F478549

General Info

Members Datasets Scaffolds Average Seq Length
740 262 731 220

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0223523|Ga0496111_0223523_464_1141
Length 225
Sequence MDDYRRRFLTLALQAQALRFGEFTLKSGRQSPYFFNAGRFDSGAALAGLADCYADALDAHGADFDVPAFDMLFGPAYKGIPLATALACAYARRGRDLPVAFNRKEAKAHGEGGTLIGAPLAGRRVLIVDDVITAGTAIREALGLIADAGGTPAAIVIALDRQEVVDLGAPQRQSAAQAVAAQHGIPVIAVARLADLLAFAGESADLVAQRERLLAYRARYGCDPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541357 Duganella sp. GV053 Isolate Unclassified
6 2738543003 Duganella sp. GV066 Isolate Unclassified
7 2738543026 Duganella sp. GV089 Isolate Unclassified
8 2738543029 Duganella sp. GV039 Isolate Unclassified
9 2842711865 Duganella sp. R-73148 Isolate Unclassified
10 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
129 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
130 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
252 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
255 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.76
Nodule 0.27
Rhizoplane 3.78
Rhizosphere 69.73
Stem 0
Stem Tuber 0
Unclassified 9.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1852575 2162886007 Bacteria 923
2 SwRhRL2b_contig_198189 2162886007 Bacteria 6311
3 JGI25150J39212_1000530 3300002774 Bacteria 15563
4 JGI25150J39212_1005002 3300002774 Bacteria 2873
5 JGI25159J45721_1005393 3300002987 Bacteria 4021
6 JGI25151J46595_10000231 3300003187 Bacteria 66295
7 JGI25151J46595_10001054 3300003187 Bacteria 20577
8 JGI25153J46596_10000166 3300003215 Bacteria 66295
9 JGI25153J46596_10006705 3300003215 Bacteria 5787
10 rootH2_10051274 3300003320 Bacteria 6889
11 JGI25160J50197_1014123 3300003354 Bacteria 2686
12 Ga0055526_1000107 3300003771 Bacteria 72819
13 Ga0055526_1000739 3300003771 Bacteria 24635
14 Ga0055526_1006992 3300003771 Bacteria 5985
15 Ga0055537_1000147 3300003773 Bacteria 52610
16 Ga0055537_1000172 3300003773 Bacteria 48382
17 Ga0055537_1001799 3300003773 Bacteria 7802
18 Ga0055524_1000176 3300003775 Bacteria 72819
19 Ga0055524_1002415 3300003775 Bacteria 9663
20 Ga0055524_1003668 3300003775 Bacteria 7361
21 Ga0055524_1004114 3300003775 Bacteria 6818
22 Ga0055524_1013021 3300003775 Bacteria 3161
23 Ga0055536_1001750 3300003781 Bacteria 12809
24 Ga0055536_1003767 3300003781 Bacteria 8004
25 Ga0055536_1009133 3300003781 Bacteria 4151
26 Ga0055536_1009137 3300003781 Bacteria 4150
27 Ga0055534_1000090 3300003784 Bacteria 71465
28 Ga0055534_1000169 3300003784 Bacteria 48382
29 Ga0055534_1000322 3300003784 Bacteria 31844
30 Ga0055534_1000837 3300003784 Bacteria 14168
31 Ga0055528_1000088 3300003790 Bacteria 72819
32 Ga0055528_1000482 3300003790 Bacteria 31599
33 Ga0055528_1000486 3300003790 Bacteria 31484
34 Ga0055528_1000950 3300003790 Bacteria 19268
35 Ga0055530_10002248 3300003791 Bacteria 12723
36 Ga0055530_10003430 3300003791 Bacteria 9016
37 Ga0055530_10003468 3300003791 Bacteria 8951
38 Ga0055530_10005750 3300003791 Bacteria 5761
39 Ga0055531_10008250 3300003794 Bacteria 5538
40 Ga0055531_10008363 3300003794 Bacteria 5472
41 Ga0055531_10010808 3300003794 Bacteria 4492
42 Ga0055531_10011876 3300003794 Bacteria 4151
43 Ga0055531_10011880 3300003794 Bacteria 4150
44 Ga0058692_1000021 3300003856 Bacteria 240308
45 Ga0065165_1000882 3300005262 Bacteria 38756
46 Ga0065165_1002094 3300005262 Bacteria 18248
47 Ga0065704_10011596 3300005289 Bacteria 2738
48 Ga0065704_10071322 3300005289 Bacteria 11740
49 Ga0065704_10119702 3300005289 Bacteria 1776
50 Ga0070676_10126283 3300005328 Bacteria 1612
51 Ga0070670_100014590 3300005331 Bacteria 6745
52 Ga0070670_100084944 3300005331 Bacteria 2719
53 Ga0070660_100187385 3300005339 Bacteria 1675
54 Ga0070668_100019512 3300005347 Bacteria 5103
55 Ga0070668_100021714 3300005347 Bacteria 4849
56 Ga0070668_100058621 3300005347 Bacteria 2979
57 Ga0070669_100136645 3300005353 Bacteria 1886
58 Ga0070675_100277046 3300005354 Bacteria 1473
59 Ga0070671_100140483 3300005355 Bacteria 2038
60 Ga0070671_100317017 3300005355 Bacteria 1328
61 Ga0070674_100423081 3300005356 Bacteria 1093
62 Ga0070673_100573767 3300005364 Bacteria 1027
63 Ga0070659_100255788 3300005366 Bacteria 1452
64 Ga0070678_100007944 3300005456 Bacteria 6321
65 Ga0070672_100001423 3300005543 Bacteria 14790
66 Ga0070672_100065259 3300005543 Bacteria 2879
67 Ga0070665_100022130 3300005548 Bacteria 6394
68 Ga0070665_100090044 3300005548 Bacteria 3074
69 Ga0068854_100021157 3300005578 Bacteria 4411
70 Ga0081539_10032334 3300005985 Bacteria 3205
71 Ga0075364_10004874 3300006051 Bacteria 7773
72 Ga0079104_1008838 3300006946 Bacteria 3467
73 Ga0105251_10014842 3300009011 Bacteria 4282
74 Ga0157327_1001358 3300012512 Bacteria 1516
75 Ga0157371_10003036 3300013102 Bacteria 15589
76 Ga0157371_10122809 3300013102 Bacteria 1847
77 Ga0157370_10109875 3300013104 Bacteria 2577
78 Ga0163162_10270856 3300013306 Bacteria 1830
79 Ga0163162_10389238 3300013306 Bacteria 1527
80 Ga0163163_10570492 3300014325 Bacteria 1194
81 Ga0182008_10003269 3300014497 Bacteria 9867
82 Ga0182008_10003866 3300014497 Bacteria 8898
83 Ga0182006_1000138 3300015261 Bacteria 78470
84 Ga0182006_1010683 3300015261 Bacteria 4069
85 Ga0182006_1045772 3300015261 Bacteria 1701
86 Ga0182006_1046284 3300015261 Bacteria 1690
87 Ga0182006_1056065 3300015261 Bacteria 1502
88 Ga0182006_1060355 3300015261 Bacteria 1433
89 Ga0182006_1110890 3300015261 Bacteria 963
90 Ga0182006_1145838 3300015261 Bacteria 806
91 Ga0182007_10000500 3300015262 Bacteria 23316
92 Ga0182005_1000046 3300015265 Bacteria 138133
93 Ga0182005_1000186 3300015265 Bacteria 42690
94 Ga0183360_10004 3300015689 Bacteria 289992
95 Ga0163161_10079534 3300017792 Bacteria 2411
96 Ga0209436_100930 3300025208 Bacteria 11574
97 Ga0207425_1000013 3300025245 Bacteria 497384
98 Ga0207425_1000029 3300025245 Bacteria 268521
99 Ga0207425_1036359 3300025245 Bacteria 956
100 Ga0209129_1000152 3300025258 Bacteria 112977
101 Ga0209129_1000216 3300025258 Bacteria 66352
102 Ga0209565_1000002 3300025263 Bacteria 1423083
103 Ga0209565_1000071 3300025263 Bacteria 166213
104 Ga0209565_1000159 3300025263 Bacteria 90295
105 Ga0209565_1004850 3300025263 Bacteria 4016
106 Ga0209565_1008627 3300025263 Bacteria 2645
107 Ga0209673_1000002 3300025273 Bacteria 1423083
108 Ga0209673_1000006 3300025273 Bacteria 650600
109 Ga0209673_1001159 3300025273 Bacteria 28752
110 Ga0209130_1000521 3300025284 Bacteria 38770
111 Ga0209130_1001127 3300025284 Bacteria 19621
112 Ga0209130_1012250 3300025284 Bacteria 2254
113 Ga0209675_1000002 3300025291 Bacteria 1423083
114 Ga0209675_1000005 3300025291 Bacteria 849192
115 Ga0209675_1000018 3300025291 Bacteria 377481
116 Ga0209675_1003768 3300025291 Bacteria 7018
117 Ga0209675_1003998 3300025291 Bacteria 6729
118 Ga0209675_1017547 3300025291 Bacteria 2041
119 Ga0209676_1000035 3300025292 Bacteria 459284
120 Ga0209676_1000185 3300025292 Bacteria 142505
121 Ga0209676_1000248 3300025292 Bacteria 115456
122 Ga0209676_1001632 3300025292 Bacteria 19793
123 Ga0209676_1002505 3300025292 Bacteria 12861
124 Ga0209676_1003787 3300025292 Bacteria 8958
125 Ga0209676_1004137 3300025292 Bacteria 8260
126 Ga0209676_1004879 3300025292 Bacteria 7244
127 Ga0209676_1005173 3300025292 Bacteria 6935
128 Ga0209676_1010327 3300025292 Bacteria 3907
129 Ga0209025_1000069 3300025294 Bacteria 290193
130 Ga0209025_1000076 3300025294 Bacteria 273934
131 Ga0209025_1003682 3300025294 Bacteria 14145
132 Ga0209025_1032329 3300025294 Bacteria 2448
133 Ga0209564_1000004 3300025295 Bacteria 1424639
134 Ga0209564_1000148 3300025295 Bacteria 172177
135 Ga0209564_1000774 3300025295 Bacteria 44427
136 Ga0209564_1006287 3300025295 Bacteria 6468
137 Ga0209564_1008042 3300025295 Bacteria 5286
138 Ga0209758_1000031 3300025297 Bacteria 497252
139 Ga0209758_1000473 3300025297 Bacteria 66352
140 Ga0209758_1016533 3300025297 Bacteria 3740
141 Ga0209050_1000182 3300025298 Bacteria 142435
142 Ga0209050_1000865 3300025298 Bacteria 40908
143 Ga0209050_1000896 3300025298 Bacteria 39492
144 Ga0209050_1001162 3300025298 Bacteria 31283
145 Ga0209050_1008268 3300025298 Bacteria 5609
146 Ga0209050_1021330 3300025298 Bacteria 2367
147 Ga0209050_1038267 3300025298 Bacteria 1370
148 Ga0209050_1047727 3300025298 Bacteria 1113
149 Ga0209256_1000004 3300025299 Bacteria 1424643
150 Ga0209256_1000274 3300025299 Bacteria 90266
151 Ga0209256_1002402 3300025299 Bacteria 15383
152 Ga0209256_1002608 3300025299 Bacteria 14282
153 Ga0209256_1004568 3300025299 Bacteria 8588
154 Ga0209256_1004676 3300025299 Bacteria 8404
155 Ga0209256_1007093 3300025299 Bacteria 5659
156 Ga0209256_1017768 3300025299 Bacteria 2345
157 Ga0207426_1016653 3300025302 Bacteria 2632
158 Ga0209051_1001702 3300025303 Bacteria 17612
159 Ga0209257_1000154 3300025304 Bacteria 185887
160 Ga0209257_1000348 3300025304 Bacteria 95101
161 Ga0209257_1000470 3300025304 Bacteria 73603
162 Ga0209257_1000611 3300025304 Bacteria 58189
163 Ga0209257_1001025 3300025304 Bacteria 37552
164 Ga0209257_1002151 3300025304 Bacteria 20504
165 Ga0209257_1002838 3300025304 Bacteria 16251
166 Ga0209257_1003487 3300025304 Bacteria 13410
167 Ga0209257_1007254 3300025304 Bacteria 6773
168 Ga0207713_1000290 3300025735 Bacteria 58238
169 Ga0207645_10308079 3300025907 Bacteria 1055
170 Ga0207649_10152419 3300025920 Bacteria 1593
171 Ga0207681_10022772 3300025923 Bacteria 3999
172 Ga0207681_10182794 3300025923 Bacteria 1598
173 Ga0207650_10005266 3300025925 Bacteria 8822
174 Ga0207659_10165328 3300025926 Bacteria 1741
175 Ga0207644_10129291 3300025931 Bacteria 1931
176 Ga0207709_10002288 3300025935 Bacteria 12152
177 Ga0207669_10406831 3300025937 Bacteria 1067
178 Ga0207691_10001199 3300025940 Bacteria 25800
179 Ga0207711_10272170 3300025941 Bacteria 1558
180 Ga0207668_10066264 3300025972 Bacteria 2559
181 Ga0207658_10116920 3300025986 Bacteria 2119
182 Ga0207675_100867093 3300026118 Bacteria 918
183 Ga0207683_10016313 3300026121 Bacteria 6322
184 Ga0209281_1002482 3300027111 Bacteria 7319
185 Ga0209371_1000031 3300027312 Bacteria 399263
186 Ga0209371_1000045 3300027312 Bacteria 316174
187 Ga0209995_1013176 3300027471 Bacteria 1353
188 Ga0209999_1001612 3300027543 Bacteria 3888
189 Ga0209983_1005692 3300027665 Bacteria 2571
190 Ga0268266_10203650 3300028379 Bacteria 1812
191 Ga0268264_11120891 3300028381 Bacteria 795
192 Ga0307515_10365716 3300028794 Bacteria 1081
193 Ga0268256_1000034 3300030500 Bacteria 398909
194 Ga0268256_1000047 3300030500 Bacteria 316174
195 Ga0316176_1213746 3300030732 Bacteria 1404
