F478646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 300 | 742 | 391 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10190204|Ga0307405_101902041 |
| Length | 419 |
| Sequence | LAPLLRGGPPMATSASDPTTVETEELALLFGPHAASAFPTDALVGKMLDYGPGISDLVFSPGRPPQVEQDGELTPVPIAGLEKLSAAHTAVIARHLVAGQPQAVRALRDQGACDLSFVLGERARFRVNVFRQRGTFAIVMRLIATKVPTLQELGLPPYLARIAALKSGIVLVTGPTGSGKSSTLAAMIDLINDTRAEHILTIEDPVEYLHEHKKATVHQRELHSDTPTFALALRAALRQAPKVILVGEMRDRDTMEIALTAAETGHLVLSTLHTIDAARTVDRVIGAFDVGDQQAIRIRLAATFRAFISQRLVPKKGGGRIALLEILTSTMRTREYIEKGDSEGRSLLDAMRDGALDGMQHFDGEIERLVRAGVISGRVGLLNATNPGNLRVMMADISLDDEPVASGVVEGLEHGLITQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 118 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 119 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 197 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 276 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 1.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 95.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_6047714 | 2162886012 | Bacteria | 2922 |
| 2 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 3 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 4 | JGI24751J29686_10000396 | 3300002459 | Bacteria | 14487 |
| 5 | JGI25406J46586_10009109 | 3300003203 | Bacteria | 4455 |
| 6 | JGI25406J46586_10015284 | 3300003203 | Bacteria | 3242 |
| 7 | JGI25406J46586_10027247 | 3300003203 | Bacteria | 2194 |
| 8 | Ga0058862_12841824 | 3300004803 | Bacteria | 1413 |
| 9 | Ga0065704_10110498 | 3300005289 | Bacteria | 1978 |
| 10 | Ga0065712_10000112 | 3300005290 | Bacteria | 340011 |
| 11 | Ga0065715_10090735 | 3300005293 | Bacteria | 6548 |
| 12 | Ga0065715_10117371 | 3300005293 | Bacteria | 2350 |
| 13 | Ga0065707_10014710 | 3300005295 | Bacteria | 2498 |
| 14 | Ga0070690_100087672 | 3300005330 | Bacteria | 2044 |
| 15 | Ga0070670_100031878 | 3300005331 | Bacteria | 4538 |
| 16 | Ga0070670_100124788 | 3300005331 | Bacteria | 2222 |
| 17 | Ga0070666_10030297 | 3300005335 | Bacteria | 3563 |
| 18 | Ga0070666_10049576 | 3300005335 | Bacteria | 2822 |
| 19 | Ga0070680_100005685 | 3300005336 | Bacteria | 9458 |
| 20 | Ga0070680_100149110 | 3300005336 | Bacteria | 1963 |
| 21 | Ga0070682_100000056 | 3300005337 | Bacteria | 108991 |
| 22 | Ga0070682_100016607 | 3300005337 | Bacteria | 4283 |
| 23 | Ga0068868_100006717 | 3300005338 | Bacteria | 8165 |
| 24 | Ga0068868_100006836 | 3300005338 | Bacteria | 8100 |
| 25 | Ga0070660_100018690 | 3300005339 | Bacteria | 5068 |
| 26 | Ga0070661_100007054 | 3300005344 | Bacteria | 7751 |
| 27 | Ga0070661_100008680 | 3300005344 | Bacteria | 7032 |
| 28 | Ga0070661_100071815 | 3300005344 | Bacteria | 2547 |
| 29 | Ga0070692_10045858 | 3300005345 | Bacteria | 2256 |
| 30 | Ga0070668_100028991 | 3300005347 | Bacteria | 4202 |
| 31 | Ga0070668_100052769 | 3300005347 | Bacteria | 3135 |
| 32 | Ga0070669_100001011 | 3300005353 | Bacteria | 20483 |
| 33 | Ga0070669_100005910 | 3300005353 | Bacteria | 8831 |
| 34 | Ga0070669_100058514 | 3300005353 | Bacteria | 2828 |
| 35 | Ga0070675_100026566 | 3300005354 | Bacteria | 4647 |
| 36 | Ga0070675_100165470 | 3300005354 | Bacteria | 1904 |
| 37 | Ga0070671_100003105 | 3300005355 | Bacteria | 12935 |
| 38 | Ga0070671_100035239 | 3300005355 | Bacteria | 4146 |
| 39 | Ga0070659_100011777 | 3300005366 | Bacteria | 6473 |
| 40 | Ga0070659_100016405 | 3300005366 | Bacteria | 5561 |
| 41 | Ga0070703_10004410 | 3300005406 | Bacteria | 3960 |
| 42 | Ga0070709_10003180 | 3300005434 | Bacteria | 8807 |
| 43 | Ga0070713_100000926 | 3300005436 | Bacteria | 18731 |
| 44 | Ga0070713_100002231 | 3300005436 | Bacteria | 12564 |
| 45 | Ga0070713_100010269 | 3300005436 | Bacteria | 6760 |
| 46 | Ga0070713_100045422 | 3300005436 | Bacteria | 3599 |
| 47 | Ga0070701_10034925 | 3300005438 | Bacteria | 2522 |
| 48 | Ga0070701_10040709 | 3300005438 | Bacteria | 2363 |
| 49 | Ga0070701_10061021 | 3300005438 | Bacteria | 1987 |
| 50 | Ga0070711_100004103 | 3300005439 | Bacteria | 8560 |
| 51 | Ga0070711_100098003 | 3300005439 | Bacteria | 2127 |
| 52 | Ga0070705_100035200 | 3300005440 | Bacteria | 2805 |
| 53 | Ga0070705_100048739 | 3300005440 | Bacteria | 2455 |
| 54 | Ga0070705_100186829 | 3300005440 | Bacteria | 1409 |
| 55 | Ga0070700_100000116 | 3300005441 | Bacteria | 51075 |
| 56 | Ga0070700_100000765 | 3300005441 | Bacteria | 15886 |
| 57 | Ga0070700_100022151 | 3300005441 | Bacteria | 3702 |
| 58 | Ga0070694_100060353 | 3300005444 | Bacteria | 2586 |
| 59 | Ga0070694_100087851 | 3300005444 | Bacteria | 2176 |
| 60 | Ga0070708_100000527 | 3300005445 | Bacteria | 28842 |
| 61 | Ga0070708_100003856 | 3300005445 | Bacteria | 11769 |
| 62 | Ga0070708_100016466 | 3300005445 | Bacteria | 6135 |
| 63 | Ga0070708_100020824 | 3300005445 | Bacteria | 5536 |
| 64 | Ga0070708_100091004 | 3300005445 | Bacteria | 2778 |
| 65 | Ga0070708_100110153 | 3300005445 | Bacteria | 2530 |
| 66 | Ga0070708_100127313 | 3300005445 | Bacteria | 2355 |
| 67 | Ga0070708_100142988 | 3300005445 | Bacteria | 2220 |
| 68 | Ga0070663_100027656 | 3300005455 | Bacteria | 3853 |
| 69 | Ga0070678_100021305 | 3300005456 | Bacteria | 4272 |
| 70 | Ga0070662_100018503 | 3300005457 | Bacteria | 4713 |
| 71 | Ga0070662_100118836 | 3300005457 | Bacteria | 2023 |
| 72 | Ga0070681_10000011 | 3300005458 | Bacteria | 139059 |
| 73 | Ga0070681_10002186 | 3300005458 | Bacteria | 17794 |
| 74 | Ga0070681_10004490 | 3300005458 | Bacteria | 13310 |
| 75 | Ga0070681_10098747 | 3300005458 | Bacteria | 2866 |
| 76 | Ga0068867_100077006 | 3300005459 | Bacteria | 2505 |
| 77 | Ga0068867_100113581 | 3300005459 | Bacteria | 2084 |
| 78 | Ga0070706_100000257 | 3300005467 | Bacteria | 64534 |
| 79 | Ga0070706_100000991 | 3300005467 | Bacteria | 30868 |
| 80 | Ga0070706_100008068 | 3300005467 | Bacteria | 9823 |
| 81 | Ga0070706_100014025 | 3300005467 | Bacteria | 7405 |
| 82 | Ga0070707_100002670 | 3300005468 | Bacteria | 16959 |
| 83 | Ga0070707_100007569 | 3300005468 | Bacteria | 10084 |
| 84 | Ga0070707_100018287 | 3300005468 | Bacteria | 6595 |
| 85 | Ga0070707_100039494 | 3300005468 | Bacteria | 4511 |
| 86 | Ga0070707_100050511 | 3300005468 | Bacteria | 3986 |
| 87 | Ga0070707_100104228 | 3300005468 | Bacteria | 2749 |
| 88 | Ga0070707_100158710 | 3300005468 | Bacteria | 2203 |
| 89 | Ga0070698_100000182 | 3300005471 | Bacteria | 59279 |
| 90 | Ga0070698_100002898 | 3300005471 | Bacteria | 18889 |
| 91 | Ga0070698_100008240 | 3300005471 | Bacteria | 11272 |
| 92 | Ga0070698_100011225 | 3300005471 | Bacteria | 9516 |
| 93 | Ga0070698_100012602 | 3300005471 | Bacteria | 8955 |
| 94 | Ga0070698_100020887 | 3300005471 | Bacteria | 6862 |
| 95 | Ga0070699_100000852 | 3300005518 | Bacteria | 28306 |
| 96 | Ga0070699_100010712 | 3300005518 | Bacteria | 7933 |
| 97 | Ga0070699_100019382 | 3300005518 | Bacteria | 5856 |
| 98 | Ga0070699_100022524 | 3300005518 | Bacteria | 5430 |
| 99 | Ga0070699_100043476 | 3300005518 | Bacteria | 3888 |
| 100 | Ga0070699_100059115 | 3300005518 | Bacteria | 3322 |
| 101 | Ga0070699_100088237 | 3300005518 | Bacteria | 2709 |
| 102 | Ga0070699_100124573 | 3300005518 | Bacteria | 2268 |
| 103 | Ga0070699_100128010 | 3300005518 | Bacteria | 2237 |
| 104 | Ga0070699_100151537 | 3300005518 | Bacteria | 2051 |
| 105 | Ga0070699_100230021 | 3300005518 | Bacteria | 1653 |
| 106 | Ga0070679_100000082 | 3300005530 | Bacteria | 71054 |
| 107 | Ga0070679_100004782 | 3300005530 | Bacteria | 12488 |
| 108 | Ga0070679_100007014 | 3300005530 | Bacteria | 10511 |
| 109 | Ga0070679_100007738 | 3300005530 | Bacteria | 10062 |
| 110 | Ga0070679_100023469 | 3300005530 | Bacteria | 6038 |
| 111 | Ga0070679_100332694 | 3300005530 | Bacteria | 1467 |
| 112 | Ga0070684_100033500 | 3300005535 | Bacteria | 4386 |
| 113 | Ga0070684_100158318 | 3300005535 | Bacteria | 2054 |
| 114 | Ga0070697_100000128 | 3300005536 | Bacteria | 60251 |
| 115 | Ga0070697_100002229 | 3300005536 | Bacteria | 14862 |
| 116 | Ga0070697_100002841 | 3300005536 | Bacteria | 13321 |
| 117 | Ga0070697_100002898 | 3300005536 | Bacteria | 13190 |
| 118 | Ga0070697_100019042 | 3300005536 | Bacteria | 5417 |
| 119 | Ga0070697_100019610 | 3300005536 | Bacteria | 5342 |
| 120 | Ga0070697_100020567 | 3300005536 | Bacteria | 5222 |
| 121 | Ga0070697_100083795 | 3300005536 | Bacteria | 2629 |
| 122 | Ga0070697_100247593 | 3300005536 | Bacteria | 1523 |
| 123 | Ga0070697_100262053 | 3300005536 | Bacteria | 1480 |
| 124 | Ga0068853_100018006 | 3300005539 | Bacteria | 5839 |
| 125 | Ga0068853_100031297 | 3300005539 | Bacteria | 4500 |
| 126 | Ga0070686_100089327 | 3300005544 | Bacteria | 2058 |
| 127 | Ga0070695_100040732 | 3300005545 | Bacteria | 2942 |
| 128 | Ga0070695_100067461 | 3300005545 | Bacteria | 2333 |
| 129 | Ga0070696_100000725 | 3300005546 | Bacteria | 21101 |
| 130 | Ga0070696_100010498 | 3300005546 | Bacteria | 6206 |
| 131 | Ga0070696_100014326 | 3300005546 | Bacteria | 5318 |
| 132 | Ga0070696_100048327 | 3300005546 | Bacteria | 2953 |
| 133 | Ga0070696_100092362 | 3300005546 | Bacteria | 2157 |
| 134 | Ga0070696_100207386 | 3300005546 | Bacteria | 1466 |
| 135 | Ga0070693_100000712 | 3300005547 | Bacteria | 14666 |
| 136 | Ga0070665_100033884 | 3300005548 | Bacteria | 5137 |
| 137 | Ga0070704_100000356 | 3300005549 | Bacteria | 20762 |
| 138 | Ga0070704_100063279 | 3300005549 | Bacteria | 2655 |
| 139 | Ga0070704_100076325 | 3300005549 | Bacteria | 2451 |
| 140 | Ga0070704_100142374 | 3300005549 | Bacteria | 1874 |
| 141 | Ga0068855_100139705 | 3300005563 | Bacteria | 2762 |
| 142 | Ga0068855_100141131 | 3300005563 | Bacteria | 2746 |
| 143 | Ga0070664_100005057 | 3300005564 | Bacteria | 10575 |
| 144 | Ga0070664_100101977 | 3300005564 | Bacteria | 2496 |
| 145 | Ga0070664_100107730 | 3300005564 | Bacteria | 2429 |
| 146 | Ga0068857_100002999 | 3300005577 | Bacteria | 13930 |
| 147 | Ga0068857_100045026 | 3300005577 | Bacteria | 3914 |
| 148 | Ga0068857_100304891 | 3300005577 | Bacteria | 1469 |
| 149 | Ga0068854_100033249 | 3300005578 | Bacteria | 3595 |
| 150 | Ga0068856_100094547 | 3300005614 | Bacteria | 2976 |
| 151 | Ga0070702_100013158 | 3300005615 | Bacteria | 4170 |
| 152 | Ga0068852_100008382 | 3300005616 | Bacteria | 7617 |
| 153 | Ga0068852_100193734 | 3300005616 | Bacteria | 1919 |
| 154 | Ga0068859_100034026 | 3300005617 | Bacteria | 5116 |
| 155 | Ga0068859_100068765 | 3300005617 | Bacteria | 3576 |
| 156 | Ga0068859_100162882 | 3300005617 | Bacteria | 2310 |
| 157 | Ga0068859_100231000 | 3300005617 | Bacteria | 1938 |
| 158 | Ga0068864_100022101 | 3300005618 | Bacteria | 5332 |
| 159 | Ga0068866_10036677 | 3300005718 | Bacteria | 2403 |
| 160 | Ga0068866_10044082 | 3300005718 | Bacteria | 2230 |
| 161 | Ga0068861_100094624 | 3300005719 | Bacteria | 2364 |
| 162 | Ga0068861_100095098 | 3300005719 | Bacteria | 2359 |
| 163 | Ga0068861_100140512 | 3300005719 | Bacteria | 1970 |
| 164 | Ga0068861_100341739 | 3300005719 | Bacteria | 1310 |
| 165 | Ga0068851_10001653 | 3300005834 | Bacteria | 9771 |
| 166 | Ga0068851_10009864 | 3300005834 | Bacteria | 4447 |
| 167 | Ga0068870_10020921 | 3300005840 | Bacteria | 3194 |
| 168 | Ga0068863_100007354 | 3300005841 | Bacteria | 10778 |
| 169 | Ga0068863_100060976 | 3300005841 | Bacteria | 3567 |
| 170 | Ga0068858_100006042 | 3300005842 | Bacteria | 11805 |
| 171 | Ga0068858_100015108 | 3300005842 | Bacteria | 7262 |
| 172 | Ga0068858_100015899 | 3300005842 | Bacteria | 7071 |
| 173 | Ga0068858_100333205 | 3300005842 | Bacteria | 1452 |
| 174 | Ga0068860_100009175 | 3300005843 | Bacteria | 9833 |
| 175 | Ga0068860_100084310 | 3300005843 | Bacteria | 3023 |
| 176 | Ga0068860_100209626 | 3300005843 | Bacteria | 1890 |
| 177 | Ga0068862_100007997 | 3300005844 | Bacteria | 8749 |
| 178 | Ga0068862_100019123 | 3300005844 | Bacteria | 5712 |
| 179 | Ga0068862_100027631 | 3300005844 | Unclassified | 4776 |
| 180 | Ga0068862_100233872 | 3300005844 | Bacteria | 1668 |
| 181 | Ga0081539_10000017 | 3300005985 | Bacteria | 375107 |
| 182 | Ga0081539_10000049 | 3300005985 | Bacteria | 271978 |
| 183 | Ga0070717_10020698 | 3300006028 | Bacteria | 5179 |
| 184 | Ga0070717_10136109 | 3300006028 | Bacteria | 2116 |
| 185 | Ga0070717_10171602 | 3300006028 | Bacteria | 1887 |
| 186 | Ga0070717_10189375 | 3300006028 | Bacteria | 1797 |
| 187 | Ga0070717_10226918 | 3300006028 | Bacteria | 1643 |
| 188 | Ga0070716_100000496 | 3300006173 | Bacteria | 16400 |
| 189 | Ga0070716_100002152 | 3300006173 | Bacteria | 9057 |
| 190 | Ga0070716_100020108 | 3300006173 | Bacteria | 3501 |
| 191 | Ga0070716_100044628 | 3300006173 | Bacteria | 2484 |
| 192 | Ga0070716_100047302 | 3300006173 | Bacteria | 2426 |
| 193 | Ga0070712_100038007 | 3300006175 | Bacteria | 3285 |
