F478548
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 464 | 621 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300048911|Ga0496108_0172973|Ga0496108_0172973_606_1649 |
| Length | 347 |
| Sequence | VAVFRQGHAEEKERLTMLEMPPLQFAQTNGIRMGYYEAGPKTDTPPVILCHGWPEIAFSWRHQLKALAAAGIRVIAPDQRGYGATDRPEPVESYDMEHLTGDLVGLLDHLKIDKAIFVGHDWGGFIVWQMPLRHIDRVAGVVGVNTPHTDRAPADPIELFRKRFGEHMYIVQFQDPSRSADKVFNSRVEQTFDAFMRMPVPRSDTTPEDPPTAGVGASARLNLAFPQMVANYDAKHDPRTPILSPEEKQVFVDTFTKSGFTGGINWYRNMSRNWQRSADIDHKVRVPSLMIMAENDRVLPPSAADGMEKIIPDLEKYLVRGSGHWTQQEKPDEVSAKLIEWRKRRFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 21 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 22 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 23 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 24 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 25 | 2791355199 | |||
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 32 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 33 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 34 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 35 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 36 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 37 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 38 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 39 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 40 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 41 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 42 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 43 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 44 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 45 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 46 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 47 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 48 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 49 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 50 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 51 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 52 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 53 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 54 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 55 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 56 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 57 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 58 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 59 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 60 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 61 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 62 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 63 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 64 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 65 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 66 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 67 | 2904699407 | |||
| 68 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 69 | 2906610324 | |||
| 70 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 71 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 72 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 73 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 74 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 75 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 76 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 77 | 2922368715 | |||
| 78 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 79 | 2922425934 | |||
| 80 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 81 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 82 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 83 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 84 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 85 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 86 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 87 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 88 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 89 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 90 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 91 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 92 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 93 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 94 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 95 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 96 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 97 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 98 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 99 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 100 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 101 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 102 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 103 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 104 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 105 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 106 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 109 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 111 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 135 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 136 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 137 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 138 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 139 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 140 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 141 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 142 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 143 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 144 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 145 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 146 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 148 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 149 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 152 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 153 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 154 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 155 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 156 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 157 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 158 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 159 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 161 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 162 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 163 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 174 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 188 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 189 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 