196 Ga0316183_1128623 3300030742 Bacteria 3295
197 Ga0307513_10008176 3300031456 Bacteria 13424
198 Ga0307513_10384424 3300031456 Bacteria 1142
199 Ga0307413_10023991 3300031824 Bacteria 3316
200 Ga0307406_10046640 3300031901 Bacteria 2727
201 Ga0307406_10310376 3300031901 Bacteria 1216
202 Ga0307414_10004133 3300032004 Bacteria 7838
203 Ga0307414_10064443 3300032004 Bacteria 2609
204 Ga0307414_10104191 3300032004 Bacteria 2142
205 Ga0307414_10238287 3300032004 Bacteria 1504
206 Ga0307414_10257016 3300032004 Bacteria 1455
207 Ga0307411_10192011 3300032005 Bacteria 1560
208 Ga0307415_101069925 3300032126 Bacteria 754
209 Ga0395899_0238250 3300037312 Bacteria 1253
210 Ga0395899_0458421 3300037312 Bacteria 833
211 Ga0395900_0047110 3300037418 Bacteria 4438
212 Ga0395900_0142880 3300037418 Bacteria 2450
213 Ga0395898_0044960 3300037466 Bacteria 4341
214 Ga0395898_0148205 3300037466 Bacteria 2246
215 Ga0395905_0004859 3300037471 Bacteria 13853
216 Ga0395905_0034657 3300037471 Bacteria 4741
217 Ga0395905_0245507 3300037471 Bacteria 1673
218 Ga0395905_0284333 3300037471 Bacteria 1540
219 Ga0395905_1041389 3300037471 Bacteria 721
220 Ga0395901_0619321 3300038443 Bacteria 1089
221 Ga0237819_00824 3300038705 Bacteria 9797
222 Ga0237819_07876 3300038705 Bacteria 1500
223 Ga0439436_0025219 3300041404 Bacteria 1748
224 Ga0439436_0030924 3300041404 Bacteria 1555
225 Ga0439447_009161 3300041407 Bacteria 3017
226 Ga0439466_0069339 3300041411 Bacteria 1125
227 Ga0439465_0002410 3300041413 Bacteria 6125
228 Ga0439465_0043757 3300041413 Bacteria 1453
229 Ga0451791_1444411 3300041451 Bacteria 2154
230 Ga0451791_1619608 3300041451 Bacteria 3267
231 Ga0451793_0584371 3300041452 Bacteria 1069
232 Ga0451800_0341829 3300041459 Bacteria 1085
233 Ga0451800_0933770 3300041459 Bacteria 6310
234 Ga0451806_009973 3300041462 Bacteria 8615
235 Ga0451804_0198061 3300041463 Bacteria 3164
236 Ga0451807_2499404 3300041486 Bacteria 1303
237 Ga0451837_0589154 3300041494 Bacteria 970
238 Ga0451837_0839418 3300041494 Bacteria 2899
239 Ga0451843_0468904 3300041509 Bacteria 2338
240 Ga0451843_0824203 3300041509 Bacteria 1825
241 Ga0451853_0554745 3300041512 Bacteria 919
242 Ga0439445_0002498 3300042004 Bacteria 4094
243 Ga0439445_0039912 3300042004 Bacteria 1245
244 Ga0439432_056157 3300042006 Bacteria 1220
245 Ga0439449_0000397 3300042007 Bacteria 16116
246 Ga0439449_0003184 3300042007 Bacteria 6395
247 Ga0439449_0013956 3300042007 Bacteria 3022
248 Ga0439449_0027202 3300042007 Bacteria 2134
249 Ga0439449_0099152 3300042007 Bacteria 1076
250 Ga0439452_008175 3300042010 Bacteria 3164
251 Ga0439457_023403 3300042014 Bacteria 1367
252 Ga0450904_000539 3300042139 Bacteria 7181
253 Ga0450905_003222 3300042142 Bacteria 2141
254 Ga0439440_0009275 3300042993 Bacteria 2038
255 Ga0466969_0102418 3300044656 Bacteria 1346
256 Ga0453683_0018262 3300044673 Bacteria 4503
257 Ga0466968_0264087 3300044735 Bacteria 820
258 Ga0495617_000046 3300046452 Bacteria 115430
259 Ga0495617_002430 3300046452 Bacteria 7407
260 Ga0495627_000476 3300046453 Bacteria 33973
261 Ga0495627_003852 3300046453 Bacteria 6440
262 Ga0495627_009994 3300046453 Bacteria 3468
263 Ga0495603_0018570 3300046455 Bacteria 4206
264 Ga0495603_0152978 3300046455 Bacteria 1339
265 Ga0495590_0000134 3300046457 Bacteria 43957
266 Ga0495590_0002591 3300046457 Bacteria 7473
267 Ga0495590_0007426 3300046457 Bacteria 4228
268 Ga0495591_002132 3300046458 Bacteria 11370
269 Ga0495591_004885 3300046458 Bacteria 6379
270 Ga0495629_0040952 3300046459 Bacteria 3259
271 Ga0495629_0071186 3300046459 Bacteria 2427
272 Ga0495638_0035575 3300046460 Bacteria 3174
273 Ga0495638_0096024 3300046460 Bacteria 1779
274 Ga0495638_0137641 3300046460 Bacteria 1428
275 Ga0495653_0006028 3300046463 Bacteria 9926
276 Ga0495653_0021028 3300046463 Bacteria 5288
277 Ga0495650_0001029 3300046471 Bacteria 31365
278 Ga0495650_0001525 3300046471 Bacteria 21990
279 Ga0495650_0019575 3300046471 Bacteria 3326
280 Ga0495650_0025570 3300046471 Bacteria 2764
281 Ga0495580_0009495 3300046472 Bacteria 7646
282 Ga0495580_0287287 3300046472 Bacteria 1121
283 Ga0495582_0012860 3300046473 Bacteria 4612
284 Ga0495582_0021249 3300046473 Bacteria 3552
285 Ga0495582_0034839 3300046473 Bacteria 2767
286 Ga0495582_0336819 3300046473 Bacteria 868
287 Ga0495605_0000284 3300046474 Bacteria 56120
288 Ga0495605_0026709 3300046474 Bacteria 2998
289 Ga0495605_0027812 3300046474 Bacteria 2925
290 Ga0495605_0036572 3300046474 Bacteria 2474
291 Ga0495664_0463700 3300046477 Bacteria 758
292 Ga0495584_0000276 3300046491 Bacteria 36518
293 Ga0495584_0001079 3300046491 Bacteria 16954
294 Ga0495584_0021778 3300046491 Bacteria 3254
295 Ga0495584_0076978 3300046491 Bacteria 1677
296 Ga0495584_0089524 3300046491 Bacteria 1551
297 Ga0495584_0097569 3300046491 Bacteria 1484
298 Ga0495585_0000150 3300046492 Bacteria 75556
299 Ga0495585_0000181 3300046492 Bacteria 66971
300 Ga0495585_0001569 3300046492 Bacteria 17755
301 Ga0495585_0002464 3300046492 Bacteria 13235
302 Ga0495585_0006089 3300046492 Bacteria 7537
303 Ga0495585_0007441 3300046492 Bacteria 6701
304 Ga0495585_0007706 3300046492 Bacteria 6562
305 Ga0495585_0010621 3300046492 Bacteria 5472
306 Ga0495585_0015589 3300046492 Bacteria 4415
307 Ga0495585_0018633 3300046492 Bacteria 4003
308 Ga0495585_0018992 3300046492 Bacteria 3966
309 Ga0495585_0030887 3300046492 Bacteria 3045
310 Ga0495585_0046021 3300046492 Bacteria 2434
311 Ga0495585_0135035 3300046492 Bacteria 1295
312 Ga0495594_0006527 3300046499 Bacteria 5999
313 Ga0495594_0008597 3300046499 Bacteria 5262
314 Ga0495594_0024672 3300046499 Bacteria 3231
315 Ga0495594_0111654 3300046499 Bacteria 1541
316 Ga0495596_0000386 3300046500 Bacteria 28174
317 Ga0495596_0001238 3300046500 Bacteria 14862
318 Ga0495596_0001598 3300046500 Bacteria 12897
319 Ga0495596_0001797 3300046500 Bacteria 11937
320 Ga0495596_0002959 3300046500 Bacteria 8811
321 Ga0495596_0005557 3300046500 Bacteria 5928
322 Ga0495596_0009569 3300046500 Bacteria 4258
323 Ga0495596_0014374 3300046500 Bacteria 3336
324 Ga0495596_0050696 3300046500 Bacteria 1626
325 Ga0495596_0076974 3300046500 Bacteria 1295
326 Ga0495596_0080617 3300046500 Bacteria 1263
327 Ga0495607_0001573 3300046501 Bacteria 19927
328 Ga0495607_0012243 3300046501 Bacteria 5670
329 Ga0495607_0018228 3300046501 Bacteria 4481
330 Ga0495607_0023619 3300046501 Bacteria 3845
331 Ga0495607_0030754 3300046501 Bacteria 3292
332 Ga0495607_0073198 3300046501 Bacteria 1905
333 Ga0495583_0002424 3300046506 Bacteria 15992
334 Ga0495583_0002792 3300046506 Bacteria 14379
335 Ga0495583_0008007 3300046506 Bacteria 6530
336 Ga0495583_0166000 3300046506 Bacteria 909
337 Ga0495606_0002880 3300046507 Bacteria 19018
338 Ga0495606_0007137 3300046507 Bacteria 10093
339 Ga0495606_0010975 3300046507 Bacteria 7443
340 Ga0495606_0026638 3300046507 Bacteria 4118
341 Ga0495606_0029636 3300046507 Bacteria 3837
342 Ga0495606_0048034 3300046507 Bacteria 2811
343 Ga0495606_0088573 3300046507 Bacteria 1908
344 Ga0495606_0113521 3300046507 Bacteria 1631
345 Ga0495610_0001163 3300046512 Bacteria 23950
346 Ga0495616_0000644 3300046513 Bacteria 25952
347 Ga0495616_0001306 3300046513 Bacteria 17424
348 Ga0495616_0014726 3300046513 Bacteria 4368
349 Ga0495616_0016590 3300046513 Bacteria 4073
350 Ga0495616_0023248 3300046513 Bacteria 3336
351 Ga0495616_0024137 3300046513 Bacteria 3264
352 Ga0495616_0032427 3300046513 Bacteria 2729
353 Ga0495616_0033256 3300046513 Bacteria 2688
354 Ga0495616_0034954 3300046513 Bacteria 2604
355 Ga0495616_0037455 3300046513 Bacteria 2495
356 Ga0495616_0052991 3300046513 Bacteria 2018
357 Ga0495620_0012813 3300046515 Bacteria 4313
358 Ga0495630_0466754 3300046517 Bacteria 967
359 Ga0495631_0000279 3300046518 Bacteria 35571
360 Ga0495631_0000531 3300046518 Bacteria 25562
361 Ga0495631_0006260 3300046518 Bacteria 6165
362 Ga0495631_0007833 3300046518 Bacteria 5416
363 Ga0495631_0011081 3300046518 Bacteria 4447
364 Ga0495631_0012022 3300046518 Bacteria 4242
365 Ga0495631_0013083 3300046518 Bacteria 4035
366 Ga0495631_0063784 3300046518 Bacteria 1595
367 Ga0495631_0071514 3300046518 Bacteria 1498
368 Ga0495632_0001071 3300046519 Bacteria 23465
369 Ga0495632_0001258 3300046519 Bacteria 21488
370 Ga0495632_0001682 3300046519 Bacteria 18102
371 Ga0495632_0007310 3300046519 Bacteria 6959
372 Ga0495632_0023371 3300046519 Bacteria 3302
373 Ga0495632_0033026 3300046519 Bacteria 2660
374 Ga0495637_0000329 3300046520 Bacteria 36747
375 Ga0495637_0000349 3300046520 Bacteria 35312
376 Ga0495643_0000931 3300046522 Bacteria 30502
377 Ga0495643_0002769 3300046522 Bacteria 13408
378 Ga0495643_0017729 3300046522 Bacteria 4155
379 Ga0495643_0018330 3300046522 Bacteria 4071
380 Ga0495643_0018427 3300046522 Bacteria 4056
381 Ga0495643_0024012 3300046522 Bacteria 3461
382 Ga0495643_0026836 3300046522 Bacteria 3244
383 Ga0495643_0205961 3300046522 Bacteria 941
384 Ga0495644_0001025 3300046523 Bacteria 11643
385 Ga0495644_0005634 3300046523 Bacteria 4884
386 Ga0495644_0007182 3300046523 Bacteria 4303
387 Ga0495644_0010211 3300046523 Bacteria 3618
388 Ga0495644_0015747 3300046523 Bacteria 2897
389 Ga0495644_0019460 3300046523 Bacteria 2592
390 Ga0495644_0032824 3300046523 Bacteria 1962
391 Ga0495644_0044796 3300046523 Bacteria 1664
392 Ga0495648_0000846 3300046524 Bacteria 32280
393 Ga0495648_0002900 3300046524 Bacteria 15420
394 Ga0495648_0004130 3300046524 Bacteria 12496
395 Ga0495648_0052587 3300046524 Bacteria 2473
396 Ga0495648_0294537 3300046524 Bacteria 763
397 Ga0495663_0001362 3300046525 Bacteria 7702
398 Ga0495663_0007405 3300046525 Bacteria 3034
399 Ga0495663_0008166 3300046525 Bacteria 2897
400 Ga0495663_0012837 3300046525 Bacteria 2338
401 Ga0495663_0014724 3300046525 Bacteria 2195
402 Ga0495663_0035956 3300046525 Bacteria 1489
403 Ga0495666_0000578 3300046526 Bacteria 16382
404 Ga0495666_0006281 3300046526 Bacteria 5984
405 Ga0495642_0000241 3300046528 Bacteria 30854
406 Ga0495642_0001118 3300046528 Bacteria 12362
407 Ga0495642_0002439 3300046528 Bacteria 7569
408 Ga0495642_0004485 3300046528 Bacteria 5420
409 Ga0495642_0015792 3300046528 Bacteria 2939
410 Ga0495642_0055338 3300046528 Bacteria 1637
411 Ga0495642_0074345 3300046528 Bacteria 1424
412 Ga0495652_0031608 3300046529 Bacteria 4635
413 Ga0495654_0000025 3300046530 Bacteria 236572
414 Ga0495654_0037676 3300046530 Bacteria 2422
415 Ga0495654_0039907 3300046530 Bacteria 2341
416 Ga0495665_0002194 3300046531 Bacteria 10569