| 194 | Ga0097621_100002739 | 3300006237 | Bacteria | 12055 |
| 195 | Ga0097621_100015802 | 3300006237 | Bacteria | 5691 |
| 196 | Ga0097621_100051250 | 3300006237 | Bacteria | 3358 |
| 197 | Ga0068871_100003050 | 3300006358 | Bacteria | 11495 |
| 198 | Ga0068871_100011680 | 3300006358 | Bacteria | 6449 |
| 199 | Ga0068871_100012155 | 3300006358 | Bacteria | 6336 |
| 200 | Ga0075428_100334128 | 3300006844 | Bacteria | 1628 |
| 201 | Ga0075430_100070828 | 3300006846 | Bacteria | 2925 |
| 202 | Ga0075430_100084950 | 3300006846 | Bacteria | 2650 |
| 203 | Ga0075431_100113847 | 3300006847 | Bacteria | 2792 |
| 204 | Ga0075431_100139238 | 3300006847 | Bacteria | 2502 |
| 205 | Ga0075433_10026266 | 3300006852 | Bacteria | 4929 |
| 206 | Ga0075434_100003719 | 3300006871 | Bacteria | 13629 |
| 207 | Ga0075434_100012218 | 3300006871 | Bacteria | 8136 |
| 208 | Ga0075434_100045476 | 3300006871 | Bacteria | 4355 |
| 209 | Ga0075434_100107730 | 3300006871 | Bacteria | 2797 |
| 210 | Ga0075429_100011898 | 3300006880 | Bacteria | 7546 |
| 211 | Ga0075429_100032604 | 3300006880 | Bacteria | 4528 |
| 212 | Ga0068865_100067757 | 3300006881 | Bacteria | 2522 |
| 213 | Ga0075436_100000519 | 3300006914 | Bacteria | 25057 |
| 214 | Ga0075436_100011981 | 3300006914 | Bacteria | 5947 |
| 215 | Ga0075436_100014748 | 3300006914 | Bacteria | 5355 |
| 216 | Ga0075436_100040223 | 3300006914 | Bacteria | 3226 |
| 217 | Ga0075436_100090429 | 3300006914 | Bacteria | 2128 |
| 218 | Ga0075436_100092902 | 3300006914 | Bacteria | 2098 |
| 219 | Ga0097620_100034027 | 3300006931 | Bacteria | 5116 |
| 220 | Ga0097620_100068764 | 3300006931 | Bacteria | 3576 |
| 221 | Ga0097620_100095757 | 3300006931 | Bacteria | 3021 |
| 222 | Ga0097620_100162867 | 3300006931 | Bacteria | 2310 |
| 223 | Ga0097620_100231015 | 3300006931 | Bacteria | 1938 |
| 224 | Ga0075435_100001321 | 3300007076 | Bacteria | 15935 |
| 225 | Ga0075435_100001389 | 3300007076 | Bacteria | 15617 |
| 226 | Ga0075435_100006182 | 3300007076 | Bacteria | 8448 |
| 227 | Ga0075435_100013117 | 3300007076 | Bacteria | 6156 |
| 228 | Ga0075435_100039481 | 3300007076 | Bacteria | 3767 |
| 229 | Ga0075435_100216731 | 3300007076 | Bacteria | 1625 |
| 230 | Ga0099794_10000762 | 3300007265 | Bacteria | 10857 |
| 231 | Ga0099794_10003397 | 3300007265 | Bacteria | 6068 |
| 232 | Ga0099794_10013298 | 3300007265 | Bacteria | 3579 |
| 233 | Ga0099794_10027490 | 3300007265 | Bacteria | 2637 |
| 234 | Ga0099794_10045016 | 3300007265 | Bacteria | 2110 |
| 235 | Ga0099794_10056408 | 3300007265 | Bacteria | 1900 |
| 236 | Ga0099794_10069221 | 3300007265 | Bacteria | 1726 |
| 237 | Ga0099794_10069974 | 3300007265 | Bacteria | 1717 |
| 238 | Ga0099795_10002165 | 3300007788 | Bacteria | 4534 |
| 239 | Ga0099795_10006902 | 3300007788 | Bacteria | 3130 |
| 240 | Ga0099795_10023667 | 3300007788 | Bacteria | 2040 |
| 241 | Ga0105240_10048507 | 3300009093 | Bacteria | 5367 |
| 242 | Ga0105240_10058596 | 3300009093 | Bacteria | 4808 |
| 243 | Ga0105240_10126682 | 3300009093 | Unclassified | 3068 |
| 244 | Ga0105240_10137583 | 3300009093 | Bacteria | 2923 |
| 245 | Ga0105240_10224273 | 3300009093 | Bacteria | 2188 |
| 246 | Ga0111539_10000723 | 3300009094 | Bacteria | 42944 |
| 247 | Ga0111539_10007470 | 3300009094 | Bacteria | 13997 |
| 248 | Ga0111539_10079237 | 3300009094 | Bacteria | 3864 |
| 249 | Ga0111539_10200833 | 3300009094 | Bacteria | 2325 |
| 250 | Ga0111539_10330095 | 3300009094 | Bacteria | 1775 |
| 251 | Ga0111539_10451816 | 3300009094 | Bacteria | 1496 |
| 252 | Ga0111539_10490547 | 3300009094 | Bacteria | 1431 |
| 253 | Ga0105245_10089355 | 3300009098 | Bacteria | 2832 |
| 254 | Ga0105245_10149356 | 3300009098 | Bacteria | 2208 |
| 255 | Ga0105247_10000005 | 3300009101 | Bacteria | 426989 |
| 256 | Ga0105247_10107476 | 3300009101 | Bacteria | 1792 |
| 257 | Ga0114129_10043321 | 3300009147 | Bacteria | 6332 |
| 258 | Ga0114129_10107748 | 3300009147 | Unclassified | 3847 |
| 259 | Ga0114129_10298077 | 3300009147 | Bacteria | 2150 |
| 260 | Ga0105243_10015978 | 3300009148 | Bacteria | 5676 |
| 261 | Ga0105243_10043760 | 3300009148 | Bacteria | 3510 |
| 262 | Ga0105243_10058282 | 3300009148 | Bacteria | 3078 |
| 263 | Ga0105243_10060152 | 3300009148 | Unclassified | 3034 |
| 264 | Ga0105243_10114499 | 3300009148 | Bacteria | 2263 |
| 265 | Ga0105241_10009683 | 3300009174 | Bacteria | 7081 |
| 266 | Ga0105241_10018088 | 3300009174 | Bacteria | 5182 |
| 267 | Ga0105241_10024038 | 3300009174 | Bacteria | 4524 |
| 268 | Ga0105241_10055379 | 3300009174 | Bacteria | 3038 |
| 269 | Ga0105241_10114286 | 3300009174 | Bacteria | 2165 |
| 270 | Ga0105242_10020815 | 3300009176 | Bacteria | 5145 |
| 271 | Ga0105242_10112334 | 3300009176 | Bacteria | 2325 |
| 272 | Ga0105242_10122073 | 3300009176 | Bacteria | 2237 |
| 273 | Ga0105242_10243408 | 3300009176 | Bacteria | 1618 |
| 274 | Ga0105248_10007190 | 3300009177 | Bacteria | 12213 |
| 275 | Ga0105248_10010549 | 3300009177 | Bacteria | 10179 |
| 276 | Ga0105248_10047532 | 3300009177 | Bacteria | 4812 |
| 277 | Ga0105248_10079686 | 3300009177 | Bacteria | 3681 |
| 278 | Ga0105248_10187895 | 3300009177 | Bacteria | 2328 |
| 279 | Ga0105248_10247660 | 3300009177 | Bacteria | 2006 |
| 280 | Ga0105248_10253045 | 3300009177 | Bacteria | 1982 |
| 281 | Ga0105237_10022698 | 3300009545 | Bacteria | 6439 |
| 282 | Ga0105237_10240407 | 3300009545 | Bacteria | 1812 |
| 283 | Ga0105237_10266234 | 3300009545 | Bacteria | 1717 |
| 284 | Ga0105238_10019334 | 3300009551 | Bacteria | 6937 |
| 285 | Ga0105238_10052823 | 3300009551 | Bacteria | 4084 |
| 286 | Ga0105238_10070197 | 3300009551 | Bacteria | 3503 |
| 287 | Ga0105238_10332044 | 3300009551 | Bacteria | 1507 |
| 288 | Ga0105249_10000025 | 3300009553 | Bacteria | 232713 |
| 289 | Ga0105249_10016918 | 3300009553 | Bacteria | 6471 |
| 290 | Ga0105249_10043239 | 3300009553 | Bacteria | 4098 |
| 291 | Ga0105249_10413357 | 3300009553 | Bacteria | 1381 |
| 292 | Ga0105239_10108847 | 3300010375 | Bacteria | 3070 |
| 293 | Ga0105239_10152157 | 3300010375 | Bacteria | 2582 |
| 294 | Ga0105239_10183775 | 3300010375 | Bacteria | 2339 |
| 295 | Ga0105246_10015646 | 3300011119 | Bacteria | 4793 |
| 296 | Ga0157373_10015443 | 3300013100 | Bacteria | 5582 |
| 297 | Ga0157371_10009941 | 3300013102 | Bacteria | 7447 |
| 298 | Ga0157369_10033225 | 3300013105 | Bacteria | 5671 |
| 299 | Ga0157369_10118745 | 3300013105 | Bacteria | 2807 |
| 300 | Ga0157374_10018109 | 3300013296 | Bacteria | 6212 |
| 301 | Ga0157374_10025492 | 3300013296 | Bacteria | 5310 |
| 302 | Ga0157374_10164963 | 3300013296 | Bacteria | 2159 |
| 303 | Ga0157378_10000023 | 3300013297 | Bacteria | 129977 |
| 304 | Ga0157378_10011338 | 3300013297 | Bacteria | 7802 |
| 305 | Ga0157378_10063377 | 3300013297 | Bacteria | 3303 |
| 306 | Ga0157378_10066479 | 3300013297 | Bacteria | 3229 |
| 307 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 308 | Ga0163162_10013871 | 3300013306 | Bacteria | 7874 |
| 309 | Ga0163162_10021711 | 3300013306 | Bacteria | 6323 |
| 310 | Ga0163162_10046839 | 3300013306 | Bacteria | 4334 |
| 311 | Ga0163162_10120797 | 3300013306 | Bacteria | 2724 |
| 312 | Ga0163162_10294606 | 3300013306 | Bacteria | 1754 |
| 313 | Ga0163162_10325554 | 3300013306 | Bacteria | 1669 |
| 314 | Ga0163162_10335437 | 3300013306 | Bacteria | 1644 |
| 315 | Ga0157372_10000993 | 3300013307 | Bacteria | 31008 |
| 316 | Ga0157372_10003754 | 3300013307 | Bacteria | 16310 |
| 317 | Ga0157372_10133002 | 3300013307 | Bacteria | 2863 |
| 318 | Ga0157372_10154452 | 3300013307 | Bacteria | 2650 |
| 319 | Ga0157372_10209934 | 3300013307 | Bacteria | 2256 |
| 320 | Ga0157375_10039651 | 3300013308 | Bacteria | 4535 |
| 321 | Ga0157375_10247944 | 3300013308 | Bacteria | 1941 |
| 322 | Ga0163163_10000001 | 3300014325 | Bacteria | 622185 |
| 323 | Ga0163163_10001149 | 3300014325 | Bacteria | 22490 |
| 324 | Ga0163163_10020239 | 3300014325 | Bacteria | 6264 |
| 325 | Ga0163163_10023361 | 3300014325 | Bacteria | 5866 |
| 326 | Ga0163163_10085251 | 3300014325 | Bacteria | 3167 |
| 327 | Ga0163163_10086260 | 3300014325 | Bacteria | 3148 |
| 328 | Ga0157380_10001107 | 3300014326 | Bacteria | 17378 |
| 329 | Ga0157380_10001374 | 3300014326 | Bacteria | 15866 |
| 330 | Ga0157380_10036588 | 3300014326 | Bacteria | 3799 |
| 331 | Ga0157380_10039145 | 3300014326 | Unclassified | 3685 |
| 332 | Ga0157380_10051705 | 3300014326 | Bacteria | 3251 |
| 333 | Ga0157380_10125728 | 3300014326 | Bacteria | 2179 |
| 334 | Ga0182008_10055340 | 3300014497 | Bacteria | 1962 |
| 335 | Ga0157379_10005147 | 3300014968 | Bacteria | 11224 |
| 336 | Ga0157379_10039684 | 3300014968 | Bacteria | 4201 |
| 337 | Ga0157376_10000014 | 3300014969 | Bacteria | 303001 |
| 338 | Ga0157376_10036913 | 3300014969 | Bacteria | 3962 |
| 339 | Ga0157376_10107837 | 3300014969 | Bacteria | 2446 |
| 340 | Ga0163161_10051059 | 3300017792 | Bacteria | 2994 |
| 341 | Ga0184602_129938 | 3300019161 | Bacteria | 1429 |
| 342 | Ga0224572_1009425 | 3300024225 | Bacteria | 1821 |
| 343 | Ga0228598_1004923 | 3300024227 | Bacteria | 2809 |
| 344 | Ga0207672_1001357 | 3300025223 | Bacteria | 1941 |
| 345 | Ga0207656_10014688 | 3300025321 | Bacteria | 3022 |
| 346 | Ga0207653_10001170 | 3300025885 | Bacteria | 8568 |
| 347 | Ga0207692_10019836 | 3300025898 | Bacteria | 3046 |
| 348 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 349 | Ga0207710_10001622 | 3300025900 | Bacteria | 10987 |
| 350 | Ga0207699_10002789 | 3300025906 | Bacteria | 8251 |
| 351 | Ga0207699_10003030 | 3300025906 | Bacteria | 7980 |
| 352 | Ga0207699_10003056 | 3300025906 | Bacteria | 7943 |
| 353 | Ga0207699_10076508 | 3300025906 | Bacteria | 2062 |
| 354 | Ga0207699_10154670 | 3300025906 | Bacteria | 1521 |
| 355 | Ga0207643_10002710 | 3300025908 | Bacteria | 9577 |
| 356 | Ga0207684_10000254 | 3300025910 | Bacteria | 79674 |
| 357 | Ga0207684_10000921 | 3300025910 | Bacteria | 33357 |
| 358 | Ga0207684_10001275 | 3300025910 | Bacteria | 27799 |
| 359 | Ga0207684_10002463 | 3300025910 | Bacteria | 18645 |
| 360 | Ga0207684_10005783 | 3300025910 | Bacteria | 11348 |
| 361 | Ga0207684_10009363 | 3300025910 | Bacteria | 8654 |
| 362 | Ga0207684_10010195 | 3300025910 | Bacteria | 8274 |
| 363 | Ga0207684_10022870 | 3300025910 | Bacteria | 5337 |
| 364 | Ga0207684_10023266 | 3300025910 | Bacteria | 5291 |
| 365 | Ga0207684_10024388 | 3300025910 | Bacteria | 5157 |
| 366 | Ga0207684_10036687 | 3300025910 | Bacteria | 4161 |
| 367 | Ga0207684_10104196 | 3300025910 | Bacteria | 2425 |
| 368 | Ga0207684_10134171 | 3300025910 | Bacteria | 2125 |
| 369 | Ga0207684_10224337 | 3300025910 | Bacteria | 1622 |
| 370 | Ga0207654_10002903 | 3300025911 | Bacteria | 8686 |
| 371 | Ga0207654_10010827 | 3300025911 | Bacteria | 4643 |
| 372 | Ga0207654_10072390 | 3300025911 | Bacteria | 2052 |
| 373 | Ga0207707_10000037 | 3300025912 | Bacteria | 144937 |
| 374 | Ga0207707_10002231 | 3300025912 | Bacteria | 17500 |
| 375 | Ga0207707_10012920 | 3300025912 | Bacteria | 7268 |
| 376 | Ga0207707_10013240 | 3300025912 | Bacteria | 7185 |
| 377 | Ga0207707_10041183 | 3300025912 | Bacteria | 4034 |
| 378 | Ga0207707_10081721 | 3300025912 | Unclassified | 2821 |
| 379 | Ga0207707_10266259 | 3300025912 | Bacteria | 1486 |
| 380 | Ga0207695_10025312 | 3300025913 | Bacteria | 6648 |
| 381 | Ga0207695_10050743 | 3300025913 | Bacteria | 4362 |
| 382 | Ga0207695_10136417 | 3300025913 | Bacteria | 2406 |
| 383 | Ga0207671_10022859 | 3300025914 | Bacteria | 4721 |
| 384 | Ga0207671_10071201 | 3300025914 | Bacteria | 2593 |
| 385 | Ga0207693_10153904 | 3300025915 | Bacteria | 1809 |
| 386 | Ga0207663_10007347 | 3300025916 | Bacteria | 5710 |
| 387 | Ga0207660_10003334 | 3300025917 | Bacteria | 10485 |
| 388 | Ga0207660_10015111 | 3300025917 | Bacteria | 5090 |
| 389 | Ga0207660_10031858 | 3300025917 | Bacteria | 3636 |
| 390 | Ga0207660_10210498 | 3300025917 | Bacteria | 1522 |
| 391 | Ga0207657_10000215 | 3300025919 | Bacteria | 60239 |
| 392 | Ga0207657_10006780 | 3300025919 | Bacteria | 11825 |
| 393 | Ga0207657_10148026 | 3300025919 | Bacteria | 1914 |
| 394 | Ga0207649_10031565 | 3300025920 | Bacteria | 3150 |
| 395 | Ga0207649_10169949 | 3300025920 | Bacteria | 1518 |
| 396 | Ga0207652_10000104 | 3300025921 | Bacteria | 91783 |
| 397 | Ga0207652_10029363 | 3300025921 | Bacteria | 4597 |
| 398 | Ga0207652_10035633 | 3300025921 | Bacteria | 4202 |
| 399 | Ga0207652_10051053 | 3300025921 | Bacteria | 3545 |
| 400 | Ga0207652_10166825 | 3300025921 | Bacteria | 1975 |
| 401 | Ga0207646_10000959 | 3300025922 | Bacteria | 37166 |
| 402 | Ga0207646_10002064 | 3300025922 | Bacteria | 24118 |
| 403 | Ga0207646_10002760 | 3300025922 | Bacteria | 20509 |