190 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 242 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 243 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 244 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 251 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 253 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 258 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 267 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 268 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 269 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 270 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 271 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 272 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 375 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 376 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 415 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 416 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 421 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 424 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 425 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 426 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 427 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 432 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 433 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 434 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 436 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 437 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 438 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 440 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 441 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 443 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 444 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 445 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 446 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 447 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 449 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 450 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 451 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 452 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 453 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 454 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 455 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 456 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 457 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 458 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 459 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 460 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 461 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 462 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 463 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 464 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.49 |
| Metatranscriptomes | 0 |
| Isolates | 15.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.54 |
| Nodule | 12.7 |
| Rhizoplane | 4.05 |
| Rhizosphere | 60.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000050 | 3300003203 | Bacteria | 54388 |
| 2 | JGI25153J46596_10008915 | 3300003215 | Bacteria | 4733 |
| 3 | JGI25160J50197_1001490 | 3300003354 | Bacteria | 11633 |
| 4 | JGI25160J50197_1002236 | 3300003354 | Bacteria | 9086 |
| 5 | JGI25404J52841_10005298 | 3300003659 | Bacteria | 2661 |
| 6 | JGI25404J52841_10021596 | 3300003659 | Bacteria | 1393 |
| 7 | Ga0070658_10099686 | 3300005327 | Bacteria | 2400 |
| 8 | Ga0070658_10109993 | 3300005327 | Bacteria | 2282 |
| 9 | Ga0070658_10186629 | 3300005327 | Bacteria | 1746 |
| 10 | Ga0068869_100029935 | 3300005334 | Bacteria | 3818 |
| 11 | Ga0070680_100004719 | 3300005336 | Bacteria | 10256 |
| 12 | Ga0070680_100014584 | 3300005336 | Bacteria | 6146 |
| 13 | Ga0070680_100255953 | 3300005336 | Bacteria | 1481 |
| 14 | Ga0068868_100076601 | 3300005338 | Bacteria | 2674 |
| 15 | Ga0070660_100009169 | 3300005339 | Bacteria | 6948 |
| 16 | Ga0070660_100094591 | 3300005339 | Bacteria | 2361 |
| 17 | Ga0070689_100138200 | 3300005340 | Bacteria | 1958 |
| 18 | Ga0070661_100071579 | 3300005344 | Bacteria | 2551 |
| 19 | Ga0070661_100076977 | 3300005344 | Bacteria | 2459 |
| 20 | Ga0070661_100147483 | 3300005344 | Bacteria | 1777 |
| 21 | Ga0070668_100156147 | 3300005347 | Bacteria | 1848 |
| 22 | Ga0070668_100237573 | 3300005347 | Bacteria | 1508 |
| 23 | Ga0070675_100150308 | 3300005354 | Bacteria | 1996 |
| 24 | Ga0070659_100031867 | 3300005366 | Bacteria | 4086 |
| 25 | Ga0070709_10003646 | 3300005434 | Bacteria | 8262 |
| 26 | Ga0070709_10009472 | 3300005434 | Bacteria | 5376 |
| 27 | Ga0070714_100007489 | 3300005435 | Bacteria | 8495 |
| 28 | Ga0070714_100142015 | 3300005435 | Bacteria | 2156 |
| 29 | Ga0070713_100001931 | 3300005436 | Bacteria | 13391 |
| 30 | Ga0070713_100067392 | 3300005436 | Bacteria | 3013 |
| 31 | Ga0070713_100094645 | 3300005436 | Bacteria | 2576 |
| 32 | Ga0070710_10000550 | 3300005437 | Bacteria | 17724 |
| 33 | Ga0070710_10003153 | 3300005437 | Bacteria | 7815 |
| 34 | Ga0070710_10130331 | 3300005437 | Bacteria | 1533 |
| 35 | Ga0070711_100002127 | 3300005439 | Bacteria | 11224 |
| 36 | Ga0070711_100007740 | 3300005439 | Bacteria | 6545 |
| 37 | Ga0070711_100070950 | 3300005439 | Bacteria | 2454 |
| 38 | Ga0070708_100108943 | 3300005445 | Bacteria | 2544 |
| 39 | Ga0070663_100016024 | 3300005455 | Bacteria | 4854 |
| 40 | Ga0070663_100051004 | 3300005455 | Bacteria | 2945 |
| 41 | Ga0070663_100080349 | 3300005455 | Bacteria | 2394 |
| 42 | Ga0070663_100228043 | 3300005455 | Bacteria | 1465 |
| 43 | Ga0070678_100035925 | 3300005456 | Bacteria | 3464 |
| 44 | Ga0070678_100097677 | 3300005456 | Bacteria | 2269 |
| 45 | Ga0070678_100254636 | 3300005456 | Bacteria | 1473 |
| 46 | Ga0070662_100053581 | 3300005457 | Bacteria | 2920 |
| 47 | Ga0070681_10042060 | 3300005458 | Bacteria | 4580 |
| 48 | Ga0070698_100031641 | 3300005471 | Bacteria | 5484 |
| 49 | Ga0070679_100015108 | 3300005530 | Bacteria | 7421 |
| 50 | Ga0070679_100022377 | 3300005530 | Bacteria | 6179 |
| 51 | Ga0070679_100080354 | 3300005530 | Bacteria | 3249 |
| 52 | Ga0070684_100010908 | 3300005535 | Bacteria | 7221 |
| 53 | Ga0068853_100001884 | 3300005539 | Bacteria | 15451 |
| 54 | Ga0068853_100132729 | 3300005539 | Bacteria | 2230 |
| 55 | Ga0070665_100012656 | 3300005548 | Bacteria | 8497 |
| 56 | Ga0070665_100027888 | 3300005548 | Bacteria | 5686 |
| 57 | Ga0068855_100019655 | 3300005563 | Bacteria | 8112 |
| 58 | Ga0070664_100112233 | 3300005564 | Bacteria | 2380 |
| 59 | Ga0068857_100013449 | 3300005577 | Bacteria | 7129 |
| 60 | Ga0068856_100000340 | 3300005614 | Bacteria | 51206 |