417 Ga0495665_0031475 3300046531 Bacteria 2839
418 Ga0495665_0202685 3300046531 Bacteria 1028
419 Ga0495586_0189842 3300046535 Bacteria 1163
420 Ga0495587_0130771 3300046536 Bacteria 1434
421 Ga0495587_0399798 3300046536 Bacteria 763
422 Ga0495609_0000846 3300046538 Bacteria 22605
423 Ga0495609_0001506 3300046538 Bacteria 15365
424 Ga0495609_0001754 3300046538 Bacteria 13939
425 Ga0495609_0001905 3300046538 Bacteria 13307
426 Ga0495609_0006582 3300046538 Bacteria 5916
427 Ga0495609_0022039 3300046538 Bacteria 2936
428 Ga0495609_0028941 3300046538 Bacteria 2525
429 Ga0495609_0095586 3300046538 Bacteria 1289
430 Ga0495597_0000531 3300046542 Bacteria 31589
431 Ga0495597_0005381 3300046542 Bacteria 6784
432 Ga0495597_0005402 3300046542 Bacteria 6767
433 Ga0495597_0005943 3300046542 Bacteria 6368
434 Ga0495597_0007324 3300046542 Bacteria 5616
435 Ga0495597_0010383 3300046542 Bacteria 4552
436 Ga0495597_0048100 3300046542 Bacteria 1887
437 Ga0495597_0051925 3300046542 Bacteria 1806
438 Ga0495622_0003256 3300046557 Bacteria 7681
439 Ga0495622_0046674 3300046557 Bacteria 2012
440 Ga0495622_0082905 3300046557 Bacteria 1475
441 Ga0495633_0002165 3300046558 Bacteria 14090
442 Ga0495633_0002394 3300046558 Bacteria 13284
443 Ga0495633_0002683 3300046558 Bacteria 12369
444 Ga0495633_0008728 3300046558 Bacteria 5680
445 Ga0495633_0040469 3300046558 Bacteria 2220
446 Ga0495633_0042618 3300046558 Bacteria 2154
447 Ga0495633_0045225 3300046558 Bacteria 2085
448 Ga0495633_0051646 3300046558 Bacteria 1936
449 Ga0495633_0067666 3300046558 Bacteria 1667
450 Ga0495633_0121946 3300046558 Bacteria 1207
451 Ga0495667_0044905 3300046559 Bacteria 2926
452 Ga0495656_0000725 3300046615 Bacteria 10653
453 Ga0495656_0002235 3300046615 Bacteria 6398
454 Ga0495656_0131437 3300046615 Bacteria 1192
455 Ga0495668_0000210 3300046616 Bacteria 84755
456 Ga0495668_0000906 3300046616 Bacteria 33252
457 Ga0495668_0001500 3300046616 Bacteria 22305
458 Ga0495668_0003252 3300046616 Bacteria 12350
459 Ga0495668_0007049 3300046616 Bacteria 7245
460 Ga0495668_0008911 3300046616 Bacteria 6205
461 Ga0495668_0009320 3300046616 Bacteria 6035
462 Ga0495668_0009515 3300046616 Bacteria 5962
463 Ga0495668_0012968 3300046616 Bacteria 4933
464 Ga0495668_0044390 3300046616 Bacteria 2470
465 Ga0495634_0008190 3300046642 Bacteria 7790
466 Ga0495611_0000780 3300046648 Bacteria 17711
467 Ga0495611_0002724 3300046648 Bacteria 7949
468 Ga0495611_0022624 3300046648 Bacteria 2720
469 Ga0495611_0066957 3300046648 Bacteria 1638
470 Ga0495611_0077937 3300046648 Bacteria 1520
471 Ga0495611_0124816 3300046648 Bacteria 1200
472 Ga0495611_0143764 3300046648 Bacteria 1113
473 Ga0495611_0161630 3300046648 Bacteria 1046
474 Ga0495625_0000821 3300046660 Bacteria 42765
475 Ga0495625_0001740 3300046660 Bacteria 25173
476 Ga0495625_0005169 3300046660 Bacteria 12040
477 Ga0495625_0018084 3300046660 Bacteria 5509
478 Ga0495635_0010078 3300046663 Bacteria 6607
479 Ga0495659_0002752 3300046664 Bacteria 5656
480 Ga0495659_0178023 3300046664 Bacteria 865
481 Ga0495661_0001879 3300046665 Bacteria 16772
482 Ga0495661_0002173 3300046665 Bacteria 15314
483 Ga0495661_0003143 3300046665 Bacteria 12366
484 Ga0495661_0010058 3300046665 Bacteria 6469
485 Ga0495661_0011924 3300046665 Bacteria 5883
486 Ga0495661_0017553 3300046665 Bacteria 4724
487 Ga0495661_0028742 3300046665 Bacteria 3555
488 Ga0495661_0031066 3300046665 Bacteria 3394
489 Ga0495661_0051642 3300046665 Bacteria 2481
490 Ga0495661_0088259 3300046665 Bacteria 1770
491 Ga0495661_0107449 3300046665 Bacteria 1560
492 Ga0495661_0112446 3300046665 Bacteria 1515
493 Ga0495661_0132191 3300046665 Bacteria 1366
494 Ga0495588_0004088 3300046674 Bacteria 6421
495 Ga0495588_0016640 3300046674 Bacteria 3556
496 Ga0495588_0023670 3300046674 Bacteria 3042
497 Ga0495588_0091182 3300046674 Bacteria 1596
498 Ga0495599_0131589 3300046678 Bacteria 1554
499 Ga0495599_0292654 3300046678 Bacteria 984
500 Ga0495669_0000301 3300046684 Bacteria 27468
501 Ga0495669_0000538 3300046684 Bacteria 17062
502 Ga0495669_0001610 3300046684 Bacteria 9268
503 Ga0495669_0018286 3300046684 Bacteria 3012
504 Ga0495669_0018683 3300046684 Bacteria 2982
505 Ga0495669_0036128 3300046684 Bacteria 2183
506 Ga0495613_0112571 3300046689 Bacteria 1960
507 Ga0495624_0460793 3300046690 Bacteria 761
508 Ga0495670_0014701 3300046691 Bacteria 3850
509 Ga0495670_0015441 3300046691 Bacteria 3752
510 Ga0495670_0050152 3300046691 Bacteria 2089
511 Ga0495670_0070734 3300046691 Bacteria 1765
512 Ga0495670_0075962 3300046691 Bacteria 1706
513 Ga0495670_0210375 3300046691 Bacteria 1031
514 Ga0495670_0320323 3300046691 Bacteria 832
515 Ga0495671_0000893 3300046692 Bacteria 21240
516 Ga0495671_0001997 3300046692 Bacteria 13116
517 Ga0495671_0002713 3300046692 Bacteria 11086
518 Ga0495671_0149757 3300046692 Bacteria 1136
519 Ga0495649_0001486 3300046694 Bacteria 17605
520 Ga0495649_0003700 3300046694 Bacteria 10173
521 Ga0495649_0027625 3300046694 Bacteria 3147
522 Ga0495589_0000595 3300046794 Bacteria 24705
523 Ga0495589_0004794 3300046794 Bacteria 7186
524 Ga0495589_0015083 3300046794 Bacteria 3978
525 Ga0495589_0021880 3300046794 Bacteria 3266
526 Ga0495589_0031000 3300046794 Bacteria 2692
527 Ga0495589_0136369 3300046794 Bacteria 1176
528 Ga0495589_0168223 3300046794 Bacteria 1042
529 Ga0495660_0001934 3300046810 Bacteria 13490
530 Ga0495660_0040767 3300046810 Bacteria 2572
531 Ga0495660_0076692 3300046810 Bacteria 1760
532 Ga0495660_0084771 3300046810 Bacteria 1657
533 Ga0495660_0152801 3300046810 Bacteria 1138
534 Ga0495604_0013287 3300047317 Bacteria 6556
535 Ga0495604_0124048 3300047317 Bacteria 1865
536 Ga0495636_0029859 3300047318 Bacteria 2226
537 Ga0495636_0187531 3300047318 Bacteria 940
538 Ga0495674_0002787 3300047319 Bacteria 16961
539 Ga0495672_0000092 3300047320 Bacteria 146431
540 Ga0495672_0000732 3300047320 Bacteria 36104
541 Ga0495672_0000769 3300047320 Bacteria 34882
542 Ga0495672_0000895 3300047320 Bacteria 31259
543 Ga0495672_0101172 3300047320 Bacteria 1562
544 Ga0495672_0119721 3300047320 Bacteria 1401
545 Ga0495676_0000099 3300047321 Bacteria 65701
546 Ga0495676_0006300 3300047321 Bacteria 10919
547 Ga0495680_0007715 3300047322 Bacteria 9827
548 Ga0495680_0028277 3300047322 Bacteria 4598
549 Ga0495680_0298287 3300047322 Bacteria 1132
550 Ga0495683_0000304 3300047323 Bacteria 41515
551 Ga0495683_0000843 3300047323 Bacteria 21776
552 Ga0495683_0002827 3300047323 Bacteria 10287
553 Ga0495683_0008642 3300047323 Bacteria 5440
554 Ga0495683_0024859 3300047323 Bacteria 3072
555 Ga0495683_0027472 3300047323 Bacteria 2909
556 Ga0495687_001071 3300047443 Bacteria 26962
557 Ga0495687_001138 3300047443 Bacteria 25784
558 Ga0495687_001176 3300047443 Bacteria 25213
559 Ga0495687_146650 3300047443 Bacteria 812
560 Ga0495675_0022715 3300047444 Bacteria 4000
561 Ga0495675_0041969 3300047444 Bacteria 2914
562 Ga0495675_0113568 3300047444 Bacteria 1689
563 Ga0495677_0000482 3300047445 Bacteria 16922
564 Ga0495677_0001127 3300047445 Bacteria 10691
565 Ga0495677_0004030 3300047445 Bacteria 5671
566 Ga0495677_0008195 3300047445 Bacteria 3882
567 Ga0495677_0011987 3300047445 Bacteria 3164
568 Ga0495677_0027051 3300047445 Bacteria 2080
569 Ga0495677_0031367 3300047445 Bacteria 1934
570 Ga0495679_005612 3300047446 Bacteria 5534
571 Ga0495679_014603 3300047446 Bacteria 2902
572 Ga0495679_054457 3300047446 Bacteria 1191
573 Ga0495685_000869 3300047447 Bacteria 9201
574 Ga0495685_001601 3300047447 Bacteria 6976
575 Ga0495685_005414 3300047447 Bacteria 4166
576 Ga0495685_014299 3300047447 Bacteria 2697
577 Ga0495673_0000074 3300047469 Bacteria 210788
578 Ga0495673_0000194 3300047469 Bacteria 96014
579 Ga0495673_0003436 3300047469 Bacteria 10437
580 Ga0495673_0116686 3300047469 Bacteria 1061
581 Ga0495681_0000330 3300047470 Bacteria 37408
582 Ga0495681_0001200 3300047470 Bacteria 19721
583 Ga0495681_0001614 3300047470 Bacteria 16786
584 Ga0495681_0003002 3300047470 Bacteria 11873
585 Ga0495681_0008156 3300047470 Bacteria 6593
586 Ga0495681_0010660 3300047470 Bacteria 5551
587 Ga0495681_0030239 3300047470 Bacteria 2760
588 Ga0495681_0038550 3300047470 Bacteria 2341
589 Ga0495681_0044654 3300047470 Bacteria 2127
590 Ga0495681_0053563 3300047470 Bacteria 1888
591 Ga0495681_0058307 3300047470 Bacteria 1789
592 Ga0495681_0079297 3300047470 Bacteria 1469
593 Ga0495686_0001068 3300047472 Bacteria 32627
594 Ga0495686_0001657 3300047472 Bacteria 23205
595 Ga0495686_0002128 3300047472 Bacteria 19378
596 Ga0495686_0015733 3300047472 Bacteria 5153
597 Ga0495686_0124743 3300047472 Bacteria 1532
598 Ga0495593_0001611 3300047673 Bacteria 13340
599 Ga0495593_0016671 3300047673 Bacteria 4141
600 Ga0495602_0005336 3300048088 Bacteria 13488
601 Ga0495602_0079024 3300048088 Bacteria 2776
602 Ga0495626_0000196 3300048091 Bacteria 73575
603 Ga0495626_0001058 3300048091 Bacteria 23533
604 Ga0495626_0002192 3300048091 Bacteria 14027
605 Ga0495626_0002194 3300048091 Bacteria 14023
606 Ga0495626_0003018 3300048091 Bacteria 11108
607 Ga0495626_0005897 3300048091 Bacteria 7053
608 Ga0495626_0006096 3300048091 Bacteria 6919
609 Ga0495626_0008257 3300048091 Bacteria 5725
610 Ga0495626_0008343 3300048091 Bacteria 5690
611 Ga0495626_0013954 3300048091 Bacteria 4160
612 Ga0495626_0015678 3300048091 Bacteria 3874
613 Ga0495626_0020822 3300048091 Bacteria 3263
614 Ga0495626_0028231 3300048091 Bacteria 2722
615 Ga0495626_0030054 3300048091 Bacteria 2622
616 Ga0495626_0031669 3300048091 Bacteria 2543
617 Ga0496100_0036155 3300048903 Bacteria 3112
618 Ga0496100_0047890 3300048903 Bacteria 2757
619 Ga0496102_0000670 3300048905 Bacteria 34263
620 Ga0496102_0010487 3300048905 Bacteria 7977
621 Ga0496102_0170566 3300048905 Bacteria 2048
622 Ga0496102_0254613 3300048905 Bacteria 1655
623 Ga0496103_0003490 3300048906 Bacteria 9615
624 Ga0496103_0096651 3300048906 Bacteria 1867
625 Ga0496103_0253888 3300048906 Bacteria 1131
626 Ga0496104_0468021 3300048907 Bacteria 1172
627 Ga0496104_0674276 3300048907 Bacteria 942
628 Ga0496105_0071930 3300048908 Bacteria 2858
629 Ga0496108_0091925 3300048911 Bacteria 2579
630 Ga0496109_0714116 3300048912 Bacteria 940
631 Ga0496110_0000333 3300048913 Bacteria 31529
632 Ga0496111_0069440 3300048914 Bacteria 2562
633 Ga0496111_0223523 3300048914 Bacteria 1399
634 Ga0496111_0364387 3300048914 Bacteria 1069
635 Ga0496113_0212138 3300048916 Bacteria 1541
636 Ga0496114_0004682 3300048917 Bacteria 10640
637 Ga0496116_0003037 3300048919 Bacteria 16975
638 Ga0496116_0036483 3300048919 Bacteria 3439
639 Ga0496117_0002348 3300048920 Bacteria 24193
640 Ga0496117_0004119 3300048920 Bacteria 16288
641 Ga0496117_0187127 3300048920 Bacteria 1183
642 Ga0496118_0004569 3300048921 Bacteria 16301
643 Ga0496118_0014921 3300048921 Bacteria 7231
644 Ga0496118_0016956 3300048921 Bacteria 6652
645 Ga0496118_0019003 3300048921 Bacteria 6161
646 Ga0496118_0072807 3300048921 Bacteria 2465
647 Ga0496119_0000176 3300048922 Bacteria 89501
648 Ga0496119_0001471 3300048922 Bacteria 28191
649 Ga0496120_0000277 3300048923 Bacteria 85951
650 Ga0496120_0003247 3300048923 Bacteria 15046
651 Ga0496121_0036323 3300048924 Bacteria 4392
652 Ga0496121_0119632 3300048924 Bacteria 1991
653 Ga0496122_0001792 3300048925 Bacteria 32883
654 Ga0496122_0009056 3300048925 Bacteria 10565
655 Ga0496122_0011708 3300048925 Bacteria 8840
656 Ga0496122_0014795 3300048925 Bacteria 7517
657 Ga0496122_0034237 3300048925 Bacteria 4160
658 Ga0496122_0197304 3300048925 Bacteria 1180
659 Ga0496122_0270494 3300048925 Bacteria 936
660 Ga0496123_0001387 3300048926 Bacteria 33973
661 Ga0496123_0009350 3300048926 Bacteria 8840
662 Ga0496123_0010195 3300048926 Bacteria 8339
663 Ga0496123_0014236 3300048926 Bacteria 6610
664 Ga0496123_0017269 3300048926 Bacteria 5816
665 Ga0496124_0000020 3300048927 Bacteria 434107
666 Ga0496124_0001413 3300048927 Bacteria 35745
667 Ga0496124_0001960 3300048927 Bacteria 28118
668 Ga0496124_0009419 3300048927 Bacteria 10058
669 Ga0496124_0026544 3300048927 Bacteria 5219
670 Ga0496124_0094207 3300048927 Bacteria 2436
671 Ga0496124_0111670 3300048927 Bacteria 2198
672 Ga0496124_0413564 3300048927 Bacteria 932
673 Ga0496124_0441277 3300048927 Bacteria 890
674 Ga0496124_0476243 3300048927 Bacteria 844
675 Ga0496125_0001174 3300048928 Bacteria 39666
676 Ga0496125_0001742 3300048928 Bacteria 30235
677 Ga0496125_0028128 3300048928 Bacteria 5083
678 Ga0496125_0080177 3300048928 Bacteria 2499
679 Ga0496125_0088709 3300048928 Bacteria 2330
680 Ga0496125_0304053 3300048928 Bacteria 975
681 Ga0496125_0441257 3300048928 Bacteria 748
682 Ga0496126_0017494 3300048929 Bacteria 7140
683 Ga0496126_0034531 3300048929 Bacteria 4749
684 Ga0496126_0037648 3300048929 Bacteria 4511
685 Ga0496126_0136390 3300048929 Bacteria 2116
686 Ga0496126_0170349 3300048929 Bacteria 1855
687 Ga0496126_0340679 3300048929 Bacteria 1228
688 Ga0495678_000146 3300049459 Bacteria 85995
689 Ga0495678_000561 3300049459 Bacteria 35692
690 Ga0495678_001260 3300049459 Bacteria 20572
691 Ga0495678_001614 3300049459 Bacteria 17233
692 Ga0495682_0021466 3300049460 Bacteria 2419
693 Ga0495682_0025443 3300049460 Bacteria 2202
694 Ga0495682_0121912 3300049460 Bacteria 933
695 Ga0501290_000414 3300049513 Bacteria 6791
696 Ga0501031_0007657 3300049568 Bacteria 7028
697 Ga0501032_0008208 3300049569 Bacteria 7609
698 Ga0501034_0000448 3300049571 Bacteria 68146
699 Ga0501034_0000798 3300049571 Bacteria 46906
700 Ga0501034_0002483 3300049571 Bacteria 22159
701 Ga0501034_0004657 3300049571 Bacteria 15193
702 Ga0501034_0019800 3300049571 Bacteria 6878
703 Ga0501034_0455151 3300049571 Bacteria 1197
704 Ga0501036_0003765 3300049572 Bacteria 12156
705 Ga0501036_0765487 3300049572 Bacteria 796
706 Ga0501037_0003115 3300049573 Bacteria 12021
707 Ga0501038_0000610 3300049574 Bacteria 31817
708 Ga0501043_0003950 3300049579 Bacteria 12160
709 Ga0501043_0005273 3300049579 Bacteria 10448
710 Ga0501047_0111938 3300049581 Bacteria 2612
711 Ga0501068_0043555 3300049584 Bacteria 2701
712 Ga0501070_0055366 3300049586 Bacteria 3287
713 Ga0501073_0006493 3300049589 Bacteria 8702
714 Ga0501074_0299007 3300049590 Bacteria 1143
715 Ga0501222_013147 3300049662 Bacteria 1089
716 Ga0501221_044051 3300049704 Bacteria 984
717 Ga0501080_0005548 3300049742 Bacteria 11267
718 Ga0501275_000560 3300049772 Bacteria 4150
719 Ga0501279_001829 3300049775 Bacteria 2805
720 Ga0501035_0002406 3300049822 Bacteria 18342
721 Ga0501044_0002382 3300049823 Bacteria 21418
722 Ga0501044_0085735 3300049823 Bacteria 3182
723 nmdc:mga03n38_311153_c1 3300050490 Bacteria 848
724 nmdc:mga00v17_121611_c1 3300050491 Bacteria 1663
725 nmdc:mga00v17_153585_c1 3300050491 Bacteria 1480
726 nmdc:mga00v17_174012_c1 3300050491 Bacteria 1389
727 nmdc:mga00v17_680_c1 3300050491 Bacteria 18694
728 nmdc:mga00v17_90175_c2 3300050491 Bacteria 1631
729 nmdc:mga0yw44_310926_c1 3300050492 Bacteria 1057
730 Ga0500577_0097258 3300053142 Bacteria 1199
731 Ga0500634_0000117 3300053161 Bacteria 29635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027665 Ga0209983_1005692 Ga0209983_10056922 206
2 3300049571 Ga0501034_0455151 Ga0501034_0455151_324_1022 207
3 3300047469 Ga0495673_0000194 Ga0495673_0000194_26497_27174 209
4 3300027471 Ga0209995_1013176 Ga0209995_10131762 210
5 3300031824 Ga0307413_10023991 Ga0307413_100239914 210
6 3300005262 Ga0065165_1002094 Ga0065165_100209410 211
7 3300026118 Ga0207675_100867093 Ga0207675_1008670931 211
8 3300005543 Ga0070672_100065259 Ga0070672_1000652593 213
9 3300002774 JGI25150J39212_1005002 JGI25150J39212_10050024 214
10 3300002987 JGI25159J45721_1005393 JGI25159J45721_10053934 214
11 3300003215 JGI25153J46596_10006705 JGI25153J46596_100067051 214
12 3300003354 JGI25160J50197_1014123 JGI25160J50197_10141233 214
13 3300003771 Ga0055526_1000739 Ga0055526_10007397 214
14 3300003773 Ga0055537_1000172 Ga0055537_100017226 214
15 3300003775 Ga0055524_1002415 Ga0055524_10024155 214
16 3300003775 Ga0055524_1003668 Ga0055524_10036686 214
17 3300003784 Ga0055534_1000169 Ga0055534_100016928 214
18 3300003790 Ga0055528_1000482 Ga0055528_10004827 214
19 3300003790 Ga0055528_1000486 Ga0055528_100048628 214
20 3300003791 Ga0055530_10005750 Ga0055530_100057501 214
21 3300005262 Ga0065165_1000882 Ga0065165_100088220 214
22 3300025208 Ga0209436_100930 Ga0209436_1009304 214
23 3300025245 Ga0207425_1000013 Ga0207425_100001336 214
24 3300025258 Ga0209129_1000152 Ga0209129_100015237 214
25 3300025263 Ga0209565_1000159 Ga0209565_100015926 214
26 3300025263 Ga0209565_1004850 Ga0209565_10048505 214
27 3300025263 Ga0209565_1008627 Ga0209565_10086272 214
28 3300025273 Ga0209673_1000006 Ga0209673_100000626 214
29 3300025284 Ga0209130_1000521 Ga0209130_100052120 214
30 3300025284 Ga0209130_1001127 Ga0209130_100112710 214
31 3300025291 Ga0209675_1000005 Ga0209675_1000005745 214
32 3300025295 Ga0209564_1000774 Ga0209564_100077426 214
33 3300025295 Ga0209564_1008042 Ga0209564_10080425 214
34 3300025297 Ga0209758_1000031 Ga0209758_1000031428 214
35 3300025298 Ga0209050_1001162 Ga0209050_100116223 214
36 3300025299 Ga0209256_1000274 Ga0209256_100027426 214
37 3300025299 Ga0209256_1002402 Ga0209256_100240212 214
38 3300025302 Ga0207426_1016653 Ga0207426_10166532 214
39 3300025907 Ga0207645_10308079 Ga0207645_103080792 214
40 3300032004 Ga0307414_10257016 Ga0307414_102570162 214
41 3300042139 Ga0450904_000539 Ga0450904_000539_2183_2845 214
42 3300046459 Ga0495629_0040952 Ga0495629_0040952_1683_2345 214
43 3300046459 Ga0495629_0071186 Ga0495629_0071186_869_1531 214
44 3300046460 Ga0495638_0035575 Ga0495638_0035575_1466_2128 214
45 3300046463 Ga0495653_0021028 Ga0495653_0021028_2927_3580 214
46 3300046472 Ga0495580_0009495 Ga0495580_0009495_2426_3079 214
47 3300046472 Ga0495580_0287287 Ga0495580_0287287_363_1025 214
48 3300046473 Ga0495582_0012860 Ga0495582_0012860_2434_3096 214
49 3300046473 Ga0495582_0021249 Ga0495582_0021249_1399_2052 214
50 3300046473 Ga0495582_0336819 Ga0495582_0336819_130_792 214
51 3300046474 Ga0495605_0027812 Ga0495605_0027812_1938_2600 214
52 3300046474 Ga0495605_0036572 Ga0495605_0036572_1422_2084 214
53 3300046477 Ga0495664_0463700 Ga0495664_0463700_23_685 214
54 3300046491 Ga0495584_0001079 Ga0495584_0001079_1592_2254 214
55 3300046491 Ga0495584_0021778 Ga0495584_0021778_1951_2613 214
56 3300046492 Ga0495585_0000150 Ga0495585_0000150_48204_48866 214
57 3300046492 Ga0495585_0000181 Ga0495585_0000181_63023_63685 214
58 3300046492 Ga0495585_0001569 Ga0495585_0001569_15882_16544 214
59 3300046492 Ga0495585_0002464 Ga0495585_0002464_6295_6957 214
60 3300046492 Ga0495585_0006089 Ga0495585_0006089_4522_5184 214
61 3300046492 Ga0495585_0007441 Ga0495585_0007441_3956_4618 214
62 3300046492 Ga0495585_0018633 Ga0495585_0018633_1791_2453 214
63 3300046492 Ga0495585_0030887 Ga0495585_0030887_1662_2324 214
64 3300046499 Ga0495594_0008597 Ga0495594_0008597_1708_2370 214
65 3300046499 Ga0495594_0024672 Ga0495594_0024672_1009_1662 214
66 3300046499 Ga0495594_0111654 Ga0495594_0111654_23_685 214
67 3300046500 Ga0495596_0000386 Ga0495596_0000386_2634_3296 214
68 3300046500 Ga0495596_0001797 Ga0495596_0001797_9809_10471 214
69 3300046500 Ga0495596_0080617 Ga0495596_0080617_348_1010 214
70 3300046501 Ga0495607_0073198 Ga0495607_0073198_332_994 214
71 3300046506 Ga0495583_0002424 Ga0495583_0002424_11033_11689 214
72 3300046506 Ga0495583_0166000 Ga0495583_0166000_93_755 214
73 3300046507 Ga0495606_0010975 Ga0495606_0010975_5711_6373 214
74 3300046507 Ga0495606_0029636 Ga0495606_0029636_1656_2318 214
75 3300046507 Ga0495606_0088573 Ga0495606_0088573_282_944 214
76 3300046507 Ga0495606_0113521 Ga0495606_0113521_941_1603 214
77 3300046513 Ga0495616_0000644 Ga0495616_0000644_9766_10428 214
78 3300046513 Ga0495616_0023248 Ga0495616_0023248_772_1434 214
79 3300046513 Ga0495616_0024137 Ga0495616_0024137_1299_1961 214
80 3300046513 Ga0495616_0034954 Ga0495616_0034954_423_1085 214
81 3300046515 Ga0495620_0012813 Ga0495620_0012813_2015_2677 214
82 3300046517 Ga0495630_0466754 Ga0495630_0466754_40_702 214
83 3300046518 Ga0495631_0000531 Ga0495631_0000531_3911_4564 214
84 3300046518 Ga0495631_0012022 Ga0495631_0012022_2312_2974 214
85 3300046518 Ga0495631_0063784 Ga0495631_0063784_206_868 214
86 3300046519 Ga0495632_0033026 Ga0495632_0033026_1619_2281 214
87 3300046522 Ga0495643_0017729 Ga0495643_0017729_2349_3011 214
88 3300046522 Ga0495643_0026836 Ga0495643_0026836_2003_2656 214
89 3300046522 Ga0495643_0205961 Ga0495643_0205961_165_827 214
90 3300046523 Ga0495644_0005634 Ga0495644_0005634_3165_3827 214
91 3300046523 Ga0495644_0044796 Ga0495644_0044796_965_1627 214
92 3300046524 Ga0495648_0000846 Ga0495648_0000846_4928_5590 214
93 3300046524 Ga0495648_0294537 Ga0495648_0294537_59_721 214
94 3300046525 Ga0495663_0008166 Ga0495663_0008166_1847_2509 214
95 3300046526 Ga0495666_0006281 Ga0495666_0006281_2781_3443 214
96 3300046528 Ga0495642_0015792 Ga0495642_0015792_643_1305 214
97 3300046528 Ga0495642_0074345 Ga0495642_0074345_483_1145 214
98 3300046529 Ga0495652_0031608 Ga0495652_0031608_3706_4368 214
99 3300046531 Ga0495665_0002194 Ga0495665_0002194_7543_8196 214
100 3300046531 Ga0495665_0031475 Ga0495665_0031475_1694_2356 214
101 3300046535 Ga0495586_0189842 Ga0495586_0189842_460_1122 214
102 3300046536 Ga0495587_0130771 Ga0495587_0130771_743_1396 214
103 3300046536 Ga0495587_0399798 Ga0495587_0399798_73_735 214
104 3300046538 Ga0495609_0001754 Ga0495609_0001754_11027_11689 214
105 3300046538 Ga0495609_0001905 Ga0495609_0001905_2391_3047 214
106 3300046538 Ga0495609_0022039 Ga0495609_0022039_627_1289 214
107 3300046538 Ga0495609_0028941 Ga0495609_0028941_171_833 214
108 3300046542 Ga0495597_0005381 Ga0495597_0005381_5641_6294 214
109 3300046542 Ga0495597_0005402 Ga0495597_0005402_993_1655 214
110 3300046542 Ga0495597_0007324 Ga0495597_0007324_1518_2180 214
111 3300046542 Ga0495597_0010383 Ga0495597_0010383_3462_4124 214
112 3300046542 Ga0495597_0051925 Ga0495597_0051925_904_1566 214
113 3300046557 Ga0495622_0003256 Ga0495622_0003256_6103_6765 214
114 3300046557 Ga0495622_0082905 Ga0495622_0082905_549_1202 214
115 3300046558 Ga0495633_0002165 Ga0495633_0002165_6295_6957 214
116 3300046558 Ga0495633_0002394 Ga0495633_0002394_11432_12094 214
117 3300046558 Ga0495633_0008728 Ga0495633_0008728_563_1225 214
118 3300046558 Ga0495633_0040469 Ga0495633_0040469_334_996 214
119 3300046558 Ga0495633_0121946 Ga0495633_0121946_303_965 214
120 3300046559 Ga0495667_0044905 Ga0495667_0044905_1002_1664 214
121 3300046615 Ga0495656_0131437 Ga0495656_0131437_79_735 214
122 3300046616 Ga0495668_0000210 Ga0495668_0000210_62778_63434 214
123 3300046616 Ga0495668_0007049 Ga0495668_0007049_3454_4110 214
124 3300046616 Ga0495668_0009320 Ga0495668_0009320_2000_2662 214
125 3300046616 Ga0495668_0009515 Ga0495668_0009515_1204_1866 214
126 3300046616 Ga0495668_0012968 Ga0495668_0012968_2959_3621 214
127 3300046642 Ga0495634_0008190 Ga0495634_0008190_2123_2776 214
128 3300046648 Ga0495611_0022624 Ga0495611_0022624_1307_1969 214
129 3300046648 Ga0495611_0066957 Ga0495611_0066957_241_903 214
130 3300046648 Ga0495611_0124816 Ga0495611_0124816_316_978 214
131 3300046660 Ga0495625_0001740 Ga0495625_0001740_16127_16783 214
132 3300046664 Ga0495659_0002752 Ga0495659_0002752_2862_3518 214
133 3300046665 Ga0495661_0002173 Ga0495661_0002173_6295_6957 214
134 3300046665 Ga0495661_0010058 Ga0495661_0010058_771_1433 214
135 3300046665 Ga0495661_0017553 Ga0495661_0017553_1945_2607 214
136 3300046665 Ga0495661_0088259 Ga0495661_0088259_740_1402 214
137 3300046665 Ga0495661_0107449 Ga0495661_0107449_693_1349 214
138 3300046665 Ga0495661_0112446 Ga0495661_0112446_371_1033 214
139 3300046674 Ga0495588_0004088 Ga0495588_0004088_4405_5067 214
140 3300046674 Ga0495588_0023670 Ga0495588_0023670_873_1535 214
141 3300046678 Ga0495599_0131589 Ga0495599_0131589_281_934 214
142 3300046684 Ga0495669_0000538 Ga0495669_0000538_15476_16132 214
143 3300046684 Ga0495669_0018286 Ga0495669_0018286_1710_2372 214
144 3300046689 Ga0495613_0112571 Ga0495613_0112571_917_1579 214
145 3300046691 Ga0495670_0014701 Ga0495670_0014701_2640_3302 214
146 3300046691 Ga0495670_0050152 Ga0495670_0050152_736_1398 214
147 3300046691 Ga0495670_0075962 Ga0495670_0075962_460_1122 214
148 3300046691 Ga0495670_0320323 Ga0495670_0320323_135_797 214
149 3300046692 Ga0495671_0149757 Ga0495671_0149757_149_811 214
150 3300046694 Ga0495649_0003700 Ga0495649_0003700_6924_7577 214
151 3300046694 Ga0495649_0027625 Ga0495649_0027625_694_1350 214
152 3300046794 Ga0495589_0021880 Ga0495589_0021880_162_824 214
153 3300046810 Ga0495660_0152801 Ga0495660_0152801_439_1101 214
154 3300047318 Ga0495636_0029859 Ga0495636_0029859_1497_2159 214
155 3300047318 Ga0495636_0187531 Ga0495636_0187531_244_900 214
156 3300047319 Ga0495674_0002787 Ga0495674_0002787_14056_14718 214
157 3300047320 Ga0495672_0101172 Ga0495672_0101172_745_1407 214
158 3300047321 Ga0495676_0006300 Ga0495676_0006300_522_1184 214
159 3300047322 Ga0495680_0298287 Ga0495680_0298287_223_885 214
160 3300047323 Ga0495683_0000304 Ga0495683_0000304_35935_36597 214
161 3300047323 Ga0495683_0024859 Ga0495683_0024859_1069_1731 214
162 3300047443 Ga0495687_146650 Ga0495687_146650_41_697 214
163 3300047444 Ga0495675_0041969 Ga0495675_0041969_772_1425 214
164 3300047444 Ga0495675_0113568 Ga0495675_0113568_100_762 214
165 3300047445 Ga0495677_0001127 Ga0495677_0001127_7198_7851 214
166 3300047445 Ga0495677_0008195 Ga0495677_0008195_2520_3182 214
167 3300047445 Ga0495677_0011987 Ga0495677_0011987_1068_1730 214
168 3300047445 Ga0495677_0027051 Ga0495677_0027051_636_1292 214
169 3300047446 Ga0495679_014603 Ga0495679_014603_1220_1876 214
170 3300047447 Ga0495685_000869 Ga0495685_000869_2222_2878 214
171 3300047469 Ga0495673_0003436 Ga0495673_0003436_5164_5826 214
172 3300047470 Ga0495681_0000330 Ga0495681_0000330_16994_17650 214
173 3300047470 Ga0495681_0003002 Ga0495681_0003002_3439_4101 214
174 3300047470 Ga0495681_0010660 Ga0495681_0010660_1885_2547 214
175 3300047470 Ga0495681_0038550 Ga0495681_0038550_1380_2042 214
176 3300047470 Ga0495681_0044654 Ga0495681_0044654_1266_1928 214
177 3300047470 Ga0495681_0058307 Ga0495681_0058307_336_998 214
178 3300047472 Ga0495686_0001068 Ga0495686_0001068_29329_29982 214
179 3300047472 Ga0495686_0001657 Ga0495686_0001657_19588_20244 214
180 3300047673 Ga0495593_0016671 Ga0495593_0016671_885_1547 214
181 3300048088 Ga0495602_0005336 Ga0495602_0005336_7822_8475 214
182 3300048088 Ga0495602_0079024 Ga0495602_0079024_21_683 214
183 3300048091 Ga0495626_0002192 Ga0495626_0002192_6541_7203 214
184 3300048091 Ga0495626_0005897 Ga0495626_0005897_3609_4271 214
185 3300048091 Ga0495626_0006096 Ga0495626_0006096_3555_4208 214
186 3300048091 Ga0495626_0008257 Ga0495626_0008257_5044_5697 214
187 3300048091 Ga0495626_0008343 Ga0495626_0008343_4686_5348 214
188 3300048091 Ga0495626_0013954 Ga0495626_0013954_3144_3806 214
189 3300048091 Ga0495626_0020822 Ga0495626_0020822_438_1091 214
190 3300048091 Ga0495626_0028231 Ga0495626_0028231_107_760 214
191 3300048905 Ga0496102_0010487 Ga0496102_0010487_7026_7679 214
192 3300048906 Ga0496103_0003490 Ga0496103_0003490_8821_9474 214
193 3300049460 Ga0495682_0025443 Ga0495682_0025443_717_1379 214
194 3300049572 Ga0501036_0765487 Ga0501036_0765487_116_766 214
195 3300049662 Ga0501222_013147 Ga0501222_013147_243_899 214
196 3300049704 Ga0501221_044051 Ga0501221_044051_213_869 214
197 3300049775 Ga0501279_001829 Ga0501279_001829_1072_1728 214
198 iso_pu_bacteria 2643221579 2643906534 214
199 iso_pu_bacteria 2643221581 2643913958 214
200 iso_pu_bacteria 2738541297 2738827926 214
201 iso_pu_bacteria 2738541357 2739151722 214
202 iso_pu_bacteria 2738543003 2739193642 214
203 iso_pu_bacteria 2738543026 2739320118 214
204 iso_pu_bacteria 2738543029 2739338359 214
205 iso_pu_bacteria 2923516293 2923516425 214
206 3300005339 Ga0070660_100187385 Ga0070660_1001873853 215
207 3300006946 Ga0079104_1008838 Ga0079104_10088385 215
208 3300015261 Ga0182006_1000138 Ga0182006_100013829 215
209 3300015265 Ga0182005_1000046 Ga0182005_100004629 215
210 3300027111 Ga0209281_1002482 Ga0209281_10024828 215
211 3300037312 Ga0395899_0238250 Ga0395899_0238250_450_1106 215
212 3300037312 Ga0395899_0458421 Ga0395899_0458421_60_716 215
213 3300037418 Ga0395900_0047110 Ga0395900_0047110_40_696 215
214 3300037466 Ga0395898_0044960 Ga0395898_0044960_3623_4279 215
215 3300037466 Ga0395898_0148205 Ga0395898_0148205_1422_2078 215
216 3300037471 Ga0395905_0034657 Ga0395905_0034657_1061_1717 215
217 3300037471 Ga0395905_0284333 Ga0395905_0284333_54_710 215
218 3300044656 Ga0466969_0102418 Ga0466969_0102418_645_1301 215
219 3300044673 Ga0453683_0018262 Ga0453683_0018262_2146_2823 215
220 3300044735 Ga0466968_0264087 Ga0466968_0264087_145_801 215
221 3300046452 Ga0495617_002430 Ga0495617_002430_3822_4487 215
222 3300046453 Ga0495627_009994 Ga0495627_009994_2171_2827 215
223 3300046455 Ga0495603_0018570 Ga0495603_0018570_2368_3024 215
224 3300046455 Ga0495603_0152978 Ga0495603_0152978_308_964 215
225 3300046457 Ga0495590_0002591 Ga0495590_0002591_3719_4375 215
226 3300046457 Ga0495590_0007426 Ga0495590_0007426_2522_3178 215
227 3300046458 Ga0495591_004885 Ga0495591_004885_3465_4121 215
228 3300046460 Ga0495638_0137641 Ga0495638_0137641_147_803 215
229 3300046471 Ga0495650_0001525 Ga0495650_0001525_14002_14667 215
230 3300046471 Ga0495650_0019575 Ga0495650_0019575_2535_3191 215
231 3300046473 Ga0495582_0034839 Ga0495582_0034839_1062_1718 215
232 3300046474 Ga0495605_0026709 Ga0495605_0026709_675_1331 215
233 3300046491 Ga0495584_0076978 Ga0495584_0076978_460_1116 215
234 3300046491 Ga0495584_0089524 Ga0495584_0089524_575_1231 215
235 3300046491 Ga0495584_0097569 Ga0495584_0097569_816_1472 215
236 3300046492 Ga0495585_0135035 Ga0495585_0135035_363_1019 215
237 3300046500 Ga0495596_0001238 Ga0495596_0001238_8113_8769 215
238 3300046500 Ga0495596_0009569 Ga0495596_0009569_217_873 215
239 3300046500 Ga0495596_0050696 Ga0495596_0050696_532_1188 215
240 3300046500 Ga0495596_0076974 Ga0495596_0076974_277_933 215
241 3300046501 Ga0495607_0001573 Ga0495607_0001573_16659_17315 215
242 3300046501 Ga0495607_0018228 Ga0495607_0018228_645_1301 215
243 3300046506 Ga0495583_0008007 Ga0495583_0008007_2592_3248 215
244 3300046507 Ga0495606_0002880 Ga0495606_0002880_5853_6518 215
245 3300046507 Ga0495606_0026638 Ga0495606_0026638_1385_2041 215
246 3300046513 Ga0495616_0001306 Ga0495616_0001306_12220_12876 215
247 3300046513 Ga0495616_0016590 Ga0495616_0016590_2254_2910 215
248 3300046513 Ga0495616_0033256 Ga0495616_0033256_1550_2206 215
249 3300046518 Ga0495631_0006260 Ga0495631_0006260_2541_3197 215
250 3300046518 Ga0495631_0007833 Ga0495631_0007833_387_1043 215
251 3300046518 Ga0495631_0071514 Ga0495631_0071514_782_1438 215
252 3300046519 Ga0495632_0001071 Ga0495632_0001071_16437_17093 215
253 3300046519 Ga0495632_0001258 Ga0495632_0001258_6498_7154 215
254 3300046519 Ga0495632_0001682 Ga0495632_0001682_2617_3273 215
255 3300046520 Ga0495637_0000329 Ga0495637_0000329_22780_23445 215
256 3300046522 Ga0495643_0000931 Ga0495643_0000931_6897_7553 215
257 3300046522 Ga0495643_0002769 Ga0495643_0002769_36_692 215
258 3300046522 Ga0495643_0018330 Ga0495643_0018330_36_692 215
259 3300046523 Ga0495644_0010211 Ga0495644_0010211_677_1333 215
260 3300046523 Ga0495644_0015747 Ga0495644_0015747_1418_2074 215
261 3300046523 Ga0495644_0032824 Ga0495644_0032824_448_1104 215
262 3300046524 Ga0495648_0002900 Ga0495648_0002900_2519_3175 215
263 3300046524 Ga0495648_0052587 Ga0495648_0052587_1027_1683 215
264 3300046525 Ga0495663_0007405 Ga0495663_0007405_1819_2475 215
265 3300046528 Ga0495642_0002439 Ga0495642_0002439_5979_6635 215
266 3300046528 Ga0495642_0004485 Ga0495642_0004485_624_1280 215
267 3300046530 Ga0495654_0000025 Ga0495654_0000025_22558_23223 215
268 3300046530 Ga0495654_0037676 Ga0495654_0037676_1224_1880 215
269 3300046531 Ga0495665_0202685 Ga0495665_0202685_169_825 215
270 3300046538 Ga0495609_0000846 Ga0495609_0000846_17668_18324 215
271 3300046538 Ga0495609_0001506 Ga0495609_0001506_11651_12307 215
272 3300046538 Ga0495609_0006582 Ga0495609_0006582_4270_4926 215
273 3300046538 Ga0495609_0095586 Ga0495609_0095586_179_835 215
274 3300046542 Ga0495597_0000531 Ga0495597_0000531_27932_28588 215
275 3300046542 Ga0495597_0005943 Ga0495597_0005943_3196_3852 215
276 3300046542 Ga0495597_0048100 Ga0495597_0048100_27_683 215
277 3300046557 Ga0495622_0046674 Ga0495622_0046674_893_1549 215
278 3300046558 Ga0495633_0051646 Ga0495633_0051646_219_875 215
279 3300046616 Ga0495668_0008911 Ga0495668_0008911_4226_4882 215
280 3300046616 Ga0495668_0044390 Ga0495668_0044390_351_1007 215
281 3300046648 Ga0495611_0077937 Ga0495611_0077937_618_1274 215
282 3300046648 Ga0495611_0143764 Ga0495611_0143764_95_751 215
283 3300046648 Ga0495611_0161630 Ga0495611_0161630_322_978 215
284 3300046660 Ga0495625_0000821 Ga0495625_0000821_15443_16108 215
285 3300046660 Ga0495625_0005169 Ga0495625_0005169_9984_10640 215
286 3300046665 Ga0495661_0001879 Ga0495661_0001879_12806_13462 215
287 3300046665 Ga0495661_0011924 Ga0495661_0011924_2348_3004 215
288 3300046665 Ga0495661_0031066 Ga0495661_0031066_2687_3343 215
289 3300046674 Ga0495588_0016640 Ga0495588_0016640_2460_3116 215
290 3300046674 Ga0495588_0091182 Ga0495588_0091182_897_1553 215
291 3300046678 Ga0495599_0292654 Ga0495599_0292654_189_845 215
292 3300046684 Ga0495669_0000301 Ga0495669_0000301_25799_26455 215
293 3300046684 Ga0495669_0018683 Ga0495669_0018683_412_1068 215
294 3300046684 Ga0495669_0036128 Ga0495669_0036128_291_947 215
295 3300046690 Ga0495624_0460793 Ga0495624_0460793_57_713 215
296 3300046691 Ga0495670_0070734 Ga0495670_0070734_891_1547 215
297 3300046691 Ga0495670_0210375 Ga0495670_0210375_325_981 215
298 3300046692 Ga0495671_0001997 Ga0495671_0001997_8134_8790 215
299 3300046794 Ga0495589_0000595 Ga0495589_0000595_890_1546 215
300 3300046794 Ga0495589_0031000 Ga0495589_0031000_1770_2426 215
301 3300046794 Ga0495589_0136369 Ga0495589_0136369_426_1082 215
302 3300046810 Ga0495660_0001934 Ga0495660_0001934_2750_3406 215
303 3300046810 Ga0495660_0040767 Ga0495660_0040767_1007_1663 215
304 3300047320 Ga0495672_0000732 Ga0495672_0000732_3848_4504 215
305 3300047320 Ga0495672_0119721 Ga0495672_0119721_133_789 215
306 3300047321 Ga0495676_0000099 Ga0495676_0000099_60432_61088 215
307 3300047322 Ga0495680_0028277 Ga0495680_0028277_3913_4569 215
308 3300047323 Ga0495683_0002827 Ga0495683_0002827_4986_5642 215
309 3300047323 Ga0495683_0008642 Ga0495683_0008642_853_1509 215
310 3300047323 Ga0495683_0027472 Ga0495683_0027472_1277_1933 215
311 3300047443 Ga0495687_001071 Ga0495687_001071_23570_24226 215
312 3300047443 Ga0495687_001138 Ga0495687_001138_4244_4900 215
313 3300047443 Ga0495687_001176 Ga0495687_001176_6004_6660 215
314 3300047445 Ga0495677_0004030 Ga0495677_0004030_3354_4010 215
315 3300047445 Ga0495677_0031367 Ga0495677_0031367_375_1031 215
316 3300047446 Ga0495679_005612 Ga0495679_005612_679_1335 215
317 3300047447 Ga0495685_001601 Ga0495685_001601_3751_4407 215
318 3300047447 Ga0495685_005414 Ga0495685_005414_1096_1752 215
319 3300047469 Ga0495673_0000074 Ga0495673_0000074_183450_184115 215
320 3300047470 Ga0495681_0001200 Ga0495681_0001200_11294_11950 215
321 3300047470 Ga0495681_0001614 Ga0495681_0001614_14199_14855 215
322 3300047470 Ga0495681_0008156 Ga0495681_0008156_1500_2156 215
323 3300047472 Ga0495686_0124743 Ga0495686_0124743_662_1327 215
324 3300048091 Ga0495626_0000196 Ga0495626_0000196_51034_51690 215
325 3300048091 Ga0495626_0002194 Ga0495626_0002194_3946_4602 215
326 3300048091 Ga0495626_0015678 Ga0495626_0015678_2081_2737 215
327 3300048091 Ga0495626_0030054 Ga0495626_0030054_774_1430 215
328 3300048091 Ga0495626_0031669 Ga0495626_0031669_697_1353 215
329 3300048905 Ga0496102_0000670 Ga0496102_0000670_6754_7410 215
330 3300048905 Ga0496102_0170566 Ga0496102_0170566_508_1164 215
331 3300048906 Ga0496103_0253888 Ga0496103_0253888_411_1067 215
332 3300048907 Ga0496104_0468021 Ga0496104_0468021_38_694 215
333 3300048927 Ga0496124_0009419 Ga0496124_0009419_4706_5380 215
334 3300048927 Ga0496124_0476243 Ga0496124_0476243_78_734 215
335 3300048928 Ga0496125_0441257 Ga0496125_0441257_64_720 215
336 3300049459 Ga0495678_000561 Ga0495678_000561_3520_4176 215
337 3300049459 Ga0495678_001260 Ga0495678_001260_5760_6416 215
338 3300049459 Ga0495678_001614 Ga0495678_001614_12155_12811 215
339 3300049460 Ga0495682_0021466 Ga0495682_0021466_464_1120 215
340 iso_pu_bacteria 2842711865 2842717862 215
341 3300003187 JGI25151J46595_10001054 JGI25151J46595_1000105413 216
342 3300003771 Ga0055526_1000107 Ga0055526_10001078 216
343 3300003773 Ga0055537_1000147 Ga0055537_100014737 216
344 3300003775 Ga0055524_1000176 Ga0055524_10001768 216
345 3300003784 Ga0055534_1000090 Ga0055534_10000908 216
346 3300003784 Ga0055534_1000837 Ga0055534_10008377 216
347 3300003790 Ga0055528_1000088 Ga0055528_10000888 216
348 3300015689 Ga0183360_10004 Ga0183360_10004238 216
349 3300025263 Ga0209565_1000002 Ga0209565_10000021223 216
350 3300025273 Ga0209673_1000002 Ga0209673_10000021223 216
351 3300025291 Ga0209675_1000002 Ga0209675_10000021223 216
352 3300025294 Ga0209025_1000069 Ga0209025_1000069220 216
353 3300025295 Ga0209564_1000004 Ga0209564_10000041224 216
354 3300025299 Ga0209256_1000004 Ga0209256_10000041224 216
355 3300027543 Ga0209999_1001612 Ga0209999_10016125 216
356 3300037418 Ga0395900_0142880 Ga0395900_0142880_1308_1967 216
357 3300037471 Ga0395905_0245507 Ga0395905_0245507_658_1317 216
358 3300041411 Ga0439466_0069339 Ga0439466_0069339_423_1079 216
359 3300041451 Ga0451791_1619608 Ga0451791_1619608_1921_2592 216
360 3300041509 Ga0451843_0468904 Ga0451843_0468904_1017_1685 216
361 3300042007 Ga0439449_0013956 Ga0439449_0013956_119_775 216
362 3300042993 Ga0439440_0009275 Ga0439440_0009275_54_707 216
363 3300046452 Ga0495617_000046 Ga0495617_000046_88633_89292 216
364 3300046453 Ga0495627_000476 Ga0495627_000476_7126_7785 216
365 3300046453 Ga0495627_003852 Ga0495627_003852_2049_2708 216
366 3300046457 Ga0495590_0000134 Ga0495590_0000134_13555_14214 216
367 3300046458 Ga0495591_002132 Ga0495591_002132_6144_6803 216
368 3300046463 Ga0495653_0006028 Ga0495653_0006028_1167_1826 216
369 3300046471 Ga0495650_0025570 Ga0495650_0025570_259_918 216
370 3300046474 Ga0495605_0000284 Ga0495605_0000284_26139_26798 216
371 3300046491 Ga0495584_0000276 Ga0495584_0000276_6116_6775 216
372 3300046492 Ga0495585_0007706 Ga0495585_0007706_4098_4757 216
373 3300046492 Ga0495585_0010621 Ga0495585_0010621_1851_2510 216
374 3300046492 Ga0495585_0015589 Ga0495585_0015589_477_1136 216
375 3300046492 Ga0495585_0018992 Ga0495585_0018992_1927_2586 216
376 3300046492 Ga0495585_0046021 Ga0495585_0046021_437_1096 216
377 3300046499 Ga0495594_0006527 Ga0495594_0006527_4156_4815 216
378 3300046500 Ga0495596_0001598 Ga0495596_0001598_8426_9085 216
379 3300046500 Ga0495596_0005557 Ga0495596_0005557_2326_2985 216
380 3300046500 Ga0495596_0014374 Ga0495596_0014374_190_849 216
381 3300046501 Ga0495607_0012243 Ga0495607_0012243_4850_5509 216
382 3300046501 Ga0495607_0023619 Ga0495607_0023619_2869_3528 216
383 3300046506 Ga0495583_0002792 Ga0495583_0002792_10868_11527 216
384 3300046512 Ga0495610_0001163 Ga0495610_0001163_5443_6102 216
385 3300046513 Ga0495616_0014726 Ga0495616_0014726_3159_3818 216
386 3300046518 Ga0495631_0000279 Ga0495631_0000279_5193_5852 216
387 3300046518 Ga0495631_0011081 Ga0495631_0011081_763_1422 216
388 3300046518 Ga0495631_0013083 Ga0495631_0013083_3341_4000 216
389 3300046519 Ga0495632_0007310 Ga0495632_0007310_6087_6746 216
390 3300046520 Ga0495637_0000349 Ga0495637_0000349_4925_5584 216
391 3300046522 Ga0495643_0024012 Ga0495643_0024012_142_801 216
392 3300046523 Ga0495644_0001025 Ga0495644_0001025_1228_1887 216
393 3300046523 Ga0495644_0007182 Ga0495644_0007182_1785_2444 216
394 3300046523 Ga0495644_0019460 Ga0495644_0019460_1457_2116 216
395 3300046524 Ga0495648_0004130 Ga0495648_0004130_7493_8152 216
396 3300046526 Ga0495666_0000578 Ga0495666_0000578_4324_4983 216
397 3300046528 Ga0495642_0000241 Ga0495642_0000241_26143_26802 216
398 3300046528 Ga0495642_0001118 Ga0495642_0001118_8123_8782 216
399 3300046528 Ga0495642_0055338 Ga0495642_0055338_144_803 216
400 3300046530 Ga0495654_0039907 Ga0495654_0039907_1662_2321 216
401 3300046558 Ga0495633_0002683 Ga0495633_0002683_5814_6473 216
402 3300046615 Ga0495656_0002235 Ga0495656_0002235_4268_4927 216
403 3300046616 Ga0495668_0000906 Ga0495668_0000906_4737_5396 216
404 3300046616 Ga0495668_0003252 Ga0495668_0003252_4322_4981 216
405 3300046648 Ga0495611_0000780 Ga0495611_0000780_10598_11257 216
406 3300046648 Ga0495611_0002724 Ga0495611_0002724_5485_6144 216
407 3300046663 Ga0495635_0010078 Ga0495635_0010078_4904_5563 216
408 3300046665 Ga0495661_0003143 Ga0495661_0003143_3110_3769 216
409 3300046665 Ga0495661_0028742 Ga0495661_0028742_763_1422 216
410 3300046665 Ga0495661_0051642 Ga0495661_0051642_988_1647 216
411 3300046665 Ga0495661_0132191 Ga0495661_0132191_49_708 216
412 3300046684 Ga0495669_0001610 Ga0495669_0001610_608_1267 216
413 3300046691 Ga0495670_0015441 Ga0495670_0015441_2761_3420 216
414 3300046692 Ga0495671_0000893 Ga0495671_0000893_3758_4417 216
415 3300046694 Ga0495649_0001486 Ga0495649_0001486_11435_12094 216
416 3300046794 Ga0495589_0004794 Ga0495589_0004794_2854_3513 216
417 3300046794 Ga0495589_0168223 Ga0495589_0168223_318_977 216
418 3300046810 Ga0495660_0076692 Ga0495660_0076692_139_798 216
419 3300047317 Ga0495604_0013287 Ga0495604_0013287_2945_3604 216
420 3300047317 Ga0495604_0124048 Ga0495604_0124048_225_884 216
421 3300047320 Ga0495672_0000769 Ga0495672_0000769_4495_5154 216
422 3300047322 Ga0495680_0007715 Ga0495680_0007715_8402_9061 216
423 3300047323 Ga0495683_0000843 Ga0495683_0000843_16759_17418 216
424 3300047444 Ga0495675_0022715 Ga0495675_0022715_778_1437 216
425 3300047445 Ga0495677_0000482 Ga0495677_0000482_10179_10838 216
426 3300047446 Ga0495679_054457 Ga0495679_054457_215_874 216
427 3300047447 Ga0495685_014299 Ga0495685_014299_1539_2198 216
428 3300047469 Ga0495673_0116686 Ga0495673_0116686_10_669 216
429 3300047470 Ga0495681_0030239 Ga0495681_0030239_1887_2546 216
430 3300047470 Ga0495681_0079297 Ga0495681_0079297_506_1165 216
431 3300047472 Ga0495686_0002128 Ga0495686_0002128_10839_11498 216
432 3300047472 Ga0495686_0015733 Ga0495686_0015733_1516_2175 216
433 3300047673 Ga0495593_0001611 Ga0495593_0001611_4044_4703 216
434 3300048091 Ga0495626_0001058 Ga0495626_0001058_5196_5855 216
435 3300048091 Ga0495626_0003018 Ga0495626_0003018_9756_10415 216
436 3300048903 Ga0496100_0036155 Ga0496100_0036155_1114_1773 216
437 3300048913 Ga0496110_0000333 Ga0496110_0000333_9713_10372 216
438 3300048914 Ga0496111_0069440 Ga0496111_0069440_1352_2011 216
439 3300048925 Ga0496122_0001792 Ga0496122_0001792_7365_8024 216
440 3300048926 Ga0496123_0014236 Ga0496123_0014236_5769_6428 216
441 3300048928 Ga0496125_0001742 Ga0496125_0001742_4780_5439 216
442 3300049459 Ga0495678_000146 Ga0495678_000146_55591_56250 216
443 3300049460 Ga0495682_0121912 Ga0495682_0121912_26_685 216
444 3300049568 Ga0501031_0007657 Ga0501031_0007657_5967_6620 216
445 3300049569 Ga0501032_0008208 Ga0501032_0008208_5623_6276 216
446 3300049571 Ga0501034_0002483 Ga0501034_0002483_15731_16384 216
447 3300049571 Ga0501034_0004657 Ga0501034_0004657_11968_12621 216
448 3300049572 Ga0501036_0003765 Ga0501036_0003765_8508_9161 216
449 3300049573 Ga0501037_0003115 Ga0501037_0003115_5673_6326 216
450 3300049574 Ga0501038_0000610 Ga0501038_0000610_24554_25207 216
451 3300049579 Ga0501043_0005273 Ga0501043_0005273_4131_4784 216
452 3300049581 Ga0501047_0111938 Ga0501047_0111938_517_1170 216
453 3300049584 Ga0501068_0043555 Ga0501068_0043555_644_1297 216
454 3300049586 Ga0501070_0055366 Ga0501070_0055366_1354_2007 216
455 3300049589 Ga0501073_0006493 Ga0501073_0006493_4754_5407 216
456 3300049590 Ga0501074_0299007 Ga0501074_0299007_334_987 216
457 3300049742 Ga0501080_0005548 Ga0501080_0005548_4746_5399 216
458 3300049822 Ga0501035_0002406 Ga0501035_0002406_5890_6543 216
459 3300049823 Ga0501044_0002382 Ga0501044_0002382_13667_14320 216
460 3300005548 Ga0070665_100090044 Ga0070665_1000900442 217
461 3300015261 Ga0182006_1110890 Ga0182006_11108902 217
462 3300028379 Ga0268266_10203650 Ga0268266_102036502 217
463 3300041404 Ga0439436_0025219 Ga0439436_0025219_749_1411 217
464 3300041413 Ga0439465_0043757 Ga0439465_0043757_579_1241 217
465 3300042007 Ga0439449_0003184 Ga0439449_0003184_292_954 217
466 3300042010 Ga0439452_008175 Ga0439452_008175_840_1502 217
467 3300046501 Ga0495607_0030754 Ga0495607_0030754_2110_2769 217
468 3300046507 Ga0495606_0007137 Ga0495606_0007137_2351_3010 217
469 3300046513 Ga0495616_0032427 Ga0495616_0032427_68_727 217
470 3300046519 Ga0495632_0023371 Ga0495632_0023371_257_910 217
471 3300046558 Ga0495633_0067666 Ga0495633_0067666_399_1052 217
472 3300047470 Ga0495681_0053563 Ga0495681_0053563_145_804 217
473 3300048927 Ga0496124_0000020 Ga0496124_0000020_7314_7973 217
474 3300049571 Ga0501034_0000448 Ga0501034_0000448_27407_28063 217
475 3300053161 Ga0500634_0000117 Ga0500634_0000117_21828_22481 217
476 3300003771 Ga0055526_1006992 Ga0055526_10069926 218
477 3300003775 Ga0055524_1004114 Ga0055524_10041146 218
478 3300003775 Ga0055524_1013021 Ga0055524_10130213 218
479 3300003781 Ga0055536_1001750 Ga0055536_10017507 218
480 3300003781 Ga0055536_1003767 Ga0055536_10037673 218
481 3300003791 Ga0055530_10002248 Ga0055530_100022488 218
482 3300003794 Ga0055531_10008363 Ga0055531_100083633 218
483 3300003794 Ga0055531_10010808 Ga0055531_100108084 218
484 3300005289 Ga0065704_10071322 Ga0065704_100713225 218
485 3300005328 Ga0070676_10126283 Ga0070676_101262832 218
486 3300005331 Ga0070670_100084944 Ga0070670_1000849443 218
487 3300005347 Ga0070668_100021714 Ga0070668_1000217143 218
488 3300005347 Ga0070668_100058621 Ga0070668_1000586212 218
489 3300005354 Ga0070675_100277046 Ga0070675_1002770461 218
490 3300005355 Ga0070671_100140483 Ga0070671_1001404832 218
491 3300005355 Ga0070671_100317017 Ga0070671_1003170172 218
492 3300005356 Ga0070674_100423081 Ga0070674_1004230812 218
493 3300005364 Ga0070673_100573767 Ga0070673_1005737672 218
494 3300005543 Ga0070672_100001423 Ga0070672_1000014234 218
495 3300013306 Ga0163162_10270856 Ga0163162_102708562 218
496 3300014325 Ga0163163_10570492 Ga0163163_105704922 218
497 3300017792 Ga0163161_10079534 Ga0163161_100795342 218
498 3300025245 Ga0207425_1036359 Ga0207425_10363591 218
499 3300025291 Ga0209675_1003768 Ga0209675_10037683 218
500 3300025291 Ga0209675_1003998 Ga0209675_10039983 218
501 3300025291 Ga0209675_1017547 Ga0209675_10175471 218
502 3300025292 Ga0209676_1000035 Ga0209676_1000035407 218
503 3300025292 Ga0209676_1002505 Ga0209676_10025057 218
504 3300025292 Ga0209676_1003787 Ga0209676_10037878 218
505 3300025292 Ga0209676_1004137 Ga0209676_10041373 218
506 3300025292 Ga0209676_1004879 Ga0209676_10048794 218
507 3300025292 Ga0209676_1005173 Ga0209676_10051737 218
508 3300025292 Ga0209676_1010327 Ga0209676_10103272 218
509 3300025294 Ga0209025_1003682 Ga0209025_10036827 218
510 3300025294 Ga0209025_1032329 Ga0209025_10323294 218
511 3300025295 Ga0209564_1006287 Ga0209564_10062874 218
512 3300025297 Ga0209758_1016533 Ga0209758_10165335 218
513 3300025298 Ga0209050_1000865 Ga0209050_100086534 218
514 3300025298 Ga0209050_1021330 Ga0209050_10213304 218
515 3300025298 Ga0209050_1038267 Ga0209050_10382672 218
516 3300025299 Ga0209256_1002608 Ga0209256_10026087 218
517 3300025299 Ga0209256_1004568 Ga0209256_10045687 218
518 3300025299 Ga0209256_1007093 Ga0209256_10070933 218
519 3300025304 Ga0209257_1000154 Ga0209257_1000154169 218
520 3300025304 Ga0209257_1000348 Ga0209257_100034876 218
521 3300025304 Ga0209257_1000611 Ga0209257_100061135 218
522 3300025304 Ga0209257_1001025 Ga0209257_100102529 218
523 3300025304 Ga0209257_1002151 Ga0209257_10021518 218
524 3300025304 Ga0209257_1007254 Ga0209257_10072544 218
525 3300025920 Ga0207649_10152419 Ga0207649_101524192 218
526 3300025923 Ga0207681_10022772 Ga0207681_100227723 218
527 3300025926 Ga0207659_10165328 Ga0207659_101653282 218
528 3300025931 Ga0207644_10129291 Ga0207644_101292912 218
529 3300025937 Ga0207669_10406831 Ga0207669_104068311 218
530 3300025940 Ga0207691_10001199 Ga0207691_1000119914 218
531 3300025986 Ga0207658_10116920 Ga0207658_101169202 218
532 3300028381 Ga0268264_11120891 Ga0268264_111208911 218
533 3300028794 Ga0307515_10365716 Ga0307515_103657162 218
534 3300031456 Ga0307513_10008176 Ga0307513_100081764 218
535 3300031456 Ga0307513_10384424 Ga0307513_103844242 218
536 3300031901 Ga0307406_10046640 Ga0307406_100466402 218
537 3300031901 Ga0307406_10310376 Ga0307406_103103762 218
538 3300032004 Ga0307414_10104191 Ga0307414_101041912 218
539 3300032005 Ga0307411_10192011 Ga0307411_101920112 218
540 3300032126 Ga0307415_101069925 Ga0307415_1010699251 218
541 3300037471 Ga0395905_0004859 Ga0395905_0004859_601_1263 218
542 3300037471 Ga0395905_1041389 Ga0395905_1041389_35_697 218
543 3300038443 Ga0395901_0619321 Ga0395901_0619321_261_923 218
544 3300041404 Ga0439436_0030924 Ga0439436_0030924_151_825 218
545 3300041407 Ga0439447_009161 Ga0439447_009161_1257_1919 218
546 3300041413 Ga0439465_0002410 Ga0439465_0002410_1653_2330 218
547 3300041451 Ga0451791_1444411 Ga0451791_1444411_704_1378 218
548 3300041459 Ga0451800_0341829 Ga0451800_0341829_59_733 218
549 3300042004 Ga0439445_0002498 Ga0439445_0002498_3396_4073 218
550 3300042004 Ga0439445_0039912 Ga0439445_0039912_218_892 218
551 3300042007 Ga0439449_0000397 Ga0439449_0000397_8112_8789 218
552 3300042007 Ga0439449_0027202 Ga0439449_0027202_23_697 218
553 3300042014 Ga0439457_023403 Ga0439457_023403_212_886 218
554 3300046507 Ga0495606_0048034 Ga0495606_0048034_561_1238 218
555 3300046513 Ga0495616_0052991 Ga0495616_0052991_254_928 218
556 3300046525 Ga0495663_0001362 Ga0495663_0001362_2455_3129 218
557 3300046525 Ga0495663_0012837 Ga0495663_0012837_1357_2019 218
558 3300046525 Ga0495663_0035956 Ga0495663_0035956_305_967 218
559 3300046616 Ga0495668_0001500 Ga0495668_0001500_14938_15600 218
560 3300046664 Ga0495659_0178023 Ga0495659_0178023_52_714 218
561 3300046692 Ga0495671_0002713 Ga0495671_0002713_404_1078 218
562 3300048903 Ga0496100_0047890 Ga0496100_0047890_1447_2124 218
563 3300048905 Ga0496102_0254613 Ga0496102_0254613_20_691 218
564 3300048912 Ga0496109_0714116 Ga0496109_0714116_246_908 218
565 3300048914 Ga0496111_0223523 Ga0496111_0223523_464_1141 218
566 3300048925 Ga0496122_0009056 Ga0496122_0009056_9536_10210 218
567 3300048925 Ga0496122_0014795 Ga0496122_0014795_65_739 218
568 3300048926 Ga0496123_0010195 Ga0496123_0010195_7018_7692 218
569 3300048926 Ga0496123_0017269 Ga0496123_0017269_4731_5405 218
570 3300048927 Ga0496124_0094207 Ga0496124_0094207_1347_2021 218
571 3300048929 Ga0496126_0340679 Ga0496126_0340679_498_1172 218
572 3300049513 Ga0501290_000414 Ga0501290_000414_162_830 218
573 3300049571 Ga0501034_0000798 Ga0501034_0000798_36395_37066 218
574 3300049579 Ga0501043_0003950 Ga0501043_0003950_4714_5379 218
575 3300049772 Ga0501275_000560 Ga0501275_000560_2766_3434 218
576 3300050491 nmdc:mga00v17_121611_c1 nmdc:mga00v17_121611_c1_539_1198 218
577 3300050491 nmdc:mga00v17_153585_c1 nmdc:mga00v17_153585_c1_713_1372 218
578 3300050491 nmdc:mga00v17_90175_c2 nmdc:mga00v17_90175_c2_523_1182 218
579 3300053142 Ga0500577_0097258 Ga0500577_0097258_264_938 218
580 2162886007 SwRhRL2b_contig_198189 SwRhRL2b_0194.00006850 219
581 3300002774 JGI25150J39212_1000530 JGI25150J39212_10005308 219
582 3300003187 JGI25151J46595_10000231 JGI25151J46595_1000023159 219
583 3300003215 JGI25153J46596_10000166 JGI25153J46596_1000016659 219
584 3300003320 rootH2_10051274 rootH2_100512744 219
585 3300003773 Ga0055537_1001799 Ga0055537_10017993 219
586 3300003781 Ga0055536_1009133 Ga0055536_10091332 219
587 3300003781 Ga0055536_1009137 Ga0055536_10091374 219
588 3300003784 Ga0055534_1000322 Ga0055534_10003228 219
589 3300003790 Ga0055528_1000950 Ga0055528_10009509 219
590 3300003791 Ga0055530_10003430 Ga0055530_100034304 219
591 3300003791 Ga0055530_10003468 Ga0055530_100034684 219
592 3300003794 Ga0055531_10008250 Ga0055531_100082503 219
593 3300003794 Ga0055531_10011876 Ga0055531_100118764 219
594 3300003794 Ga0055531_10011880 Ga0055531_100118804 219
595 3300003856 Ga0058692_1000021 Ga0058692_1000021229 219
596 3300005289 Ga0065704_10011596 Ga0065704_100115962 219
597 3300005331 Ga0070670_100014590 Ga0070670_1000145906 219
598 3300005347 Ga0070668_100019512 Ga0070668_1000195125 219
599 3300005353 Ga0070669_100136645 Ga0070669_1001366452 219
600 3300005366 Ga0070659_100255788 Ga0070659_1002557882 219
601 3300005456 Ga0070678_100007944 Ga0070678_1000079445 219
602 3300005548 Ga0070665_100022130 Ga0070665_1000221304 219
603 3300005578 Ga0068854_100021157 Ga0068854_1000211573 219
604 3300005985 Ga0081539_10032334 Ga0081539_100323344 219
605 3300006051 Ga0075364_10004874 Ga0075364_100048744 219
606 3300009011 Ga0105251_10014842 Ga0105251_100148424 219
607 3300013102 Ga0157371_10003036 Ga0157371_100030362 219
608 3300013102 Ga0157371_10122809 Ga0157371_101228092 219
609 3300013104 Ga0157370_10109875 Ga0157370_101098754 219
610 3300013306 Ga0163162_10389238 Ga0163162_103892382 219
611 3300014497 Ga0182008_10003269 Ga0182008_100032692 219
612 3300014497 Ga0182008_10003866 Ga0182008_100038662 219
613 3300015261 Ga0182006_1045772 Ga0182006_10457722 219
614 3300015261 Ga0182006_1046284 Ga0182006_10462842 219
615 3300015261 Ga0182006_1056065 Ga0182006_10560651 219
616 3300015261 Ga0182006_1060355 Ga0182006_10603552 219
617 3300015261 Ga0182006_1145838 Ga0182006_11458381 219
618 3300015262 Ga0182007_10000500 Ga0182007_1000050013 219
619 3300015265 Ga0182005_1000186 Ga0182005_100018637 219
620 3300025245 Ga0207425_1000029 Ga0207425_10000293 219
621 3300025258 Ga0209129_1000216 Ga0209129_10002167 219
622 3300025263 Ga0209565_1000071 Ga0209565_10000718 219
623 3300025273 Ga0209673_1001159 Ga0209673_100115919 219
624 3300025284 Ga0209130_1012250 Ga0209130_10122501 219
625 3300025291 Ga0209675_1000018 Ga0209675_1000018334 219
626 3300025292 Ga0209676_1000185 Ga0209676_1000185140 219
627 3300025292 Ga0209676_1000248 Ga0209676_10002487 219
628 3300025292 Ga0209676_1001632 Ga0209676_100163217 219
629 3300025294 Ga0209025_1000076 Ga0209025_10000767 219
630 3300025295 Ga0209564_1000148 Ga0209564_10001488 219
631 3300025297 Ga0209758_1000473 Ga0209758_10004737 219
632 3300025298 Ga0209050_1000182 Ga0209050_10001827 219
633 3300025298 Ga0209050_1000896 Ga0209050_10008966 219
634 3300025298 Ga0209050_1008268 Ga0209050_10082685 219
635 3300025298 Ga0209050_1047727 Ga0209050_10477272 219
636 3300025299 Ga0209256_1004676 Ga0209256_10046762 219
637 3300025299 Ga0209256_1017768 Ga0209256_10177682 219
638 3300025303 Ga0209051_1001702 Ga0209051_10017029 219
639 3300025304 Ga0209257_1000470 Ga0209257_100047067 219
640 3300025304 Ga0209257_1002838 Ga0209257_100283816 219
641 3300025304 Ga0209257_1003487 Ga0209257_10034877 219
642 3300025923 Ga0207681_10182794 Ga0207681_101827942 219
643 3300025925 Ga0207650_10005266 Ga0207650_100052662 219
644 3300025935 Ga0207709_10002288 Ga0207709_100022885 219
645 3300025972 Ga0207668_10066264 Ga0207668_100662642 219
646 3300026121 Ga0207683_10016313 Ga0207683_100163135 219
647 3300027312 Ga0209371_1000031 Ga0209371_10000317 219
648 3300027312 Ga0209371_1000045 Ga0209371_10000457 219
649 3300030500 Ga0268256_1000034 Ga0268256_1000034345 219
650 3300030500 Ga0268256_1000047 Ga0268256_10000477 219
651 3300030732 Ga0316176_1213746 Ga0316176_12137462 219
652 3300030742 Ga0316183_1128623 Ga0316183_11286234 219
653 3300032004 Ga0307414_10064443 Ga0307414_100644433 219
654 3300032004 Ga0307414_10238287 Ga0307414_102382872 219
655 3300038705 Ga0237819_00824 Ga0237819_00824_2306_2965 219
656 3300038705 Ga0237819_07876 Ga0237819_07876_700_1359 219
657 3300041452 Ga0451793_0584371 Ga0451793_0584371_236_916 219
658 3300041459 Ga0451800_0933770 Ga0451800_0933770_2469_3128 219
659 3300041462 Ga0451806_009973 Ga0451806_009973_6695_7354 219
660 3300041463 Ga0451804_0198061 Ga0451804_0198061_1730_2389 219
661 3300041486 Ga0451807_2499404 Ga0451807_2499404_166_825 219
662 3300041494 Ga0451837_0589154 Ga0451837_0589154_204_866 219
663 3300041494 Ga0451837_0839418 Ga0451837_0839418_817_1497 219
664 3300041509 Ga0451843_0824203 Ga0451843_0824203_320_1000 219
665 3300041512 Ga0451853_0554745 Ga0451853_0554745_51_710 219
666 3300042006 Ga0439432_056157 Ga0439432_056157_443_1102 219
667 3300042007 Ga0439449_0099152 Ga0439449_0099152_355_1038 219
668 3300042142 Ga0450905_003222 Ga0450905_003222_1112_1771 219
669 3300046460 Ga0495638_0096024 Ga0495638_0096024_333_992 219
670 3300046471 Ga0495650_0001029 Ga0495650_0001029_9229_9933 219
671 3300046500 Ga0495596_0002959 Ga0495596_0002959_4608_5312 219
672 3300046513 Ga0495616_0037455 Ga0495616_0037455_217_876 219
673 3300046522 Ga0495643_0018427 Ga0495643_0018427_3057_3716 219
674 3300046525 Ga0495663_0014724 Ga0495663_0014724_438_1097 219
675 3300046558 Ga0495633_0042618 Ga0495633_0042618_406_1065 219
676 3300046558 Ga0495633_0045225 Ga0495633_0045225_267_926 219
677 3300046660 Ga0495625_0018084 Ga0495625_0018084_1598_2257 219
678 3300046794 Ga0495589_0015083 Ga0495589_0015083_3114_3818 219
679 3300046810 Ga0495660_0084771 Ga0495660_0084771_273_932 219
680 3300047320 Ga0495672_0000092 Ga0495672_0000092_138850_139509 219
681 3300047320 Ga0495672_0000895 Ga0495672_0000895_21357_22061 219
682 3300048907 Ga0496104_0674276 Ga0496104_0674276_200_859 219
683 3300048908 Ga0496105_0071930 Ga0496105_0071930_1995_2654 219
684 3300048919 Ga0496116_0036483 Ga0496116_0036483_1698_2357 219
685 3300048920 Ga0496117_0004119 Ga0496117_0004119_304_963 219
686 3300048920 Ga0496117_0187127 Ga0496117_0187127_456_1115 219
687 3300048921 Ga0496118_0004569 Ga0496118_0004569_15344_16003 219
688 3300048921 Ga0496118_0014921 Ga0496118_0014921_6504_7163 219
689 3300048921 Ga0496118_0016956 Ga0496118_0016956_3387_4046 219
690 3300048921 Ga0496118_0019003 Ga0496118_0019003_4200_4859 219
691 3300048922 Ga0496119_0000176 Ga0496119_0000176_342_1001 219
692 3300048923 Ga0496120_0000277 Ga0496120_0000277_352_1011 219
693 3300048924 Ga0496121_0036323 Ga0496121_0036323_325_984 219
694 3300048924 Ga0496121_0119632 Ga0496121_0119632_998_1657 219
695 3300048925 Ga0496122_0034237 Ga0496122_0034237_346_1005 219
696 3300048925 Ga0496122_0197304 Ga0496122_0197304_477_1136 219
697 3300048926 Ga0496123_0001387 Ga0496123_0001387_9143_9802 219
698 3300048927 Ga0496124_0001413 Ga0496124_0001413_7448_8107 219
699 3300048927 Ga0496124_0001960 Ga0496124_0001960_7198_7857 219
700 3300048927 Ga0496124_0026544 Ga0496124_0026544_186_845 219
701 3300048927 Ga0496124_0111670 Ga0496124_0111670_283_942 219
702 3300048927 Ga0496124_0441277 Ga0496124_0441277_85_744 219
703 3300048928 Ga0496125_0001174 Ga0496125_0001174_27_686 219
704 3300048928 Ga0496125_0028128 Ga0496125_0028128_2683_3342 219
705 3300048928 Ga0496125_0080177 Ga0496125_0080177_66_725 219
706 3300048928 Ga0496125_0088709 Ga0496125_0088709_339_998 219
707 3300048928 Ga0496125_0304053 Ga0496125_0304053_260_919 219
708 3300048929 Ga0496126_0034531 Ga0496126_0034531_3741_4400 219
709 3300048929 Ga0496126_0037648 Ga0496126_0037648_2146_2805 219
710 3300048929 Ga0496126_0136390 Ga0496126_0136390_1124_1783 219
711 3300048929 Ga0496126_0170349 Ga0496126_0170349_389_1048 219
712 3300049571 Ga0501034_0019800 Ga0501034_0019800_735_1394 219
713 3300050490 nmdc:mga03n38_311153_c1 nmdc:mga03n38_311153_c1_50_709 219
714 3300050491 nmdc:mga00v17_680_c1 nmdc:mga00v17_680_c1_14235_14894 219
715 3300050492 nmdc:mga0yw44_310926_c1 nmdc:mga0yw44_310926_c1_56_715 219
716 3300012512 Ga0157327_1001358 Ga0157327_10013582 220
717 3300025941 Ga0207711_10272170 Ga0207711_102721702 220
718 3300048914 Ga0496111_0364387 Ga0496111_0364387_389_1057 220
719 3300050491 nmdc:mga00v17_174012_c1 nmdc:mga00v17_174012_c1_225_893 220
720 3300049823 Ga0501044_0085735 Ga0501044_0085735_11_823 221
721 3300005289 Ga0065704_10119702 Ga0065704_101197022 222
722 3300032004 Ga0307414_10004133 Ga0307414_100041333 222
723 3300046615 Ga0495656_0000725 Ga0495656_0000725_4164_4904 222
724 3300048906 Ga0496103_0096651 Ga0496103_0096651_169_909 222
725 3300048911 Ga0496108_0091925 Ga0496108_0091925_460_1200 222
726 3300048916 Ga0496113_0212138 Ga0496113_0212138_418_1158 222
727 3300048927 Ga0496124_0413564 Ga0496124_0413564_53_793 222
728 3300015261 Ga0182006_1010683 Ga0182006_10106835 224
729 3300025735 Ga0207713_1000290 Ga0207713_10002907 225
730 3300048917 Ga0496114_0004682 Ga0496114_0004682_5608_6420 225
731 3300048920 Ga0496117_0002348 Ga0496117_0002348_3862_4569 225
732 3300048921 Ga0496118_0072807 Ga0496118_0072807_31_738 225
733 3300048922 Ga0496119_0001471 Ga0496119_0001471_20353_21060 225
734 3300048923 Ga0496120_0003247 Ga0496120_0003247_7132_7839 225
735 3300048925 Ga0496122_0011708 Ga0496122_0011708_1081_1788 225
736 3300048926 Ga0496123_0009350 Ga0496123_0009350_1081_1788 225
737 3300048929 Ga0496126_0017494 Ga0496126_0017494_3635_4447 225
738 2162886007 SwRhRL2b_contig_1852575 SwRhRL2b_0516.00005600 226
739 3300048919 Ga0496116_0003037 Ga0496116_0003037_15958_16638 226
740 3300048925 Ga0496122_0270494 Ga0496122_0270494_214_894 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

56

166

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9515 8 222
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9507 8 222
6tak-assembly1.cif.gz_BBB crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9493 8 222
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.947 8 222
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9461 8 222
ID Description Score Start End Superfamily
af_O94331_1_215_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9385 11 223 3.40.50.2020
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9348 8 201 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9294 15 221 3.40.50.2020
af_O94331_1_215_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9259 11 223 3.40.50.2020
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9243 8 201 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3D5JQL8-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9834 8 178 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A508AHB3-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9797 11 226 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A3D0GIX5-F1-model_v4 deleted 0.9771 8 109
AF-A0A258SMY8-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9752 11 199 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A3D5JQL8-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9722 8 178 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132

Feature Viewer

pLDDT pTM Quality
91.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map