| 404 | Ga0207646_10008388 | 3300025922 | Bacteria | 10359 |
| 405 | Ga0207646_10009318 | 3300025922 | Bacteria | 9709 |
| 406 | Ga0207646_10043427 | 3300025922 | Bacteria | 4037 |
| 407 | Ga0207646_10073100 | 3300025922 | Bacteria | 3063 |
| 408 | Ga0207646_10144560 | 3300025922 | Bacteria | 2143 |
| 409 | Ga0207646_10180861 | 3300025922 | Bacteria | 1904 |
| 410 | Ga0207681_10001062 | 3300025923 | Bacteria | 17822 |
| 411 | Ga0207681_10029311 | 3300025923 | Unclassified | 3573 |
| 412 | Ga0207681_10080628 | 3300025923 | Bacteria | 2296 |
| 413 | Ga0207694_10001733 | 3300025924 | Bacteria | 18281 |
| 414 | Ga0207694_10058815 | 3300025924 | Bacteria | 2990 |
| 415 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 416 | Ga0207650_10042021 | 3300025925 | Bacteria | 3353 |
| 417 | Ga0207659_10027312 | 3300025926 | Bacteria | 3863 |
| 418 | Ga0207687_10001479 | 3300025927 | Bacteria | 16100 |
| 419 | Ga0207700_10002026 | 3300025928 | Bacteria | 11583 |
| 420 | Ga0207700_10006558 | 3300025928 | Bacteria | 7043 |
| 421 | Ga0207700_10012825 | 3300025928 | Bacteria | 5421 |
| 422 | Ga0207700_10038582 | 3300025928 | Bacteria | 3468 |
| 423 | Ga0207664_10005426 | 3300025929 | Bacteria | 8712 |
| 424 | Ga0207644_10000309 | 3300025931 | Bacteria | 31740 |
| 425 | Ga0207644_10004053 | 3300025931 | Bacteria | 9505 |
| 426 | Ga0207644_10166709 | 3300025931 | Bacteria | 1717 |
| 427 | Ga0207706_10004908 | 3300025933 | Bacteria | 12508 |
| 428 | Ga0207706_10007827 | 3300025933 | Bacteria | 9863 |
| 429 | Ga0207706_10030994 | 3300025933 | Bacteria | 4766 |
| 430 | Ga0207709_10021836 | 3300025935 | Bacteria | 3625 |
| 431 | Ga0207709_10030715 | 3300025935 | Bacteria | 3128 |
| 432 | Ga0207670_10002918 | 3300025936 | Bacteria | 9038 |
| 433 | Ga0207670_10063511 | 3300025936 | Bacteria | 2527 |
| 434 | Ga0207665_10000709 | 3300025939 | Bacteria | 22594 |
| 435 | Ga0207665_10004561 | 3300025939 | Bacteria | 9191 |
| 436 | Ga0207665_10006371 | 3300025939 | Bacteria | 7828 |
| 437 | Ga0207665_10007285 | 3300025939 | Bacteria | 7319 |
| 438 | Ga0207665_10066437 | 3300025939 | Bacteria | 2454 |
| 439 | Ga0207691_10150742 | 3300025940 | Bacteria | 2044 |
| 440 | Ga0207711_10025317 | 3300025941 | Bacteria | 4979 |
| 441 | Ga0207711_10091894 | 3300025941 | Bacteria | 2670 |
| 442 | Ga0207711_10099079 | 3300025941 | Bacteria | 2576 |
| 443 | Ga0207711_10231404 | 3300025941 | Bacteria | 1693 |
| 444 | Ga0207689_10003754 | 3300025942 | Bacteria | 13839 |
| 445 | Ga0207689_10143940 | 3300025942 | Bacteria | 1964 |
| 446 | Ga0207661_10117444 | 3300025944 | Bacteria | 2260 |
| 447 | Ga0207661_10118487 | 3300025944 | Bacteria | 2250 |
| 448 | Ga0207661_10346412 | 3300025944 | Bacteria | 1340 |
| 449 | Ga0207679_10014735 | 3300025945 | Bacteria | 5149 |
| 450 | Ga0207679_10030833 | 3300025945 | Bacteria | 3748 |
| 451 | Ga0207679_10260938 | 3300025945 | Bacteria | 1478 |
| 452 | Ga0207667_10160529 | 3300025949 | Bacteria | 2312 |
| 453 | Ga0207651_10047346 | 3300025960 | Bacteria | 2899 |
| 454 | Ga0207712_10002724 | 3300025961 | Bacteria | 11288 |
| 455 | Ga0207712_10129419 | 3300025961 | Bacteria | 1921 |
| 456 | Ga0207712_10134154 | 3300025961 | Bacteria | 1891 |
| 457 | Ga0207712_10146203 | 3300025961 | Bacteria | 1820 |
| 458 | Ga0207668_10041205 | 3300025972 | Bacteria | 3120 |
| 459 | Ga0207640_10016000 | 3300025981 | Bacteria | 4354 |
| 460 | Ga0207640_10043304 | 3300025981 | Bacteria | 2876 |
| 461 | Ga0207677_10007639 | 3300026023 | Bacteria | 6000 |
| 462 | Ga0207677_10016558 | 3300026023 | Bacteria | 4371 |
| 463 | Ga0207703_10000486 | 3300026035 | Bacteria | 41391 |
| 464 | Ga0207703_10020633 | 3300026035 | Bacteria | 5154 |
| 465 | Ga0207703_10030684 | 3300026035 | Bacteria | 4248 |
| 466 | Ga0207703_10069166 | 3300026035 | Bacteria | 2911 |
| 467 | Ga0207639_10128074 | 3300026041 | Bacteria | 2097 |
| 468 | Ga0207639_10171924 | 3300026041 | Bacteria | 1836 |
| 469 | Ga0207678_10000874 | 3300026067 | Bacteria | 27662 |
| 470 | Ga0207708_10000486 | 3300026075 | Bacteria | 30609 |
| 471 | Ga0207708_10001072 | 3300026075 | Bacteria | 20503 |
| 472 | Ga0207708_10129778 | 3300026075 | Bacteria | 1970 |
| 473 | Ga0207708_10147607 | 3300026075 | Bacteria | 1849 |
| 474 | Ga0207702_10000536 | 3300026078 | Bacteria | 42507 |
| 475 | Ga0207702_10012786 | 3300026078 | Bacteria | 6985 |
| 476 | Ga0207641_10020450 | 3300026088 | Bacteria | 5435 |
| 477 | Ga0207648_10011682 | 3300026089 | Bacteria | 8264 |
| 478 | Ga0207648_10017065 | 3300026089 | Bacteria | 6618 |
| 479 | Ga0207676_10087190 | 3300026095 | Bacteria | 2552 |
| 480 | Ga0207676_10156973 | 3300026095 | Bacteria | 1967 |
| 481 | Ga0207674_10015232 | 3300026116 | Bacteria | 8459 |
| 482 | Ga0207674_10219408 | 3300026116 | Bacteria | 1850 |
| 483 | Ga0207675_100005094 | 3300026118 | Bacteria | 12643 |
| 484 | Ga0207675_100056030 | 3300026118 | Bacteria | 3677 |
| 485 | Ga0207675_100065785 | 3300026118 | Bacteria | 3388 |
| 486 | Ga0207675_100106910 | 3300026118 | Bacteria | 2638 |
| 487 | Ga0207675_100208974 | 3300026118 | Bacteria | 1877 |
| 488 | Ga0207683_10008581 | 3300026121 | Bacteria | 8747 |
| 489 | Ga0207683_10020514 | 3300026121 | Bacteria | 5653 |
| 490 | Ga0207683_10178957 | 3300026121 | Unclassified | 1922 |
| 491 | Ga0207698_10043325 | 3300026142 | Bacteria | 3370 |
| 492 | Ga0209588_1000091 | 3300027671 | Bacteria | 28595 |
| 493 | Ga0209588_1003900 | 3300027671 | Bacteria | 4165 |
| 494 | Ga0209588_1005114 | 3300027671 | Bacteria | 3740 |
| 495 | Ga0209588_1011988 | 3300027671 | Bacteria | 2627 |
| 496 | Ga0209588_1015949 | 3300027671 | Bacteria | 2315 |
| 497 | Ga0209588_1016208 | 3300027671 | Bacteria | 2297 |
| 498 | Ga0209588_1017371 | 3300027671 | Bacteria | 2230 |
| 499 | Ga0207428_10003104 | 3300027907 | Bacteria | 16327 |
| 500 | Ga0207428_10010799 | 3300027907 | Bacteria | 8139 |
| 501 | Ga0207428_10147990 | 3300027907 | Bacteria | 1789 |
| 502 | Ga0265356_1000057 | 3300028017 | Bacteria | 18461 |
| 503 | Ga0268266_10000204 | 3300028379 | Bacteria | 104000 |
| 504 | Ga0268266_10025409 | 3300028379 | Bacteria | 5039 |
| 505 | Ga0268265_10005239 | 3300028380 | Bacteria | 8873 |
| 506 | Ga0268265_10011259 | 3300028380 | Bacteria | 6048 |
| 507 | Ga0268265_10034627 | 3300028380 | Bacteria | 3683 |
| 508 | Ga0268265_10073447 | 3300028380 | Bacteria | 2671 |
| 509 | Ga0268264_10056067 | 3300028381 | Bacteria | 3293 |
| 510 | Ga0268264_10093079 | 3300028381 | Bacteria | 2603 |
| 511 | Ga0268264_10093365 | 3300028381 | Bacteria | 2599 |
| 512 | Ga0268264_10138907 | 3300028381 | Bacteria | 2164 |
| 513 | Ga0268264_10191007 | 3300028381 | Bacteria | 1867 |
| 514 | Ga0268264_10249039 | 3300028381 | Bacteria | 1649 |
| 515 | Ga0265318_10000865 | 3300028577 | Bacteria | 19883 |
| 516 | Ga0265338_10084598 | 3300028800 | Bacteria | 2647 |
| 517 | Ga0265338_10123897 | 3300028800 | Unclassified | 2055 |
| 518 | Ga0265762_1000184 | 3300030760 | Bacteria | 9864 |
| 519 | Ga0265770_1000930 | 3300030878 | Bacteria | 4054 |
| 520 | Ga0265760_10004245 | 3300031090 | Bacteria | 4120 |
| 521 | Ga0265760_10006664 | 3300031090 | Bacteria | 3306 |
| 522 | Ga0265760_10008231 | 3300031090 | Bacteria | 2980 |
| 523 | Ga0265760_10011862 | 3300031090 | Bacteria | 2489 |
| 524 | Ga0265320_10000061 | 3300031240 | Bacteria | 101367 |
| 525 | Ga0265339_10004127 | 3300031249 | Bacteria | 10015 |
| 526 | Ga0265331_10000192 | 3300031250 | Bacteria | 75526 |
| 527 | Ga0265316_10016576 | 3300031344 | Bacteria | 6388 |
| 528 | Ga0265316_10030922 | 3300031344 | Bacteria | 4383 |
| 529 | Ga0265313_10005368 | 3300031595 | Bacteria | 9458 |
| 530 | Ga0265314_10058861 | 3300031711 | Bacteria | 2631 |
| 531 | Ga0265342_10000235 | 3300031712 | Bacteria | 62290 |
| 532 | Ga0307405_10190204 | 3300031731 | Bacteria | 1482 |
| 533 | Ga0307413_10056848 | 3300031824 | Bacteria | 2389 |
| 534 | Ga0307412_10072535 | 3300031911 | Bacteria | 2353 |
| 535 | Ga0307416_100066971 | 3300032002 | Bacteria | 2959 |
| 536 | Ga0307416_100318369 | 3300032002 | Bacteria | 1556 |
| 537 | Ga0307415_100006127 | 3300032126 | Bacteria | 6452 |
| 538 | Ga0316214_1007752 | 3300033545 | Bacteria | 1438 |
| 539 | Ga0316212_1000699 | 3300033547 | Bacteria | 4232 |
| 540 | Ga0373934_0018419 | 3300035086 | Bacteria | 2671 |
| 541 | Ga0373923_0001010 | 3300035111 | Bacteria | 7623 |
| 542 | Ga0373923_0019977 | 3300035111 | Bacteria | 2598 |
| 543 | Ga0373945_0010016 | 3300035116 | Bacteria | 3116 |
| 544 | Ga0373953_0017988 | 3300035117 | Bacteria | 2607 |
| 545 | Ga0373954_0004801 | 3300035118 | Bacteria | 5827 |
| 546 | Ga0373954_0016183 | 3300035118 | Bacteria | 3337 |
| 547 | Ga0373956_0000874 | 3300035119 | Bacteria | 12520 |
| 548 | Ga0373943_0001497 | 3300035170 | Bacteria | 10585 |
| 549 | Ga0373946_0001703 | 3300035171 | Bacteria | 7663 |
| 550 | Ga0373946_0052572 | 3300035171 | Bacteria | 1709 |
| 551 | Ga0373955_0002010 | 3300035172 | Bacteria | 8764 |
| 552 | Ga0373955_0028684 | 3300035172 | Bacteria | 2888 |
| 553 | Ga0373955_0152112 | 3300035172 | Unclassified | 1362 |
| 554 | Ga0373961_0011822 | 3300035241 | Bacteria | 2173 |
| 555 | Ga0373924_0007307 | 3300035410 | Bacteria | 3984 |
| 556 | Ga0373924_0030073 | 3300035410 | Bacteria | 2175 |
| 557 | Ga0373931_0035901 | 3300035691 | Bacteria | 2580 |
| 558 | Ga0373931_0192775 | 3300035691 | Bacteria | 1213 |
| 559 | Ga0373935_0006699 | 3300035692 | Bacteria | 6884 |
| 560 | Ga0373927_0002385 | 3300035695 | Bacteria | 13698 |
| 561 | Ga0373933_0000760 | 3300035724 | Bacteria | 19740 |
| 562 | Ga0373933_0127025 | 3300035724 | Bacteria | 1601 |
| 563 | Ga0373947_0004173 | 3300035725 | Bacteria | 8490 |
| 564 | Ga0373947_0005813 | 3300035725 | Bacteria | 7193 |
| 565 | Ga0373947_0010288 | 3300035725 | Bacteria | 5367 |
| 566 | Ga0373937_0000406 | 3300036401 | Bacteria | 40149 |
| 567 | Ga0373937_0027758 | 3300036401 | Bacteria | 5121 |
| 568 | Ga0373937_0065255 | 3300036401 | Bacteria | 3351 |
| 569 | Ga0373937_0096821 | 3300036401 | Bacteria | 2737 |
| 570 | Ga0373937_0191703 | 3300036401 | Bacteria | 1921 |
| 571 | Ga0373937_0196745 | 3300036401 | Bacteria | 1895 |
| 572 | Ga0373937_0466899 | 3300036401 | Bacteria | 1199 |
| 573 | Ga0373937_0470109 | 3300036401 | Bacteria | 1194 |
| 574 | Ga0373925_0002487 | 3300037068 | Bacteria | 14733 |
| 575 | Ga0373925_0039877 | 3300037068 | Bacteria | 3475 |
| 576 | Ga0373925_0212832 | 3300037068 | Bacteria | 1540 |
| 577 | Ga0242420_006411 | 3300038996 | Bacteria | 1858 |
| 578 | Ga0436365_1368512 | 3300039437 | Bacteria | 61437 |
| 579 | Ga0450923_016213 | 3300042125 | Bacteria | 1401 |
| 580 | Ga0466963_0000364 | 3300044694 | Bacteria | 20573 |
| 581 | Ga0466964_0014152 | 3300044706 | Bacteria | 3031 |
| 582 | Ga0453684_0028124 | 3300044712 | Bacteria | 8037 |
| 583 | Ga0451576_0004103 | 3300045051 | Bacteria | 19215 |
| 584 | Ga0451576_0008700 | 3300045051 | Bacteria | 11879 |
| 585 | Ga0451576_0473227 | 3300045051 | Bacteria | 1316 |
| 586 | Ga0466967_0228382 | 3300045976 | Bacteria | 1771 |
| 587 | Ga0466967_0462061 | 3300045976 | Bacteria | 1242 |
| 588 | Ga0495592_0023814 | 3300046454 | Bacteria | 4657 |
| 589 | Ga0495592_0075371 | 3300046454 | Bacteria | 2450 |
| 590 | Ga0495603_0013040 | 3300046455 | Bacteria | 5025 |
| 591 | Ga0495629_0085044 | 3300046459 | Bacteria | 2207 |
| 592 | Ga0495629_0148602 | 3300046459 | Bacteria | 1629 |
| 593 | Ga0495638_0022957 | 3300046460 | Bacteria | 4088 |
| 594 | Ga0495651_0000107 | 3300046462 | Bacteria | 61202 |
| 595 | Ga0495651_0003070 | 3300046462 | Bacteria | 12901 |
| 596 | Ga0495651_0005147 | 3300046462 | Bacteria | 9970 |
| 597 | Ga0495651_0036488 | 3300046462 | Bacteria | 3827 |
| 598 | Ga0495653_0042041 | 3300046463 | Unclassified | 3563 |
| 599 | Ga0495653_0056293 | 3300046463 | Bacteria | 2998 |
| 600 | Ga0495580_0003581 | 3300046472 | Bacteria | 13193 |
| 601 | Ga0495580_0006228 | 3300046472 | Bacteria | 9749 |
| 602 | Ga0495580_0009426 | 3300046472 | Bacteria | 7681 |
| 603 | Ga0495580_0046715 | 3300046472 | Bacteria | 3071 |
| 604 | Ga0495580_0053624 | 3300046472 | Bacteria | 2845 |
| 605 | Ga0495580_0207935 | 3300046472 | Bacteria | 1347 |
| 606 | Ga0495582_0000168 | 3300046473 | Bacteria | 35577 |
| 607 | Ga0495582_0001359 | 3300046473 | Bacteria | 13765 |
| 608 | Ga0495639_0027131 | 3300046475 | Bacteria | 2534 |
| 609 | Ga0495664_0006293 | 3300046477 | Bacteria | 6555 |
| 610 | Ga0495608_0017607 | 3300046511 | Bacteria | 4941 |
| 611 | Ga0495608_0029758 | 3300046511 | Bacteria | 3701 |
| 612 | Ga0495628_0006382 | 3300046516 | Bacteria | 10303 |
| 613 | Ga0495628_0023669 | 3300046516 | Bacteria | 5039 |
| 614 | Ga0495628_0062299 | 3300046516 | Bacteria | 2924 |