| 61 | Ga0068852_100007926 | 3300005616 | Bacteria | 7780 |
| 62 | Ga0068852_100070224 | 3300005616 | Bacteria | 3072 |
| 63 | Ga0068852_100167947 | 3300005616 | Bacteria | 2054 |
| 64 | Ga0068852_100292596 | 3300005616 | Bacteria | 1574 |
| 65 | Ga0068859_100525050 | 3300005617 | Bacteria | 1279 |
| 66 | Ga0068864_100109305 | 3300005618 | Bacteria | 2461 |
| 67 | Ga0068866_10227760 | 3300005718 | Bacteria | 1129 |
| 68 | Ga0068851_10003888 | 3300005834 | Bacteria | 6682 |
| 69 | Ga0068860_100000399 | 3300005843 | Bacteria | 56959 |
| 70 | Ga0068862_100079066 | 3300005844 | Bacteria | 2850 |
| 71 | Ga0068862_100298078 | 3300005844 | Bacteria | 1482 |
| 72 | Ga0081455_10004053 | 3300005937 | Bacteria | 16599 |
| 73 | Ga0081455_10191473 | 3300005937 | Bacteria | 1540 |
| 74 | Ga0081540_1005983 | 3300005983 | Bacteria | 8958 |
| 75 | Ga0081540_1018369 | 3300005983 | Bacteria | 4292 |
| 76 | Ga0081540_1018679 | 3300005983 | Bacteria | 4244 |
| 77 | Ga0081540_1032906 | 3300005983 | Bacteria | 2823 |
| 78 | Ga0081540_1039319 | 3300005983 | Bacteria | 2481 |
| 79 | Ga0081540_1052450 | 3300005983 | Bacteria | 2008 |
| 80 | Ga0081539_10000325 | 3300005985 | Bacteria | 106431 |
| 81 | Ga0081539_10000542 | 3300005985 | Bacteria | 78012 |
| 82 | Ga0070717_10010145 | 3300006028 | Bacteria | 7093 |
| 83 | Ga0070717_10025752 | 3300006028 | Bacteria | 4684 |
| 84 | Ga0070717_10044557 | 3300006028 | Bacteria | 3624 |
| 85 | Ga0070717_10134868 | 3300006028 | Bacteria | 2125 |
| 86 | Ga0075365_10064627 | 3300006038 | Bacteria | 2452 |
| 87 | Ga0075365_10168477 | 3300006038 | Bacteria | 1528 |
| 88 | Ga0075363_100169824 | 3300006048 | Bacteria | 1238 |
| 89 | Ga0070715_10000126 | 3300006163 | Bacteria | 18112 |
| 90 | Ga0070716_100001133 | 3300006173 | Bacteria | 11734 |
| 91 | Ga0070716_100006711 | 3300006173 | Bacteria | 5636 |
| 92 | Ga0070712_100013177 | 3300006175 | Bacteria | 5276 |
| 93 | Ga0070712_100047312 | 3300006175 | Bacteria | 2976 |
| 94 | Ga0070712_100086776 | 3300006175 | Bacteria | 2281 |
| 95 | Ga0075362_10032532 | 3300006177 | Bacteria | 2263 |
| 96 | Ga0075367_10011614 | 3300006178 | Bacteria | 4669 |
| 97 | Ga0075367_10044740 | 3300006178 | Bacteria | 2596 |
| 98 | Ga0075369_10027159 | 3300006186 | Bacteria | 2391 |
| 99 | Ga0075369_10057238 | 3300006186 | Bacteria | 1695 |
| 100 | Ga0075366_10098245 | 3300006195 | Bacteria | 1756 |
| 101 | Ga0075370_10071674 | 3300006353 | Bacteria | 1982 |
| 102 | Ga0075370_10186447 | 3300006353 | Bacteria | 1221 |
| 103 | Ga0068871_100017334 | 3300006358 | Bacteria | 5447 |
| 104 | Ga0075434_100408743 | 3300006871 | Bacteria | 1378 |
| 105 | Ga0097620_100525050 | 3300006931 | Bacteria | 1279 |
| 106 | Ga0099824_1006123 | 3300006942 | Bacteria | 16665 |
| 107 | Ga0099824_1009448 | 3300006942 | Bacteria | 12008 |
| 108 | Ga0099822_1000072 | 3300006943 | Bacteria | 55118 |
| 109 | Ga0075435_100362900 | 3300007076 | Bacteria | 1243 |
| 110 | Ga0105240_10005923 | 3300009093 | Bacteria | 18106 |
| 111 | Ga0105240_10168707 | 3300009093 | Bacteria | 2594 |
| 112 | Ga0105240_10259063 | 3300009093 | Bacteria | 2007 |
| 113 | Ga0111539_10116537 | 3300009094 | Bacteria | 3132 |
| 114 | Ga0105245_10015073 | 3300009098 | Bacteria | 6735 |
| 115 | Ga0105243_10042686 | 3300009148 | Bacteria | 3551 |
| 116 | Ga0105241_10047862 | 3300009174 | Bacteria | 3252 |
| 117 | Ga0105241_10074158 | 3300009174 | Bacteria | 2650 |
| 118 | Ga0105242_10407420 | 3300009176 | Bacteria | 1271 |
| 119 | Ga0105248_10273135 | 3300009177 | Bacteria | 1903 |
| 120 | Ga0105248_10331401 | 3300009177 | Bacteria | 1714 |
| 121 | Ga0105248_10454131 | 3300009177 | Bacteria | 1444 |
| 122 | Ga0105237_10005891 | 3300009545 | Bacteria | 13744 |
| 123 | Ga0105237_10052535 | 3300009545 | Bacteria | 4090 |
| 124 | Ga0105237_10193235 | 3300009545 | Bacteria | 2035 |
| 125 | Ga0105238_10024022 | 3300009551 | Bacteria | 6216 |
| 126 | Ga0105238_10390547 | 3300009551 | Bacteria | 1384 |
| 127 | Ga0105249_10261413 | 3300009553 | Bacteria | 1720 |
| 128 | Ga0105249_10611897 | 3300009553 | Bacteria | 1145 |
| 129 | Ga0099796_10003203 | 3300010159 | Bacteria | 3752 |
| 130 | Ga0099796_10008560 | 3300010159 | Bacteria | 2731 |
| 131 | Ga0105239_10005379 | 3300010375 | Bacteria | 15037 |
| 132 | Ga0105239_10074580 | 3300010375 | Bacteria | 3730 |
| 133 | Ga0105239_10080906 | 3300010375 | Bacteria | 3575 |
| 134 | Ga0105246_10156475 | 3300011119 | Bacteria | 1731 |
| 135 | Ga0157370_10061963 | 3300013104 | Bacteria | 3549 |
| 136 | Ga0157369_10041084 | 3300013105 | Bacteria | 5049 |
| 137 | Ga0157374_10119370 | 3300013296 | Bacteria | 2544 |
| 138 | Ga0157374_10152904 | 3300013296 | Bacteria | 2244 |
| 139 | Ga0157374_10242269 | 3300013296 | Bacteria | 1773 |
| 140 | Ga0157374_10375567 | 3300013296 | Bacteria | 1415 |
| 141 | Ga0157374_10561997 | 3300013296 | Bacteria | 1149 |
| 142 | Ga0157378_10014292 | 3300013297 | Bacteria | 6950 |
| 143 | Ga0163162_10008402 | 3300013306 | Bacteria | 10070 |
| 144 | Ga0163162_10401977 | 3300013306 | Bacteria | 1502 |
| 145 | Ga0157372_10022136 | 3300013307 | Bacteria | 6876 |
| 146 | Ga0157375_10339602 | 3300013308 | Bacteria | 1667 |
| 147 | Ga0163163_10072203 | 3300014325 | Bacteria | 3440 |
| 148 | Ga0157379_10190689 | 3300014968 | Bacteria | 1852 |
| 149 | Ga0157376_10137758 | 3300014969 | Bacteria | 2186 |
| 150 | Ga0157376_10540482 | 3300014969 | Bacteria | 1152 |
| 151 | Ga0163161_10354110 | 3300017792 | Bacteria | 1168 |
| 152 | Ga0213872_10023809 | 3300021361 | Bacteria | 2816 |
| 153 | Ga0213874_10047879 | 3300021377 | Unclassified | 1302 |
| 154 | Ga0213876_10001347 | 3300021384 | Bacteria | 15365 |
| 155 | Ga0213876_10027818 | 3300021384 | Bacteria | 2982 |
| 156 | Ga0209233_1003471 | 3300025261 | Bacteria | 5548 |
| 157 | Ga0209130_1013576 | 3300025284 | Bacteria | 2081 |
| 158 | Ga0209564_1000385 | 3300025295 | Bacteria | 80273 |
| 159 | Ga0209564_1013271 | 3300025295 | Bacteria | 3518 |
| 160 | Ga0209758_1000651 | 3300025297 | Bacteria | 52531 |
| 161 | Ga0209758_1004669 | 3300025297 | Bacteria | 11205 |
| 162 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 163 | Ga0207697_10029127 | 3300025315 | Bacteria | 2259 |
| 164 | Ga0207656_10073224 | 3300025321 | Bacteria | 1527 |
| 165 | Ga0207692_10000608 | 3300025898 | Bacteria | 12589 |
| 166 | Ga0207692_10002722 | 3300025898 | Bacteria | 6818 |
| 167 | Ga0207692_10005822 | 3300025898 | Bacteria | 4967 |
| 168 | Ga0207692_10172714 | 3300025898 | Bacteria | 1253 |
| 169 | Ga0207710_10115243 | 3300025900 | Bacteria | 1279 |
| 170 | Ga0207685_10004333 | 3300025905 | Bacteria | 3594 |
| 171 | Ga0207685_10028538 | 3300025905 | Bacteria | 1966 |
| 172 | Ga0207699_10024900 | 3300025906 | Bacteria | 3279 |
| 173 | Ga0207699_10037019 | 3300025906 | Bacteria | 2785 |
| 174 | Ga0207699_10207114 | 3300025906 | Bacteria | 1332 |
| 175 | Ga0207705_10087032 | 3300025909 | Bacteria | 2284 |
| 176 | Ga0207705_10116850 | 3300025909 | Bacteria | 1975 |
| 177 | Ga0207707_10016399 | 3300025912 | Bacteria | 6462 |
| 178 | Ga0207707_10076775 | 3300025912 | Bacteria | 2915 |
| 179 | Ga0207695_10050774 | 3300025913 | Bacteria | 4360 |
| 180 | Ga0207695_10054700 | 3300025913 | Bacteria | 4165 |
| 181 | Ga0207671_10031752 | 3300025914 | Bacteria | 3934 |
| 182 | Ga0207671_10231988 | 3300025914 | Bacteria | 1448 |
| 183 | Ga0207693_10000683 | 3300025915 | Bacteria | 30507 |
| 184 | Ga0207693_10044030 | 3300025915 | Bacteria | 3508 |
| 185 | Ga0207693_10126568 | 3300025915 | Bacteria | 2008 |
| 186 | Ga0207663_10001947 | 3300025916 | Bacteria | 9768 |
| 187 | Ga0207663_10032337 | 3300025916 | Bacteria | 3105 |
| 188 | Ga0207663_10101688 | 3300025916 | Bacteria | 1931 |
| 189 | Ga0207660_10001275 | 3300025917 | Bacteria | 16907 |
| 190 | Ga0207660_10226171 | 3300025917 | Bacteria | 1470 |
| 191 | Ga0207657_10002026 | 3300025919 | Bacteria | 21899 |
| 192 | Ga0207649_10255794 | 3300025920 | Bacteria | 1263 |
| 193 | Ga0207652_10000750 | 3300025921 | Bacteria | 31226 |
| 194 | Ga0207652_10010784 | 3300025921 | Bacteria | 7361 |
| 195 | Ga0207681_10138095 | 3300025923 | Bacteria | 1812 |
| 196 | Ga0207694_10003753 | 3300025924 | Bacteria | 12036 |
| 197 | Ga0207694_10165378 | 3300025924 | Bacteria | 1789 |
| 198 | Ga0207659_10260409 | 3300025926 | Bacteria | 1411 |
| 199 | Ga0207687_10029932 | 3300025927 | Bacteria | 3666 |
| 200 | Ga0207700_10027779 | 3300025928 | Bacteria | 3968 |
| 201 | Ga0207700_10070672 | 3300025928 | Bacteria | 2685 |
| 202 | Ga0207700_10116568 | 3300025928 | Bacteria | 2158 |
| 203 | Ga0207664_10026050 | 3300025929 | Bacteria | 4415 |
| 204 | Ga0207690_10079292 | 3300025932 | Bacteria | 2288 |
| 205 | Ga0207706_10157808 | 3300025933 | Bacteria | 1995 |
| 206 | Ga0207709_10041379 | 3300025935 | Bacteria | 2765 |
| 207 | Ga0207670_10150021 | 3300025936 | Bacteria | 1729 |
| 208 | Ga0207669_10141525 | 3300025937 | Bacteria | 1670 |
| 209 | Ga0207665_10000339 | 3300025939 | Bacteria | 32422 |
| 210 | Ga0207665_10002674 | 3300025939 | Bacteria | 11972 |
| 211 | Ga0207691_10132535 | 3300025940 | Bacteria | 2200 |
| 212 | Ga0207691_10306910 | 3300025940 | Bacteria | 1362 |
| 213 | Ga0207711_10105448 | 3300025941 | Bacteria | 2500 |
| 214 | Ga0207689_10158597 | 3300025942 | Bacteria | 1865 |
| 215 | Ga0207661_10048506 | 3300025944 | Bacteria | 3375 |
| 216 | Ga0207661_10125464 | 3300025944 | Bacteria | 2192 |
| 217 | Ga0207679_10070558 | 3300025945 | Bacteria | 2633 |
| 218 | Ga0207679_10150400 | 3300025945 | Bacteria | 1894 |
| 219 | Ga0207667_10008531 | 3300025949 | Bacteria | 12165 |
| 220 | Ga0207667_10018138 | 3300025949 | Bacteria | 7901 |
| 221 | Ga0207667_10052933 | 3300025949 | Bacteria | 4273 |
| 222 | Ga0207651_10172271 | 3300025960 | Bacteria | 1708 |
| 223 | Ga0207677_10103045 | 3300026023 | Bacteria | 2105 |
| 224 | Ga0207703_10095890 | 3300026035 | Bacteria | 2503 |
| 225 | Ga0207703_10131761 | 3300026035 | Bacteria | 2160 |
| 226 | Ga0207703_10180724 | 3300026035 | Bacteria | 1861 |
| 227 | Ga0207703_10476527 | 3300026035 | Bacteria | 1169 |
| 228 | Ga0207639_10003675 | 3300026041 | Bacteria | 10307 |
| 229 | Ga0207678_10053086 | 3300026067 | Bacteria | 3494 |
| 230 | Ga0207678_10072041 | 3300026067 | Bacteria | 2961 |
| 231 | Ga0207678_10083348 | 3300026067 | Bacteria | 2735 |
| 232 | Ga0207678_10137255 | 3300026067 | Bacteria | 2086 |
| 233 | Ga0207678_10188825 | 3300026067 | Bacteria | 1760 |
| 234 | Ga0207678_10193435 | 3300026067 | Bacteria | 1739 |
| 235 | Ga0207708_10109018 | 3300026075 | Bacteria | 2148 |
| 236 | Ga0207708_10344112 | 3300026075 | Bacteria | 1222 |
| 237 | Ga0207702_10000371 | 3300026078 | Bacteria | 51217 |
| 238 | Ga0207702_10325583 | 3300026078 | Bacteria | 1465 |
| 239 | Ga0207702_10378359 | 3300026078 | Bacteria | 1361 |
| 240 | Ga0207676_10126646 | 3300026095 | Bacteria | 2164 |
| 241 | Ga0207676_10143134 | 3300026095 | Bacteria | 2049 |
| 242 | Ga0207674_10020168 | 3300026116 | Bacteria | 7209 |
| 243 | Ga0207674_10525771 | 3300026116 | Bacteria | 1143 |
| 244 | Ga0207675_100273435 | 3300026118 | Bacteria | 1640 |
| 245 | Ga0207683_10021269 | 3300026121 | Bacteria | 5551 |
| 246 | Ga0207683_10183843 | 3300026121 | Bacteria | 1896 |
| 247 | Ga0207698_10038868 | 3300026142 | Bacteria | 3520 |
| 248 | Ga0207698_10187372 | 3300026142 | Bacteria | 1839 |
| 249 | Ga0207698_10246508 | 3300026142 | Bacteria | 1632 |
| 250 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 251 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 252 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 253 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 254 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 255 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 256 | Ga0209489_102213 | 3300027361 | Bacteria | 39761 |
| 257 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 258 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 259 | Ga0209588_1001736 | 3300027671 | Bacteria | 5767 |
| 260 | Ga0207428_10193849 | 3300027907 | Bacteria | 1531 |
| 261 | Ga0268266_10003127 | 3300028379 | Bacteria | 16840 |
| 262 | Ga0268266_10026938 | 3300028379 | Bacteria | 4890 |
| 263 | Ga0268266_10068734 | 3300028379 | Bacteria | 3068 |
| 264 | Ga0268266_10184106 | 3300028379 | Bacteria | 1904 |
| 265 | Ga0268266_10247990 | 3300028379 | Bacteria | 1646 |
| 266 | Ga0268265_10070120 | 3300028380 | Bacteria | 2724 |
| 267 | Ga0268264_10001991 | 3300028381 | Bacteria | 18360 |
| 268 | Ga0265326_10019700 | 3300028558 | Bacteria | 1938 |
| 269 | Ga0265334_10063647 | 3300028573 | Bacteria | 1386 |
| 270 | Ga0265318_10082152 | 3300028577 | Bacteria | 1189 |
| 271 | Ga0265336_10000251 | 3300028666 | Bacteria | 38092 |
| 272 | Ga0307517_10001377 | 3300028786 | Bacteria | 40867 |
| 273 | Ga0307515_10015737 | 3300028794 | Bacteria | 13916 |
| 274 | Ga0307515_10292228 | 3300028794 | Bacteria | 1324 |
| 275 | Ga0265338_10000582 | 3300028800 | Bacteria | 64301 |
| 276 | Ga0307511_10186809 | 3300030521 | Bacteria | 1104 |
| 277 | Ga0265330_10058738 | 3300031235 | Bacteria | 1676 |
| 278 | Ga0265325_10030259 | 3300031241 | Bacteria | 2904 |
| 279 | Ga0265339_10003547 | 3300031249 | Bacteria | 10912 |
| 280 | Ga0265331_10015945 | 3300031250 | Bacteria | 3955 |
| 281 | Ga0307509_10031346 | 3300031507 | Bacteria | 5871 |
| 282 | Ga0307509_10092253 | 3300031507 | Bacteria | 3096 |
| 283 | Ga0307508_10000015 | 3300031616 | Bacteria | 210182 |
| 284 | Ga0307508_10076362 | 3300031616 | Bacteria | 2928 |
| 285 | Ga0307508_10119666 | 3300031616 | Bacteria | 2235 |
| 286 | Ga0307516_10099436 | 3300031730 | Bacteria | 2726 |
| 287 | Ga0307516_10173172 | 3300031730 | Bacteria | 1897 |
| 288 | Ga0307412_10110355 | 3300031911 | Bacteria | 1963 |
| 289 | Ga0307416_100209455 | 3300032002 | Bacteria | 1858 |
| 290 | Ga0307415_100104096 | 3300032126 | Bacteria | 2090 |
| 291 | Ga0307507_10041557 | 3300033179 | Bacteria | 4598 |
| 292 | Ga0307510_10023663 | 3300033180 | Bacteria | 7117 |
| 293 | Ga0307510_10050267 | 3300033180 | Bacteria | 4425 |
| 294 | Ga0307510_10121371 | 3300033180 | Bacteria | 2317 |
| 295 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 296 | Ga0316215_1001502 | 3300033544 | Bacteria | 2239 |
| 297 | Ga0373934_0025731 | 3300035086 | Bacteria | 2281 |
| 298 | Ga0373923_0016759 | 3300035111 | Bacteria | 2791 |
| 299 | Ga0373945_0056831 | 3300035116 | Bacteria | 1452 |
| 300 | Ga0373953_0000552 | 3300035117 | Bacteria | 10385 |
| 301 | Ga0373953_0011362 | 3300035117 | Bacteria | 3123 |
| 302 | Ga0373954_0000416 | 3300035118 | Bacteria | 15875 |
| 303 | Ga0373956_0000642 | 3300035119 | Bacteria | 14377 |
| 304 | Ga0373956_0076405 | 3300035119 | Bacteria | 1532 |
| 305 | Ga0373943_0003731 | 3300035170 | Bacteria | 6929 |
| 306 | Ga0373946_0013143 | 3300035171 | Bacteria | 3107 |
| 307 | Ga0373955_0000572 | 3300035172 | Bacteria | 15637 |
| 308 | Ga0373955_0097636 | 3300035172 | Bacteria | 1682 |
| 309 | Ga0373924_0045322 | 3300035410 | Bacteria | 1809 |
| 310 | Ga0373935_0052701 | 3300035692 | Bacteria | 2587 |
| 311 | Ga0373935_0202421 | 3300035692 | Bacteria | 1372 |
| 312 | Ga0373927_0001301 | 3300035695 | Bacteria | 18871 |
| 313 | Ga0373927_0018657 | 3300035695 | Bacteria | 4554 |
| 314 | Ga0373927_0020028 | 3300035695 | Bacteria | 4387 |
| 315 | Ga0373927_0109288 | 3300035695 | Bacteria | 1801 |
| 316 | Ga0373933_0000270 | 3300035724 | Bacteria | 33800 |
| 317 | Ga0373933_0000296 | 3300035724 | Bacteria | 32065 |
| 318 | Ga0373933_0096432 | 3300035724 | Bacteria | 1830 |
| 319 | Ga0373947_0000180 | 3300035725 | Bacteria | 34668 |
| 320 | Ga0373947_0007716 | 3300035725 | Bacteria | 6220 |
| 321 | Ga0373947_0022378 | 3300035725 | Bacteria | 3666 |
| 322 | Ga0373937_0007677 | 3300036401 | Bacteria | 9345 |
| 323 | Ga0373937_0010170 | 3300036401 | Bacteria | 8206 |
| 324 | Ga0373937_0186402 | 3300036401 | Bacteria | 1949 |
| 325 | Ga0373925_0003959 | 3300037068 | Bacteria | 11291 |
| 326 | Ga0373925_0043342 | 3300037068 | Bacteria | 3339 |
| 327 | Ga0395899_0039304 | 3300037312 | Bacteria | 3542 |
| 328 | Ga0395900_0000939 | 3300037418 | Bacteria | 38089 |
| 329 | Ga0395900_0003215 | 3300037418 | Bacteria | 17688 |
| 330 | Ga0395898_0010196 | 3300037466 | Bacteria | 9838 |
| 331 | Ga0395898_0011912 | 3300037466 | Bacteria | 9007 |
| 332 | Ga0395898_0105086 | 3300037466 | Bacteria | 2708 |
| 333 | Ga0395898_0475872 | 3300037466 | Bacteria | 1188 |
| 334 | Ga0395905_0088612 | 3300037471 | Bacteria | 2900 |
| 335 | Ga0395905_0417902 | 3300037471 | Bacteria | 1237 |
| 336 | Ga0395901_0038620 | 3300038443 | Bacteria | 4938 |
| 337 | Ga0395901_0112942 | 3300038443 | Bacteria | 2853 |
| 338 | Ga0395901_0627801 | 3300038443 | Bacteria | 1080 |
| 339 | Ga0436365_1475839 | 3300039437 | Bacteria | 9395 |
| 340 | Ga0436361_0192375 | 3300039447 | Bacteria | 5642 |
| 341 | Ga0436361_1030557 | 3300039447 | Bacteria | 5905 |
| 342 | Ga0436363_0577232 | 3300039450 | Bacteria | 5397 |
| 343 | Ga0466971_0104934 | 3300044719 | Bacteria | 1301 |
| 344 | Ga0495617_080729 | 3300046452 | Bacteria | 1065 |
| 345 | Ga0495592_0008493 | 3300046454 | Bacteria | 7707 |
| 346 | Ga0495592_0104004 | 3300046454 | Bacteria | 2019 |
| 347 | Ga0495603_0000040 | 3300046455 | Bacteria | 55056 |
| 348 | Ga0495603_0024269 | 3300046455 | Bacteria | 3667 |
| 349 | Ga0495603_0054696 | 3300046455 | Bacteria | 2365 |
| 350 | Ga0495603_0066955 | 3300046455 | Bacteria | 2115 |
| 351 | Ga0495590_0069497 | 3300046457 | Bacteria | 1234 |
| 352 | Ga0495629_0000077 | 3300046459 | Bacteria | 85931 |
| 353 | Ga0495629_0000165 | 3300046459 | Bacteria | 58366 |
| 354 | Ga0495629_0038030 | 3300046459 | Bacteria | 3391 |
| 355 | Ga0495638_0018541 | 3300046460 | Bacteria | 4620 |
| 356 | Ga0495638_0088644 | 3300046460 | Bacteria | 1868 |
| 357 | Ga0495638_0191218 | 3300046460 | Bacteria | 1161 |
| 358 | Ga0495641_0001743 | 3300046461 | Bacteria | 18153 |
| 359 | Ga0495651_0000839 | 3300046462 | Bacteria | 23890 |
| 360 | Ga0495651_0043164 | 3300046462 | Bacteria | 3499 |
| 361 | Ga0495651_0058459 | 3300046462 | Bacteria | 2958 |
| 362 | Ga0495653_0000769 | 3300046463 | Bacteria | 24618 |
| 363 | Ga0495653_0078386 | 3300046463 | Bacteria | 2450 |
| 364 | Ga0495580_0011797 | 3300046472 | Bacteria | 6745 |
| 365 | Ga0495582_0000020 | 3300046473 | Bacteria | 88349 |
| 366 | Ga0495605_0089205 | 3300046474 | Bacteria | 1431 |
| 367 | Ga0495639_0000011 | 3300046475 | Bacteria | 92268 |
| 368 | Ga0495639_0015632 | 3300046475 | Bacteria | 3292 |
| 369 | Ga0495639_0061269 | 3300046475 | Bacteria | 1725 |
| 370 | Ga0495662_0006153 | 3300046476 | Bacteria | 6000 |
| 371 | Ga0495662_0053307 | 3300046476 | Bacteria | 1953 |
| 372 | Ga0495664_0155242 | 3300046477 | Bacteria | 1388 |
| 373 | Ga0495584_0038653 | 3300046491 | Bacteria | 2412 |
| 374 | Ga0495585_0044596 | 3300046492 | Bacteria | 2477 |
| 375 | Ga0495585_0087442 | 3300046492 | Bacteria | 1682 |
| 376 | Ga0495606_0029307 | 3300046507 | Bacteria | 3867 |
| 377 | Ga0495606_0102289 | 3300046507 | Bacteria | 1742 |
| 378 | Ga0495608_0002598 | 3300046511 | Bacteria | 12980 |
| 379 | Ga0495608_0003283 | 3300046511 | Bacteria | 11554 |
| 380 | Ga0495610_0053558 | 3300046512 | Bacteria | 1953 |
| 381 | Ga0495618_0023818 | 3300046514 | Bacteria | 3790 |
| 382 | Ga0495628_0015464 | 3300046516 | Bacteria | 6372 |
| 383 | Ga0495628_0022286 | 3300046516 | Bacteria | 5204 |
| 384 | Ga0495630_0087793 | 3300046517 | Bacteria | 2349 |
| 385 | Ga0495643_0129046 | 3300046522 | Bacteria | 1271 |
| 386 | Ga0495644_0032174 | 3300046523 | Bacteria | 1982 |
| 387 | Ga0495648_0005256 | 3300046524 | Bacteria | 10818 |
| 388 | Ga0495648_0107560 | 3300046524 | Bacteria | 1524 |
| 389 | Ga0495663_0020274 | 3300046525 | Bacteria | 1907 |
| 390 | Ga0495652_0010743 | 3300046529 | Bacteria | 8297 |
| 391 | Ga0495652_0015364 | 3300046529 | Bacteria | 6854 |
| 392 | Ga0495652_0068870 | 3300046529 | Bacteria | 2963 |
| 393 | Ga0495665_0000035 | 3300046531 | Bacteria | 53229 |
| 394 | Ga0495640_0007431 | 3300046533 | Bacteria | 8611 |
| 395 | Ga0495640_0013357 | 3300046533 | Bacteria | 6239 |
| 396 | Ga0495640_0040689 | 3300046533 | Bacteria | 3253 |
| 397 | Ga0495640_0103148 | 3300046533 | Bacteria | 1871 |
| 398 | Ga0495586_0227424 | 3300046535 | Bacteria | 1061 |
| 399 | Ga0495587_0003203 | 3300046536 | Bacteria | 10935 |
| 400 | Ga0495587_0059895 | 3300046536 | Bacteria | 2233 |
| 401 | Ga0495645_0067550 | 3300046543 | Bacteria | 2581 |
| 402 | Ga0495622_0006195 | 3300046557 | Bacteria | 5555 |
| 403 | Ga0495622_0052574 | 3300046557 | Bacteria | 1890 |
| 404 | Ga0495667_0001596 | 3300046559 | Bacteria | 15032 |
| 405 | Ga0495656_0004563 | 3300046615 | Bacteria | 4749 |
| 406 | Ga0495668_0107709 | 3300046616 | Bacteria | 1524 |
| 407 | Ga0495668_0109421 | 3300046616 | Bacteria | 1511 |
| 408 | Ga0495668_0213594 | 3300046616 | Bacteria | 1056 |
| 409 | Ga0495634_0000553 | 3300046642 | Bacteria | 36653 |
| 410 | Ga0495634_0019446 | 3300046642 | Bacteria | 4826 |
| 411 | Ga0495634_0064893 | 3300046642 | Bacteria | 2420 |
| 412 | Ga0495611_0111758 | 3300046648 | Bacteria | 1272 |
| 413 | Ga0495611_0151302 | 3300046648 | Bacteria | 1083 |
| 414 | Ga0495635_0000160 | 3300046663 | Bacteria | 41557 |
| 415 | Ga0495635_0001030 | 3300046663 | Bacteria | 18443 |
| 416 | Ga0495635_0053167 | 3300046663 | Bacteria | 2790 |
| 417 | Ga0495659_0022724 | 3300046664 | Bacteria | 2125 |
| 418 | Ga0495659_0086208 | 3300046664 | Bacteria | 1199 |
| 419 | Ga0495588_0123080 | 3300046674 | Bacteria | 1367 |
| 420 | Ga0495657_0011085 | 3300046675 | Bacteria | 6757 |
| 421 | Ga0495657_0265723 | 3300046675 | Bacteria | 1030 |
| 422 | Ga0495599_0001355 | 3300046678 | Bacteria | 13990 |
| 423 | Ga0495599_0032836 | 3300046678 | Bacteria | 3259 |
| 424 | Ga0495623_0007375 | 3300046679 | Bacteria | 7138 |
| 425 | Ga0495623_0009192 | 3300046679 | Bacteria | 6411 |
| 426 | Ga0495646_0017794 | 3300046680 | Bacteria | 4505 |
| 427 | Ga0495658_0000900 | 3300046683 | Bacteria | 15945 |
| 428 | Ga0495613_0105538 | 3300046689 | Bacteria | 2034 |
| 429 | Ga0495624_0000138 | 3300046690 | Bacteria | 52220 |
| 430 | Ga0495649_0154931 | 3300046694 | Bacteria | 1203 |
| 431 | Ga0495600_0000248 | 3300046809 | Bacteria | 29398 |
| 432 | Ga0495600_0015435 | 3300046809 | Bacteria | 4827 |
| 433 | Ga0495581_0000001 | 3300047315 | Bacteria | 104278 |
| 434 | Ga0495604_0000443 | 3300047317 | Bacteria | 36693 |
| 435 | Ga0495604_0184741 | 3300047317 | Bacteria | 1456 |
| 436 | Ga0495604_0222460 | 3300047317 | Bacteria | 1299 |
| 437 | Ga0495674_0001044 | 3300047319 | Bacteria | 26638 |
| 438 | Ga0495674_0085523 | 3300047319 | Bacteria | 2701 |
| 439 | Ga0495674_0093050 | 3300047319 | Bacteria | 2573 |
| 440 | Ga0495676_0026328 | 3300047321 | Bacteria | 5010 |
| 441 | Ga0495676_0058173 | 3300047321 | Bacteria | 3043 |
| 442 | Ga0495680_0002003 | 3300047322 | Bacteria | 21375 |
| 443 | Ga0495680_0007102 | 3300047322 | Bacteria | 10313 |
| 444 | Ga0495680_0022043 | 3300047322 | Bacteria | 5319 |
| 445 | Ga0495687_069680 | 3300047443 | Bacteria | 1415 |
| 446 | Ga0495675_0000857 | 3300047444 | Bacteria | 18584 |
| 447 | Ga0495675_0021623 | 3300047444 | Bacteria | 4098 |
| 448 | Ga0495684_0000068 | 3300047471 | Bacteria | 70808 |
| 449 | Ga0495684_0037624 | 3300047471 | Bacteria | 3712 |
| 450 | Ga0495593_0000006 | 3300047673 | Bacteria | 90370 |
| 451 | Ga0495593_0000215 | 3300047673 | Bacteria | 30493 |
| 452 | Ga0495602_0026301 | 3300048088 | Bacteria | 5614 |
| 453 | Ga0496100_0003644 | 3300048903 | Bacteria | 8054 |
| 454 | Ga0496101_0041170 | 3300048904 | Bacteria | 3293 |
| 455 | Ga0496102_0012975 | 3300048905 | Bacteria | 7216 |
| 456 | Ga0496103_0038852 | 3300048906 | Bacteria | 2923 |
| 457 | Ga0496104_0169532 | 3300048907 | Bacteria | 2093 |
| 458 | Ga0496105_0017824 | 3300048908 | Bacteria | 5697 |
| 459 | Ga0496105_0176634 | 3300048908 | Bacteria | 1749 |
| 460 | Ga0496106_0005689 | 3300048909 | Bacteria | 9219 |
| 461 | Ga0496106_0072134 | 3300048909 | Bacteria | 2640 |
| 462 | Ga0496106_0118924 | 3300048909 | Bacteria | 2064 |
| 463 | Ga0496107_0002113 | 3300048910 | Bacteria | 12728 |
| 464 | Ga0496107_0097049 | 3300048910 | Bacteria | 2157 |
| 465 | Ga0496108_0066977 | 3300048911 | Bacteria | 3028 |
| 466 | Ga0496108_0121901 | 3300048911 | Bacteria | 2237 |
| 467 | Ga0496108_0172973 | 3300048911 | Bacteria | 1869 |
| 468 | Ga0496109_0199957 | 3300048912 | Bacteria | 1878 |
| 469 | Ga0496110_0021514 | 3300048913 | Bacteria | 5463 |
| 470 | Ga0496110_0339063 | 3300048913 | Bacteria | 1369 |
| 471 | Ga0496112_0000044 | 3300048915 | Bacteria | 86865 |
| 472 | Ga0496112_0013612 | 3300048915 | Bacteria | 7518 |
| 473 | Ga0496112_0014847 | 3300048915 | Bacteria | 7244 |
| 474 | Ga0496112_0118903 | 3300048915 | Bacteria | 2612 |
| 475 | Ga0496112_0240439 | 3300048915 | Bacteria | 1763 |
| 476 | Ga0496112_0324962 | 3300048915 | Bacteria | 1482 |
| 477 | Ga0496113_0020886 | 3300048916 | Bacteria | 4612 |
| 478 | Ga0496113_0044619 | 3300048916 | Bacteria | 3285 |
| 479 | Ga0496115_0004269 | 3300048918 | Bacteria | 10342 |
| 480 | Ga0496115_0359541 | 3300048918 | Bacteria | 1186 |
| 481 | Ga0496116_0001178 | 3300048919 | Bacteria | 30717 |
| 482 | Ga0496117_0045212 | 3300048920 | Bacteria | 3183 |
| 483 | Ga0496118_0003016 | 3300048921 | Bacteria | 21744 |
| 484 | Ga0496118_0226717 | 3300048921 | Bacteria | 1082 |
| 485 | Ga0496119_0153040 | 3300048922 | Bacteria | 1234 |
| 486 | Ga0496120_0015097 | 3300048923 | Bacteria | 5111 |
| 487 | Ga0496120_0049551 | 3300048923 | Bacteria | 2410 |
| 488 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 489 | Ga0496121_0001244 | 3300048924 | Bacteria | 44194 |
| 490 | Ga0496121_0006260 | 3300048924 | Bacteria | 14894 |
| 491 | Ga0496121_0011806 | 3300048924 | Bacteria | 9625 |
| 492 | Ga0496121_0076263 | 3300048924 | Bacteria | 2674 |
| 493 | Ga0496121_0081704 | 3300048924 | Bacteria | 2557 |
| 494 | Ga0496121_0096357 | 3300048924 | Bacteria | 2296 |
| 495 | Ga0496121_0103269 | 3300048924 | Bacteria | 2193 |
| 496 | Ga0496121_0153828 | 3300048924 | Bacteria | 1689 |
| 497 | Ga0496121_0162398 | 3300048924 | Bacteria | 1632 |
| 498 | Ga0496121_0184230 | 3300048924 | Bacteria | 1503 |
| 499 | Ga0496123_0144346 | 3300048926 | Bacteria | 1295 |
| 500 | Ga0496124_0019158 | 3300048927 | Bacteria | 6384 |
| 501 | Ga0496124_0237910 | 3300048927 | Bacteria | 1356 |
| 502 | Ga0496125_0000504 | 3300048928 | Bacteria | 67902 |
| 503 | Ga0496125_0000712 | 3300048928 | Bacteria | 54983 |
| 504 | Ga0496125_0000998 | 3300048928 | Bacteria | 44135 |
| 505 | Ga0496125_0005652 | 3300048928 | Bacteria | 13798 |
| 506 | Ga0496125_0007928 | 3300048928 | Bacteria | 11213 |
| 507 | Ga0496125_0018155 | 3300048928 | Bacteria | 6685 |
| 508 | Ga0496125_0062865 | 3300048928 | Bacteria | 2965 |
| 509 | Ga0496125_0107391 | 3300048928 | Bacteria | 2034 |
| 510 | Ga0496126_0007108 | 3300048929 | Bacteria | 12332 |
| 511 | Ga0496126_0032076 | 3300048929 | Bacteria | 4954 |
| 512 | Ga0496126_0033543 | 3300048929 | Bacteria | 4828 |
| 513 | Ga0496126_0066222 | 3300048929 | Bacteria | 3230 |
| 514 | Ga0496126_0088670 | 3300048929 | Bacteria | 2724 |
| 515 | Ga0496126_0357805 | 3300048929 | Bacteria | 1193 |
| 516 | Ga0496126_0414614 | 3300048929 | Bacteria | 1090 |
| 517 | Ga0495682_0005698 | 3300049460 | Bacteria | 5143 |
| 518 | Ga0495682_0063488 | 3300049460 | Bacteria | 1332 |
| 519 | Ga0501032_0002299 | 3300049569 | Bacteria | 14998 |
| 520 | Ga0501033_0000091 | 3300049570 | Bacteria | 85666 |
| 521 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 522 | Ga0501034_0208184 | 3300049571 | Bacteria | 1912 |
| 523 | Ga0501036_0000052 | 3300049572 | Bacteria | 74795 |
| 524 | Ga0501036_0245793 | 3300049572 | Bacteria | 1500 |
| 525 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 526 | Ga0501038_0002924 | 3300049574 | Bacteria | 15925 |
| 527 | Ga0501039_0003915 | 3300049575 | Bacteria | 11185 |
| 528 | Ga0501043_0000928 | 3300049579 | Bacteria | 25941 |
| 529 | Ga0501043_0012964 | 3300049579 | Bacteria | 6516 |
| 530 | Ga0501043_0415218 | 3300049579 | Bacteria | 1015 |
| 531 | Ga0501046_0000231 | 3300049580 | Bacteria | 57655 |
| 532 | Ga0501047_0000457 | 3300049581 | Bacteria | 45136 |
| 533 | Ga0501047_0003830 | 3300049581 | Bacteria | 14145 |
| 534 | Ga0501047_0039347 | 3300049581 | Bacteria | 4574 |
| 535 | Ga0501047_0431990 | 3300049581 | Bacteria | 1148 |
| 536 | Ga0501048_0000218 | 3300049582 | Bacteria | 37734 |
| 537 | Ga0501068_0023915 | 3300049584 | Bacteria | 3583 |
| 538 | Ga0501070_0002829 | 3300049586 | Bacteria | 15142 |
| 539 | Ga0501070_0181783 | 3300049586 | Bacteria | 1730 |
| 540 | Ga0501070_0315373 | 3300049586 | Bacteria | 1272 |
| 541 | Ga0501072_0103621 | 3300049588 | Bacteria | 2261 |
| 542 | Ga0501073_0000877 | 3300049589 | Bacteria | 21517 |
| 543 | Ga0501073_0028874 | 3300049589 | Bacteria | 3963 |
| 544 | Ga0501074_0000273 | 3300049590 | Bacteria | 29590 |
| 545 | Ga0501074_0259238 | 3300049590 | Bacteria | 1236 |
| 546 | Ga0501079_0011695 | 3300049741 | Bacteria | 6704 |
| 547 | Ga0501080_0000124 | 3300049742 | Bacteria | 54519 |
| 548 | Ga0501080_0125088 | 3300049742 | Bacteria | 2381 |
| 549 | Ga0501083_0000785 | 3300049744 | Bacteria | 20828 |
| 550 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 551 | Ga0501035_0081230 | 3300049822 | Bacteria | 2861 |
| 552 | Ga0501044_0000217 | 3300049823 | Bacteria | 73242 |
| 553 | Ga0501044_0047107 | 3300049823 | Bacteria | 4460 |
| 554 | Ga0501044_0078587 | 3300049823 | Bacteria | 3343 |
| 555 | Ga0501045_0100442 | 3300049824 | Bacteria | 2141 |
| 556 | nmdc:mga00v17_100836_c1 | 3300050491 | Bacteria | 1822 |
| 557 | nmdc:mga00v17_162262_c1 | 3300050491 | Bacteria | 1439 |
| 558 | nmdc:mga0yw44_130805_c1 | 3300050492 | Bacteria | 1625 |
| 559 | nmdc:mga0yw44_136992_c1 | 3300050492 | Bacteria | 1589 |
| 560 | nmdc:mga0yw44_330785_c1 | 3300050492 | Bacteria | 1024 |
| 561 | nmdc:mga0yw44_69043_c1 | 3300050492 | Bacteria | 2188 |
| 562 | nmdc:mga0yw44_96917_c1 | 3300050492 | Bacteria | 1873 |
| 563 | nmdc:mga04h51_7798_c1 | 3300050495 | Bacteria | 2841 |
| 564 | nmdc:mga07m45_160947_c1 | 3300050496 | Bacteria | 1303 |
| 565 | nmdc:mga05p37_13452_c1 | 3300050507 | Bacteria | 9806 |
| 566 | nmdc:mga0sz30_16268_c1 | 3300050516 | Bacteria | 2951 |
| 567 | nmdc:mga0sz30_60931_c1 | 3300050516 | Bacteria | 1612 |
| 568 | Ga0495601_0027716 | 3300053077 | Bacteria | 3504 |
| 569 | Ga0495601_0054936 | 3300053077 | Bacteria | 2520 |
| 570 | Ga0495595_0000543 | 3300053084 | Bacteria | 14425 |
| 571 | Ga0495595_0018616 | 3300053084 | Bacteria | 3003 |
| 572 | Ga0495619_0022259 | 3300053085 | Bacteria | 4054 |
| 573 | Ga0495619_0245538 | 3300053085 | Bacteria | 1241 |
| 574 | Ga0500643_000069 | 3300053087 | Bacteria | 116366 |
| 575 | Ga0500651_0127028 | 3300053093 | Bacteria | 1544 |
| 576 | Ga0500566_0001531 | 3300053094 | Bacteria | 13576 |
| 577 | Ga0500641_0006118 | 3300053096 | Bacteria | 4264 |
| 578 | Ga0500555_007493 | 3300053103 | Bacteria | 3100 |
| 579 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 580 | Ga0500569_004477 | 3300053109 | Bacteria | 2940 |
| 581 | Ga0500572_000742 | 3300053111 | Bacteria | 10514 |
| 582 | Ga0500592_010843 | 3300053116 | Bacteria | 1454 |
| 583 | Ga0500595_000200 | 3300053119 | Bacteria | 40977 |
| 584 | Ga0500595_002044 | 3300053119 | Bacteria | 10308 |
| 585 | Ga0500595_003639 | 3300053119 | Bacteria | 7137 |
| 586 | Ga0500607_075569 | 3300053121 | Bacteria | 1729 |
| 587 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 588 | Ga0500642_0011629 | 3300053130 | Bacteria | 3156 |
| 589 | Ga0500642_0050795 | 3300053130 | Bacteria | 1829 |
| 590 | Ga0500652_004088 | 3300053131 | Bacteria | 4481 |
| 591 | Ga0500658_0048535 | 3300053134 | Bacteria | 1726 |
| 592 | Ga0500658_0138636 | 3300053134 | Bacteria | 1089 |
| 593 | Ga0500658_0153361 | 3300053134 | Bacteria | 1039 |
| 594 | Ga0500559_0000396 | 3300053136 | Bacteria | 31631 |
| 595 | Ga0500559_0001660 | 3300053136 | Bacteria | 12308 |
| 596 | Ga0500568_0004509 | 3300053139 | Bacteria | 7420 |
| 597 | Ga0500568_0015661 | 3300053139 | Bacteria | 3391 |
| 598 | Ga0500577_0000054 | 3300053142 | Bacteria | 25499 |
| 599 | Ga0500586_000408 | 3300053145 | Bacteria | 8598 |
| 600 | Ga0500589_093384 | 3300053147 | Bacteria | 1320 |
| 601 | Ga0500590_107700 | 3300053148 | Bacteria | 1328 |
| 602 | Ga0500603_001215 | 3300053150 | Bacteria | 5985 |
| 603 | Ga0500603_032993 | 3300053150 | Bacteria | 1346 |
| 604 | Ga0500604_0054152 | 3300053151 | Bacteria | 1245 |
| 605 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 606 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 607 | Ga0500616_0022364 | 3300053153 | Bacteria | 3531 |
| 608 | Ga0500622_0022547 | 3300053156 | Bacteria | 3337 |
| 609 | Ga0500622_0042068 | 3300053156 | Bacteria | 2375 |
| 610 | Ga0500622_0118010 | 3300053156 | Bacteria | 1290 |
| 611 | Ga0500627_0025475 | 3300053158 | Bacteria | 2431 |
| 612 | Ga0500634_0037717 | 3300053161 | Bacteria | 2628 |
| 613 | Ga0500638_005976 | 3300053162 | Bacteria | 4925 |
| 614 | Ga0500636_0000616 | 3300053177 | Bacteria | 19257 |
| 615 | Ga0500637_0000144 | 3300053178 | Bacteria | 26094 |
| 616 | Ga0500552_006897 | 3300053733 | Bacteria | 1291 |
| 617 | Ga0500596_001679 | 3300053735 | Bacteria | 4478 |
| 618 | Ga0500599_000340 | 3300053736 | Bacteria | 4623 |
| 619 | Ga0500601_000035 | 3300053737 | Bacteria | 28001 |
| 620 | Ga0501084_0000683 | 3300054114 | Bacteria | 25896 |
| 621 | Ga0501084_0043895 | 3300054114 | Bacteria | 3741 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046457 | Ga0495590_0069497 | Ga0495590_0069497_379_1224 | 281 |
| 2 | 3300048929 | Ga0496126_0414614 | Ga0496126_0414614_26_916 | 291 |
| 3 | 3300035695 | Ga0373927_0020028 | Ga0373927_0020028_23_901 | 292 |
| 4 | 3300048910 | Ga0496107_0097049 | Ga0496107_0097049_1241_2125 | 294 |
| 5 | iso_pu_bacteria | 8019638758 | 8019646667 | 295 |
| 6 | 3300049579 | Ga0501043_0415218 | Ga0501043_0415218_76_996 | 297 |
| 7 | 3300047322 | Ga0495680_0007102 | Ga0495680_0007102_38_940 | 300 |
| 8 | 3300038443 | Ga0395901_0627801 | Ga0395901_0627801_125_1069 | 301 |
| 9 | 3300048915 | Ga0496112_0013612 | Ga0496112_0013612_852_1847 | 305 |
| 10 | 3300048921 | Ga0496118_0226717 | Ga0496118_0226717_144_1067 | 307 |
| 11 | 3300053148 | Ga0500590_107700 | Ga0500590_107700_384_1307 | 307 |
| 12 | iso_pu_bacteria | 2513237141 | 2513891187 | 309 |
| 13 | 3300006175 | Ga0070712_100086776 | Ga0070712_1000867762 | 310 |
| 14 | 3300013296 | Ga0157374_10242269 | Ga0157374_102422692 | 310 |
| 15 | 3300013308 | Ga0157375_10339602 | Ga0157375_103396022 | 310 |
| 16 | 3300025915 | Ga0207693_10044030 | Ga0207693_100440302 | 310 |
| 17 | 3300005435 | Ga0070714_100142015 | Ga0070714_1001420152 | 311 |
| 18 | 3300005439 | Ga0070711_100070950 | Ga0070711_1000709502 | 311 |
| 19 | 3300053147 | Ga0500589_093384 | Ga0500589_093384_171_1166 | 311 |
| 20 | 3300053151 | Ga0500604_0054152 | Ga0500604_0054152_14_1009 | 311 |
| 21 | 3300049741 | Ga0501079_0011695 | Ga0501079_0011695_69_1055 | 312 |
| 22 | 3300047317 | Ga0495604_0222460 | Ga0495604_0222460_74_1069 | 313 |
| 23 | 3300005339 | Ga0070660_100094591 | Ga0070660_1000945912 | 314 |
| 24 | 3300006942 | Ga0099824_1006123 | Ga0099824_10061232 | 315 |
| 25 | 3300021384 | Ga0213876_10001347 | Ga0213876_100013478 | 315 |
| 26 | 3300039437 | Ga0436365_1475839 | Ga0436365_1475839_7890_8891 | 315 |
| 27 | 3300046452 | Ga0495617_080729 | Ga0495617_080729_10_957 | 315 |
| 28 | 3300046474 | Ga0495605_0089205 | Ga0495605_0089205_13_960 | 315 |
| 29 | 3300046648 | Ga0495611_0111758 | Ga0495611_0111758_310_1257 | 315 |
| 30 | 3300046675 | Ga0495657_0265723 | Ga0495657_0265723_51_998 | 315 |
| 31 | 3300049569 | Ga0501032_0002299 | Ga0501032_0002299_6002_6997 | 315 |
| 32 | 3300049570 | Ga0501033_0000091 | Ga0501033_0000091_23007_24002 | 315 |
| 33 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_128621_129616 | 315 |
| 34 | 3300049572 | Ga0501036_0000052 | Ga0501036_0000052_56526_57521 | 315 |
| 35 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_31189_32184 | 315 |
| 36 | 3300049574 | Ga0501038_0002924 | Ga0501038_0002924_8044_9039 | 315 |
| 37 | 3300049575 | Ga0501039_0003915 | Ga0501039_0003915_9687_10682 | 315 |
| 38 | 3300049579 | Ga0501043_0000928 | Ga0501043_0000928_7672_8667 | 315 |
| 39 | 3300049580 | Ga0501046_0000231 | Ga0501046_0000231_52347_53342 | 315 |
| 40 | 3300049581 | Ga0501047_0000457 | Ga0501047_0000457_8705_9700 | 315 |
| 41 | 3300049582 | Ga0501048_0000218 | Ga0501048_0000218_28880_29875 | 315 |
| 42 | 3300049584 | Ga0501068_0023915 | Ga0501068_0023915_572_1567 | 315 |
| 43 | 3300049586 | Ga0501070_0002829 | Ga0501070_0002829_6862_7857 | 315 |
| 44 | 3300049586 | Ga0501070_0181783 | Ga0501070_0181783_73_1068 | 315 |
| 45 | 3300049589 | Ga0501073_0000877 | Ga0501073_0000877_5534_6529 | 315 |
| 46 | 3300049590 | Ga0501074_0000273 | Ga0501074_0000273_20451_21446 | 315 |
| 47 | 3300049742 | Ga0501080_0000124 | Ga0501080_0000124_14825_15820 | 315 |
| 48 | 3300049744 | Ga0501083_0000785 | Ga0501083_0000785_5830_6825 | 315 |
| 49 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_71028_72023 | 315 |
| 50 | 3300049823 | Ga0501044_0000217 | Ga0501044_0000217_54973_55968 | 315 |
| 51 | 3300049824 | Ga0501045_0100442 | Ga0501045_0100442_408_1403 | 315 |
| 52 | 3300050492 | nmdc:mga0yw44_330785_c1 | nmdc:mga0yw44_330785_c1_23_970 | 315 |
| 53 | 3300053134 | Ga0500658_0138636 | Ga0500658_0138636_14_961 | 315 |
| 54 | 3300053134 | Ga0500658_0153361 | Ga0500658_0153361_17_964 | 315 |
| 55 | 3300054114 | Ga0501084_0000683 | Ga0501084_0000683_14840_15835 | 315 |
| 56 | 3300005434 | Ga0070709_10009472 | Ga0070709_100094721 | 316 |
| 57 | 3300005435 | Ga0070714_100007489 | Ga0070714_1000074895 | 316 |
| 58 | 3300005436 | Ga0070713_100001931 | Ga0070713_1000019317 | 316 |
| 59 | 3300005437 | Ga0070710_10000550 | Ga0070710_100005508 | 316 |
| 60 | 3300005439 | Ga0070711_100002127 | Ga0070711_1000021273 | 316 |
| 61 | 3300006028 | Ga0070717_10010145 | Ga0070717_100101454 | 316 |
| 62 | 3300006163 | Ga0070715_10000126 | Ga0070715_1000012616 | 316 |
| 63 | 3300006173 | Ga0070716_100006711 | Ga0070716_1000067112 | 316 |
| 64 | 3300006175 | Ga0070712_100013177 | Ga0070712_1000131772 | 316 |
| 65 | 3300025898 | Ga0207692_10000608 | Ga0207692_100006088 | 316 |
| 66 | 3300025905 | Ga0207685_10004333 | Ga0207685_100043332 | 316 |
| 67 | 3300025906 | Ga0207699_10037019 | Ga0207699_100370192 | 316 |
| 68 | 3300025915 | Ga0207693_10000683 | Ga0207693_1000068315 | 316 |
| 69 | 3300025916 | Ga0207663_10001947 | Ga0207663_100019477 | 316 |
| 70 | 3300025928 | Ga0207700_10027779 | Ga0207700_100277792 | 316 |
| 71 | 3300025929 | Ga0207664_10026050 | Ga0207664_100260502 | 316 |
| 72 | 3300025939 | Ga0207665_10000339 | Ga0207665_1000033913 | 316 |
| 73 | 3300035117 | Ga0373953_0011362 | Ga0373953_0011362_1312_2307 | 316 |
| 74 | 3300035119 | Ga0373956_0076405 | Ga0373956_0076405_361_1356 | 316 |
| 75 | 3300035172 | Ga0373955_0097636 | Ga0373955_0097636_348_1343 | 316 |
| 76 | 3300035724 | Ga0373933_0096432 | Ga0373933_0096432_798_1793 | 316 |
| 77 | 3300046454 | Ga0495592_0104004 | Ga0495592_0104004_979_1974 | 316 |
| 78 | 3300046459 | Ga0495629_0038030 | Ga0495629_0038030_463_1458 | 316 |
| 79 | 3300046462 | Ga0495651_0058459 | Ga0495651_0058459_257_1252 | 316 |
| 80 | 3300046463 | Ga0495653_0078386 | Ga0495653_0078386_935_1930 | 316 |
| 81 | 3300046476 | Ga0495662_0053307 | Ga0495662_0053307_653_1651 | 316 |
| 82 | 3300046477 | Ga0495664_0155242 | Ga0495664_0155242_11_1006 | 316 |
| 83 | 3300046511 | Ga0495608_0003283 | Ga0495608_0003283_7864_8859 | 316 |
| 84 | 3300046516 | Ga0495628_0022286 | Ga0495628_0022286_1073_2068 | 316 |
| 85 | 3300046517 | Ga0495630_0087793 | Ga0495630_0087793_360_1355 | 316 |
| 86 | 3300046529 | Ga0495652_0068870 | Ga0495652_0068870_1801_2796 | 316 |
| 87 | 3300046533 | Ga0495640_0040689 | Ga0495640_0040689_1568_2563 | 316 |
| 88 | 3300046535 | Ga0495586_0227424 | Ga0495586_0227424_12_1007 | 316 |
| 89 | 3300046536 | Ga0495587_0059895 | Ga0495587_0059895_1006_2001 | 316 |
| 90 | 3300046543 | Ga0495645_0067550 | Ga0495645_0067550_879_1874 | 316 |
| 91 | 3300046642 | Ga0495634_0019446 | Ga0495634_0019446_2300_3295 | 316 |
| 92 | 3300046663 | Ga0495635_0053167 | Ga0495635_0053167_232_1227 | 316 |
| 93 | 3300046678 | Ga0495599_0032836 | Ga0495599_0032836_321_1316 | 316 |
| 94 | 3300046679 | Ga0495623_0009192 | Ga0495623_0009192_2021_3016 | 316 |
| 95 | 3300046809 | Ga0495600_0015435 | Ga0495600_0015435_1569_2564 | 316 |
| 96 | 3300047317 | Ga0495604_0184741 | Ga0495604_0184741_230_1225 | 316 |
| 97 | 3300047319 | Ga0495674_0085523 | Ga0495674_0085523_36_1031 | 316 |
| 98 | 3300047319 | Ga0495674_0093050 | Ga0495674_0093050_1427_2422 | 316 |
| 99 | 3300047322 | Ga0495680_0022043 | Ga0495680_0022043_865_1860 | 316 |
| 100 | 3300047444 | