325 3300005549 Bacteria 2451
140 Ga0070704_100142374 3300005549 Bacteria 1874
141 Ga0068855_100139705 3300005563 Bacteria 2762
142 Ga0068855_100141131 3300005563 Bacteria 2746
143 Ga0070664_100005057 3300005564 Bacteria 10575
144 Ga0070664_100101977 3300005564 Bacteria 2496
145 Ga0070664_100107730 3300005564 Bacteria 2429
146 Ga0068857_100002999 3300005577 Bacteria 13930
147 Ga0068857_100045026 3300005577 Bacteria 3914
148 Ga0068857_100304891 3300005577 Bacteria 1469
149 Ga0068854_100033249 3300005578 Bacteria 3595
150 Ga0068856_100094547 3300005614 Bacteria 2976
151 Ga0070702_100013158 3300005615 Bacteria 4170
152 Ga0068852_100008382 3300005616 Bacteria 7617
153 Ga0068852_100193734 3300005616 Bacteria 1919
154 Ga0068859_100034026 3300005617 Bacteria 5116
155 Ga0068859_100068765 3300005617 Bacteria 3576
156 Ga0068859_100162882 3300005617 Bacteria 2310
157 Ga0068859_100231000 3300005617 Bacteria 1938
158 Ga0068864_100022101 3300005618 Bacteria 5332
159 Ga0068866_10036677 3300005718 Bacteria 2403
160 Ga0068866_10044082 3300005718 Bacteria 2230
161 Ga0068861_100094624 3300005719 Bacteria 2364
162 Ga0068861_100095098 3300005719 Bacteria 2359
163 Ga0068861_100140512 3300005719 Bacteria 1970
164 Ga0068861_100341739 3300005719 Bacteria 1310
165 Ga0068851_10001653 3300005834 Bacteria 9771
166 Ga0068851_10009864 3300005834 Bacteria 4447
167 Ga0068870_10020921 3300005840 Bacteria 3194
168 Ga0068863_100007354 3300005841 Bacteria 10778
169 Ga0068863_100060976 3300005841 Bacteria 3567
170 Ga0068858_100006042 3300005842 Bacteria 11805
171 Ga0068858_100015108 3300005842 Bacteria 7262
172 Ga0068858_100015899 3300005842 Bacteria 7071
173 Ga0068858_100333205 3300005842 Bacteria 1452
174 Ga0068860_100009175 3300005843 Bacteria 9833
175 Ga0068860_100084310 3300005843 Bacteria 3023
176 Ga0068860_100209626 3300005843 Bacteria 1890
177 Ga0068862_100007997 3300005844 Bacteria 8749
178 Ga0068862_100019123 3300005844 Bacteria 5712
179 Ga0068862_100027631 3300005844 Unclassified 4776
180 Ga0068862_100233872 3300005844 Bacteria 1668
181 Ga0081539_10000017 3300005985 Bacteria 375107
182 Ga0081539_10000049 3300005985 Bacteria 271978
183 Ga0070717_10020698 3300006028 Bacteria 5179
184 Ga0070717_10136109 3300006028 Bacteria 2116
185 Ga0070717_10171602 3300006028 Bacteria 1887
186 Ga0070717_10189375 3300006028 Bacteria 1797
187 Ga0070717_10226918 3300006028 Bacteria 1643
188 Ga0070716_100000496 3300006173 Bacteria 16400
189 Ga0070716_100002152 3300006173 Bacteria 9057
190 Ga0070716_100020108 3300006173 Bacteria 3501
191 Ga0070716_100044628 3300006173 Bacteria 2484
192 Ga0070716_100047302 3300006173 Bacteria 2426
193 Ga0070712_100038007 3300006175 Bacteria 3285
194 Ga0097621_100002739 3300006237 Bacteria 12055
195 Ga0097621_100015802 3300006237 Bacteria 5691
196 Ga0097621_100051250 3300006237 Bacteria 3358
197 Ga0068871_100003050 3300006358 Bacteria 11495
198 Ga0068871_100011680 3300006358 Bacteria 6449
199 Ga0068871_100012155 3300006358 Bacteria 6336
200 Ga0075428_100334128 3300006844 Bacteria 1628
201 Ga0075430_100070828 3300006846 Bacteria 2925
202 Ga0075430_100084950 3300006846 Bacteria 2650
203 Ga0075431_100113847 3300006847 Bacteria 2792
204 Ga0075431_100139238 3300006847 Bacteria 2502
205 Ga0075433_10026266 3300006852 Bacteria 4929
206 Ga0075434_100003719 3300006871 Bacteria 13629
207 Ga0075434_100012218 3300006871 Bacteria 8136
208 Ga0075434_100045476 3300006871 Bacteria 4355
209 Ga0075434_100107730 3300006871 Bacteria 2797
210 Ga0075429_100011898 3300006880 Bacteria 7546
211 Ga0075429_100032604 3300006880 Bacteria 4528
212 Ga0068865_100067757 3300006881 Bacteria 2522
213 Ga0075436_100000519 3300006914 Bacteria 25057
214 Ga0075436_100011981 3300006914 Bacteria 5947
215 Ga0075436_100014748 3300006914 Bacteria 5355
216 Ga0075436_100040223 3300006914 Bacteria 3226
217 Ga0075436_100090429 3300006914 Bacteria 2128
218 Ga0075436_100092902 3300006914 Bacteria 2098
219 Ga0097620_100034027 3300006931 Bacteria 5116
220 Ga0097620_100068764 3300006931 Bacteria 3576
221 Ga0097620_100095757 3300006931 Bacteria 3021
222 Ga0097620_100162867 3300006931 Bacteria 2310
223 Ga0097620_100231015 3300006931 Bacteria 1938
224 Ga0075435_100001321 3300007076 Bacteria 15935
225 Ga0075435_100001389 3300007076 Bacteria 15617
226 Ga0075435_100006182 3300007076 Bacteria 8448
227 Ga0075435_100013117 3300007076 Bacteria 6156
228 Ga0075435_100039481 3300007076 Bacteria 3767
229 Ga0075435_100216731 3300007076 Bacteria 1625
230 Ga0099794_10000762 3300007265 Bacteria 10857
231 Ga0099794_10003397 3300007265 Bacteria 6068
232 Ga0099794_10013298 3300007265 Bacteria 3579
233 Ga0099794_10027490 3300007265 Bacteria 2637
234 Ga0099794_10045016 3300007265 Bacteria 2110
235 Ga0099794_10056408 3300007265 Bacteria 1900
236 Ga0099794_10069221 3300007265 Bacteria 1726
237 Ga0099794_10069974 3300007265 Bacteria 1717
238 Ga0099795_10002165 3300007788 Bacteria 4534
239 Ga0099795_10006902 3300007788 Bacteria 3130
240 Ga0099795_10023667 3300007788 Bacteria 2040
241 Ga0105240_10048507 3300009093 Bacteria 5367
242 Ga0105240_10058596 3300009093 Bacteria 4808
243 Ga0105240_10126682 3300009093 Unclassified 3068
244 Ga0105240_10137583 3300009093 Bacteria 2923
245 Ga0105240_10224273 3300009093 Bacteria 2188
246 Ga0111539_10000723 3300009094 Bacteria 42944
247 Ga0111539_10007470 3300009094 Bacteria 13997
248 Ga0111539_10079237 3300009094 Bacteria 3864
249 Ga0111539_10200833 3300009094 Bacteria 2325
250 Ga0111539_10330095 3300009094 Bacteria 1775
251 Ga0111539_10451816 3300009094 Bacteria 1496
252 Ga0111539_10490547 3300009094 Bacteria 1431
253 Ga0105245_10089355 3300009098 Bacteria 2832
254 Ga0105245_10149356 3300009098 Bacteria 2208
255 Ga0105247_10000005 3300009101 Bacteria 426989
256 Ga0105247_10107476 3300009101 Bacteria 1792
257 Ga0114129_10043321 3300009147 Bacteria 6332
258 Ga0114129_10107748 3300009147 Unclassified 3847
259 Ga0114129_10298077 3300009147 Bacteria 2150
260 Ga0105243_10015978 3300009148 Bacteria 5676
261 Ga0105243_10043760 3300009148 Bacteria 3510
262 Ga0105243_10058282 3300009148 Bacteria 3078
263 Ga0105243_10060152 3300009148 Unclassified 3034
264 Ga0105243_10114499 3300009148 Bacteria 2263
265 Ga0105241_10009683 3300009174 Bacteria 7081
266 Ga0105241_10018088 3300009174 Bacteria 5182
267 Ga0105241_10024038 3300009174 Bacteria 4524
268 Ga0105241_10055379 3300009174 Bacteria 3038
269 Ga0105241_10114286 3300009174 Bacteria 2165
270 Ga0105242_10020815 3300009176 Bacteria 5145
271 Ga0105242_10112334 3300009176 Bacteria 2325
272 Ga0105242_10122073 3300009176 Bacteria 2237
273 Ga0105242_10243408 3300009176 Bacteria 1618
274 Ga0105248_10007190 3300009177 Bacteria 12213
275 Ga0105248_10010549 3300009177 Bacteria 10179
276 Ga0105248_10047532 3300009177 Bacteria 4812
277 Ga0105248_10079686 3300009177 Bacteria 3681
278 Ga0105248_10187895 3300009177 Bacteria 2328
279 Ga0105248_10247660 3300009177 Bacteria 2006
280 Ga0105248_10253045 3300009177 Bacteria 1982
281 Ga0105237_10022698 3300009545 Bacteria 6439
282 Ga0105237_10240407 3300009545 Bacteria 1812
283 Ga0105237_10266234 3300009545 Bacteria 1717
284 Ga0105238_10019334 3300009551 Bacteria 6937
285 Ga0105238_10052823 3300009551 Bacteria 4084
286 Ga0105238_10070197 3300009551 Bacteria 3503
287 Ga0105238_10332044 3300009551 Bacteria 1507
288 Ga0105249_10000025 3300009553 Bacteria 232713
289 Ga0105249_10016918 3300009553 Bacteria 6471
290 Ga0105249_10043239 3300009553 Bacteria 4098
291 Ga0105249_10413357 3300009553 Bacteria 1381
292 Ga0105239_10108847 3300010375 Bacteria 3070
293 Ga0105239_10152157 3300010375 Bacteria 2582
294 Ga0105239_10183775 3300010375 Bacteria 2339
295 Ga0105246_10015646 3300011119 Bacteria 4793
296 Ga0157373_10015443 3300013100 Bacteria 5582
297 Ga0157371_10009941 3300013102 Bacteria 7447
298 Ga0157369_10033225 3300013105 Bacteria 5671
299 Ga0157369_10118745 3300013105 Bacteria 2807
300 Ga0157374_10018109 3300013296 Bacteria 6212
301 Ga0157374_10025492 3300013296 Bacteria 5310
302 Ga0157374_10164963 3300013296 Bacteria 2159
303 Ga0157378_10000023 3300013297 Bacteria 129977
304 Ga0157378_10011338 3300013297 Bacteria 7802
305 Ga0157378_10063377 3300013297 Bacteria 3303
306 Ga0157378_10066479 3300013297 Bacteria 3229
307 Ga0163162_10000002 3300013306 Bacteria 717331
308 Ga0163162_10013871 3300013306 Bacteria 7874
309 Ga0163162_10021711 3300013306 Bacteria 6323
310 Ga0163162_10046839 3300013306 Bacteria 4334
311 Ga0163162_10120797 3300013306 Bacteria 2724
312 Ga0163162_10294606 3300013306 Bacteria 1754
313 Ga0163162_10325554 3300013306 Bacteria 1669
314 Ga0163162_10335437 3300013306 Bacteria 1644
315 Ga0157372_10000993 3300013307 Bacteria 31008
316 Ga0157372_10003754 3300013307 Bacteria 16310
317 Ga0157372_10133002 3300013307 Bacteria 2863
318 Ga0157372_10154452 3300013307 Bacteria 2650
319 Ga0157372_10209934 3300013307 Bacteria 2256
320 Ga0157375_10039651 3300013308 Bacteria 4535
321 Ga0157375_10247944 3300013308 Bacteria 1941
322 Ga0163163_10000001 3300014325 Bacteria 622185
323 Ga0163163_10001149 3300014325 Bacteria 22490
324 Ga0163163_10020239 3300014325 Bacteria 6264
325 Ga0163163_10023361 3300014325 Bacteria 5866
326 Ga0163163_10085251 3300014325 Bacteria 3167
327 Ga0163163_10086260 3300014325 Bacteria 3148
328 Ga0157380_10001107 3300014326 Bacteria 17378
329 Ga0157380_10001374 3300014326 Bacteria 15866
330 Ga0157380_10036588 3300014326 Bacteria 3799
331 Ga0157380_10039145 3300014326 Unclassified 3685
332 Ga0157380_10051705 3300014326 Bacteria 3251
333 Ga0157380_10125728 3300014326 Bacteria 2179
334 Ga0182008_10055340 3300014497 Bacteria 1962
335 Ga0157379_10005147 3300014968 Bacteria 11224
336 Ga0157379_10039684 3300014968 Bacteria 4201
337 Ga0157376_10000014 3300014969 Bacteria 303001
338 Ga0157376_10036913 3300014969 Bacteria 3962
339 Ga0157376_10107837 3300014969 Bacteria 2446
340 Ga0163161_10051059 3300017792 Bacteria 2994
341 Ga0184602_129938 3300019161 Bacteria 1429
342 Ga0224572_1009425 3300024225 Bacteria 1821
343 Ga0228598_1004923 3300024227 Bacteria 2809
344 Ga0207672_1001357 3300025223 Bacteria 1941
345 Ga0207656_10014688 3300025321 Bacteria 3022
346 Ga0207653_10001170 3300025885 Bacteria 8568
347 Ga0207692_10019836 3300025898 Bacteria 3046
348 Ga0207710_10000004 3300025900 Bacteria 846540
349 Ga0207710_10001622 3300025900 Bacteria 10987
350 Ga0207699_10002789 3300025906 Bacteria 8251
351 Ga0207699_10003030 3300025906 Bacteria 7980
352 Ga0207699_10003056 3300025906 Bacteria 7943
353 Ga0207699_10076508 3300025906 Bacteria 2062
354 Ga0207699_10154670 3300025906 Bacteria 1521
355 Ga0207643_10002710 3300025908 Bacteria 9577
356 Ga0207684_10000254 3300025910 Bacteria 79674
357 Ga0207684_10000921 3300025910 Bacteria 33357
358 Ga0207684_10001275 3300025910 Bacteria 27799
359 Ga0207684_10002463 3300025910 Bacteria 18645
360 Ga0207684_10005783 3300025910 Bacteria 11348
361 Ga0207684_10009363 3300025910 Bacteria 8654
362 Ga0207684_10010195 3300025910 Bacteria 8274
363 Ga0207684_10022870 3300025910 Bacteria 5337
364 Ga0207684_10023266 3300025910 Bacteria 5291
365 Ga0207684_10024388 3300025910 Bacteria 5157
366 Ga0207684_10036687 3300025910 Bacteria 4161
367 Ga0207684_10104196 3300025910 Bacteria 2425
368 Ga0207684_10134171 3300025910 Bacteria 2125
369 Ga0207684_10224337 3300025910 Bacteria 1622
370 Ga0207654_10002903 3300025911 Bacteria 8686
371 Ga0207654_10010827 3300025911 Bacteria 4643
372 Ga0207654_10072390 3300025911 Bacteria 2052
373 Ga0207707_10000037 3300025912 Bacteria 144937
374 Ga0207707_10002231 3300025912 Bacteria 17500
375 Ga0207707_10012920 3300025912 Bacteria 7268
376 Ga0207707_10013240 3300025912 Bacteria 7185
377 Ga0207707_10041183 3300025912 Bacteria 4034
378 Ga0207707_10081721 3300025912 Unclassified 2821
379 Ga0207707_10266259 3300025912 Bacteria 1486
380 Ga0207695_10025312 3300025913 Bacteria 6648
381 Ga0207695_10050743 3300025913 Bacteria 4362
382 Ga0207695_10136417 3300025913 Bacteria 2406
383 Ga0207671_10022859 3300025914 Bacteria 4721
384 Ga0207671_10071201 3300025914 Bacteria 2593
385 Ga0207693_10153904 3300025915 Bacteria 1809
386 Ga0207663_10007347 3300025916 Bacteria 5710
387 Ga0207660_10003334 3300025917 Bacteria 10485
388 Ga0207660_10015111 3300025917 Bacteria 5090
389 Ga0207660_10031858 3300025917 Bacteria 3636
390 Ga0207660_10210498 3300025917 Bacteria 1522
391 Ga0207657_10000215 3300025919 Bacteria 60239
392 Ga0207657_10006780 3300025919 Bacteria 11825
393 Ga0207657_10148026 3300025919 Bacteria 1914
394 Ga0207649_10031565 3300025920 Bacteria 3150
395 Ga0207649_10169949 3300025920 Bacteria 1518
396 Ga0207652_10000104 3300025921 Bacteria 91783
397 Ga0207652_10029363 3300025921 Bacteria 4597
398 Ga0207652_10035633 3300025921 Bacteria 4202
399 Ga0207652_10051053 3300025921 Bacteria 3545
400 Ga0207652_10166825 3300025921 Bacteria 1975
401 Ga0207646_10000959 3300025922 Bacteria 37166
402 Ga0207646_10002064 3300025922 Bacteria 24118
403 Ga0207646_10002760 3300025922 Bacteria 20509
404 Ga0207646_10008388 3300025922 Bacteria 10359
405 Ga0207646_10009318 3300025922 Bacteria 9709
406 Ga0207646_10043427 3300025922 Bacteria 4037
407 Ga0207646_10073100 3300025922 Bacteria 3063
408 Ga0207646_10144560 3300025922 Bacteria 2143
409 Ga0207646_10180861 3300025922 Bacteria 1904
410 Ga0207681_10001062 3300025923 Bacteria 17822
411 Ga0207681_10029311 3300025923 Unclassified 3573
412 Ga0207681_10080628 3300025923 Bacteria 2296
413 Ga0207694_10001733 3300025924 Bacteria 18281
414 Ga0207694_10058815 3300025924 Bacteria 2990
415 Ga0207650_10000001 3300025925 Bacteria 1545726
416 Ga0207650_10042021 3300025925 Bacteria 3353
417 Ga0207659_10027312 3300025926 Bacteria 3863
418 Ga0207687_10001479 3300025927 Bacteria 16100
419 Ga0207700_10002026 3300025928 Bacteria 11583
420 Ga0207700_10006558 3300025928 Bacteria 7043
421 Ga0207700_10012825 3300025928 Bacteria 5421
422 Ga0207700_10038582 3300025928 Bacteria 3468
423 Ga0207664_10005426 3300025929 Bacteria 8712
424 Ga0207644_10000309 3300025931 Bacteria 31740
425 Ga0207644_10004053 3300025931 Bacteria 9505
426 Ga0207644_10166709 3300025931 Bacteria 1717
427 Ga0207706_10004908 3300025933 Bacteria 12508
428 Ga0207706_10007827 3300025933 Bacteria 9863
429 Ga0207706_10030994 3300025933 Bacteria 4766
430 Ga0207709_10021836 3300025935 Bacteria 3625
431 Ga0207709_10030715 3300025935 Bacteria 3128
432 Ga0207670_10002918 3300025936 Bacteria 9038
433 Ga0207670_10063511 3300025936 Bacteria 2527
434 Ga0207665_10000709 3300025939 Bacteria 22594
435 Ga0207665_10004561 3300025939 Bacteria 9191
436 Ga0207665_10006371 3300025939 Bacteria 7828
437 Ga0207665_10007285 3300025939 Bacteria 7319
438 Ga0207665_10066437 3300025939 Bacteria 2454
439 Ga0207691_10150742 3300025940 Bacteria 2044
440 Ga0207711_10025317 3300025941 Bacteria 4979
441 Ga0207711_10091894 3300025941 Bacteria 2670
442 Ga0207711_10099079 3300025941 Bacteria 2576
443 Ga0207711_10231404 3300025941 Bacteria 1693
444 Ga0207689_10003754 3300025942 Bacteria 13839
445 Ga0207689_10143940 3300025942 Bacteria 1964
446 Ga0207661_10117444 3300025944 Bacteria 2260
447 Ga0207661_10118487 3300025944 Bacteria 2250
448 Ga0207661_10346412 3300025944 Bacteria 1340
449 Ga0207679_10014735 3300025945 Bacteria 5149
450 Ga0207679_10030833 3300025945 Bacteria 3748
451 Ga0207679_10260938 3300025945 Bacteria 1478
452 Ga0207667_10160529 3300025949 Bacteria 2312
453 Ga0207651_10047346 3300025960 Bacteria 2899
454 Ga0207712_10002724 3300025961 Bacteria 11288
455 Ga0207712_10129419 3300025961 Bacteria 1921
456 Ga0207712_10134154 3300025961 Bacteria 1891
457 Ga0207712_10146203 3300025961 Bacteria 1820
458 Ga0207668_10041205 3300025972 Bacteria 3120
459 Ga0207640_10016000 3300025981 Bacteria 4354
460 Ga0207640_10043304 3300025981 Bacteria 2876
461 Ga0207677_10007639 3300026023 Bacteria 6000
462 Ga0207677_10016558 3300026023 Bacteria 4371
463 Ga0207703_10000486 3300026035 Bacteria 41391
464 Ga0207703_10020633 3300026035 Bacteria 5154
465 Ga0207703_10030684 3300026035 Bacteria 4248
466 Ga0207703_10069166 3300026035 Bacteria 2911
467 Ga0207639_10128074 3300026041 Bacteria 2097
468 Ga0207639_10171924 3300026041 Bacteria 1836
469 Ga0207678_10000874 3300026067 Bacteria 27662
470 Ga0207708_10000486 3300026075 Bacteria 30609
471 Ga0207708_10001072 3300026075 Bacteria 20503
472 Ga0207708_10129778 3300026075 Bacteria 1970
473 Ga0207708_10147607 3300026075 Bacteria 1849
474 Ga0207702_10000536 3300026078 Bacteria 42507
475 Ga0207702_10012786 3300026078 Bacteria 6985
476 Ga0207641_10020450 3300026088 Bacteria 5435
477 Ga0207648_10011682 3300026089 Bacteria 8264
478 Ga0207648_10017065 3300026089 Bacteria 6618
479 Ga0207676_10087190 3300026095 Bacteria 2552
480 Ga0207676_10156973 3300026095 Bacteria 1967
481 Ga0207674_10015232 3300026116 Bacteria 8459
482 Ga0207674_10219408 3300026116 Bacteria 1850
483 Ga0207675_100005094 3300026118 Bacteria 12643
484 Ga0207675_100056030 3300026118 Bacteria 3677
485 Ga0207675_100065785 3300026118 Bacteria 3388
486 Ga0207675_100106910 3300026118 Bacteria 2638
487 Ga0207675_100208974 3300026118 Bacteria 1877
488 Ga0207683_10008581 3300026121 Bacteria 8747
489 Ga0207683_10020514 3300026121 Bacteria 5653
490 Ga0207683_10178957 3300026121 Unclassified 1922
491 Ga0207698_10043325 3300026142 Bacteria 3370
492 Ga0209588_1000091 3300027671 Bacteria 28595
493 Ga0209588_1003900 3300027671 Bacteria 4165
494 Ga0209588_1005114 3300027671 Bacteria 3740
495 Ga0209588_1011988 3300027671 Bacteria 2627
496 Ga0209588_1015949 3300027671 Bacteria 2315
497 Ga0209588_1016208 3300027671 Bacteria 2297
498 Ga0209588_1017371 3300027671 Bacteria 2230
499 Ga0207428_10003104 3300027907 Bacteria 16327
500 Ga0207428_10010799 3300027907 Bacteria 8139
501 Ga0207428_10147990 3300027907 Bacteria 1789
502 Ga0265356_1000057 3300028017 Bacteria 18461
503 Ga0268266_10000204 3300028379 Bacteria 104000
504 Ga0268266_10025409 3300028379 Bacteria 5039
505 Ga0268265_10005239 3300028380 Bacteria 8873
506 Ga0268265_10011259 3300028380 Bacteria 6048
507 Ga0268265_10034627 3300028380 Bacteria 3683
508 Ga0268265_10073447 3300028380 Bacteria 2671
509 Ga0268264_10056067 3300028381 Bacteria 3293
510 Ga0268264_10093079 3300028381 Bacteria 2603
511 Ga0268264_10093365 3300028381 Bacteria 2599
512 Ga0268264_10138907 3300028381 Bacteria 2164
513 Ga0268264_10191007 3300028381 Bacteria 1867
514 Ga0268264_10249039 3300028381 Bacteria 1649
515 Ga0265318_10000865 3300028577 Bacteria 19883
516 Ga0265338_10084598 3300028800 Bacteria 2647
517 Ga0265338_10123897 3300028800 Unclassified 2055
518 Ga0265762_1000184 3300030760 Bacteria 9864
519 Ga0265770_1000930 3300030878 Bacteria 4054
520 Ga0265760_10004245 3300031090 Bacteria 4120
521 Ga0265760_10006664 3300031090 Bacteria 3306
522 Ga0265760_10008231 3300031090 Bacteria 2980
523 Ga0265760_10011862 3300031090 Bacteria 2489
524 Ga0265320_10000061 3300031240 Bacteria 101367
525 Ga0265339_10004127 3300031249 Bacteria 10015
526 Ga0265331_10000192 3300031250 Bacteria 75526
527 Ga0265316_10016576 3300031344 Bacteria 6388
528 Ga0265316_10030922 3300031344 Bacteria 4383
529 Ga0265313_10005368 3300031595 Bacteria 9458
530 Ga0265314_10058861 3300031711 Bacteria 2631
531 Ga0265342_10000235 3300031712 Bacteria 62290
532 Ga0307405_10190204 3300031731 Bacteria 1482
533 Ga0307413_10056848 3300031824 Bacteria 2389
534 Ga0307412_10072535 3300031911 Bacteria 2353
535 Ga0307416_100066971 3300032002 Bacteria 2959
536 Ga0307416_100318369 3300032002 Bacteria 1556
537 Ga0307415_100006127 3300032126 Bacteria 6452
538 Ga0316214_1007752 3300033545 Bacteria 1438
539 Ga0316212_1000699 3300033547 Bacteria 4232
540 Ga0373934_0018419 3300035086 Bacteria 2671
541 Ga0373923_0001010 3300035111 Bacteria 7623
542 Ga0373923_0019977 3300035111 Bacteria 2598
543 Ga0373945_0010016 3300035116 Bacteria 3116
544 Ga0373953_0017988 3300035117 Bacteria 2607
545 Ga0373954_0004801 3300035118 Bacteria 5827
546 Ga0373954_0016183 3300035118 Bacteria 3337
547 Ga0373956_0000874 3300035119 Bacteria 12520
548 Ga0373943_0001497 3300035170 Bacteria 10585
549 Ga0373946_0001703 3300035171 Bacteria 7663
550 Ga0373946_0052572 3300035171 Bacteria 1709
551 Ga0373955_0002010 3300035172 Bacteria 8764
552 Ga0373955_0028684 3300035172 Bacteria 2888
553 Ga0373955_0152112 3300035172 Unclassified 1362
554 Ga0373961_0011822 3300035241 Bacteria 2173
555 Ga0373924_0007307 3300035410 Bacteria 3984
556 Ga0373924_0030073 3300035410 Bacteria 2175
557 Ga0373931_0035901 3300035691 Bacteria 2580
558 Ga0373931_0192775 3300035691 Bacteria 1213
559 Ga0373935_0006699 3300035692 Bacteria 6884
560 Ga0373927_0002385 3300035695 Bacteria 13698
561 Ga0373933_0000760 3300035724 Bacteria 19740
562 Ga0373933_0127025 3300035724 Bacteria 1601
563 Ga0373947_0004173 3300035725 Bacteria 8490
564 Ga0373947_0005813 3300035725 Bacteria 7193
565 Ga0373947_0010288 3300035725 Bacteria 5367
566 Ga0373937_0000406 3300036401 Bacteria 40149
567 Ga0373937_0027758 3300036401 Bacteria 5121
568 Ga0373937_0065255 3300036401 Bacteria 3351
569 Ga0373937_0096821 3300036401 Bacteria 2737
570 Ga0373937_0191703 3300036401 Bacteria 1921
571 Ga0373937_0196745 3300036401 Bacteria 1895
572 Ga0373937_0466899 3300036401 Bacteria 1199
573 Ga0373937_0470109 3300036401 Bacteria 1194
574 Ga0373925_0002487 3300037068 Bacteria 14733
575 Ga0373925_0039877 3300037068 Bacteria 3475
576 Ga0373925_0212832 3300037068 Bacteria 1540
577 Ga0242420_006411 3300038996 Bacteria 1858
578 Ga0436365_1368512 3300039437 Bacteria 61437
579 Ga0450923_016213 3300042125 Bacteria 1401
580 Ga0466963_0000364 3300044694 Bacteria 20573
581 Ga0466964_0014152 3300044706 Bacteria 3031
582 Ga0453684_0028124 3300044712 Bacteria 8037
583 Ga0451576_0004103 3300045051 Bacteria 19215
584 Ga0451576_0008700 3300045051 Bacteria 11879
585 Ga0451576_0473227 3300045051 Bacteria 1316
586 Ga0466967_0228382 3300045976 Bacteria 1771
587 Ga0466967_0462061 3300045976 Bacteria 1242
588 Ga0495592_0023814 3300046454 Bacteria 4657
589 Ga0495592_0075371 3300046454 Bacteria 2450
590 Ga0495603_0013040 3300046455 Bacteria 5025
591 Ga0495629_0085044 3300046459 Bacteria 2207
592 Ga0495629_0148602 3300046459 Bacteria 1629
593 Ga0495638_0022957 3300046460 Bacteria 4088
594 Ga0495651_0000107 3300046462 Bacteria 61202
595 Ga0495651_0003070 3300046462 Bacteria 12901
596 Ga0495651_0005147 3300046462 Bacteria 9970
597 Ga0495651_0036488 3300046462 Bacteria 3827
598 Ga0495653_0042041 3300046463 Unclassified 3563
599 Ga0495653_0056293 3300046463 Bacteria 2998
600 Ga0495580_0003581 3300046472 Bacteria 13193
601 Ga0495580_0006228 3300046472 Bacteria 9749
602 Ga0495580_0009426 3300046472 Bacteria 7681
603 Ga0495580_0046715 3300046472 Bacteria 3071
604 Ga0495580_0053624 3300046472 Bacteria 2845
605 Ga0495580_0207935 3300046472 Bacteria 1347
606 Ga0495582_0000168 3300046473 Bacteria 35577
607 Ga0495582_0001359 3300046473 Bacteria 13765
608 Ga0495639_0027131 3300046475 Bacteria 2534
609 Ga0495664_0006293 3300046477 Bacteria 6555
610 Ga0495608_0017607 3300046511 Bacteria 4941
611 Ga0495608_0029758 3300046511 Bacteria 3701
612 Ga0495628_0006382 3300046516 Bacteria 10303
613 Ga0495628_0023669 3300046516 Bacteria 5039
614 Ga0495628_0062299 3300046516 Bacteria 2924
615 Ga0495628_0063679 3300046516 Bacteria 2889
616 Ga0495630_0010252 3300046517 Bacteria 6760
617 Ga0495663_0000089 3300046525 Bacteria 40248
618 Ga0495666_0029539 3300046526 Bacteria 2697
619 Ga0495652_0012220 3300046529 Bacteria 7754
620 Ga0495652_0015005 3300046529 Bacteria 6940
621 Ga0495665_0010816 3300046531 Bacteria 4938
622 Ga0495665_0032911 3300046531 Bacteria 2773
623 Ga0495640_0045238 3300046533 Bacteria 3056
624 Ga0495586_0000316 3300046535 Bacteria 30580
625 Ga0495587_0001200 3300046536 Bacteria 17150
626 Ga0495587_0009379 3300046536 Bacteria 6274
627 Ga0495621_0003641 3300046539 Bacteria 4255
628 Ga0495621_0031774 3300046539 Bacteria 1813
629 Ga0495645_0018739 3300046543 Bacteria 4977
630 Ga0495645_0024828 3300046543 Bacteria 4348
631 Ga0495645_0059068 3300046543 Bacteria 2781
632 Ga0495667_0008116 3300046559 Bacteria 7127
633 Ga0495635_0011669 3300046663 Bacteria 6158
634 Ga0495635_0025267 3300046663 Bacteria 4137
635 Ga0495635_0050347 3300046663 Bacteria 2872
636 Ga0495635_0099486 3300046663 Bacteria 1988
637 Ga0495657_0021776 3300046675 Bacteria 4597
638 Ga0495657_0037087 3300046675 Bacteria 3363
639 Ga0495599_0023235 3300046678 Bacteria 3875
640 Ga0495599_0105479 3300046678 Bacteria 1756
641 Ga0495623_0001481 3300046679 Bacteria 15905
642 Ga0495646_0001242 3300046680 Bacteria 14962
643 Ga0495669_0002736 3300046684 Bacteria 7232
644 Ga0495669_0019556 3300046684 Bacteria 2924
645 Ga0495669_0039940 3300046684 Bacteria 2079
646 Ga0495613_0250135 3300046689 Bacteria 1237
647 Ga0495624_0026980 3300046690 Bacteria 3762
648 Ga0495604_0047692 3300047317 Bacteria 3335
649 Ga0495604_0129560 3300047317 Bacteria 1815
650 Ga0495636_0047706 3300047318 Bacteria 1789
651 Ga0495674_0004479 3300047319 Bacteria 13444
652 Ga0495680_0001862 3300047322 Bacteria 22190
653 Ga0495680_0164540 3300047322 Bacteria 1609
654 Ga0495675_0000727 3300047444 Bacteria 20561
655 Ga0495675_0027051 3300047444 Bacteria 3656
656 Ga0495675_0033678 3300047444 Bacteria 3270
657 Ga0495684_0004395 3300047471 Bacteria 11012
658 Ga0495684_0009878 3300047471 Bacteria 7365
659 Ga0495684_0026956 3300047471 Bacteria 4415
660 Ga0495684_0073814 3300047471 Unclassified 2592
661 Ga0495684_0243385 3300047471 Bacteria 1311
662 Ga0495593_0007392 3300047673 Bacteria 6434
663 Ga0495602_0038095 3300048088 Bacteria 4451
664 Ga0495602_0084610 3300048088 Unclassified 2653
665 Ga0495602_0118169 3300048088 Bacteria 2139
666 Ga0496100_0056865 3300048903 Bacteria 2560
667 Ga0496100_0058856 3300048903 Bacteria 2523
668 Ga0496101_0007379 3300048904 Bacteria 7121
669 Ga0496102_0005869 3300048905 Bacteria 10453
670 Ga0496102_0098832 3300048905 Bacteria 2708
671 Ga0496102_0162209 3300048905 Bacteria 2103
672 Ga0496103_0004547 3300048906 Bacteria 8397
673 Ga0496103_0034632 3300048906 Bacteria 3089
674 Ga0496104_0004711 3300048907 Bacteria 11872
675 Ga0496104_0053828 3300048907 Bacteria 3804
676 Ga0496104_0053981 3300048907 Bacteria 3798
677 Ga0496104_0180005 3300048907 Bacteria 2024
678 Ga0496106_0057871 3300048909 Bacteria 2932
679 Ga0496106_0098670 3300048909 Bacteria 2263
680 Ga0496106_0121867 3300048909 Bacteria 2039
681 Ga0496108_0082418 3300048911 Bacteria 2728
682 Ga0496108_0125412 3300048911 Bacteria 2204
683 Ga0496109_0020643 3300048912 Bacteria 5820
684 Ga0496109_0138775 3300048912 Bacteria 2273
685 Ga0496112_0013152 3300048915 Bacteria 7637
686 Ga0496112_0057191 3300048915 Bacteria 3839
687 Ga0496112_0120693 3300048915 Bacteria 2591
688 Ga0496112_0230891 3300048915 Bacteria 1805
689 Ga0496113_0152455 3300048916 Bacteria 1824
690 Ga0496114_0003782 3300048917 Bacteria 11668
691 Ga0496114_0027200 3300048917 Bacteria 4683
692 Ga0496114_0243507 3300048917 Bacteria 1582
693 Ga0496115_0026815 3300048918 Bacteria 4501
694 Ga0496115_0033010 3300048918 Bacteria 4085
695 Ga0496115_0057523 3300048918 Bacteria 3128
696 Ga0496115_0102854 3300048918 Bacteria 2343
697 Ga0501296_001050 3300049519 Bacteria 2765
698 Ga0501298_010004 3300049521 Bacteria 1623
699 Ga0501036_0073969 3300049572 Bacteria 2881
700 Ga0501046_0131054 3300049580 Bacteria 1902
701 Ga0501048_0084020 3300049582 Bacteria 2245
702 Ga0501071_0097492 3300049587 Bacteria 2165
703 Ga0501072_0017449 3300049588 Bacteria 5515
704 Ga0501225_0033560 3300049705 Bacteria 1412
705 Ga0501079_0259609 3300049741 Bacteria 1358
706 Ga0501081_0065204 3300049743 Bacteria 2531
707 Ga0501283_000784 3300049779 Bacteria 4176
708 Ga0501045_0068738 3300049824 Bacteria 2603
709 Ga0501212_000726 3300049851 Bacteria 3364
710 nmdc:mga05p37_149016_c1 3300050507 Bacteria 2863
711 nmdc:mga05p37_539405_c1 3300050507 Bacteria 1330
712 nmdc:mga05p37_78689_c1 3300050507 Bacteria 4060
713 nmdc:mga09592_8475_c1 3300050508 Bacteria 8361
714 nmdc:mga0qj67_4138_c1 3300050509 Bacteria 10516
715 nmdc:mga06r32_198923_c1 3300050510 Bacteria 1992
716 nmdc:mga06r32_31879_c1 3300050510 Bacteria 4954
717 nmdc:mga06r32_329514_c1 3300050510 Bacteria 1512
718 nmdc:mga08y16_198267_c1 3300050511 Bacteria 2081
719 nmdc:mga08y16_261106_c1 3300050511 Bacteria 1789
720 nmdc:mga08y16_261556_c1 3300050511 Bacteria 1787
721 nmdc:mga08y16_3295_c1 3300050511 Bacteria 16725
722 nmdc:mga08y16_73643_c1 3300050511 Bacteria 3559
723 nmdc:mga08y16_74624_c1 3300050511 Bacteria 3535
724 nmdc:mga0n895_14256_c1 3300050512 Bacteria 7212
725 nmdc:mga0n895_15388_c1 3300050512 Bacteria 6972
726 nmdc:mga0n895_82942_c1 3300050512 Bacteria 3196
727 nmdc:mga0rr50_10664_c1 3300050513 Bacteria 5846
728 nmdc:mga0rr50_22361_c1 3300050513 Bacteria 4338
729 nmdc:mga0rr50_34658_c1 3300050513 Bacteria 3617
730 nmdc:mga0rr50_77726_c1 3300050513 Bacteria 2551
731 nmdc:mga08x19_3455_c1 3300050514 Bacteria 9421
732 nmdc:mga08x19_78457_c1 3300050514 Bacteria 2164
733 nmdc:mga08x19_8699_c1 3300050514 Bacteria 6054
734 nmdc:mga0a205_252100_c1 3300050515 Bacteria 1644
735 nmdc:mga0a205_59326_c1 3300050515 Bacteria 3696
736 nmdc:mga0a205_72084_c1 3300050515 Bacteria 3336
737 Ga0495601_0002978 3300053077 Bacteria 9642
738 Ga0495601_0168311 3300053077 Bacteria 1432
739 Ga0495601_0197035 3300053077 Bacteria 1317
740 Ga0495612_0003712 3300053078 Bacteria 6339
741 Ga0500641_0001491 3300053096 Bacteria 8354
742 Ga0530510_0006569 3300061734 Bacteria 8105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10098747 Ga0070681_100987472 350
2 3300005614 Ga0068856_100094547 Ga0068856_1000945473 350
3 3300013297 Ga0157378_10066479 Ga0157378_100664792 350
4 3300013307 Ga0157372_10209934 Ga0157372_102099341 350
5 3300005445 Ga0070708_100127313 Ga0070708_1001273132 351
6 3300044706 Ga0466964_0014152 Ga0466964_0014152_216_1343 353
7 3300006846 Ga0075430_100070828 Ga0075430_1000708281 354
8 3300006880 Ga0075429_100011898 Ga0075429_1000118982 354
9 3300031911 Ga0307412_10072535 Ga0307412_100725351 354
10 3300002074 JGI24748J21848_1000002 JGI24748J21848_100000267 357
11 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004306 357
12 3300005355 Ga0070671_100035239 Ga0070671_1000352394 357
13 3300005842 Ga0068858_100006042 Ga0068858_1000060424 357
14 3300009101 Ga0105247_10000005 Ga0105247_10000005296 357
15 3300025223 Ga0207672_1001357 Ga0207672_10013572 357
16 3300025900 Ga0207710_10000004 Ga0207710_10000004295 357
17 3300025931 Ga0207644_10000309 Ga0207644_1000030920 357
18 3300026035 Ga0207703_10000486 Ga0207703_1000048612 357
19 3300046684 Ga0495669_0039940 Ga0495669_0039940_533_1609 357
20 3300050510 nmdc:mga06r32_31879_c1 nmdc:mga06r32_31879_c1_3167_4246 358
21 3300050511 nmdc:mga08y16_73643_c1 nmdc:mga08y16_73643_c1_1657_2736 358
22 3300003203 JGI25406J46586_10015284 JGI25406J46586_100152841 359
23 3300005293 Ga0065715_10090735 Ga0065715_100907353 359
24 3300005438 Ga0070701_10034925 Ga0070701_100349253 359
25 3300005457 Ga0070662_100118836 Ga0070662_1001188362 359
26 3300005518 Ga0070699_100124573 Ga0070699_1001245732 359
27 3300005549 Ga0070704_100063279 Ga0070704_1000632792 359
28 3300005719 Ga0068861_100341739 Ga0068861_1003417391 359
29 3300006881 Ga0068865_100067757 Ga0068865_1000677573 359
30 3300009094 Ga0111539_10490547 Ga0111539_104905472 359
31 3300017792 Ga0163161_10051059 Ga0163161_100510593 359
32 3300026118 Ga0207675_100065785 Ga0207675_1000657854 359
33 3300005353 Ga0070669_100005910 Ga0070669_1000059108 360
34 3300005441 Ga0070700_100022151 Ga0070700_1000221513 360
35 3300005468 Ga0070707_100050511 Ga0070707_1000505112 360
36 3300005536 Ga0070697_100083795 Ga0070697_1000837952 360
37 3300005844 Ga0068862_100007997 Ga0068862_1000079974 360
38 3300009094 Ga0111539_10200833 Ga0111539_102008333 360
39 3300013308 Ga0157375_10247944 Ga0157375_102479442 360
40 3300025910 Ga0207684_10010195 Ga0207684_100101956 360
41 3300025922 Ga0207646_10009318 Ga0207646_100093186 360
42 3300026075 Ga0207708_10001072 Ga0207708_1000107212 360
43 3300028380 Ga0268265_10011259 Ga0268265_100112595 360
44 3300042125 Ga0450923_016213 Ga0450923_016213_17_1132 360
45 3300046684 Ga0495669_0019556 Ga0495669_0019556_1081_2295 360
46 3300036401 Ga0373937_0470109 Ga0373937_0470109_39_1127 361
47 3300045051 Ga0451576_0473227 Ga0451576_0473227_19_1182 361
48 3300049572 Ga0501036_0073969 Ga0501036_0073969_20_1117 361
49 3300053096 Ga0500641_0001491 Ga0500641_0001491_5475_6563 361
50 3300005355 Ga0070671_100003105 Ga0070671_10000310510 362
51 3300025931 Ga0207644_10004053 Ga0207644_100040532 362
52 3300003203 JGI25406J46586_10027247 JGI25406J46586_100272472 363
53 3300005468 Ga0070707_100158710 Ga0070707_1001587102 363
54 3300005617 Ga0068859_100162882 Ga0068859_1001628822 363
55 3300005985 Ga0081539_10000049 Ga0081539_1000004949 363
56 3300006844 Ga0075428_100334128 Ga0075428_1003341282 363
57 3300006931 Ga0097620_100162867 Ga0097620_1001628672 363
58 3300009094 Ga0111539_10079237 Ga0111539_100792372 363
59 3300013306 Ga0163162_10046839 Ga0163162_100468393 363
60 3300025910 Ga0207684_10023266 Ga0207684_100232665 363
61 3300028381 Ga0268264_10093365 Ga0268264_100933651 363
62 3300005834 Ga0068851_10001653 Ga0068851_100016539 364
63 3300009147 Ga0114129_10298077 Ga0114129_102980772 364
64 3300024225 Ga0224572_1009425 Ga0224572_10094252 364
65 3300046472 Ga0495580_0053624 Ga0495580_0053624_1065_2195 364
66 3300024227 Ga0228598_1004923 Ga0228598_10049232 365
67 3300028017 Ga0265356_1000057 Ga0265356_100005713 365
68 3300030760 Ga0265762_1000184 Ga0265762_10001844 365
69 3300031090 Ga0265760_10006664 Ga0265760_100066643 365
70 3300005536 Ga0070697_100000128 Ga0070697_10000012820 366
71 3300005546 Ga0070696_100092362 Ga0070696_1000923622 366
72 3300005842 Ga0068858_100333205 Ga0068858_1003332052 366
73 3300006914 Ga0075436_100040223 Ga0075436_1000402233 366
74 3300009093 Ga0105240_10058596 Ga0105240_100585961 366
75 3300046539 Ga0495621_0031774 Ga0495621_0031774_666_1766 366
76 3300050514 nmdc:mga08x19_3455_c1 nmdc:mga08x19_3455_c1_6476_7714 366
77 3300005289 Ga0065704_10110498 Ga0065704_101104982 367
78 3300005295 Ga0065707_10014710 Ga0065707_100147102 367
79 3300005345 Ga0070692_10045858 Ga0070692_100458583 367
80 3300005539 Ga0068853_100018006 Ga0068853_1000180064 367
81 3300005615 Ga0070702_100013158 Ga0070702_1000131581 367
82 3300009094 Ga0111539_10000723 Ga0111539_1000072324 367
83 3300009148 Ga0105243_10060152 Ga0105243_100601522 367
84 3300009177 Ga0105248_10007190 Ga0105248_1000719012 367
85 3300009553 Ga0105249_10413357 Ga0105249_104133571 367
86 3300025908 Ga0207643_10002710 Ga0207643_100027102 367
87 3300025910 Ga0207684_10024388 Ga0207684_100243886 367
88 3300025936 Ga0207670_10002918 Ga0207670_100029187 367
89 3300025942 Ga0207689_10003754 Ga0207689_1000375411 367
90 3300050511 nmdc:mga08y16_74624_c1 nmdc:mga08y16_74624_c1_1157_2371 367
91 3300050512 nmdc:mga0n895_15388_c1 nmdc:mga0n895_15388_c1_1623_2816 367
92 3300050515 nmdc:mga0a205_59326_c1 nmdc:mga0a205_59326_c1_124_1338 367
93 3300005518 Ga0070699_100022524 Ga0070699_1000225243 368
94 3300005563 Ga0068855_100141131 Ga0068855_1001411312 368
95 3300005577 Ga0068857_100045026 Ga0068857_1000450263 368
96 3300005616 Ga0068852_100193734 Ga0068852_1001937342 368
97 3300005719 Ga0068861_100095098 Ga0068861_1000950981 368
98 3300005841 Ga0068863_100060976 Ga0068863_1000609762 368
99 3300009101 Ga0105247_10107476 Ga0105247_101074762 368
100 3300009148 Ga0105243_10058282 Ga0105243_100582823 368
101 3300009545 Ga0105237_10240407 Ga0105237_102404072 368
102 3300010375 Ga0105239_10183775 Ga0105239_101837752 368
103 3300014326 Ga0157380_10001107 Ga0157380_100011076 368
104 3300014497 Ga0182008_10055340 Ga0182008_100553401 368
105 3300025900 Ga0207710_10001622 Ga0207710_1000162211 368
106 3300025919 Ga0207657_10006780 Ga0207657_1000678010 368
107 3300025931 Ga0207644_10166709 Ga0207644_101667091 368
108 3300025933 Ga0207706_10007827 Ga0207706_100078279 368
109 3300025933 Ga0207706_10030994 Ga0207706_100309942 368
110 3300025944 Ga0207661_10346412 Ga0207661_103464121 368
111 3300026095 Ga0207676_10156973 Ga0207676_101569732 368
112 3300048907 Ga0496104_0053981 Ga0496104_0053981_2228_3376 368
113 3300048911 Ga0496108_0125412 Ga0496108_0125412_777_1925 368
114 3300048916 Ga0496113_0152455 Ga0496113_0152455_240_1388 368
115 3300006028 Ga0070717_10020698 Ga0070717_100206984 369
116 3300009176 Ga0105242_10020815 Ga0105242_100208153 369
117 3300013307 Ga0157372_10000993 Ga0157372_1000099321 369
118 3300026078 Ga0207702_10000536 Ga0207702_1000053621 369
119 3300046472 Ga0495580_0207935 Ga0495580_0207935_45_1190 369
120 3300005546 Ga0070696_100010498 Ga0070696_1000104985 370
121 3300007265 Ga0099794_10069221 Ga0099794_100692211 370
122 3300009094 Ga0111539_10007470 Ga0111539_1000747011 370
123 3300009148 Ga0105243_10043760 Ga0105243_100437603 370
124 3300028381 Ga0268264_10249039 Ga0268264_102490392 370
125 3300046678 Ga0495599_0105479 Ga0495599_0105479_260_1411 370
126 3300048915 Ga0496112_0120693 Ga0496112_0120693_507_1700 370
127 3300048918 Ga0496115_0026815 Ga0496115_0026815_2701_3819 370
128 3300049519 Ga0501296_001050 Ga0501296_001050_1431_2642 370
129 3300049705 Ga0501225_0033560 Ga0501225_0033560_170_1381 370
130 3300049779 Ga0501283_000784 Ga0501283_000784_2786_3997 370
131 3300049851 Ga0501212_000726 Ga0501212_000726_59_1270 370
132 3300050511 nmdc:mga08y16_261106_c1 nmdc:mga08y16_261106_c1_144_1256 370
133 3300050512 nmdc:mga0n895_82942_c1 nmdc:mga0n895_82942_c1_1901_3013 370
134 3300005535 Ga0070684_100158318 Ga0070684_1001583182 371
135 3300005577 Ga0068857_100304891 Ga0068857_1003048912 371
136 3300005844 Ga0068862_100233872 Ga0068862_1002338722 371
137 3300009176 Ga0105242_10122073 Ga0105242_101220732 371
138 3300009177 Ga0105248_10253045 Ga0105248_102530452 371
139 3300014325 Ga0163163_10086260 Ga0163163_100862603 371
140 3300025941 Ga0207711_10231404 Ga0207711_102314042 371
141 3300025944 Ga0207661_10117444 Ga0207661_101174442 371
142 3300036401 Ga0373937_0466899 Ga0373937_0466899_17_1150 371
143 3300048912 Ga0496109_0020643 Ga0496109_0020643_3460_4653 371
144 3300005335 Ga0070666_10049576 Ga0070666_100495763 372
145 3300005338 Ga0068868_100006836 Ga0068868_1000068363 372
146 3300005459 Ga0068867_100113581 Ga0068867_1001135812 372
147 3300005518 Ga0070699_100019382 Ga0070699_1000193822 372
148 3300005578 Ga0068854_100033249 Ga0068854_1000332493 372
149 3300005718 Ga0068866_10044082 Ga0068866_100440821 372
150 3300005842 Ga0068858_100015108 Ga0068858_1000151083 372
151 3300006028 Ga0070717_10189375 Ga0070717_101893752 372
152 3300006358 Ga0068871_100003050 Ga0068871_1000030502 372
153 3300009177 Ga0105248_10010549 Ga0105248_100105496 372
154 3300010375 Ga0105239_10108847 Ga0105239_101088471 372
155 3300013297 Ga0157378_10000023 Ga0157378_1000002353 372
156 3300013306 Ga0163162_10325554 Ga0163162_103255542 372
157 3300025981 Ga0207640_10043304 Ga0207640_100433042 372
158 3300026023 Ga0207677_10007639 Ga0207677_100076395 372
159 3300026035 Ga0207703_10020633 Ga0207703_100206332 372
160 3300028381 Ga0268264_10056067 Ga0268264_100560673 372
161 3300031090 Ga0265760_10008231 Ga0265760_100082312 372
162 3300045976 Ga0466967_0228382 Ga0466967_0228382_339_1568 372
163 3300005440 Ga0070705_100186829 Ga0070705_1001868291 373
164 3300005441 Ga0070700_100000116 Ga0070700_10000011619 373
165 3300005546 Ga0070696_100014326 Ga0070696_1000143263 373
166 3300006914 Ga0075436_100000519 Ga0075436_10000051924 373
167 3300009174 Ga0105241_10024038 Ga0105241_100240383 373
168 3300009551 Ga0105238_10070197 Ga0105238_100701971 373
169 3300013296 Ga0157374_10164963 Ga0157374_101649632 373
170 3300025898 Ga0207692_10019836 Ga0207692_100198362 373
171 3300026075 Ga0207708_10000486 Ga0207708_1000048610 373
172 3300031824 Ga0307413_10056848 Ga0307413_100568483 373
173 3300032002 Ga0307416_100066971 Ga0307416_1000669712 373
174 3300032126 Ga0307415_100006127 Ga0307415_1000061277 373
175 3300035725 Ga0373947_0010288 Ga0373947_0010288_2375_3670 373
176 3300037068 Ga0373925_0002487 Ga0373925_0002487_12131_13426 373
177 3300046472 Ga0495580_0003581 Ga0495580_0003581_7500_8795 373
178 3300046473 Ga0495582_0001359 Ga0495582_0001359_5557_6852 373
179 3300046475 Ga0495639_0027131 Ga0495639_0027131_836_2131 373
180 3300046531 Ga0495665_0010816 Ga0495665_0010816_2757_4052 373
181 3300050514 nmdc:mga08x19_8699_c1 nmdc:mga08x19_8699_c1_2517_3812 373
182 3300005445 Ga0070708_100020824 Ga0070708_1000208243 374
183 3300005563 Ga0068855_100139705 Ga0068855_1001397053 374
184 3300025922 Ga0207646_10144560 Ga0207646_101445602 374
185 3300035172 Ga0373955_0152112 Ga0373955_0152112_17_1144 374
186 3300036401 Ga0373937_0191703 Ga0373937_0191703_107_1315 374
187 3300046525 Ga0495663_0000089 Ga0495663_0000089_25795_26991 374
188 3300005337 Ga0070682_100000056 Ga0070682_10000005680 375
189 3300009093 Ga0105240_10137583 Ga0105240_101375832 375
190 3300025913 Ga0207695_10136417 Ga0207695_101364172 375
191 3300036401 Ga0373937_0065255 Ga0373937_0065255_1721_2908 375
192 3300037068 Ga0373925_0212832 Ga0373925_0212832_44_1204 375
193 3300046663 Ga0495635_0050347 Ga0495635_0050347_456_1643 375
194 3300049582 Ga0501048_0084020 Ga0501048_0084020_945_2105 375
195 3300005290 Ga0065712_10000112 Ga0065712_10000112234 376
196 3300005347 Ga0070668_100028991 Ga0070668_1000289914 376
197 3300005354 Ga0070675_100026566 Ga0070675_1000265661 376
198 3300007076 Ga0075435_100013117 Ga0075435_1000131172 376
199 3300025926 Ga0207659_10027312 Ga0207659_100273122 376
200 3300025940 Ga0207691_10150742 Ga0207691_101507421 376
201 3300025961 Ga0207712_10134154 Ga0207712_101341542 376
202 3300026118 Ga0207675_100056030 Ga0207675_1000560303 376
203 3300046460 Ga0495638_0022957 Ga0495638_0022957_797_1966 376
204 3300046516 Ga0495628_0062299 Ga0495628_0062299_208_1416 376
205 3300046516 Ga0495628_0063679 Ga0495628_0063679_1595_2728 376
206 3300047322 Ga0495680_0164540 Ga0495680_0164540_222_1430 376
207 3300048909 Ga0496106_0121867 Ga0496106_0121867_357_1568 376
208 3300050507 nmdc:mga05p37_539405_c1 nmdc:mga05p37_539405_c1_20_1231 376
209 3300053077 Ga0495601_0168311 Ga0495601_0168311_185_1393 376
210 3300005617 Ga0068859_100068765 Ga0068859_1000687652 377
211 3300006173 Ga0070716_100000496 Ga0070716_1000004968 377
212 3300006931 Ga0097620_100068764 Ga0097620_1000687642 377
213 3300009174 Ga0105241_10018088 Ga0105241_100180884 377
214 3300013297 Ga0157378_10063377 Ga0157378_100633772 377
215 3300014326 Ga0157380_10001374 Ga0157380_100013746 377
216 3300014326 Ga0157380_10036588 Ga0157380_100365882 377
217 3300014968 Ga0157379_10005147 Ga0157379_100051475 377
218 3300025906 Ga0207699_10154670 Ga0207699_101546701 377
219 3300027671 Ga0209588_1003900 Ga0209588_10039002 377
220 3300027907 Ga0207428_10003104 Ga0207428_100031044 377
221 3300028380 Ga0268265_10034627 Ga0268265_100346272 377
222 3300028381 Ga0268264_10191007 Ga0268264_101910072 377
223 3300035691 Ga0373931_0192775 Ga0373931_0192775_28_1161 377
224 3300048903 Ga0496100_0058856 Ga0496100_0058856_519_1652 377
225 3300048905 Ga0496102_0005869 Ga0496102_0005869_7470_8603 377
226 3300048906 Ga0496103_0004547 Ga0496103_0004547_4919_6052 377
227 3300048907 Ga0496104_0004711 Ga0496104_0004711_7675_8808 377
228 3300048909 Ga0496106_0098670 Ga0496106_0098670_385_1518 377
229 3300048911 Ga0496108_0082418 Ga0496108_0082418_940_2127 377
230 3300048915 Ga0496112_0013152 Ga0496112_0013152_1686_2873 377
231 3300050513 nmdc:mga0rr50_22361_c1 nmdc:mga0rr50_22361_c1_1062_2234 377
232 3300005445 Ga0070708_100003856 Ga0070708_10000385611 378
233 3300005467 Ga0070706_100008068 Ga0070706_1000080687 378
234 3300005468 Ga0070707_100007569 Ga0070707_1000075693 378
235 3300005471 Ga0070698_100008240 Ga0070698_1000082401 378
236 3300005518 Ga0070699_100000852 Ga0070699_10000085224 378
237 3300005518 Ga0070699_100128010 Ga0070699_1001280102 378
238 3300006847 Ga0075431_100139238 Ga0075431_1001392383 378
239 3300006914 Ga0075436_100092902 Ga0075436_1000929021 378
240 3300007788 Ga0099795_10023667 Ga0099795_100236672 378
241 3300025910 Ga0207684_10000921 Ga0207684_1000092110 378
242 3300025922 Ga0207646_10008388 Ga0207646_100083888 378
243 3300027907 Ga0207428_10010799 Ga0207428_100107999 378
244 3300046455 Ga0495603_0013040 Ga0495603_0013040_1209_2375 378
245 3300046472 Ga0495580_0009426 Ga0495580_0009426_3815_4981 378
246 3300046472 Ga0495580_0046715 Ga0495580_0046715_1751_2938 378
247 3300046473 Ga0495582_0000168 Ga0495582_0000168_1784_2950 378
248 3300046689 Ga0495613_0250135 Ga0495613_0250135_32_1198 378
249 3300048905 Ga0496102_0162209 Ga0496102_0162209_646_1881 378
250 3300050510 nmdc:mga06r32_329514_c1 nmdc:mga06r32_329514_c1_265_1437 378
251 3300050511 nmdc:mga08y16_3295_c1 nmdc:mga08y16_3295_c1_5238_6413 378
252 3300002459 JGI24751J29686_10000396 JGI24751J29686_100003962 379
253 3300005331 Ga0070670_100031878 Ga0070670_1000318782 379
254 3300005436 Ga0070713_100000926 Ga0070713_1000009269 379
255 3300005438 Ga0070701_10040709 Ga0070701_100407093 379
256 3300005440 Ga0070705_100035200 Ga0070705_1000352001 379
257 3300005441 Ga0070700_100000765 Ga0070700_10000076511 379
258 3300005459 Ga0068867_100077006 Ga0068867_1000770063 379
259 3300005719 Ga0068861_100140512 Ga0068861_1001405122 379
260 3300005843 Ga0068860_100084310 Ga0068860_1000843102 379
261 3300006931 Ga0097620_100095757 Ga0097620_1000957572 379
262 3300007265 Ga0099794_10069974 Ga0099794_100699742 379
263 3300009148 Ga0105243_10015978 Ga0105243_100159784 379
264 3300009148 Ga0105243_10114499 Ga0105243_101144993 379
265 3300009176 Ga0105242_10112334 Ga0105242_101123343 379
266 3300009177 Ga0105248_10247660 Ga0105248_102476601 379
267 3300013306 Ga0163162_10294606 Ga0163162_102946061 379
268 3300014325 Ga0163163_10001149 Ga0163163_1000114916 379
269 3300025924 Ga0207694_10001733 Ga0207694_100017334 379
270 3300025925 Ga0207650_10000001 Ga0207650_100000011220 379
271 3300025928 Ga0207700_10002026 Ga0207700_1000202610 379
272 3300025961 Ga0207712_10129419 Ga0207712_101294192 379
273 3300026075 Ga0207708_10129778 Ga0207708_101297782 379
274 3300026089 Ga0207648_10011682 Ga0207648_100116824 379
275 3300026118 Ga0207675_100005094 Ga0207675_1000050945 379
276 3300026118 Ga0207675_100208974 Ga0207675_1002089741 379
277 3300026121 Ga0207683_10008581 Ga0207683_100085817 379
278 3300047471 Ga0495684_0073814 Ga0495684_0073814_226_1422 379
279 3300005336 Ga0070680_100005685 Ga0070680_1000056859 380
280 3300005458 Ga0070681_10000011 Ga0070681_10000011102 380
281 3300005530 Ga0070679_100000082 Ga0070679_10000008222 380
282 3300013306 Ga0163162_10120797 Ga0163162_101207972 380
283 3300014325 Ga0163163_10085251 Ga0163163_100852512 380
284 3300025912 Ga0207707_10000037 Ga0207707_100000373 380
285 3300025917 Ga0207660_10003334 Ga0207660_100033342 380
286 3300025921 Ga0207652_10000104 Ga0207652_1000010422 380
287 3300032002 Ga0307416_100318369 Ga0307416_1003183693 380
288 3300033545 Ga0316214_1007752 Ga0316214_10077521 380
289 3300046454 Ga0495592_0075371 Ga0495592_0075371_278_1462 380
290 3300047318 Ga0495636_0047706 Ga0495636_0047706_61_1233 380
291 3300005293 Ga0065715_10117371 Ga0065715_101173712 381
292 3300005354 Ga0070675_100165470 Ga0070675_1001654701 381
293 3300005546 Ga0070696_100048327 Ga0070696_1000483272 381
294 3300005564 Ga0070664_100101977 Ga0070664_1001019772 381
295 3300006871 Ga0075434_100107730 Ga0075434_1001077302 381
296 3300007076 Ga0075435_100001389 Ga0075435_10000138910 381
297 3300009094 Ga0111539_10451816 Ga0111539_104518161 381
298 3300013296 Ga0157374_10025492 Ga0157374_100254923 381
299 3300013306 Ga0163162_10335437 Ga0163162_103354372 381
300 3300013307 Ga0157372_10154452 Ga0157372_101544523 381
301 3300014326 Ga0157380_10125728 Ga0157380_101257282 381
302 3300025910 Ga0207684_10000254 Ga0207684_1000025459 381
303 3300025922 Ga0207646_10073100 Ga0207646_100731002 381
304 3300025941 Ga0207711_10099079 Ga0207711_100990792 381
305 3300027907 Ga0207428_10147990 Ga0207428_101479902 381
306 3300035111 Ga0373923_0001010 Ga0373923_0001010_3813_4979 381
307 3300035116 Ga0373945_0010016 Ga0373945_0010016_186_1352 381
308 3300035118 Ga0373954_0004801 Ga0373954_0004801_2633_3799 381
309 3300035171 Ga0373946_0052572 Ga0373946_0052572_434_1600 381
310 3300035410 Ga0373924_0030073 Ga0373924_0030073_128_1294 381
311 3300035692 Ga0373935_0006699 Ga0373935_0006699_2508_3674 381
312 3300035695 Ga0373927_0002385 Ga0373927_0002385_5402_6568 381
313 3300035725 Ga0373947_0005813 Ga0373947_0005813_817_1983 381
314 3300036401 Ga0373937_0027758 Ga0373937_0027758_1118_2284 381
315 3300046454 Ga0495592_0023814 Ga0495592_0023814_153_1319 381
316 3300046462 Ga0495651_0036488 Ga0495651_0036488_2369_3535 381
317 3300046472 Ga0495580_0006228 Ga0495580_0006228_1001_2167 381
318 3300046477 Ga0495664_0006293 Ga0495664_0006293_2580_3746 381
319 3300046511 Ga0495608_0029758 Ga0495608_0029758_19_1185 381
320 3300046516 Ga0495628_0023669 Ga0495628_0023669_2712_3878 381
321 3300046517 Ga0495630_0010252 Ga0495630_0010252_67_1233 381
322 3300046526 Ga0495666_0029539 Ga0495666_0029539_48_1214 381
323 3300046529 Ga0495652_0015005 Ga0495652_0015005_5406_6572 381
324 3300046531 Ga0495665_0032911 Ga0495665_0032911_1096_2262 381
325 3300046535 Ga0495586_0000316 Ga0495586_0000316_8457_9623 381
326 3300046536 Ga0495587_0009379 Ga0495587_0009379_3262_4428 381
327 3300046543 Ga0495645_0024828 Ga0495645_0024828_2963_4129 381
328 3300046663 Ga0495635_0011669 Ga0495635_0011669_2477_3643 381
329 3300046675 Ga0495657_0021776 Ga0495657_0021776_967_2133 381
330 3300046679 Ga0495623_0001481 Ga0495623_0001481_9454_10620 381
331 3300046680 Ga0495646_0001242 Ga0495646_0001242_4227_5393 381
332 3300046690 Ga0495624_0026980 Ga0495624_0026980_2190_3356 381
333 3300047317 Ga0495604_0047692 Ga0495604_0047692_2103_3269 381
334 3300047317 Ga0495604_0129560 Ga0495604_0129560_29_1243 381
335 3300047444 Ga0495675_0033678 Ga0495675_0033678_584_1798 381
336 3300047471 Ga0495684_0009878 Ga0495684_0009878_6103_7269 381
337 3300047471 Ga0495684_0243385 Ga0495684_0243385_21_1208 381
338 3300047673 Ga0495593_0007392 Ga0495593_0007392_185_1351 381
339 3300048088 Ga0495602_0038095 Ga0495602_0038095_2319_3485 381
340 3300048088 Ga0495602_0118169 Ga0495602_0118169_878_2092 381
341 3300050511 nmdc:mga08y16_198267_c1 nmdc:mga08y16_198267_c1_413_1579 381
342 3300050511 nmdc:mga08y16_261556_c1 nmdc:mga08y16_261556_c1_22_1179 381
343 3300050513 nmdc:mga0rr50_34658_c1 nmdc:mga0rr50_34658_c1_1615_2832 381
344 3300050515 nmdc:mga0a205_252100_c1 nmdc:mga0a205_252100_c1_292_1503 381
345 3300053078 Ga0495612_0003712 Ga0495612_0003712_2189_3355 381
346 3300003203 JGI25406J46586_10009109 JGI25406J46586_100091095 382
347 3300005331 Ga0070670_100124788 Ga0070670_1001247882 382
348 3300005985 Ga0081539_10000017 Ga0081539_10000017174 382
349 3300007265 Ga0099794_10045016 Ga0099794_100450162 382
350 3300039437 Ga0436365_1368512 Ga0436365_1368512_52604_53827 382
351 3300046462 Ga0495651_0000107 Ga0495651_0000107_55814_56995 382
352 3300046463 Ga0495653_0056293 Ga0495653_0056293_1170_2351 382
353 3300046543 Ga0495645_0059068 Ga0495645_0059068_999_2180 382
354 3300046559 Ga0495667_0008116 Ga0495667_0008116_3036_4217 382
355 3300047322 Ga0495680_0001862 Ga0495680_0001862_586_1767 382
356 3300047444 Ga0495675_0027051 Ga0495675_0027051_514_1695 382
357 3300025910 Ga0207684_10104196 Ga0207684_101041962 383
358 3300028577 Ga0265318_10000865 Ga0265318_100008652 383
359 3300031240 Ga0265320_10000061 Ga0265320_1000006145 383
360 3300031249 Ga0265339_10004127 Ga0265339_100041275 383
361 3300031250 Ga0265331_10000192 Ga0265331_1000019230 383
362 3300031344 Ga0265316_10030922 Ga0265316_100309225 383
363 3300031595 Ga0265313_10005368 Ga0265313_100053684 383
364 3300031712 Ga0265342_10000235 Ga0265342_100002355 383
365 3300050507 nmdc:mga05p37_78689_c1 nmdc:mga05p37_78689_c1_489_1694 383
366 3300009176 Ga0105242_10243408 Ga0105242_102434082 384
367 3300009177 Ga0105248_10047532 Ga0105248_100475322 384
368 3300009551 Ga0105238_10332044 Ga0105238_103320442 384
369 3300025945 Ga0207679_10260938 Ga0207679_102609381 384
370 3300031090 Ga0265760_10004245 Ga0265760_100042453 384
371 3300047471 Ga0495684_0004395 Ga0495684_0004395_9452_10642 384
372 3300005353 Ga0070669_100001011 Ga0070669_1000010116 385
373 3300006028 Ga0070717_10136109 Ga0070717_101361093 385
374 3300025923 Ga0207681_10001062 Ga0207681_1000106218 385
375 3300028800 Ga0265338_10084598 Ga0265338_100845982 385
376 3300031344 Ga0265316_10016576 Ga0265316_100165762 385
377 3300031711 Ga0265314_10058861 Ga0265314_100588611 385
378 3300035086 Ga0373934_0018419 Ga0373934_0018419_1127_2311 385
379 3300035117 Ga0373953_0017988 Ga0373953_0017988_225_1409 385
380 3300035118 Ga0373954_0016183 Ga0373954_0016183_1241_2425 385
381 3300035119 Ga0373956_0000874 Ga0373956_0000874_7038_8222 385
382 3300035172 Ga0373955_0002010 Ga0373955_0002010_3242_4426 385
383 3300035724 Ga0373933_0000760 Ga0373933_0000760_5116_6300 385
384 3300036401 Ga0373937_0000406 Ga0373937_0000406_36736_37920 385
385 3300044712 Ga0453684_0028124 Ga0453684_0028124_5260_6423 385
386 3300045051 Ga0451576_0008700 Ga0451576_0008700_8545_9708 385
387 3300045976 Ga0466967_0462061 Ga0466967_0462061_29_1225 385
388 3300046462 Ga0495651_0003070 Ga0495651_0003070_5706_6890 385
389 3300049580 Ga0501046_0131054 Ga0501046_0131054_12_1217 385
390 3300049587 Ga0501071_0097492 Ga0501071_0097492_805_2010 385
391 3300049588 Ga0501072_0017449 Ga0501072_0017449_4027_5232 385
392 3300049743 Ga0501081_0065204 Ga0501081_0065204_348_1553 385
393 3300049824 Ga0501045_0068738 Ga0501045_0068738_726_1931 385
394 3300061734 Ga0530510_0006569 Ga0530510_0006569_353_1558 385
395 3300005344 Ga0070661_100071815 Ga0070661_1000718151 386
396 3300005445 Ga0070708_100091004 Ga0070708_1000910043 386
397 3300005458 Ga0070681_10004490 Ga0070681_100044909 386
398 3300005471 Ga0070698_100002898 Ga0070698_10000289811 386
399 3300005530 Ga0070679_100007738 Ga0070679_1000077385 386
400 3300005536 Ga0070697_100019042 Ga0070697_1000190423 386
401 3300005840 Ga0068870_10020921 Ga0068870_100209212 386
402 3300007076 Ga0075435_100006182 Ga0075435_1000061825 386
403 3300007265 Ga0099794_10013298 Ga0099794_100132982 386
404 3300009094 Ga0111539_10330095 Ga0111539_103300952 386
405 3300009553 Ga0105249_10043239 Ga0105249_100432393 386
406 3300025910 Ga0207684_10005783 Ga0207684_100057832 386
407 3300025910 Ga0207684_10134171 Ga0207684_101341712 386
408 3300025912 Ga0207707_10013240 Ga0207707_100132409 386
409 3300025919 Ga0207657_10148026 Ga0207657_101480263 386
410 3300025920 Ga0207649_10169949 Ga0207649_101699492 386
411 3300025921 Ga0207652_10035633 Ga0207652_100356335 386
412 3300025935 Ga0207709_10030715 Ga0207709_100307152 386
413 3300025960 Ga0207651_10047346 Ga0207651_100473462 386
414 3300027671 Ga0209588_1011988 Ga0209588_10119882 386
415 3300031090 Ga0265760_10011862 Ga0265760_100118622 386
416 3300046459 Ga0495629_0085044 Ga0495629_0085044_803_1999 386
417 3300046462 Ga0495651_0005147 Ga0495651_0005147_8294_9463 386
418 3300046463 Ga0495653_0042041 Ga0495653_0042041_2078_3247 386
419 3300046511 Ga0495608_0017607 Ga0495608_0017607_1106_2275 386
420 3300046516 Ga0495628_0006382 Ga0495628_0006382_836_2005 386
421 3300046529 Ga0495652_0012220 Ga0495652_0012220_3813_4982 386
422 3300046533 Ga0495640_0045238 Ga0495640_0045238_1751_2920 386
423 3300046536 Ga0495587_0001200 Ga0495587_0001200_8263_9432 386
424 3300046663 Ga0495635_0025267 Ga0495635_0025267_2103_3272 386
425 3300046675 Ga0495657_0037087 Ga0495657_0037087_643_1812 386
426 3300046678 Ga0495599_0023235 Ga0495599_0023235_1107_2276 386
427 3300047319 Ga0495674_0004479 Ga0495674_0004479_6438_7607 386
428 3300047444 Ga0495675_0000727 Ga0495675_0000727_8271_9440 386
429 3300047471 Ga0495684_0026956 Ga0495684_0026956_1704_2873 386
430 3300048088 Ga0495602_0084610 Ga0495602_0084610_917_2086 386
431 3300048915 Ga0496112_0230891 Ga0496112_0230891_18_1211 386
432 3300049521 Ga0501298_010004 Ga0501298_010004_79_1305 386
433 3300049741 Ga0501079_0259609 Ga0501079_0259609_70_1278 386
434 3300050513 nmdc:mga0rr50_10664_c1 nmdc:mga0rr50_10664_c1_1922_3118 386
435 3300005436 Ga0070713_100045422 Ga0070713_1000454222 387
436 3300005439 Ga0070711_100098003 Ga0070711_1000980032 387
437 3300005617 Ga0068859_100231000 Ga0068859_1002310001 387
438 3300006914 Ga0075436_100014748 Ga0075436_1000147481 387
439 3300006931 Ga0097620_100231015 Ga0097620_1002310152 387
440 3300009093 Ga0105240_10126682 Ga0105240_101266822 387
441 3300009545 Ga0105237_10266234 Ga0105237_102662342 387
442 3300013105 Ga0157369_10033225 Ga0157369_100332255 387
443 3300013307 Ga0157372_10003754 Ga0157372_1000375412 387
444 3300014325 Ga0163163_10000001 Ga0163163_1000000150 387
445 3300025906 Ga0207699_10003030 Ga0207699_100030306 387
446 3300025912 Ga0207707_10081721 Ga0207707_100817212 387
447 3300025925 Ga0207650_10042021 Ga0207650_100420212 387
448 3300025928 Ga0207700_10012825 Ga0207700_100128256 387
449 3300025929 Ga0207664_10005426 Ga0207664_1000542610 387
450 3300026121 Ga0207683_10178957 Ga0207683_101789572 387
451 3300045051 Ga0451576_0004103 Ga0451576_0004103_12048_13244 387
452 3300046539 Ga0495621_0003641 Ga0495621_0003641_1412_2608 387
453 3300048917 Ga0496114_0243507 Ga0496114_0243507_368_1564 387
454 3300005436 Ga0070713_100010269 Ga0070713_1000102692 388
455 3300005438 Ga0070701_10061021 Ga0070701_100610211 388
456 3300005518 Ga0070699_100010712 Ga0070699_1000107126 388
457 3300005544 Ga0070686_100089327 Ga0070686_1000893271 388
458 3300005546 Ga0070696_100207386 Ga0070696_1002073861 388
459 3300005844 Ga0068862_100027631 Ga0068862_1000276315 388
460 3300006028 Ga0070717_10171602 Ga0070717_101716022 388
461 3300006846 Ga0075430_100084950 Ga0075430_1000849502 388
462 3300006847 Ga0075431_100113847 Ga0075431_1001138473 388
463 3300006880 Ga0075429_100032604 Ga0075429_1000326042 388
464 3300007265 Ga0099794_10003397 Ga0099794_100033972 388
465 3300009147 Ga0114129_10043321 Ga0114129_100433215 388
466 3300009147 Ga0114129_10107748 Ga0114129_101077483 388
467 3300014326 Ga0157380_10039145 Ga0157380_100391451 388
468 3300025906 Ga0207699_10003056 Ga0207699_100030563 388
469 3300025913 Ga0207695_10050743 Ga0207695_100507434 388
470 3300025923 Ga0207681_10029311 Ga0207681_100293113 388
471 3300025928 Ga0207700_10038582 Ga0207700_100385824 388
472 3300025935 Ga0207709_10021836 Ga0207709_100218362 388
473 3300026078 Ga0207702_10012786 Ga0207702_100127868 388
474 3300027671 Ga0209588_1015949 Ga0209588_10159491 388
475 3300027671 Ga0209588_1017371 Ga0209588_10173711 388
476 3300028380 Ga0268265_10005239 Ga0268265_100052397 388
477 3300035111 Ga0373923_0019977 Ga0373923_0019977_914_2134 388
478 3300035170 Ga0373943_0001497 Ga0373943_0001497_7583_8803 388
479 3300035171 Ga0373946_0001703 Ga0373946_0001703_5342_6562 388
480 3300035172 Ga0373955_0028684 Ga0373955_0028684_1361_2581 388
481 3300035410 Ga0373924_0007307 Ga0373924_0007307_49_1269 388
482 3300035724 Ga0373933_0127025 Ga0373933_0127025_113_1333 388
483 3300035725 Ga0373947_0004173 Ga0373947_0004173_1664_2884 388
484 3300036401 Ga0373937_0196745 Ga0373937_0196745_79_1299 388
485 3300046684 Ga0495669_0002736 Ga0495669_0002736_2648_3853 388
486 3300050507 nmdc:mga05p37_149016_c1 nmdc:mga05p37_149016_c1_1316_2524 388
487 3300050508 nmdc:mga09592_8475_c1 nmdc:mga09592_8475_c1_5880_7088 388
488 3300050509 nmdc:mga0qj67_4138_c1 nmdc:mga0qj67_4138_c1_8740_9948 388
489 3300050510 nmdc:mga06r32_198923_c1 nmdc:mga06r32_198923_c1_172_1380 388
490 3300005344 Ga0070661_100007054 Ga0070661_1000070547 389
491 3300005366 Ga0070659_100011777 Ga0070659_1000117776 389
492 3300005434 Ga0070709_10003180 Ga0070709_100031804 389
493 3300005436 Ga0070713_100002231 Ga0070713_1000022314 389
494 3300005530 Ga0070679_100007014 Ga0070679_1000070147 389
495 3300005564 Ga0070664_100005057 Ga0070664_1000050576 389
496 3300005577 Ga0068857_100002999 Ga0068857_1000029998 389
497 3300005618 Ga0068864_100022101 Ga0068864_1000221015 389
498 3300006173 Ga0070716_100002152 Ga0070716_1000021522 389
499 3300009177 Ga0105248_10187895 Ga0105248_101878952 389
500 3300013100 Ga0157373_10015443 Ga0157373_100154432 389
501 3300013306 Ga0163162_10013871 Ga0163162_100138715 389
502 3300014325 Ga0163163_10020239 Ga0163163_100202392 389
503 3300014325 Ga0163163_10023361 Ga0163163_100233612 389
504 3300025906 Ga0207699_10002789 Ga0207699_100027897 389
505 3300025912 Ga0207707_10041183 Ga0207707_100411835 389
506 3300025917 Ga0207660_10031858 Ga0207660_100318583 389
507 3300025921 Ga0207652_10051053 Ga0207652_100510533 389
508 3300025928 Ga0207700_10006558 Ga0207700_100065585 389
509 3300025939 Ga0207665_10004561 Ga0207665_100045613 389
510 3300025945 Ga0207679_10030833 Ga0207679_100308332 389
511 3300026095 Ga0207676_10087190 Ga0207676_100871902 389
512 3300026116 Ga0207674_10015232 Ga0207674_100152322 389
513 3300031731 Ga0307405_10190204 Ga0307405_101902041 389
514 3300033547 Ga0316212_1000699 Ga0316212_10006992 389
515 3300004803 Ga0058862_12841824 Ga0058862_128418242 390
516 3300005406 Ga0070703_10004410 Ga0070703_100044102 390
517 3300005440 Ga0070705_100048739 Ga0070705_1000487392 390
518 3300005444 Ga0070694_100087851 Ga0070694_1000878512 390
519 3300005467 Ga0070706_100014025 Ga0070706_1000140253 390
520 3300005530 Ga0070679_100004782 Ga0070679_1000047823 390
521 3300005536 Ga0070697_100002229 Ga0070697_10000222915 390
522 3300005545 Ga0070695_100040732 Ga0070695_1000407322 390
523 3300005546 Ga0070696_100000725 Ga0070696_10000072511 390
524 3300005547 Ga0070693_100000712 Ga0070693_1000007124 390
525 3300005549 Ga0070704_100000356 Ga0070704_1000003565 390
526 3300005841 Ga0068863_100007354 Ga0068863_1000073542 390
527 3300005843 Ga0068860_100209626 Ga0068860_1002096262 390
528 3300006173 Ga0070716_100047302 Ga0070716_1000473023 390
529 3300006237 Ga0097621_100002739 Ga0097621_1000027396 390
530 3300006358 Ga0068871_100012155 Ga0068871_1000121552 390
531 3300006871 Ga0075434_100045476 Ga0075434_1000454764 390
532 3300006914 Ga0075436_100090429 Ga0075436_1000904292 390
533 3300007076 Ga0075435_100216731 Ga0075435_1002167312 390
534 3300007265 Ga0099794_10056408 Ga0099794_100564081 390
535 3300011119 Ga0105246_10015646 Ga0105246_100156461 390
536 3300014969 Ga0157376_10000014 Ga0157376_10000014111 390
537 3300025885 Ga0207653_10001170 Ga0207653_100011702 390
538 3300025906 Ga0207699_10076508 Ga0207699_100765081 390
539 3300025910 Ga0207684_10009363 Ga0207684_100093635 390
540 3300025911 Ga0207654_10072390 Ga0207654_100723902 390
541 3300025912 Ga0207707_10012920 Ga0207707_100129203 390
542 3300025914 Ga0207671_10071201 Ga0207671_100712012 390
543 3300025917 Ga0207660_10210498 Ga0207660_102104981 390
544 3300025921 Ga0207652_10029363 Ga0207652_100293632 390
545 3300025921 Ga0207652_10166825 Ga0207652_101668252 390
546 3300025939 Ga0207665_10066437 Ga0207665_100664373 390
547 3300026035 Ga0207703_10069166 Ga0207703_100691662 390
548 3300026041 Ga0207639_10171924 Ga0207639_101719241 390
549 3300026088 Ga0207641_10020450 Ga0207641_100204502 390
550 3300027671 Ga0209588_1016208 Ga0209588_10162082 390
551 3300038996 Ga0242420_006411 Ga0242420_006411_597_1808 390
552 3300048917 Ga0496114_0003782 Ga0496114_0003782_5914_7128 390
553 3300050513 nmdc:mga0rr50_77726_c1 nmdc:mga0rr50_77726_c1_1076_2290 390
554 3300050514 nmdc:mga08x19_78457_c1 nmdc:mga08x19_78457_c1_433_1644 390
555 3300050515 nmdc:mga0a205_72084_c1 nmdc:mga0a205_72084_c1_1713_2927 390
556 3300005445 Ga0070708_100142988 Ga0070708_1001429882 391
557 3300005468 Ga0070707_100039494 Ga0070707_1000394944 391
558 3300005471 Ga0070698_100011225 Ga0070698_1000112257 391
559 3300005518 Ga0070699_100059115 Ga0070699_1000591152 391
560 3300005536 Ga0070697_100262053 Ga0070697_1002620531 391
561 3300005549 Ga0070704_100142374 Ga0070704_1001423742 391
562 3300006173 Ga0070716_100044628 Ga0070716_1000446282 391
563 3300006175 Ga0070712_100038007 Ga0070712_1000380072 391
564 3300009553 Ga0105249_10000025 Ga0105249_1000002581 391
565 3300013306 Ga0163162_10000002 Ga0163162_10000002266 391
566 3300014326 Ga0157380_10051705 Ga0157380_100517051 391
567 3300019161 Ga0184602_129938 Ga0184602_1299381 391
568 3300025910 Ga0207684_10036687 Ga0207684_100366872 391
569 3300025915 Ga0207693_10153904 Ga0207693_101539042 391
570 3300025922 Ga0207646_10002064 Ga0207646_100020647 391
571 3300025922 Ga0207646_10043427 Ga0207646_100434274 391
572 3300025939 Ga0207665_10006371 Ga0207665_100063715 391
573 3300025961 Ga0207712_10002724 Ga0207712_100027246 391
574 3300028379 Ga0268266_10000204 Ga0268266_1000020477 391
575 3300028800 Ga0265338_10123897 Ga0265338_101238971 391
576 3300030878 Ga0265770_1000930 Ga0265770_10009302 391
577 3300005439 Ga0070711_100004103 Ga0070711_1000041036 392
578 3300006237 Ga0097621_100015802 Ga0097621_1000158024 392
579 3300006358 Ga0068871_100011680 Ga0068871_1000116804 392
580 3300009093 Ga0105240_10048507 Ga0105240_100485072 392
581 3300009098 Ga0105245_10089355 Ga0105245_100893553 392
582 3300009174 Ga0105241_10009683 Ga0105241_100096837 392
583 3300009551 Ga0105238_10019334 Ga0105238_100193344 392
584 3300010375 Ga0105239_10152157 Ga0105239_101521571 392
585 3300013297 Ga0157378_10011338 Ga0157378_100113385 392
586 3300014968 Ga0157379_10039684 Ga0157379_100396843 392
587 3300014969 Ga0157376_10107837 Ga0157376_101078372 392
588 3300025916 Ga0207663_10007347 Ga0207663_100073475 392
589 3300046543 Ga0495645_0018739 Ga0495645_0018739_1103_2299 392
590 3300048907 Ga0496104_0180005 Ga0496104_0180005_679_1875 392
591 3300053077 Ga0495601_0002978 Ga0495601_0002978_5177_6373 392
592 3300005336 Ga0070680_100149110 Ga0070680_1001491101 393
593 3300005458 Ga0070681_10002186 Ga0070681_100021867 393
594 3300005471 Ga0070698_100012602 Ga0070698_1000126025 393
595 3300005518 Ga0070699_100043476 Ga0070699_1000434764 393
596 3300005530 Ga0070679_100023469 Ga0070679_1000234695 393
597 3300005536 Ga0070697_100019610 Ga0070697_1000196104 393
598 3300006871 Ga0075434_100012218 Ga0075434_1000122185 393
599 3300007076 Ga0075435_100039481 Ga0075435_1000394813 393
600 3300009545 Ga0105237_10022698 Ga0105237_100226982 393
601 3300025912 Ga0207707_10002231 Ga0207707_1000223115 393
602 3300025917 Ga0207660_10015111 Ga0207660_100151112 393
603 3300025939 Ga0207665_10000709 Ga0207665_100007093 393
604 3300025941 Ga0207711_10091894 Ga0207711_100918943 393
605 3300025942 Ga0207689_10143940 Ga0207689_101439402 393
606 3300036401 Ga0373937_0096821 Ga0373937_0096821_1348_2565 393
607 3300037068 Ga0373925_0039877 Ga0373925_0039877_2074_3291 393
608 3300044694 Ga0466963_0000364 Ga0466963_0000364_4810_6018 393
609 3300046459 Ga0495629_0148602 Ga0495629_0148602_154_1371 393
610 3300046663 Ga0495635_0099486 Ga0495635_0099486_366_1583 393
611 3300048903 Ga0496100_0056865 Ga0496100_0056865_883_2100 393
612 3300048904 Ga0496101_0007379 Ga0496101_0007379_4951_6168 393
613 3300048907 Ga0496104_0053828 Ga0496104_0053828_1123_2340 393
614 3300048909 Ga0496106_0057871 Ga0496106_0057871_1473_2690 393
615 3300048912 Ga0496109_0138775 Ga0496109_0138775_71_1288 393
616 3300048917 Ga0496114_0027200 Ga0496114_0027200_3114_4331 393
617 3300048918 Ga0496115_0033010 Ga0496115_0033010_1641_2858 393
618 3300048918 Ga0496115_0102854 Ga0496115_0102854_464_1663 393
619 3300050512 nmdc:mga0n895_14256_c1 nmdc:mga0n895_14256_c1_3000_4223 393
620 3300053077 Ga0495601_0197035 Ga0495601_0197035_85_1302 393
621 3300007788 Ga0099795_10006902 Ga0099795_100069022 394
622 3300005536 Ga0070697_100247593 Ga0070697_1002475932 400
623 3300006028 Ga0070717_10226918 Ga0070717_102269181 400
624 3300007265 Ga0099794_10000762 Ga0099794_100007628 400
625 3300007265 Ga0099794_10027490 Ga0099794_100274903 400
626 3300025939 Ga0207665_10007285 Ga0207665_100072855 400
627 3300027671 Ga0209588_1000091 Ga0209588_100009122 400
628 3300025911 Ga0207654_10010827 Ga0207654_100108273 401
629 3300028381 Ga0268264_10138907 Ga0268264_101389072 401
630 3300048918 Ga0496115_0057523 Ga0496115_0057523_1404_2609 401
631 3300005445 Ga0070708_100016466 Ga0070708_1000164663 402
632 3300006852 Ga0075433_10026266 Ga0075433_100262663 402
633 3300006871 Ga0075434_100003719 Ga0075434_1000037194 402
634 3300006914 Ga0075436_100011981 Ga0075436_1000119814 402
635 3300007076 Ga0075435_100001321 Ga0075435_1000013217 402
636 3300027671 Ga0209588_1005114 Ga0209588_10051142 402
637 3300005445 Ga0070708_100000527 Ga0070708_1000005274 403
638 3300005467 Ga0070706_100000991 Ga0070706_1000009913 403
639 3300005468 Ga0070707_100002670 Ga0070707_10000267014 403
640 3300005468 Ga0070707_100018287 Ga0070707_1000182873 403
641 3300005471 Ga0070698_100000182 Ga0070698_10000018232 403
642 3300005471 Ga0070698_100020887 Ga0070698_1000208875 403
643 3300005518 Ga0070699_100088237 Ga0070699_1000882372 403
644 3300005518 Ga0070699_100151537 Ga0070699_1001515372 403
645 3300005536 Ga0070697_100002841 Ga0070697_1000028414 403
646 3300009174 Ga0105241_10114286 Ga0105241_101142861 403
647 3300025910 Ga0207684_10001275 Ga0207684_1000127525 403
648 3300025910 Ga0207684_10022870 Ga0207684_100228702 403
649 3300025922 Ga0207646_10000959 Ga0207646_100009599 403
650 3300025922 Ga0207646_10002760 Ga0207646_1000276017 403
651 3300005445 Ga0070708_100110153 Ga0070708_1001101532 404
652 3300005468 Ga0070707_100104228 Ga0070707_1001042282 404
653 3300005536 Ga0070697_100020567 Ga0070697_1000205674 404
654 3300007788 Ga0099795_10002165 Ga0099795_100021651 404
655 3300025910 Ga0207684_10224337 Ga0207684_102243372 404
656 3300025922 Ga0207646_10180861 Ga0207646_101808612 404
657 2162886012 MBSR1b_contig_6047714 MBSR1b_0040.00000470 405
658 3300005330 Ga0070690_100087672 Ga0070690_1000876721 405
659 3300005335 Ga0070666_10030297 Ga0070666_100302972 405
660 3300005337 Ga0070682_100016607 Ga0070682_1000166073 405
661 3300005338 Ga0068868_100006717 Ga0068868_1000067173 405
662 3300005339 Ga0070660_100018690 Ga0070660_1000186904 405
663 3300005344 Ga0070661_100008680 Ga0070661_1000086805 405
664 3300005347 Ga0070668_100052769 Ga0070668_1000527692 405
665 3300005353 Ga0070669_100058514 Ga0070669_1000585142 405
666 3300005366 Ga0070659_100016405 Ga0070659_1000164053 405
667 3300005444 Ga0070694_100060353 Ga0070694_1000603531 405
668 3300005455 Ga0070663_100027656 Ga0070663_1000276563 405
669 3300005456 Ga0070678_100021305 Ga0070678_1000213053 405
670 3300005457 Ga0070662_100018503 Ga0070662_1000185032 405
671 3300005467 Ga0070706_100000257 Ga0070706_10000025728 405
672 3300005518 Ga0070699_100230021 Ga0070699_1002300211 405
673 3300005530 Ga0070679_100332694 Ga0070679_1003326942 405
674 3300005535 Ga0070684_100033500 Ga0070684_1000335003 405
675 3300005536 Ga0070697_100002898 Ga0070697_10000289812 405
676 3300005539 Ga0068853_100031297 Ga0068853_1000312972 405
677 3300005545 Ga0070695_100067461 Ga0070695_1000674612 405
678 3300005548 Ga0070665_100033884 Ga0070665_1000338844 405
679 3300005549 Ga0070704_100076325 Ga0070704_1000763252 405
680 3300005564 Ga0070664_100107730 Ga0070664_1001077302 405
681 3300005616 Ga0068852_100008382 Ga0068852_1000083824 405
682 3300005617 Ga0068859_100034026 Ga0068859_1000340263 405
683 3300005718 Ga0068866_10036677 Ga0068866_100366772 405
684 3300005719 Ga0068861_100094624 Ga0068861_1000946242 405
685 3300005834 Ga0068851_10009864 Ga0068851_100098643 405
686 3300005842 Ga0068858_100015899 Ga0068858_1000158995 405
687 3300005843 Ga0068860_100009175 Ga0068860_1000091756 405
688 3300005844 Ga0068862_100019123 Ga0068862_1000191233 405
689 3300006173 Ga0070716_100020108 Ga0070716_1000201084 405
690 3300006237 Ga0097621_100051250 Ga0097621_1000512502 405
691 3300006931 Ga0097620_100034027 Ga0097620_1000340273 405
692 3300009093 Ga0105240_10224273 Ga0105240_102242732 405
693 3300009098 Ga0105245_10149356 Ga0105245_101493562 405
694 3300009174 Ga0105241_10055379 Ga0105241_100553792 405
695 3300009177 Ga0105248_10079686 Ga0105248_100796863 405
696 3300009551 Ga0105238_10052823 Ga0105238_100528232 405
697 3300009553 Ga0105249_10016918 Ga0105249_100169183 405
698 3300013102 Ga0157371_10009941 Ga0157371_100099412 405
699 3300013105 Ga0157369_10118745 Ga0157369_101187452 405
700 3300013296 Ga0157374_10018109 Ga0157374_100181095 405
701 3300013306 Ga0163162_10021711 Ga0163162_100217111 405
702 3300013307 Ga0157372_10133002 Ga0157372_101330022 405
703 3300013308 Ga0157375_10039651 Ga0157375_100396513 405
704 3300014969 Ga0157376_10036913 Ga0157376_100369133 405
705 3300025321 Ga0207656_10014688 Ga0207656_100146882 405
706 3300025910 Ga0207684_10002463 Ga0207684_100024632 405
707 3300025911 Ga0207654_10002903 Ga0207654_100029037 405
708 3300025912 Ga0207707_10266259 Ga0207707_102662591 405
709 3300025913 Ga0207695_10025312 Ga0207695_100253123 405
710 3300025914 Ga0207671_10022859 Ga0207671_100228593 405
711 3300025919 Ga0207657_10000215 Ga0207657_1000021547 405
712 3300025920 Ga0207649_10031565 Ga0207649_100315652 405
713 3300025923 Ga0207681_10080628 Ga0207681_100806282 405
714 3300025924 Ga0207694_10058815 Ga0207694_100588152 405
715 3300025927 Ga0207687_10001479 Ga0207687_100014793 405
716 3300025933 Ga0207706_10004908 Ga0207706_1000490810 405
717 3300025936 Ga0207670_10063511 Ga0207670_100635112 405
718 3300025941 Ga0207711_10025317 Ga0207711_100253173 405
719 3300025944 Ga0207661_10118487 Ga0207661_101184872 405
720 3300025945 Ga0207679_10014735 Ga0207679_100147353 405
721 3300025949 Ga0207667_10160529 Ga0207667_101605292 405
722 3300025961 Ga0207712_10146203 Ga0207712_101462031 405
723 3300025972 Ga0207668_10041205 Ga0207668_100412052 405
724 3300025981 Ga0207640_10016000 Ga0207640_100160003 405
725 3300026023 Ga0207677_10016558 Ga0207677_100165582 405
726 3300026035 Ga0207703_10030684 Ga0207703_100306842 405
727 3300026041 Ga0207639_10128074 Ga0207639_101280742 405
728 3300026067 Ga0207678_10000874 Ga0207678_1000087418 405
729 3300026075 Ga0207708_10147607 Ga0207708_101476072 405
730 3300026089 Ga0207648_10017065 Ga0207648_100170655 405
731 3300026116 Ga0207674_10219408 Ga0207674_102194081 405
732 3300026118 Ga0207675_100106910 Ga0207675_1001069101 405
733 3300026121 Ga0207683_10020514 Ga0207683_100205143 405
734 3300026142 Ga0207698_10043325 Ga0207698_100433253 405
735 3300028379 Ga0268266_10025409 Ga0268266_100254092 405
736 3300028380 Ga0268265_10073447 Ga0268265_100734472 405
737 3300028381 Ga0268264_10093079 Ga0268264_100930791 405
738 3300035241 Ga0373961_0011822 Ga0373961_0011822_858_2075 405
739 3300035691 Ga0373931_0035901 Ga0373931_0035901_965_2182 405
740 3300048905 Ga0496102_0098832 Ga0496102_0098832_118_1335 405
741 3300048906 Ga0496103_0034632 Ga0496103_0034632_678_1895 405
742 3300048915 Ga0496112_0057191 Ga0496112_0057191_1120_2337 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00437

T2SSE

Type II/IV secretion system protein

46

316

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ojy-assembly1.cif.gz_B methylated pilt4 from geobacter metallireducens bound to sulfate: c3ocococ conformation 0.9536 21 373
3jvu-assembly1.cif.gz_A-2 crystal structure of unliganded p. aeruginosa pilt 0.9382 22 368
2eyu-assembly2.cif.gz_B the crystal structure of the c-terminal domain of aquifex aeolicus pilt 0.938 128 375
3jvv-assembly1.cif.gz_A-2 crystal structure of p. aeruginosa pilt with bound amp-pcp 0.9359 20 368
3jvv-assembly1.cif.gz_B-2 crystal structure of p. aeruginosa pilt with bound amp-pcp 0.9308 23 368
ID Description Score Start End Superfamily
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9603 125 368 3.40.50.300
3jvvC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 125 368 3.40.50.300
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.9089 21 124 3.30.450.90
2ewwA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8918 19 124 3.30.450.90
5fl3A01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8752 21 124 3.30.450.90
ID Description Score Start End GO Terms
AF-A0A645FIK6-F1-model_v4 Twitching mobility protein 0.9788 135 377 GO:0005524
GO:0016887
AF-A0A6I1IXX6-F1-model_v4 deleted 0.975 121 268
AF-A0A6L4ZL45-F1-model_v4 Twitching motility protein PilT 0.9734 166 374 GO:0005524
GO:0016887
AF-X1KSN6-F1-model_v4 Bacterial type II secretion system protein E domain-containing protein 0.9721 84 309 GO:0005524
GO:0016887
AF-A0A2V8TJU6-F1-model_v4 Twitching motility protein 0.9718 82 379 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
84.45 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map