| 615 | Ga0495628_0063679 | 3300046516 | Bacteria | 2889 |
| 616 | Ga0495630_0010252 | 3300046517 | Bacteria | 6760 |
| 617 | Ga0495663_0000089 | 3300046525 | Bacteria | 40248 |
| 618 | Ga0495666_0029539 | 3300046526 | Bacteria | 2697 |
| 619 | Ga0495652_0012220 | 3300046529 | Bacteria | 7754 |
| 620 | Ga0495652_0015005 | 3300046529 | Bacteria | 6940 |
| 621 | Ga0495665_0010816 | 3300046531 | Bacteria | 4938 |
| 622 | Ga0495665_0032911 | 3300046531 | Bacteria | 2773 |
| 623 | Ga0495640_0045238 | 3300046533 | Bacteria | 3056 |
| 624 | Ga0495586_0000316 | 3300046535 | Bacteria | 30580 |
| 625 | Ga0495587_0001200 | 3300046536 | Bacteria | 17150 |
| 626 | Ga0495587_0009379 | 3300046536 | Bacteria | 6274 |
| 627 | Ga0495621_0003641 | 3300046539 | Bacteria | 4255 |
| 628 | Ga0495621_0031774 | 3300046539 | Bacteria | 1813 |
| 629 | Ga0495645_0018739 | 3300046543 | Bacteria | 4977 |
| 630 | Ga0495645_0024828 | 3300046543 | Bacteria | 4348 |
| 631 | Ga0495645_0059068 | 3300046543 | Bacteria | 2781 |
| 632 | Ga0495667_0008116 | 3300046559 | Bacteria | 7127 |
| 633 | Ga0495635_0011669 | 3300046663 | Bacteria | 6158 |
| 634 | Ga0495635_0025267 | 3300046663 | Bacteria | 4137 |
| 635 | Ga0495635_0050347 | 3300046663 | Bacteria | 2872 |
| 636 | Ga0495635_0099486 | 3300046663 | Bacteria | 1988 |
| 637 | Ga0495657_0021776 | 3300046675 | Bacteria | 4597 |
| 638 | Ga0495657_0037087 | 3300046675 | Bacteria | 3363 |
| 639 | Ga0495599_0023235 | 3300046678 | Bacteria | 3875 |
| 640 | Ga0495599_0105479 | 3300046678 | Bacteria | 1756 |
| 641 | Ga0495623_0001481 | 3300046679 | Bacteria | 15905 |
| 642 | Ga0495646_0001242 | 3300046680 | Bacteria | 14962 |
| 643 | Ga0495669_0002736 | 3300046684 | Bacteria | 7232 |
| 644 | Ga0495669_0019556 | 3300046684 | Bacteria | 2924 |
| 645 | Ga0495669_0039940 | 3300046684 | Bacteria | 2079 |
| 646 | Ga0495613_0250135 | 3300046689 | Bacteria | 1237 |
| 647 | Ga0495624_0026980 | 3300046690 | Bacteria | 3762 |
| 648 | Ga0495604_0047692 | 3300047317 | Bacteria | 3335 |
| 649 | Ga0495604_0129560 | 3300047317 | Bacteria | 1815 |
| 650 | Ga0495636_0047706 | 3300047318 | Bacteria | 1789 |
| 651 | Ga0495674_0004479 | 3300047319 | Bacteria | 13444 |
| 652 | Ga0495680_0001862 | 3300047322 | Bacteria | 22190 |
| 653 | Ga0495680_0164540 | 3300047322 | Bacteria | 1609 |
| 654 | Ga0495675_0000727 | 3300047444 | Bacteria | 20561 |
| 655 | Ga0495675_0027051 | 3300047444 | Bacteria | 3656 |
| 656 | Ga0495675_0033678 | 3300047444 | Bacteria | 3270 |
| 657 | Ga0495684_0004395 | 3300047471 | Bacteria | 11012 |
| 658 | Ga0495684_0009878 | 3300047471 | Bacteria | 7365 |
| 659 | Ga0495684_0026956 | 3300047471 | Bacteria | 4415 |
| 660 | Ga0495684_0073814 | 3300047471 | Unclassified | 2592 |
| 661 | Ga0495684_0243385 | 3300047471 | Bacteria | 1311 |
| 662 | Ga0495593_0007392 | 3300047673 | Bacteria | 6434 |
| 663 | Ga0495602_0038095 | 3300048088 | Bacteria | 4451 |
| 664 | Ga0495602_0084610 | 3300048088 | Unclassified | 2653 |
| 665 | Ga0495602_0118169 | 3300048088 | Bacteria | 2139 |
| 666 | Ga0496100_0056865 | 3300048903 | Bacteria | 2560 |
| 667 | Ga0496100_0058856 | 3300048903 | Bacteria | 2523 |
| 668 | Ga0496101_0007379 | 3300048904 | Bacteria | 7121 |
| 669 | Ga0496102_0005869 | 3300048905 | Bacteria | 10453 |
| 670 | Ga0496102_0098832 | 3300048905 | Bacteria | 2708 |
| 671 | Ga0496102_0162209 | 3300048905 | Bacteria | 2103 |
| 672 | Ga0496103_0004547 | 3300048906 | Bacteria | 8397 |
| 673 | Ga0496103_0034632 | 3300048906 | Bacteria | 3089 |
| 674 | Ga0496104_0004711 | 3300048907 | Bacteria | 11872 |
| 675 | Ga0496104_0053828 | 3300048907 | Bacteria | 3804 |
| 676 | Ga0496104_0053981 | 3300048907 | Bacteria | 3798 |
| 677 | Ga0496104_0180005 | 3300048907 | Bacteria | 2024 |
| 678 | Ga0496106_0057871 | 3300048909 | Bacteria | 2932 |
| 679 | Ga0496106_0098670 | 3300048909 | Bacteria | 2263 |
| 680 | Ga0496106_0121867 | 3300048909 | Bacteria | 2039 |
| 681 | Ga0496108_0082418 | 3300048911 | Bacteria | 2728 |
| 682 | Ga0496108_0125412 | 3300048911 | Bacteria | 2204 |
| 683 | Ga0496109_0020643 | 3300048912 | Bacteria | 5820 |
| 684 | Ga0496109_0138775 | 3300048912 | Bacteria | 2273 |
| 685 | Ga0496112_0013152 | 3300048915 | Bacteria | 7637 |
| 686 | Ga0496112_0057191 | 3300048915 | Bacteria | 3839 |
| 687 | Ga0496112_0120693 | 3300048915 | Bacteria | 2591 |
| 688 | Ga0496112_0230891 | 3300048915 | Bacteria | 1805 |
| 689 | Ga0496113_0152455 | 3300048916 | Bacteria | 1824 |
| 690 | Ga0496114_0003782 | 3300048917 | Bacteria | 11668 |
| 691 | Ga0496114_0027200 | 3300048917 | Bacteria | 4683 |
| 692 | Ga0496114_0243507 | 3300048917 | Bacteria | 1582 |
| 693 | Ga0496115_0026815 | 3300048918 | Bacteria | 4501 |
| 694 | Ga0496115_0033010 | 3300048918 | Bacteria | 4085 |
| 695 | Ga0496115_0057523 | 3300048918 | Bacteria | 3128 |
| 696 | Ga0496115_0102854 | 3300048918 | Bacteria | 2343 |
| 697 | Ga0501296_001050 | 3300049519 | Bacteria | 2765 |
| 698 | Ga0501298_010004 | 3300049521 | Bacteria | 1623 |
| 699 | Ga0501036_0073969 | 3300049572 | Bacteria | 2881 |
| 700 | Ga0501046_0131054 | 3300049580 | Bacteria | 1902 |
| 701 | Ga0501048_0084020 | 3300049582 | Bacteria | 2245 |
| 702 | Ga0501071_0097492 | 3300049587 | Bacteria | 2165 |
| 703 | Ga0501072_0017449 | 3300049588 | Bacteria | 5515 |
| 704 | Ga0501225_0033560 | 3300049705 | Bacteria | 1412 |
| 705 | Ga0501079_0259609 | 3300049741 | Bacteria | 1358 |
| 706 | Ga0501081_0065204 | 3300049743 | Bacteria | 2531 |
| 707 | Ga0501283_000784 | 3300049779 | Bacteria | 4176 |
| 708 | Ga0501045_0068738 | 3300049824 | Bacteria | 2603 |
| 709 | Ga0501212_000726 | 3300049851 | Bacteria | 3364 |
| 710 | nmdc:mga05p37_149016_c1 | 3300050507 | Bacteria | 2863 |
| 711 | nmdc:mga05p37_539405_c1 | 3300050507 | Bacteria | 1330 |
| 712 | nmdc:mga05p37_78689_c1 | 3300050507 | Bacteria | 4060 |
| 713 | nmdc:mga09592_8475_c1 | 3300050508 | Bacteria | 8361 |
| 714 | nmdc:mga0qj67_4138_c1 | 3300050509 | Bacteria | 10516 |
| 715 | nmdc:mga06r32_198923_c1 | 3300050510 | Bacteria | 1992 |
| 716 | nmdc:mga06r32_31879_c1 | 3300050510 | Bacteria | 4954 |
| 717 | nmdc:mga06r32_329514_c1 | 3300050510 | Bacteria | 1512 |
| 718 | nmdc:mga08y16_198267_c1 | 3300050511 | Bacteria | 2081 |
| 719 | nmdc:mga08y16_261106_c1 | 3300050511 | Bacteria | 1789 |
| 720 | nmdc:mga08y16_261556_c1 | 3300050511 | Bacteria | 1787 |
| 721 | nmdc:mga08y16_3295_c1 | 3300050511 | Bacteria | 16725 |
| 722 | nmdc:mga08y16_73643_c1 | 3300050511 | Bacteria | 3559 |
| 723 | nmdc:mga08y16_74624_c1 | 3300050511 | Bacteria | 3535 |
| 724 | nmdc:mga0n895_14256_c1 | 3300050512 | Bacteria | 7212 |
| 725 | nmdc:mga0n895_15388_c1 | 3300050512 | Bacteria | 6972 |
| 726 | nmdc:mga0n895_82942_c1 | 3300050512 | Bacteria | 3196 |
| 727 | nmdc:mga0rr50_10664_c1 | 3300050513 | Bacteria | 5846 |
| 728 | nmdc:mga0rr50_22361_c1 | 3300050513 | Bacteria | 4338 |
| 729 | nmdc:mga0rr50_34658_c1 | 3300050513 | Bacteria | 3617 |
| 730 | nmdc:mga0rr50_77726_c1 | 3300050513 | Bacteria | 2551 |
| 731 | nmdc:mga08x19_3455_c1 | 3300050514 | Bacteria | 9421 |
| 732 | nmdc:mga08x19_78457_c1 | 3300050514 | Bacteria | 2164 |
| 733 | nmdc:mga08x19_8699_c1 | 3300050514 | Bacteria | 6054 |
| 734 | nmdc:mga0a205_252100_c1 | 3300050515 | Bacteria | 1644 |
| 735 | nmdc:mga0a205_59326_c1 | 3300050515 | Bacteria | 3696 |
| 736 | nmdc:mga0a205_72084_c1 | 3300050515 | Bacteria | 3336 |
| 737 | Ga0495601_0002978 | 3300053077 | Bacteria | 9642 |
| 738 | Ga0495601_0168311 | 3300053077 | Bacteria | 1432 |
| 739 | Ga0495601_0197035 | 3300053077 | Bacteria | 1317 |
| 740 | Ga0495612_0003712 | 3300053078 | Bacteria | 6339 |
| 741 | Ga0500641_0001491 | 3300053096 | Bacteria | 8354 |
| 742 | Ga0530510_0006569 | 3300061734 | Bacteria | 8105 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10098747 | Ga0070681_100987472 | 350 |
| 2 | 3300005614 | Ga0068856_100094547 | Ga0068856_1000945473 | 350 |
| 3 | 3300013297 | Ga0157378_10066479 | Ga0157378_100664792 | 350 |
| 4 | 3300013307 | Ga0157372_10209934 | Ga0157372_102099341 | 350 |
| 5 | 3300005445 | Ga0070708_100127313 | Ga0070708_1001273132 | 351 |
| 6 | 3300044706 | Ga0466964_0014152 | Ga0466964_0014152_216_1343 | 353 |
| 7 | 3300006846 | Ga0075430_100070828 | Ga0075430_1000708281 | 354 |
| 8 | 3300006880 | Ga0075429_100011898 | Ga0075429_1000118982 | 354 |
| 9 | 3300031911 | Ga0307412_10072535 | Ga0307412_100725351 | 354 |
| 10 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_100000267 | 357 |
| 11 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004306 | 357 |
| 12 | 3300005355 | Ga0070671_100035239 | Ga0070671_1000352394 | 357 |
| 13 | 3300005842 | Ga0068858_100006042 | Ga0068858_1000060424 | 357 |
| 14 | 3300009101 | Ga0105247_10000005 | Ga0105247_10000005296 | 357 |
| 15 | 3300025223 | Ga0207672_1001357 | Ga0207672_10013572 | 357 |
| 16 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004295 | 357 |
| 17 | 3300025931 | Ga0207644_10000309 | Ga0207644_1000030920 | 357 |
| 18 | 3300026035 | Ga0207703_10000486 | Ga0207703_1000048612 | 357 |
| 19 | 3300046684 | Ga0495669_0039940 | Ga0495669_0039940_533_1609 | 357 |
| 20 | 3300050510 | nmdc:mga06r32_31879_c1 | nmdc:mga06r32_31879_c1_3167_4246 | 358 |
| 21 | 3300050511 | nmdc:mga08y16_73643_c1 | nmdc:mga08y16_73643_c1_1657_2736 | 358 |
| 22 | 3300003203 | JGI25406J46586_10015284 | JGI25406J46586_100152841 | 359 |
| 23 | 3300005293 | Ga0065715_10090735 | Ga0065715_100907353 | 359 |
| 24 | 3300005438 | Ga0070701_10034925 | Ga0070701_100349253 | 359 |
| 25 | 3300005457 | Ga0070662_100118836 | Ga0070662_1001188362 | 359 |
| 26 | 3300005518 | Ga0070699_100124573 | Ga0070699_1001245732 | 359 |
| 27 | 3300005549 | Ga0070704_100063279 | Ga0070704_1000632792 | 359 |
| 28 | 3300005719 | Ga0068861_100341739 | Ga0068861_1003417391 | 359 |
| 29 | 3300006881 | Ga0068865_100067757 | Ga0068865_1000677573 | 359 |
| 30 | 3300009094 | Ga0111539_10490547 | Ga0111539_104905472 | 359 |
| 31 | 3300017792 | Ga0163161_10051059 | Ga0163161_100510593 | 359 |
| 32 | 3300026118 | Ga0207675_100065785 | Ga0207675_1000657854 | 359 |
| 33 | 3300005353 | Ga0070669_100005910 | Ga0070669_1000059108 | 360 |
| 34 | 3300005441 | Ga0070700_100022151 | Ga0070700_1000221513 | 360 |
| 35 | 3300005468 | Ga0070707_100050511 | Ga0070707_1000505112 | 360 |
| 36 | 3300005536 | Ga0070697_100083795 | Ga0070697_1000837952 | 360 |
| 37 | 3300005844 | Ga0068862_100007997 | Ga0068862_1000079974 | 360 |
| 38 | 3300009094 | Ga0111539_10200833 | Ga0111539_102008333 | 360 |
| 39 | 3300013308 | Ga0157375_10247944 | Ga0157375_102479442 | 360 |
| 40 | 3300025910 | Ga0207684_10010195 | Ga0207684_100101956 | 360 |
| 41 | 3300025922 | Ga0207646_10009318 | Ga0207646_100093186 | 360 |
| 42 | 3300026075 | Ga0207708_10001072 | Ga0207708_1000107212 | 360 |
| 43 | 3300028380 | Ga0268265_10011259 | Ga0268265_100112595 | 360 |
| 44 | 3300042125 | Ga0450923_016213 | Ga0450923_016213_17_1132 | 360 |
| 45 | 3300046684 | Ga0495669_0019556 | Ga0495669_0019556_1081_2295 | 360 |
| 46 | 3300036401 | Ga0373937_0470109 | Ga0373937_0470109_39_1127 | 361 |
| 47 | 3300045051 | Ga0451576_0473227 | Ga0451576_0473227_19_1182 | 361 |
| 48 | 3300049572 | Ga0501036_0073969 | Ga0501036_0073969_20_1117 | 361 |
| 49 | 3300053096 | Ga0500641_0001491 | Ga0500641_0001491_5475_6563 | 361 |
| 50 | 3300005355 | Ga0070671_100003105 | Ga0070671_10000310510 | 362 |
| 51 | 3300025931 | Ga0207644_10004053 | Ga0207644_100040532 | 362 |
| 52 | 3300003203 | JGI25406J46586_10027247 | JGI25406J46586_100272472 | 363 |
| 53 | 3300005468 | Ga0070707_100158710 | Ga0070707_1001587102 | 363 |
| 54 | 3300005617 | Ga0068859_100162882 | Ga0068859_1001628822 | 363 |
| 55 | 3300005985 | Ga0081539_10000049 | Ga0081539_1000004949 | 363 |
| 56 | 3300006844 | Ga0075428_100334128 | Ga0075428_1003341282 | 363 |
| 57 | 3300006931 | Ga0097620_100162867 | Ga0097620_1001628672 | 363 |
| 58 | 3300009094 | Ga0111539_10079237 | Ga0111539_100792372 | 363 |
| 59 | 3300013306 | Ga0163162_10046839 | Ga0163162_100468393 | 363 |
| 60 | 3300025910 | Ga0207684_10023266 | Ga0207684_100232665 | 363 |
| 61 | 3300028381 | Ga0268264_10093365 | Ga0268264_100933651 | 363 |
| 62 | 3300005834 | Ga0068851_10001653 | Ga0068851_100016539 | 364 |
| 63 | 3300009147 | Ga0114129_10298077 | Ga0114129_102980772 | 364 |
| 64 | 3300024225 | Ga0224572_1009425 | Ga0224572_10094252 | 364 |
| 65 | 3300046472 | Ga0495580_0053624 | Ga0495580_0053624_1065_2195 | 364 |
| 66 | 3300024227 | Ga0228598_1004923 | Ga0228598_10049232 | 365 |
| 67 | 3300028017 | Ga0265356_1000057 | Ga0265356_100005713 | 365 |
| 68 | 3300030760 | Ga0265762_1000184 | Ga0265762_10001844 | 365 |
| 69 | 3300031090 | Ga0265760_10006664 | Ga0265760_100066643 | 365 |
| 70 | 3300005536 | Ga0070697_100000128 | Ga0070697_10000012820 | 366 |
| 71 | 3300005546 | Ga0070696_100092362 | Ga0070696_1000923622 | 366 |
| 72 | 3300005842 | Ga0068858_100333205 | Ga0068858_1003332052 | 366 |
| 73 | 3300006914 | Ga0075436_100040223 | Ga0075436_1000402233 | 366 |
| 74 | 3300009093 | Ga0105240_10058596 | Ga0105240_100585961 | 366 |
| 75 | 3300046539 | Ga0495621_0031774 | Ga0495621_0031774_666_1766 | 366 |
| 76 | 3300050514 | nmdc:mga08x19_3455_c1 | nmdc:mga08x19_3455_c1_6476_7714 | 366 |
| 77 | 3300005289 | Ga0065704_10110498 | Ga0065704_101104982 | 367 |
| 78 | 3300005295 | Ga0065707_10014710 | Ga0065707_100147102 | 367 |
| 79 | 3300005345 | Ga0070692_10045858 | Ga0070692_100458583 | 367 |
| 80 | 3300005539 | Ga0068853_100018006 | Ga0068853_1000180064 | 367 |
| 81 | 3300005615 | Ga0070702_100013158 | Ga0070702_1000131581 | 367 |
| 82 | 3300009094 | Ga0111539_10000723 | Ga0111539_1000072324 | 367 |
| 83 | 3300009148 | Ga0105243_10060152 | Ga0105243_100601522 | 367 |
| 84 | 3300009177 | Ga0105248_10007190 | Ga0105248_1000719012 | 367 |
| 85 | 3300009553 | Ga0105249_10413357 | Ga0105249_104133571 | 367 |
| 86 | 3300025908 | Ga0207643_10002710 | Ga0207643_100027102 | 367 |
| 87 | 3300025910 | Ga0207684_10024388 | Ga0207684_100243886 | 367 |
| 88 | 3300025936 | Ga0207670_10002918 | Ga0207670_100029187 | 367 |
| 89 | 3300025942 | Ga0207689_10003754 | Ga0207689_1000375411 | 367 |
| 90 | 3300050511 | nmdc:mga08y16_74624_c1 | nmdc:mga08y16_74624_c1_1157_2371 | 367 |
| 91 | 3300050512 | nmdc:mga0n895_15388_c1 | nmdc:mga0n895_15388_c1_1623_2816 | 367 |
| 92 | 3300050515 | nmdc:mga0a205_59326_c1 | nmdc:mga0a205_59326_c1_124_1338 | 367 |
| 93 | 3300005518 | Ga0070699_100022524 | Ga0070699_1000225243 | 368 |
| 94 | 3300005563 | Ga0068855_100141131 | Ga0068855_1001411312 | 368 |
| 95 | 3300005577 | Ga0068857_100045026 | Ga0068857_1000450263 | 368 |
| 96 | 3300005616 | Ga0068852_100193734 | Ga0068852_1001937342 | 368 |
| 97 | 3300005719 | Ga0068861_100095098 | Ga0068861_1000950981 | 368 |
| 98 | 3300005841 | Ga0068863_100060976 | Ga0068863_1000609762 | 368 |
| 99 | 3300009101 | Ga0105247_10107476 | Ga0105247_101074762 | 368 |
| 100 | 3300009148 | Ga0105243_10058282 | Ga0105243_100582823 | 368 |
| 101 | 3300009545 | Ga0105237_10240407 | Ga0105237_102404072 | 368 |
| 102 | 3300010375 | Ga0105239_10183775 | Ga0105239_101837752 | 368 |
| 103 | 3300014326 | Ga0157380_10001107 | Ga0157380_100011076 | 368 |
| 104 | 3300014497 | Ga0182008_10055340 | Ga0182008_100553401 | 368 |
| 105 | 3300025900 | Ga0207710_10001622 | Ga0207710_1000162211 | 368 |
| 106 | 3300025919 | Ga0207657_10006780 | Ga0207657_1000678010 | 368 |
| 107 | 3300025931 | Ga0207644_10166709 | Ga0207644_101667091 | 368 |
| 108 | 3300025933 | Ga0207706_10007827 | Ga0207706_100078279 | 368 |
| 109 | 3300025933 | Ga0207706_10030994 | Ga0207706_100309942 | 368 |
| 110 | 3300025944 | Ga0207661_10346412 | Ga0207661_103464121 | 368 |
| 111 | 3300026095 | Ga0207676_10156973 | Ga0207676_101569732 | 368 |
| 112 | 3300048907 | Ga0496104_0053981 | Ga0496104_0053981_2228_3376 | 368 |
| 113 | 3300048911 | Ga0496108_0125412 | Ga0496108_0125412_777_1925 | 368 |
| 114 | 3300048916 | Ga0496113_0152455 | Ga0496113_0152455_240_1388 | 368 |
| 115 | 3300006028 | Ga0070717_10020698 | Ga0070717_100206984 | 369 |
| 116 | 3300009176 | Ga0105242_10020815 | Ga0105242_100208153 | 369 |
| 117 | 3300013307 | Ga0157372_10000993 | Ga0157372_1000099321 | 369 |
| 118 | 3300026078 | Ga0207702_10000536 | Ga0207702_1000053621 | 369 |
| 119 | 3300046472 | Ga0495580_0207935 | Ga0495580_0207935_45_1190 | 369 |
| 120 | 3300005546 | Ga0070696_100010498 | Ga0070696_1000104985 | 370 |
| 121 | 3300007265 | Ga0099794_10069221 | Ga0099794_100692211 | 370 |
| 122 | 3300009094 | Ga0111539_10007470 | Ga0111539_1000747011 | 370 |
| 123 | 3300009148 | Ga0105243_10043760 | Ga0105243_100437603 | 370 |
| 124 | 3300028381 | Ga0268264_10249039 | Ga0268264_102490392 | 370 |
| 125 | 3300046678 | Ga0495599_0105479 | Ga0495599_0105479_260_1411 | 370 |
| 126 | 3300048915 | Ga0496112_0120693 | Ga0496112_0120693_507_1700 | 370 |
| 127 | 3300048918 | Ga0496115_0026815 | Ga0496115_0026815_2701_3819 | 370 |
| 128 | 3300049519 | Ga0501296_001050 | Ga0501296_001050_1431_2642 | 370 |
| 129 | 3300049705 | Ga0501225_0033560 | Ga0501225_0033560_170_1381 | 370 |
| 130 | 3300049779 | Ga0501283_000784 | Ga0501283_000784_2786_3997 | 370 |
| 131 | 3300049851 | Ga0501212_000726 | Ga0501212_000726_59_1270 | 370 |
| 132 | 3300050511 | nmdc:mga08y16_261106_c1 | nmdc:mga08y16_261106_c1_144_1256 | 370 |
| 133 | 3300050512 | nmdc:mga0n895_82942_c1 | nmdc:mga0n895_82942_c1_1901_3013 | 370 |
| 134 | 3300005535 | Ga0070684_100158318 | Ga0070684_1001583182 | 371 |
| 135 | 3300005577 | Ga0068857_100304891 | Ga0068857_1003048912 | 371 |
| 136 | 3300005844 | Ga0068862_100233872 | Ga0068862_1002338722 | 371 |
| 137 | 3300009176 | Ga0105242_10122073 | Ga0105242_101220732 | 371 |
| 138 | 3300009177 | Ga0105248_10253045 | Ga0105248_102530452 | 371 |
| 139 | 3300014325 | Ga0163163_10086260 | Ga0163163_100862603 | 371 |
| 140 | 3300025941 | Ga0207711_10231404 | Ga0207711_102314042 | 371 |
| 141 | 3300025944 | Ga0207661_10117444 | Ga0207661_101174442 | 371 |
| 142 | 3300036401 | Ga0373937_0466899 | Ga0373937_0466899_17_1150 | 371 |
| 143 | 3300048912 | Ga0496109_0020643 | Ga0496109_0020643_3460_4653 | 371 |
| 144 | 3300005335 | Ga0070666_10049576 | Ga0070666_100495763 | 372 |
| 145 | 3300005338 | Ga0068868_100006836 | Ga0068868_1000068363 | 372 |
| 146 | 3300005459 | Ga0068867_100113581 | Ga0068867_1001135812 | 372 |
| 147 | 3300005518 | Ga0070699_100019382 | Ga0070699_1000193822 | 372 |
| 148 | 3300005578 | Ga0068854_100033249 | Ga0068854_1000332493 | 372 |
| 149 | 3300005718 | Ga0068866_10044082 | Ga0068866_100440821 | 372 |
| 150 | 3300005842 | Ga0068858_100015108 | Ga0068858_1000151083 | 372 |
| 151 | 3300006028 | Ga0070717_10189375 | Ga0070717_101893752 | 372 |
| 152 | 3300006358 | Ga0068871_100003050 | Ga0068871_1000030502 | 372 |
| 153 | 3300009177 | Ga0105248_10010549 | Ga0105248_100105496 | 372 |
| 154 | 3300010375 | Ga0105239_10108847 | Ga0105239_101088471 | 372 |
| 155 | 3300013297 | Ga0157378_10000023 | Ga0157378_1000002353 | 372 |
| 156 | 3300013306 | Ga0163162_10325554 | Ga0163162_103255542 | 372 |
| 157 | 3300025981 | Ga0207640_10043304 | Ga0207640_100433042 | 372 |
| 158 | 3300026023 | Ga0207677_10007639 | Ga0207677_100076395 | 372 |
| 159 | 3300026035 | Ga0207703_10020633 | Ga0207703_100206332 | 372 |
| 160 | 3300028381 | Ga0268264_10056067 | Ga0268264_100560673 | 372 |
| 161 | 3300031090 | Ga0265760_10008231 | Ga0265760_100082312 | 372 |
| 162 | 3300045976 | Ga0466967_0228382 | Ga0466967_0228382_339_1568 | 372 |
| 163 | 3300005440 | Ga0070705_100186829 | Ga0070705_1001868291 | 373 |
| 164 | 3300005441 | Ga0070700_100000116 | Ga0070700_10000011619 | 373 |
| 165 | 3300005546 | Ga0070696_100014326 | Ga0070696_1000143263 | 373 |
| 166 | 3300006914 | Ga0075436_100000519 | Ga0075436_10000051924 | 373 |
| 167 | 3300009174 | Ga0105241_10024038 | Ga0105241_100240383 | 373 |
| 168 | 3300009551 | Ga0105238_10070197 | Ga0105238_100701971 | 373 |
| 169 | 3300013296 | Ga0157374_10164963 | Ga0157374_101649632 | 373 |
| 170 | 3300025898 | Ga0207692_10019836 | Ga0207692_100198362 | 373 |
| 171 | 3300026075 | Ga0207708_10000486 | Ga0207708_1000048610 | 373 |
| 172 | 3300031824 | Ga0307413_10056848 | Ga0307413_100568483 | 373 |
| 173 | 3300032002 | Ga0307416_100066971 | Ga0307416_1000669712 | 373 |
| 174 | 3300032126 | Ga0307415_100006127 | Ga0307415_1000061277 | 373 |
| 175 | 3300035725 | Ga0373947_0010288 | Ga0373947_0010288_2375_3670 | 373 |
| 176 | 3300037068 | Ga0373925_0002487 | Ga0373925_0002487_12131_13426 | 373 |
| 177 | 3300046472 | Ga0495580_0003581 | Ga0495580_0003581_7500_8795 | 373 |
| 178 | 3300046473 | Ga0495582_0001359 | Ga0495582_0001359_5557_6852 | 373 |
| 179 | 3300046475 | Ga0495639_0027131 | Ga0495639_0027131_836_2131 | 373 |
| 180 | 3300046531 | Ga0495665_0010816 | Ga0495665_0010816_2757_4052 | 373 |
| 181 | 3300050514 | nmdc:mga08x19_8699_c1 | nmdc:mga08x19_8699_c1_2517_3812 | 373 |
| 182 | 3300005445 | Ga0070708_100020824 | Ga0070708_1000208243 | 374 |
| 183 | 3300005563 | Ga0068855_100139705 | Ga0068855_1001397053 | 374 |
| 184 | 3300025922 | Ga0207646_10144560 | Ga0207646_101445602 | 374 |
| 185 | 3300035172 | Ga0373955_0152112 | Ga0373955_0152112_17_1144 | 374 |
| 186 | 3300036401 | Ga0373937_0191703 | Ga0373937_0191703_107_1315 | 374 |
| 187 | 3300046525 | Ga0495663_0000089 | Ga0495663_0000089_25795_26991 | 374 |
| 188 | 3300005337 | Ga0070682_100000056 | Ga0070682_10000005680 | 375 |
| 189 | 3300009093 | Ga0105240_10137583 | Ga0105240_101375832 | 375 |
| 190 | 3300025913 | Ga0207695_10136417 | Ga0207695_101364172 | 375 |
| 191 | 3300036401 | Ga0373937_0065255 | Ga0373937_0065255_1721_2908 | 375 |
| 192 | 3300037068 | Ga0373925_0212832 | Ga0373925_0212832_44_1204 | 375 |
| 193 | 3300046663 | Ga0495635_0050347 | Ga0495635_0050347_456_1643 | 375 |
| 194 | 3300049582 | Ga0501048_0084020 | Ga0501048_0084020_945_2105 | 375 |
| 195 | 3300005290 | Ga0065712_10000112 | Ga0065712_10000112234 | 376 |
| 196 | 3300005347 | Ga0070668_100028991 | Ga0070668_1000289914 | 376 |
| 197 | 3300005354 | Ga0070675_100026566 | Ga0070675_1000265661 | 376 |
| 198 | 3300007076 | Ga0075435_100013117 | Ga0075435_1000131172 | 376 |
| 199 | 3300025926 | Ga0207659_10027312 | Ga0207659_100273122 | 376 |
| 200 | 3300025940 | Ga0207691_10150742 | Ga0207691_101507421 | 376 |
| 201 | 3300025961 | Ga0207712_10134154 | Ga0207712_101341542 | 376 |
| 202 | 3300026118 | Ga0207675_100056030 | Ga0207675_1000560303 | 376 |
| 203 | 3300046460 | Ga0495638_0022957 | Ga0495638_0022957_797_1966 | 376 |
| 204 | 3300046516 | Ga0495628_0062299 | Ga0495628_0062299_208_1416 | 376 |
| 205 | 3300046516 | Ga0495628_0063679 | Ga0495628_0063679_1595_2728 | 376 |
| 206 | 3300047322 | Ga0495680_0164540 | Ga0495680_0164540_222_1430 | 376 |
| 207 | 3300048909 | Ga0496106_0121867 | Ga0496106_0121867_357_1568 | 376 |
| 208 | 3300050507 | nmdc:mga05p37_539405_c1 | nmdc:mga05p37_539405_c1_20_1231 | 376 |
| 209 | 3300053077 | Ga0495601_0168311 | Ga0495601_0168311_185_1393 | 376 |
| 210 | 3300005617 | Ga0068859_100068765 | Ga0068859_1000687652 | 377 |
| 211 | 3300006173 | Ga0070716_100000496 | Ga0070716_1000004968 | 377 |
| 212 | 3300006931 | Ga0097620_100068764 | Ga0097620_1000687642 | 377 |
| 213 | 3300009174 | Ga0105241_10018088 | Ga0105241_100180884 | 377 |
| 214 | 3300013297 | Ga0157378_10063377 | Ga0157378_100633772 | 377 |
| 215 | 3300014326 | Ga0157380_10001374 | Ga0157380_100013746 | 377 |
| 216 | 3300014326 | Ga0157380_10036588 | Ga0157380_100365882 | 377 |
| 217 | 3300014968 | Ga0157379_10005147 | Ga0157379_100051475 | 377 |
| 218 | 3300025906 | Ga0207699_10154670 | Ga0207699_101546701 | 377 |
| 219 | 3300027671 | Ga0209588_1003900 | Ga0209588_10039002 | 377 |
| 220 | 3300027907 | Ga0207428_10003104 | Ga0207428_100031044 | 377 |
| 221 | 3300028380 | Ga0268265_10034627 | Ga0268265_100346272 | 377 |
| 222 | 3300028381 | Ga0268264_10191007 | Ga0268264_101910072 | 377 |
| 223 | 3300035691 | Ga0373931_0192775 | Ga0373931_0192775_28_1161 | 377 |
| 224 | 3300048903 | Ga0496100_0058856 | Ga0496100_0058856_519_1652 | 377 |
| 225 | 3300048905 | Ga0496102_0005869 | Ga0496102_0005869_7470_8603 | 377 |
| 226 | 3300048906 | Ga0496103_0004547 | Ga0496103_0004547_4919_6052 | 377 |
| 227 | 3300048907 | Ga0496104_0004711 | Ga0496104_0004711_7675_8808 | 377 |
| 228 | 3300048909 | Ga0496106_0098670 | Ga0496106_0098670_385_1518 | 377 |
| 229 | 3300048911 | Ga0496108_0082418 | Ga0496108_0082418_940_2127 | 377 |
| 230 | 3300048915 | Ga0496112_0013152 | Ga0496112_0013152_1686_2873 | 377 |
| 231 | 3300050513 | nmdc:mga0rr50_22361_c1 | nmdc:mga0rr50_22361_c1_1062_2234 | 377 |
| 232 | 3300005445 | Ga0070708_100003856 | Ga0070708_10000385611 | 378 |
| 233 | 3300005467 | Ga0070706_100008068 | Ga0070706_1000080687 | 378 |
| 234 | 3300005468 | Ga0070707_100007569 | Ga0070707_1000075693 | 378 |
| 235 | 3300005471 | Ga0070698_100008240 | Ga0070698_1000082401 | 378 |
| 236 | 3300005518 | Ga0070699_100000852 | Ga0070699_10000085224 | 378 |
| 237 | 3300005518 | Ga0070699_100128010 | Ga0070699_1001280102 | 378 |
| 238 | 3300006847 | Ga0075431_100139238 | Ga0075431_1001392383 | 378 |
| 239 | 3300006914 | Ga0075436_100092902 | Ga0075436_1000929021 | 378 |
| 240 | 3300007788 | Ga0099795_10023667 | Ga0099795_100236672 | 378 |
| 241 | 3300025910 | Ga0207684_10000921 | Ga0207684_1000092110 | 378 |
| 242 | 3300025922 | Ga0207646_10008388 | Ga0207646_100083888 | 378 |
| 243 | 3300027907 | Ga0207428_10010799 | Ga0207428_100107999 | 378 |
| 244 | 3300046455 | Ga0495603_0013040 | Ga0495603_0013040_1209_2375 | 378 |
| 245 | 3300046472 | Ga0495580_0009426 | Ga0495580_0009426_3815_4981 | 378 |
| 246 | 3300046472 | Ga0495580_0046715 | Ga0495580_0046715_1751_2938 | 378 |
| 247 | 3300046473 | Ga0495582_0000168 | Ga0495582_0000168_1784_2950 | 378 |
| 248 | 3300046689 | Ga0495613_0250135 | Ga0495613_0250135_32_1198 | 378 |
| 249 | 3300048905 | Ga0496102_0162209 | Ga0496102_0162209_646_1881 | 378 |
| 250 | 3300050510 | nmdc:mga06r32_329514_c1 | nmdc:mga06r32_329514_c1_265_1437 | 378 |
| 251 | 3300050511 | nmdc:mga08y16_3295_c1 | nmdc:mga08y16_3295_c1_5238_6413 | 378 |
| 252 | 3300002459 | JGI24751J29686_10000396 | JGI24751J29686_100003962 | 379 |
| 253 | 3300005331 | Ga0070670_100031878 | Ga0070670_1000318782 | 379 |
| 254 | 3300005436 | Ga0070713_100000926 | Ga0070713_1000009269 | 379 |
| 255 | 3300005438 | Ga0070701_10040709 | Ga0070701_100407093 | 379 |
| 256 | 3300005440 | Ga0070705_100035200 | Ga0070705_1000352001 | 379 |
| 257 | 3300005441 | Ga0070700_100000765 | Ga0070700_10000076511 | 379 |
| 258 | 3300005459 | Ga0068867_100077006 | Ga0068867_1000770063 | 379 |
| 259 | 3300005719 | Ga0068861_100140512 | Ga0068861_1001405122 | 379 |
| 260 | 3300005843 | Ga0068860_100084310 | Ga0068860_1000843102 | 379 |
| 261 | 3300006931 | Ga0097620_100095757 | Ga0097620_1000957572 | 379 |
| 262 | 3300007265 | Ga0099794_10069974 | Ga0099794_100699742 | 379 |
| 263 | 3300009148 | Ga0105243_10015978 | Ga0105243_100159784 | 379 |
| 264 | 3300009148 | Ga0105243_10114499 | Ga0105243_101144993 | 379 |
| 265 | 3300009176 | Ga0105242_10112334 | Ga0105242_101123343 | 379 |
| 266 | 3300009177 | Ga0105248_10247660 | Ga0105248_102476601 | 379 |
| 267 | 3300013306 | Ga0163162_10294606 | Ga0163162_102946061 | 379 |
| 268 | 3300014325 | Ga0163163_10001149 | Ga0163163_1000114916 | 379 |
| 269 | 3300025924 | Ga0207694_10001733 | Ga0207694_100017334 | 379 |
| 270 | 3300025925 | Ga0207650_10000001 | Ga0207650_100000011220 | 379 |
| 271 | 3300025928 | Ga0207700_10002026 | Ga0207700_1000202610 | 379 |
| 272 | 3300025961 | Ga0207712_10129419 | Ga0207712_101294192 | 379 |
| 273 | 3300026075 | Ga0207708_10129778 | Ga0207708_101297782 | 379 |
| 274 | 3300026089 | Ga0207648_10011682 | Ga0207648_100116824 | 379 |
| 275 | 3300026118 | Ga0207675_100005094 | Ga0207675_1000050945 | 379 |
| 276 | 3300026118 | Ga0207675_100208974 | Ga0207675_1002089741 | 379 |
| 277 | 3300026121 | Ga0207683_10008581 | Ga0207683_100085817 | 379 |
| 278 | 3300047471 | Ga0495684_0073814 | Ga0495684_0073814_226_1422 | 379 |
| 279 | 3300005336 | Ga0070680_100005685 | Ga0070680_1000056859 | 380 |
| 280 | 3300005458 | Ga0070681_10000011 | Ga0070681_10000011102 | 380 |
| 281 | 3300005530 | Ga0070679_100000082 | Ga0070679_10000008222 | 380 |
| 282 | 3300013306 | Ga0163162_10120797 | Ga0163162_101207972 | 380 |
| 283 | 3300014325 | Ga0163163_10085251 | Ga0163163_100852512 | 380 |
| 284 | 3300025912 | Ga0207707_10000037 | Ga0207707_100000373 | 380 |
| 285 | 3300025917 | Ga0207660_10003334 | Ga0207660_100033342 | 380 |
| 286 | 3300025921 | Ga0207652_10000104 | Ga0207652_1000010422 | 380 |
| 287 | 3300032002 | Ga0307416_100318369 | Ga0307416_1003183693 | 380 |
| 288 | 3300033545 | Ga0316214_1007752 | Ga0316214_10077521 | 380 |
| 289 | 3300046454 | Ga0495592_0075371 | Ga0495592_0075371_278_1462 | 380 |
| 290 | 3300047318 | Ga0495636_0047706 | Ga0495636_0047706_61_1233 | 380 |
| 291 | 3300005293 | Ga0065715_10117371 | Ga0065715_101173712 | 381 |
| 292 | 3300005354 | Ga0070675_100165470 | Ga0070675_1001654701 | 381 |
| 293 | 3300005546 | Ga0070696_100048327 | Ga0070696_1000483272 | 381 |
| 294 | 3300005564 | Ga0070664_100101977 | Ga0070664_1001019772 | 381 |
| 295 | 3300006871 | Ga0075434_100107730 | Ga0075434_1001077302 | 381 |
| 296 | 3300007076 | Ga0075435_100001389 | Ga0075435_10000138910 | 381 |
| 297 | 3300009094 | Ga0111539_10451816 | Ga0111539_104518161 | 381 |
| 298 | 3300013296 | Ga0157374_10025492 | Ga0157374_100254923 | 381 |
| 299 | 3300013306 | Ga0163162_10335437 | Ga0163162_103354372 | 381 |
| 300 | 3300013307 | Ga0157372_10154452 | Ga0157372_101544523 | 381 |
| 301 | 3300014326 | Ga0157380_10125728 | Ga0157380_101257282 | 381 |
| 302 | 3300025910 | Ga0207684_10000254 | Ga0207684_1000025459 | 381 |
| 303 | 3300025922 | Ga0207646_10073100 | Ga0207646_100731002 | 381 |
| 304 | 3300025941 | Ga0207711_10099079 | Ga0207711_100990792 | 381 |
| 305 | 3300027907 | Ga0207428_10147990 | Ga0207428_101479902 | 381 |
| 306 | 3300035111 | Ga0373923_0001010 | Ga0373923_0001010_3813_4979 | 381 |
| 307 | 3300035116 | Ga0373945_0010016 | Ga0373945_0010016_186_1352 | 381 |
| 308 | 3300035118 | Ga0373954_0004801 | Ga0373954_0004801_2633_3799 | 381 |
| 309 | 3300035171 | Ga0373946_0052572 | Ga0373946_0052572_434_1600 | 381 |
| 310 | 3300035410 | Ga0373924_0030073 | Ga0373924_0030073_128_1294 | 381 |
| 311 | 3300035692 | Ga0373935_0006699 | Ga0373935_0006699_2508_3674 | 381 |
| 312 | 3300035695 | Ga0373927_0002385 | Ga0373927_0002385_5402_6568 | 381 |
| 313 | 3300035725 | Ga0373947_0005813 | Ga0373947_0005813_817_1983 | 381 |
| 314 | 3300036401 | Ga0373937_0027758 | Ga0373937_0027758_1118_2284 | 381 |
| 315 | 3300046454 | Ga0495592_0023814 | Ga0495592_0023814_153_1319 | 381 |
| 316 | 3300046462 | Ga0495651_0036488 | Ga0495651_0036488_2369_3535 | 381 |
| 317 | 3300046472 | Ga0495580_0006228 | Ga0495580_0006228_1001_2167 | 381 |
| 318 | 3300046477 | Ga0495664_0006293 | Ga0495664_0006293_2580_3746 | 381 |
| 319 | 3300046511 | Ga0495608_0029758 | Ga0495608_0029758_19_1185 | 381 |
| 320 | 3300046516 | Ga0495628_0023669 | Ga0495628_0023669_2712_3878 | 381 |
| 321 | 3300046517 | Ga0495630_0010252 | Ga0495630_0010252_67_1233 | 381 |
| 322 | 3300046526 | Ga0495666_0029539 | Ga0495666_0029539_48_1214 | 381 |
| 323 | 3300046529 | Ga0495652_0015005 | Ga0495652_0015005_5406_6572 | 381 |
| 324 | 3300046531 | Ga0495665_0032911 | Ga0495665_0032911_1096_2262 | 381 |
| 325 | 3300046535 | Ga0495586_0000316 | Ga0495586_0000316_8457_9623 | 381 |
| 326 | 3300046536 | Ga0495587_0009379 | Ga0495587_0009379_3262_4428 | 381 |
| 327 | 3300046543 | Ga0495645_0024828 | Ga0495645_0024828_2963_4129 | 381 |
| 328 | 3300046663 | Ga0495635_0011669 | Ga0495635_0011669_2477_3643 | 381 |
| 329 | 3300046675 | Ga0495657_0021776 | Ga0495657_0021776_967_2133 | 381 |
| 330 | 3300046679 | Ga0495623_0001481 | Ga0495623_0001481_9454_10620 | 381 |
| 331 | 3300046680 | Ga0495646_0001242 | Ga0495646_0001242_4227_5393 | 381 |
| 332 | 3300046690 | Ga0495624_0026980 | Ga0495624_0026980_2190_3356 | 381 |
| 333 | 3300047317 | Ga0495604_0047692 | Ga0495604_0047692_2103_3269 | 381 |
| 334 | 3300047317 | Ga0495604_0129560 | Ga0495604_0129560_29_1243 | 381 |
| 335 | 3300047444 | Ga0495675_0033678 | Ga0495675_0033678_584_1798 | 381 |
| 336 | 3300047471 | Ga0495684_0009878 | Ga0495684_0009878_6103_7269 | 381 |
| 337 | 3300047471 | Ga0495684_0243385 | Ga0495684_0243385_21_1208 | 381 |
| 338 | 3300047673 | Ga0495593_0007392 | Ga0495593_0007392_185_1351 | 381 |
| 339 | 3300048088 | Ga0495602_0038095 | Ga0495602_0038095_2319_3485 | 381 |
| 340 | 3300048088 | Ga0495602_0118169 | Ga0495602_0118169_878_2092 | 381 |
| 341 | 3300050511 | nmdc:mga08y16_198267_c1 | nmdc:mga08y16_198267_c1_413_1579 | 381 |
| 342 | 3300050511 | nmdc:mga08y16_261556_c1 | nmdc:mga08y16_261556_c1_22_1179 | 381 |
| 343 | 3300050513 | nmdc:mga0rr50_34658_c1 | nmdc:mga0rr50_34658_c1_1615_2832 | 381 |
| 344 | 3300050515 | nmdc:mga0a205_252100_c1 | nmdc:mga0a205_252100_c1_292_1503 | 381 |
| 345 | 3300053078 | Ga0495612_0003712 | Ga0495612_0003712_2189_3355 | 381 |
| 346 | 3300003203 | JGI25406J46586_10009109 | JGI25406J46586_100091095 | 382 |
| 347 | 3300005331 | Ga0070670_100124788 | Ga0070670_1001247882 | 382 |
| 348 | 3300005985 | Ga0081539_10000017 | Ga0081539_10000017174 | 382 |
| 349 | 3300007265 | Ga0099794_10045016 | Ga0099794_100450162 | 382 |
| 350 | 3300039437 | Ga0436365_1368512 | Ga0436365_1368512_52604_53827 | 382 |
| 351 | 3300046462 | Ga0495651_0000107 | Ga0495651_0000107_55814_56995 | 382 |
| 352 | 3300046463 | Ga0495653_0056293 | Ga0495653_0056293_1170_2351 | 382 |
| 353 | 3300046543 | Ga0495645_0059068 | Ga0495645_0059068_999_2180 | 382 |
| 354 | 3300046559 | Ga0495667_0008116 | Ga0495667_0008116_3036_4217 | 382 |
| 355 | 3300047322 | Ga0495680_0001862 | Ga0495680_0001862_586_1767 | 382 |
| 356 | 3300047444 | Ga0495675_0027051 | Ga0495675_0027051_514_1695 | 382 |
| 357 | 3300025910 | Ga0207684_10104196 | Ga0207684_101041962 | 383 |
| 358 | 3300028577 | Ga0265318_10000865 | Ga0265318_100008652 | 383 |
| 359 | 3300031240 | Ga0265320_10000061 | Ga0265320_1000006145 | 383 |
| 360 | 3300031249 | Ga0265339_10004127 | Ga0265339_100041275 | 383 |
| 361 | 3300031250 | Ga0265331_10000192 | Ga0265331_1000019230 | 383 |
| 362 | 3300031344 | Ga0265316_10030922 | Ga0265316_100309225 | 383 |
| 363 | 3300031595 | Ga0265313_10005368 | Ga0265313_100053684 | 383 |
| 364 | 3300031712 | Ga0265342_10000235 | Ga0265342_100002355 | 383 |
| 365 | 3300050507 | nmdc:mga05p37_78689_c1 | nmdc:mga05p37_78689_c1_489_1694 | 383 |
| 366 | 3300009176 | Ga0105242_10243408 | Ga0105242_102434082 | 384 |
| 367 | 3300009177 | Ga0105248_10047532 | Ga0105248_100475322 | 384 |
| 368 | 3300009551 | Ga0105238_10332044 | Ga0105238_103320442 | 384 |
| 369 | 3300025945 | Ga0207679_10260938 | Ga0207679_102609381 | 384 |
| 370 | 3300031090 | Ga0265760_10004245 | Ga0265760_100042453 | 384 |
| 371 | 3300047471 | Ga0495684_0004395 | Ga0495684_0004395_9452_10642 | 384 |
| 372 | 3300005353 | Ga0070669_100001011 | Ga0070669_1000010116 | 385 |
| 373 | 3300006028 | Ga0070717_10136109 | Ga0070717_101361093 | 385 |
| 374 | 3300025923 | Ga0207681_10001062 | Ga0207681_1000106218 | 385 |
| 375 | 3300028800 | Ga0265338_10084598 | Ga0265338_100845982 | 385 |
| 376 | 3300031344 | Ga0265316_10016576 | Ga0265316_100165762 | 385 |
| 377 | 3300031711 | Ga0265314_10058861 | Ga0265314_100588611 | 385 |
| 378 | 3300035086 | Ga0373934_0018419 | Ga0373934_0018419_1127_2311 | 385 |
| 379 | 3300035117 | Ga0373953_0017988 | Ga0373953_0017988_225_1409 | 385 |
| 380 | 3300035118 | Ga0373954_0016183 | Ga0373954_0016183_1241_2425 | 385 |
| 381 | 3300035119 | Ga0373956_0000874 | Ga0373956_0000874_7038_8222 | 385 |
| 382 | 3300035172 | Ga0373955_0002010 | Ga0373955_0002010_3242_4426 | 385 |
| 383 | 3300035724 | Ga0373933_0000760 | Ga0373933_0000760_5116_6300 | 385 |
| 384 | 3300036401 | Ga0373937_0000406 | Ga0373937_0000406_36736_37920 | 385 |
| 385 | 3300044712 | Ga0453684_0028124 | Ga0453684_0028124_5260_6423 | 385 |
| 386 | 3300045051 | Ga0451576_0008700 | Ga0451576_0008700_8545_9708 | 385 |
| 387 | 3300045976 | Ga0466967_0462061 | Ga0466967_0462061_29_1225 | 385 |
| 388 | 3300046462 | Ga0495651_0003070 | Ga0495651_0003070_5706_6890 | 385 |
| 389 | 3300049580 | Ga0501046_0131054 | Ga0501046_0131054_12_1217 | 385 |
| 390 | 3300049587 | Ga0501071_0097492 | Ga0501071_0097492_805_2010 | 385 |
| 391 | 3300049588 | Ga0501072_0017449 | Ga0501072_0017449_4027_5232 | 385 |
| 392 | 3300049743 | Ga0501081_0065204 | Ga0501081_0065204_348_1553 | 385 |
| 393 | 3300049824 | Ga0501045_0068738 | Ga0501045_0068738_726_1931 | 385 |
| 394 | 3300061734 | Ga0530510_0006569 | Ga0530510_0006569_353_1558 | 385 |
| 395 | 3300005344 | Ga0070661_100071815 | Ga0070661_1000718151 | 386 |
| 396 | 3300005445 | Ga0070708_100091004 | Ga0070708_1000910043 | 386 |
| 397 | 3300005458 | Ga0070681_10004490 | Ga0070681_100044909 | 386 |
| 398 | 3300005471 | Ga0070698_100002898 | Ga0070698_10000289811 | 386 |
| 399 | 3300005530 | Ga0070679_100007738 | Ga0070679_1000077385 | 386 |
| 400 | 3300005536 | Ga0070697_100019042 | Ga0070697_1000190423 | 386 |
| 401 | 3300005840 | Ga0068870_10020921 | Ga0068870_100209212 | 386 |
| 402 | 3300007076 | Ga0075435_100006182 | Ga0075435_1000061825 | 386 |
| 403 | 3300007265 | Ga0099794_10013298 | Ga0099794_100132982 | 386 |
| 404 | 3300009094 | Ga0111539_10330095 | Ga0111539_103300952 | 386 |
| 405 | 3300009553 | Ga0105249_10043239 | Ga0105249_100432393 | 386 |
| 406 | 3300025910 | Ga0207684_10005783 | Ga0207684_100057832 | 386 |
| 407 | 3300025910 | Ga0207684_10134171 | Ga0207684_101341712 | 386 |
| 408 | 3300025912 | Ga0207707_10013240 | Ga0207707_100132409 | 386 |
| 409 | 3300025919 | Ga0207657_10148026 | Ga0207657_101480263 | 386 |
| 410 | 3300025920 | Ga0207649_10169949 | Ga0207649_101699492 | 386 |
| 411 | 3300025921 | Ga0207652_10035633 | Ga0207652_100356335 | 386 |
| 412 | 3300025935 | Ga0207709_10030715 | Ga0207709_100307152 | 386 |
| 413 | 3300025960 | Ga0207651_10047346 | Ga0207651_100473462 | 386 |
| 414 | 3300027671 | Ga0209588_1011988 | Ga0209588_10119882 | 386 |
| 415 | 3300031090 | Ga0265760_10011862 | Ga0265760_100118622 | 386 |
| 416 | 3300046459 | Ga0495629_0085044 | Ga0495629_0085044_803_1999 | 386 |
| 417 | 3300046462 | Ga0495651_0005147 | Ga0495651_0005147_8294_9463 | 386 |
| 418 | 3300046463 | Ga0495653_0042041 | Ga0495653_0042041_2078_3247 | 386 |
| 419 | 3300046511 | Ga0495608_0017607 | Ga0495608_0017607_1106_2275 | 386 |
| 420 | 3300046516 | Ga0495628_0006382 | Ga0495628_0006382_836_2005 | 386 |
| 421 | 3300046529 | Ga0495652_0012220 | Ga0495652_0012220_3813_4982 | 386 |
| 422 | 3300046533 | Ga0495640_0045238 | Ga0495640_0045238_1751_2920 | 386 |
| 423 | 3300046536 | Ga0495587_0001200 | Ga0495587_0001200_8263_9432 | 386 |
| 424 | 3300046663 | Ga0495635_0025267 | Ga0495635_0025267_2103_3272 | 386 |
| 425 | 3300046675 | Ga0495657_0037087 | Ga0495657_0037087_643_1812 | 386 |
| 426 | 3300046678 | Ga0495599_0023235 | Ga0495599_0023235_1107_2276 | 386 |
| 427 | 3300047319 | Ga0495674_0004479 | Ga0495674_0004479_6438_7607 | 386 |
| 428 | 3300047444 | Ga0495675_0000727 | Ga0495675_0000727_8271_9440 | 386 |
| 429 | 3300047471 | Ga0495684_0026956 | Ga0495684_0026956_1704_2873 | 386 |
| 430 | 3300048088 | Ga0495602_0084610 | Ga0495602_0084610_917_2086 | 386 |
| 431 | 3300048915 | Ga0496112_0230891 | Ga0496112_0230891_18_1211 | 386 |
| 432 | 3300049521 | Ga0501298_010004 | Ga0501298_010004_79_1305 | 386 |
| 433 | 3300049741 | Ga0501079_0259609 | Ga0501079_0259609_70_1278 | 386 |
| 434 | 3300050513 | nmdc:mga0rr50_10664_c1 | nmdc:mga0rr50_10664_c1_1922_3118 | 386 |
| 435 | 3300005436 | Ga0070713_100045422 | Ga0070713_1000454222 | 387 |
| 436 | 3300005439 | Ga0070711_100098003 | Ga0070711_1000980032 | 387 |
| 437 | 3300005617 | Ga0068859_100231000 | Ga0068859_1002310001 | 387 |
| 438 | 3300006914 | Ga0075436_100014748 | Ga0075436_1000147481 | 387 |
| 439 | 3300006931 | Ga0097620_100231015 | Ga0097620_1002310152 | 387 |
| 440 | 3300009093 | Ga0105240_10126682 | Ga0105240_101266822 | 387 |
| 441 | 3300009545 | Ga0105237_10266234 | Ga0105237_102662342 | 387 |
| 442 | 3300013105 | Ga0157369_10033225 | Ga0157369_100332255 | 387 |
| 443 | 3300013307 | Ga0157372_10003754 | Ga0157372_1000375412 | 387 |
| 444 | 3300014325 | Ga0163163_10000001 | Ga0163163_1000000150 | 387 |
| 445 | 3300025906 | Ga0207699_10003030 | Ga0207699_100030306 | 387 |
| 446 | 3300025912 | Ga0207707_10081721 | Ga0207707_100817212 | 387 |
| 447 | 3300025925 | Ga0207650_10042021 | Ga0207650_100420212 | 387 |
| 448 | 3300025928 | Ga0207700_10012825 | Ga0207700_100128256 | 387 |
| 449 | 3300025929 | Ga0207664_10005426 | Ga0207664_1000542610 | 387 |
| 450 | 3300026121 | Ga0207683_10178957 | Ga0207683_101789572 | 387 |
| 451 | 3300045051 | Ga0451576_0004103 | Ga0451576_0004103_12048_13244 | 387 |
| 452 | 3300046539 | Ga0495621_0003641 | Ga0495621_0003641_1412_2608 | 387 |
| 453 | 3300048917 | Ga0496114_0243507 | Ga0496114_0243507_368_1564 | 387 |
| 454 | 3300005436 | Ga0070713_100010269 | Ga0070713_1000102692 | 388 |
| 455 | 3300005438 | Ga0070701_10061021 | Ga0070701_100610211 | 388 |
| 456 | 3300005518 | Ga0070699_100010712 | Ga0070699_1000107126 | 388 |
| 457 | 3300005544 | Ga0070686_100089327 | Ga0070686_1000893271 | 388 |
| 458 | 3300005546 | Ga0070696_100207386 | Ga0070696_1002073861 | 388 |
| 459 | 3300005844 | Ga0068862_100027631 | Ga0068862_1000276315 | 388 |
| 460 | 3300006028 | Ga0070717_10171602 | Ga0070717_101716022 | 388 |
| 461 | 3300006846 | Ga0075430_100084950 | Ga0075430_1000849502 | 388 |
| 462 | 3300006847 | Ga0075431_100113847 | Ga0075431_1001138473 | 388 |
| 463 | 3300006880 | Ga0075429_100032604 | Ga0075429_1000326042 | 388 |
| 464 | 3300007265 | Ga0099794_10003397 | Ga0099794_100033972 | 388 |
| 465 | 3300009147 | Ga0114129_10043321 | Ga0114129_100433215 | 388 |
| 466 | 3300009147 | Ga0114129_10107748 | Ga0114129_101077483 | 388 |
| 467 | 3300014326 | Ga0157380_10039145 | Ga0157380_100391451 | 388 |
| 468 | 3300025906 | Ga0207699_10003056 | Ga0207699_100030563 | 388 |
| 469 | 3300025913 | Ga0207695_10050743 | Ga0207695_100507434 | 388 |
| 470 | 3300025923 | Ga0207681_10029311 | Ga0207681_100293113 | 388 |
| 471 | 3300025928 | Ga0207700_10038582 | Ga0207700_100385824 | 388 |
| 472 | 3300025935 | Ga0207709_10021836 | Ga0207709_100218362 | 388 |
| 473 | 3300026078 | Ga0207702_10012786 | Ga0207702_100127868 | 388 |
| 474 | 3300027671 | Ga0209588_1015949 | Ga0209588_10159491 | 388 |
| 475 | 3300027671 | Ga0209588_1017371 | Ga0209588_10173711 | 388 |
| 476 | 3300028380 | Ga0268265_10005239 | Ga0268265_100052397 | 388 |
| 477 | 3300035111 | Ga0373923_0019977 | Ga0373923_0019977_914_2134 | 388 |
| 478 | 3300035170 | Ga0373943_0001497 | Ga0373943_0001497_7583_8803 | 388 |
| 479 | 3300035171 | Ga0373946_0001703 | Ga0373946_0001703_5342_6562 | 388 |
| 480 | 3300035172 | Ga0373955_0028684 | Ga0373955_0028684_1361_2581 | 388 |
| 481 | 3300035410 | Ga0373924_0007307 | Ga0373924_0007307_49_1269 | 388 |
| 482 | 3300035724 | Ga0373933_0127025 | Ga0373933_0127025_113_1333 | 388 |
| 483 | 3300035725 | Ga0373947_0004173 | Ga0373947_0004173_1664_2884 | 388 |
| 484 | 3300036401 | Ga0373937_0196745 | Ga0373937_0196745_79_1299 | 388 |
| 485 | 3300046684 | Ga0495669_0002736 | Ga0495669_0002736_2648_3853 | 388 |
| 486 | 3300050507 | nmdc:mga05p37_149016_c1 | nmdc:mga05p37_149016_c1_1316_2524 | 388 |
| 487 | 3300050508 | nmdc:mga09592_8475_c1 | nmdc:mga09592_8475_c1_5880_7088 | 388 |
| 488 | 3300050509 | nmdc:mga0qj67_4138_c1 | nmdc:mga0qj67_4138_c1_8740_9948 | 388 |
| 489 | 3300050510 | nmdc:mga06r32_198923_c1 | nmdc:mga06r32_198923_c1_172_1380 | 388 |
| 490 | 3300005344 | Ga0070661_100007054 | Ga0070661_1000070547 | 389 |
| 491 | 3300005366 | Ga0070659_100011777 | Ga0070659_1000117776 | 389 |
| 492 | 3300005434 | Ga0070709_10003180 | Ga0070709_100031804 | 389 |
| 493 | 3300005436 | Ga0070713_100002231 | Ga0070713_1000022314 | 389 |
| 494 | 3300005530 | Ga0070679_100007014 | Ga0070679_1000070147 | 389 |
| 495 | 3300005564 | Ga0070664_100005057 | Ga0070664_1000050576 | 389 |
| 496 | 3300005577 | Ga0068857_100002999 | Ga0068857_1000029998 | 389 |
| 497 | 3300005618 | Ga0068864_100022101 | Ga0068864_1000221015 | 389 |
| 498 | 3300006173 | Ga0070716_100002152 | Ga0070716_1000021522 | 389 |
| 499 | 3300009177 | Ga0105248_10187895 | Ga0105248_101878952 | 389 |
| 500 | 3300013100 | Ga0157373_10015443 | Ga0157373_100154432 | 389 |
| 501 | 3300013306 | Ga0163162_10013871 | Ga0163162_100138715 | 389 |
| 502 | 3300014325 | Ga0163163_10020239 | Ga0163163_100202392 | 389 |
| 503 | 3300014325 | Ga0163163_10023361 | Ga0163163_100233612 | 389 |
| 504 | 3300025906 | Ga0207699_10002789 | Ga0207699_100027897 | 389 |
| 505 | 3300025912 | Ga0207707_10041183 | Ga0207707_100411835 | 389 |
| 506 | 3300025917 | Ga0207660_10031858 | Ga0207660_100318583 | 389 |
| 507 | 3300025921 | Ga0207652_10051053 | Ga0207652_100510533 | 389 |
| 508 | 3300025928 | Ga0207700_10006558 | Ga0207700_100065585 | 389 |
| 509 | 3300025939 | Ga0207665_10004561 | Ga0207665_100045613 | 389 |
| 510 | 3300025945 | Ga0207679_10030833 | Ga0207679_100308332 | 389 |
| 511 | 3300026095 | Ga0207676_10087190 | Ga0207676_100871902 | 389 |
| 512 | 3300026116 | Ga0207674_10015232 | Ga0207674_100152322 | 389 |
| 513 | 3300031731 | Ga0307405_10190204 | Ga0307405_101902041 | 389 |
| 514 | 3300033547 | Ga0316212_1000699 | Ga0316212_10006992 | 389 |
| 515 | 3300004803 | Ga0058862_12841824 | Ga0058862_128418242 | 390 |
| 516 | 3300005406 | Ga0070703_10004410 | Ga0070703_100044102 | 390 |
| 517 | 3300005440 | Ga0070705_100048739 | Ga0070705_1000487392 | 390 |
| 518 | 3300005444 | Ga0070694_100087851 | Ga0070694_1000878512 | 390 |
| 519 | 3300005467 | Ga0070706_100014025 | Ga0070706_1000140253 | 390 |
| 520 | 3300005530 | Ga0070679_100004782 | Ga0070679_1000047823 | 390 |
| 521 | 3300005536 | Ga0070697_100002229 | Ga0070697_10000222915 | 390 |
| 522 | 3300005545 | Ga0070695_100040732 | Ga0070695_1000407322 | 390 |
| 523 | 3300005546 | Ga0070696_100000725 | Ga0070696_10000072511 | 390 |
| 524 | 3300005547 | Ga0070693_100000712 | Ga0070693_1000007124 | 390 |
| 525 | 3300005549 | Ga0070704_100000356 | Ga0070704_1000003565 | 390 |
| 526 | 3300005841 | Ga0068863_100007354 | Ga0068863_1000073542 | 390 |
| 527 | 3300005843 | Ga0068860_100209626 | Ga0068860_1002096262 | 390 |
| 528 | 3300006173 | Ga0070716_100047302 | Ga0070716_1000473023 | 390 |
| 529 | 3300006237 | Ga0097621_100002739 | Ga0097621_1000027396 | 390 |
| 530 | 3300006358 | Ga0068871_100012155 | Ga0068871_1000121552 | 390 |
| 531 | 3300006871 | Ga0075434_100045476 | Ga0075434_1000454764 | 390 |
| 532 | 3300006914 | Ga0075436_100090429 | Ga0075436_1000904292 | 390 |
| 533 | 3300007076 | Ga0075435_100216731 | Ga0075435_1002167312 | 390 |
| 534 | 3300007265 | Ga0099794_10056408 | Ga0099794_100564081 | 390 |
| 535 | 3300011119 | Ga0105246_10015646 | Ga0105246_100156461 | 390 |
| 536 | 3300014969 | Ga0157376_10000014 | Ga0157376_10000014111 | 390 |
| 537 | 3300025885 | Ga0207653_10001170 | Ga0207653_100011702 | 390 |
| 538 | 3300025906 | Ga0207699_10076508 | Ga0207699_100765081 | 390 |
| 539 | 3300025910 | Ga0207684_10009363 | Ga0207684_100093635 | 390 |
| 540 | 3300025911 | Ga0207654_10072390 | Ga0207654_100723902 | 390 |
| 541 | 3300025912 | Ga0207707_10012920 | Ga0207707_100129203 | 390 |
| 542 | 3300025914 | Ga0207671_10071201 | Ga0207671_100712012 | 390 |
| 543 | 3300025917 | Ga0207660_10210498 | Ga0207660_102104981 | 390 |
| 544 | 3300025921 | Ga0207652_10029363 | Ga0207652_100293632 | 390 |
| 545 | 3300025921 | Ga0207652_10166825 | Ga0207652_101668252 | 390 |
| 546 | 3300025939 | Ga0207665_10066437 | Ga0207665_100664373 | 390 |
| 547 | 3300026035 | Ga0207703_10069166 | Ga0207703_100691662 | 390 |
| 548 | 3300026041 | Ga0207639_10171924 | Ga0207639_101719241 | 390 |
| 549 | 3300026088 | Ga0207641_10020450 | Ga0207641_100204502 | 390 |
| 550 | 3300027671 | Ga0209588_1016208 | Ga0209588_10162082 | 390 |
| 551 | 3300038996 | Ga0242420_006411 | Ga0242420_006411_597_1808 | 390 |
| 552 | 3300048917 | Ga0496114_0003782 | Ga0496114_0003782_5914_7128 | 390 |
| 553 | 3300050513 | nmdc:mga0rr50_77726_c1 | nmdc:mga0rr50_77726_c1_1076_2290 | 390 |
| 554 | 3300050514 | nmdc:mga08x19_78457_c1 | nmdc:mga08x19_78457_c1_433_1644 | 390 |
| 555 | 3300050515 | nmdc:mga0a205_72084_c1 | nmdc:mga0a205_72084_c1_1713_2927 | 390 |
| 556 | 3300005445 | Ga0070708_100142988 | Ga0070708_1001429882 | 391 |
| 557 | 3300005468 | Ga0070707_100039494 | Ga0070707_1000394944 | 391 |
| 558 | 3300005471 | Ga0070698_100011225 | Ga0070698_1000112257 | 391 |
| 559 | 3300005518 | Ga0070699_100059115 | Ga0070699_1000591152 | 391 |
| 560 | 3300005536 | Ga0070697_100262053 | Ga0070697_1002620531 | 391 |
| 561 | 3300005549 | Ga0070704_100142374 | Ga0070704_1001423742 | 391 |
| 562 | 3300006173 | Ga0070716_100044628 | Ga0070716_1000446282 | 391 |
| 563 | 3300006175 | Ga0070712_100038007 | Ga0070712_1000380072 | 391 |
| 564 | 3300009553 | Ga0105249_10000025 | Ga0105249_1000002581 | 391 |
| 565 | 3300013306 | Ga0163162_10000002 | Ga0163162_10000002266 | 391 |
| 566 | 3300014326 | Ga0157380_10051705 | Ga0157380_100517051 | 391 |
| 567 | 3300019161 | Ga0184602_129938 | Ga0184602_1299381 | 391 |
| 568 | 3300025910 | Ga0207684_10036687 | Ga0207684_100366872 | 391 |
| 569 | 3300025915 | Ga0207693_10153904 | Ga0207693_101539042 | 391 |
| 570 | 3300025922 | Ga0207646_10002064 | Ga0207646_100020647 | 391 |
| 571 | 3300025922 | Ga0207646_10043427 | Ga0207646_100434274 | 391 |
| 572 | 3300025939 | Ga0207665_10006371 | Ga0207665_100063715 | 391 |
| 573 | 3300025961 | Ga0207712_10002724 | Ga0207712_100027246 | 391 |
| 574 | 3300028379 | Ga0268266_10000204 | Ga0268266_1000020477 | 391 |
| 575 | 3300028800 | Ga0265338_10123897 | Ga0265338_101238971 | 391 |
| 576 | 3300030878 | Ga0265770_1000930 | Ga0265770_10009302 | 391 |
| 577 | 3300005439 | Ga0070711_100004103 | Ga0070711_1000041036 | 392 |
| 578 | 3300006237 | Ga0097621_100015802 | Ga0097621_1000158024 | 392 |
| 579 | 3300006358 | Ga0068871_100011680 | Ga0068871_1000116804 | 392 |
| 580 | 3300009093 | Ga0105240_10048507 | Ga0105240_100485072 | 392 |
| 581 | 3300009098 | Ga0105245_10089355 | Ga0105245_100893553 | 392 |
| 582 | 3300009174 | Ga0105241_10009683 | Ga0105241_100096837 | 392 |
| 583 | 3300009551 | Ga0105238_10019334 | Ga0105238_100193344 | 392 |
| 584 | 3300010375 | Ga0105239_10152157 | Ga0105239_101521571 | 392 |
| 585 | 3300013297 | Ga0157378_10011338 | Ga0157378_100113385 | 392 |
| 586 | 3300014968 | Ga0157379_10039684 | Ga0157379_100396843 | 392 |
| 587 | 3300014969 | Ga0157376_10107837 | Ga0157376_101078372 | 392 |
| 588 | 3300025916 | Ga0207663_10007347 | Ga0207663_100073475 | 392 |
| 589 | 3300046543 | Ga0495645_0018739 | Ga0495645_0018739_1103_2299 | 392 |
| 590 | 3300048907 | Ga0496104_0180005 | Ga0496104_0180005_679_1875 | 392 |
| 591 | 3300053077 | Ga0495601_0002978 | Ga0495601_0002978_5177_6373 | 392 |
| 592 | 3300005336 | Ga0070680_100149110 | Ga0070680_1001491101 | 393 |
| 593 | 3300005458 | Ga0070681_10002186 | Ga0070681_100021867 | 393 |
| 594 | 3300005471 | Ga0070698_100012602 | Ga0070698_1000126025 | 393 |
| 595 | 3300005518 | Ga0070699_100043476 | Ga0070699_1000434764 | 393 |
| 596 | 3300005530 | Ga0070679_100023469 | Ga0070679_1000234695 | 393 |
| 597 | 3300005536 | Ga0070697_100019610 | Ga0070697_1000196104 | 393 |
| 598 | 3300006871 | Ga0075434_100012218 | Ga0075434_1000122185 | 393 |
| 599 | 3300007076 | Ga0075435_100039481 | Ga0075435_1000394813 | 393 |
| 600 | 3300009545 | Ga0105237_10022698 | Ga0105237_100226982 | 393 |
| 601 | 3300025912 | Ga0207707_10002231 | Ga0207707_1000223115 | 393 |
| 602 | 3300025917 | Ga0207660_10015111 | Ga0207660_100151112 | 393 |
| 603 | 3300025939 | Ga0207665_10000709 | Ga0207665_100007093 | 393 |
| 604 | 3300025941 | Ga0207711_10091894 | Ga0207711_100918943 | 393 |
| 605 | 3300025942 | Ga0207689_10143940 | Ga0207689_101439402 | 393 |
| 606 | 3300036401 | Ga0373937_0096821 | Ga0373937_0096821_1348_2565 | 393 |
| 607 | 3300037068 | Ga0373925_0039877 | Ga0373925_0039877_2074_3291 | 393 |
| 608 | 3300044694 | Ga0466963_0000364 | Ga0466963_0000364_4810_6018 | 393 |
| 609 | 3300046459 | Ga0495629_0148602 | Ga0495629_0148602_154_1371 | 393 |
| 610 | 3300046663 | Ga0495635_0099486 | Ga0495635_0099486_366_1583 | 393 |
| 611 | 3300048903 | Ga0496100_0056865 | Ga0496100_0056865_883_2100 | 393 |
| 612 | 3300048904 | Ga0496101_0007379 | Ga0496101_0007379_4951_6168 | 393 |
| 613 | 3300048907 | Ga0496104_0053828 | Ga0496104_0053828_1123_2340 | 393 |
| 614 | 3300048909 | Ga0496106_0057871 | Ga0496106_0057871_1473_2690 | 393 |
| 615 | 3300048912 | Ga0496109_0138775 | Ga0496109_0138775_71_1288 | 393 |
| 616 | 3300048917 | Ga0496114_0027200 | Ga0496114_0027200_3114_4331 | 393 |
| 617 | 3300048918 | Ga0496115_0033010 | Ga0496115_0033010_1641_2858 | 393 |
| 618 | 3300048918 | Ga0496115_0102854 | Ga0496115_0102854_464_1663 | 393 |
| 619 | 3300050512 | nmdc:mga0n895_14256_c1 | nmdc:mga0n895_14256_c1_3000_4223 | 393 |
| 620 | 3300053077 | Ga0495601_0197035 | Ga0495601_0197035_85_1302 | 393 |
| 621 | 3300007788 | Ga0099795_10006902 | Ga0099795_100069022 | 394 |
| 622 | 3300005536 | Ga0070697_100247593 | Ga0070697_1002475932 | 400 |
| 623 | 3300006028 | Ga0070717_10226918 | Ga0070717_102269181 | 400 |
| 624 | 3300007265 | Ga0099794_10000762 | Ga0099794_100007628 | 400 |
| 625 | 3300007265 | Ga0099794_10027490 | Ga0099794_100274903 | 400 |
| 626 | 3300025939 | Ga0207665_10007285 | Ga0207665_100072855 | 400 |
| 627 | 3300027671 | Ga0209588_1000091 | Ga0209588_100009122 | 400 |
| 628 | 3300025911 | Ga0207654_10010827 | Ga0207654_100108273 | 401 |
| 629 | 3300028381 | Ga0268264_10138907 | Ga0268264_101389072 | 401 |
| 630 | 3300048918 | Ga0496115_0057523 | Ga0496115_0057523_1404_2609 | 401 |
| 631 | 3300005445 | Ga0070708_100016466 | Ga0070708_1000164663 | 402 |
| 632 | 3300006852 | Ga0075433_10026266 | Ga0075433_100262663 | 402 |
| 633 | 3300006871 | Ga0075434_100003719 | Ga0075434_1000037194 | 402 |
| 634 | 3300006914 | Ga0075436_100011981 | Ga0075436_1000119814 | 402 |
| 635 | 3300007076 | Ga0075435_100001321 | Ga0075435_1000013217 | 402 |
| 636 | 3300027671 | Ga0209588_1005114 | Ga0209588_10051142 | 402 |
| 637 | 3300005445 | Ga0070708_100000527 | Ga0070708_1000005274 | 403 |
| 638 | 3300005467 | Ga0070706_100000991 | Ga0070706_1000009913 | 403 |
| 639 | 3300005468 | Ga0070707_100002670 | Ga0070707_10000267014 | 403 |
| 640 | 3300005468 | Ga0070707_100018287 | Ga0070707_1000182873 | 403 |
| 641 | 3300005471 | Ga0070698_100000182 | Ga0070698_10000018232 | 403 |
| 642 | 3300005471 | Ga0070698_100020887 | Ga0070698_1000208875 | 403 |
| 643 | 3300005518 | Ga0070699_100088237 | Ga0070699_1000882372 | 403 |
| 644 | 3300005518 | Ga0070699_100151537 | Ga0070699_1001515372 | 403 |
| 645 | 3300005536 | Ga0070697_100002841 | Ga0070697_1000028414 | 403 |
| 646 | 3300009174 | Ga0105241_10114286 | Ga0105241_101142861 | 403 |
| 647 | 3300025910 | Ga0207684_10001275 | Ga0207684_1000127525 | 403 |
| 648 | 3300025910 | Ga0207684_10022870 | Ga0207684_100228702 | 403 |
| 649 | 3300025922 | Ga0207646_10000959 | Ga0207646_100009599 | 403 |
| 650 | 3300025922 | Ga0207646_10002760 | Ga0207646_1000276017 | 403 |
| 651 | 3300005445 | Ga0070708_100110153 | Ga0070708_1001101532 | 404 |
| 652 | 3300005468 | Ga0070707_100104228 | Ga0070707_1001042282 | 404 |
| 653 | 3300005536 | Ga0070697_100020567 | Ga0070697_1000205674 | 404 |
| 654 | 3300007788 | Ga0099795_10002165 | Ga0099795_100021651 | 404 |
| 655 | 3300025910 | Ga0207684_10224337 | Ga0207684_102243372 | 404 |
| 656 | 3300025922 | Ga0207646_10180861 | Ga0207646_101808612 | 404 |
| 657 | 2162886012 | MBSR1b_contig_6047714 | MBSR1b_0040.00000470 | 405 |
| 658 | 3300005330 | Ga0070690_100087672 | Ga0070690_1000876721 | 405 |
| 659 | 3300005335 | Ga0070666_10030297 | Ga0070666_100302972 | 405 |
| 660 | 3300005337 | Ga0070682_100016607 | Ga0070682_1000166073 | 405 |
| 661 | 3300005338 | Ga0068868_100006717 | Ga0068868_1000067173 | 405 |
| 662 | 3300005339 | Ga0070660_100018690 | Ga0070660_1000186904 | 405 |
| 663 | 3300005344 | Ga0070661_100008680 | Ga0070661_1000086805 | 405 |
| 664 | 3300005347 | Ga0070668_100052769 | Ga0070668_1000527692 | 405 |
| 665 | 3300005353 | Ga0070669_100058514 | Ga0070669_1000585142 | 405 |
| 666 | 3300005366 | Ga0070659_100016405 | Ga0070659_1000164053 | 405 |
| 667 | 3300005444 | Ga0070694_100060353 | Ga0070694_1000603531 | 405 |
| 668 | 3300005455 | Ga0070663_100027656 | Ga0070663_1000276563 | 405 |
| 669 | 3300005456 | Ga0070678_100021305 | Ga0070678_1000213053 | 405 |
| 670 | 3300005457 | Ga0070662_100018503 | Ga0070662_1000185032 | 405 |
| 671 | 3300005467 | Ga0070706_100000257 | Ga0070706_10000025728 | 405 |
| 672 | 3300005518 | Ga0070699_100230021 | Ga0070699_1002300211 | 405 |
| 673 | 3300005530 | Ga0070679_100332694 | Ga0070679_1003326942 | 405 |
| 674 | 3300005535 | Ga0070684_100033500 | Ga0070684_1000335003 | 405 |
| 675 | 3300005536 | Ga0070697_100002898 | Ga0070697_10000289812 | 405 |
| 676 | 3300005539 | Ga0068853_100031297 | Ga0068853_1000312972 | 405 |
| 677 | 3300005545 | Ga0070695_100067461 | Ga0070695_1000674612 | 405 |
| 678 | 3300005548 | Ga0070665_100033884 | Ga0070665_1000338844 | 405 |
| 679 | 3300005549 | Ga0070704_100076325 | Ga0070704_1000763252 | 405 |
| 680 | 3300005564 | Ga0070664_100107730 | Ga0070664_1001077302 | 405 |
| 681 | 3300005616 | Ga0068852_100008382 | Ga0068852_1000083824 | 405 |
| 682 | 3300005617 | Ga0068859_100034026 | Ga0068859_1000340263 | 405 |
| 683 | 3300005718 | Ga0068866_10036677 | Ga0068866_100366772 | 405 |
| 684 | 3300005719 | Ga0068861_100094624 | Ga0068861_1000946242 | 405 |
| 685 | 3300005834 | Ga0068851_10009864 | Ga0068851_100098643 | 405 |
| 686 | 3300005842 | Ga0068858_100015899 | Ga0068858_1000158995 | 405 |
| 687 | 3300005843 | Ga0068860_100009175 | Ga0068860_1000091756 | 405 |
| 688 | 3300005844 | Ga0068862_100019123 | Ga0068862_1000191233 | 405 |
| 689 | 3300006173 | Ga0070716_100020108 | Ga0070716_1000201084 | 405 |
| 690 | 3300006237 | Ga0097621_100051250 | Ga0097621_1000512502 | 405 |
| 691 | 3300006931 | Ga0097620_100034027 | Ga0097620_1000340273 | 405 |
| 692 | 3300009093 | Ga0105240_10224273 | Ga0105240_102242732 | 405 |
| 693 | 3300009098 | Ga0105245_10149356 | Ga0105245_101493562 | 405 |
| 694 | 3300009174 | Ga0105241_10055379 | Ga0105241_100553792 | 405 |
| 695 | 3300009177 | Ga0105248_10079686 | Ga0105248_100796863 | 405 |
| 696 | 3300009551 | Ga0105238_10052823 | Ga0105238_100528232 | 405 |
| 697 | 3300009553 | Ga0105249_10016918 | Ga0105249_100169183 | 405 |
| 698 | 3300013102 | Ga0157371_10009941 | Ga0157371_100099412 | 405 |
| 699 | 3300013105 | Ga0157369_10118745 | Ga0157369_101187452 | 405 |
| 700 | 3300013296 | Ga0157374_10018109 | Ga0157374_100181095 | 405 |
| 701 | 3300013306 | Ga0163162_10021711 | Ga0163162_100217111 | 405 |
| 702 | 3300013307 | Ga0157372_10133002 | Ga0157372_101330022 | 405 |
| 703 | 3300013308 | Ga0157375_10039651 | Ga0157375_100396513 | 405 |
| 704 | 3300014969 | Ga0157376_10036913 | Ga0157376_100369133 | 405 |
| 705 | 3300025321 | Ga0207656_10014688 | Ga0207656_100146882 | 405 |
| 706 | 3300025910 | Ga0207684_10002463 | Ga0207684_100024632 | 405 |
| 707 | 3300025911 | Ga0207654_10002903 | Ga0207654_100029037 | 405 |
| 708 | 3300025912 | Ga0207707_10266259 | Ga0207707_102662591 | 405 |
| 709 | 3300025913 | Ga0207695_10025312 | Ga0207695_100253123 | 405 |
| 710 | 3300025914 | Ga0207671_10022859 | Ga0207671_100228593 | 405 |
| 711 | 3300025919 | Ga0207657_10000215 | Ga0207657_1000021547 | 405 |
| 712 | 3300025920 | Ga0207649_10031565 | Ga0207649_100315652 | 405 |
| 713 | 3300025923 | Ga0207681_10080628 | Ga0207681_100806282 | 405 |
| 714 | 3300025924 | Ga0207694_10058815 | Ga0207694_100588152 | 405 |
| 715 | 3300025927 | Ga0207687_10001479 | Ga0207687_100014793 | 405 |
| 716 | 3300025933 | Ga0207706_10004908 | Ga0207706_1000490810 | 405 |
| 717 | 3300025936 | Ga0207670_10063511 | Ga0207670_100635112 | 405 |
| 718 | 3300025941 | Ga0207711_10025317 | Ga0207711_100253173 | 405 |
| 719 | 3300025944 | Ga0207661_10118487 | Ga0207661_101184872 | 405 |
| 720 | 3300025945 | Ga0207679_10014735 | Ga0207679_100147353 | 405 |
| 721 | 3300025949 | Ga0207667_10160529 | Ga0207667_101605292 | 405 |
| 722 | 3300025961 | Ga0207712_10146203 | Ga0207712_101462031 | 405 |
| 723 | 3300025972 | Ga0207668_10041205 | Ga0207668_100412052 | 405 |
| 724 | 3300025981 | Ga0207640_10016000 | Ga0207640_100160003 | 405 |
| 725 | 3300026023 | Ga0207677_10016558 | Ga0207677_100165582 | 405 |
| 726 | 3300026035 | Ga0207703_10030684 | Ga0207703_100306842 | 405 |
| 727 | 3300026041 | Ga0207639_10128074 | Ga0207639_101280742 | 405 |
| 728 | 3300026067 | Ga0207678_10000874 | Ga0207678_1000087418 | 405 |
| 729 | 3300026075 | Ga0207708_10147607 | Ga0207708_101476072 | 405 |
| 730 | 3300026089 | Ga0207648_10017065 | Ga0207648_100170655 | 405 |
| 731 | 3300026116 | Ga0207674_10219408 | Ga0207674_102194081 | 405 |
| 732 | 3300026118 | Ga0207675_100106910 | Ga0207675_1001069101 | 405 |
| 733 | 3300026121 | Ga0207683_10020514 | Ga0207683_100205143 | 405 |
| 734 | 3300026142 | Ga0207698_10043325 | Ga0207698_100433253 | 405 |
| 735 | 3300028379 | Ga0268266_10025409 | Ga0268266_100254092 | 405 |
| 736 | 3300028380 | Ga0268265_10073447 | Ga0268265_100734472 | 405 |
| 737 | 3300028381 | Ga0268264_10093079 | Ga0268264_100930791 | 405 |
| 738 | 3300035241 | Ga0373961_0011822 | Ga0373961_0011822_858_2075 | 405 |
| 739 | 3300035691 | Ga0373931_0035901 | Ga0373931_0035901_965_2182 | 405 |
| 740 | 3300048905 | Ga0496102_0098832 | Ga0496102_0098832_118_1335 | 405 |
| 741 | 3300048906 | Ga0496103_0034632 | Ga0496103_0034632_678_1895 | 405 |
| 742 | 3300048915 | Ga0496112_0057191 | Ga0496112_0057191_1120_2337 | 405 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ojy-assembly1.cif.gz_B | methylated pilt4 from geobacter metallireducens bound to sulfate: c3ocococ conformation | 0.9536 | 21 | 373 |
| 3jvu-assembly1.cif.gz_A-2 | crystal structure of unliganded p. aeruginosa pilt | 0.9382 | 22 | 368 |
| 2eyu-assembly2.cif.gz_B | the crystal structure of the c-terminal domain of aquifex aeolicus pilt | 0.938 | 128 | 375 |
| 3jvv-assembly1.cif.gz_A-2 | crystal structure of p. aeruginosa pilt with bound amp-pcp | 0.9359 | 20 | 368 |
| 3jvv-assembly1.cif.gz_B-2 | crystal structure of p. aeruginosa pilt with bound amp-pcp | 0.9308 | 23 | 368 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3jvvC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9603 | 125 | 368 | 3.40.50.300 |
| 3jvvC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9524 | 125 | 368 | 3.40.50.300 |
| 5fl3A01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.9089 | 21 | 124 | 3.30.450.90 |
| 2ewwA01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8918 | 19 | 124 | 3.30.450.90 |
| 5fl3A01 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8752 | 21 | 124 | 3.30.450.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645FIK6-F1-model_v4 | Twitching mobility protein | 0.9788 | 135 | 377 |
GO:0005524
GO:0016887 |
| AF-A0A6I1IXX6-F1-model_v4 | deleted | 0.975 | 121 | 268 |
|
| AF-A0A6L4ZL45-F1-model_v4 | Twitching motility protein PilT | 0.9734 | 166 | 374 |
GO:0005524
GO:0016887 |
| AF-X1KSN6-F1-model_v4 | Bacterial type II secretion system protein E domain-containing protein | 0.9721 | 84 | 309 |
GO:0005524
GO:0016887 |
| AF-A0A2V8TJU6-F1-model_v4 | Twitching motility protein | 0.9718 | 82 | 379 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar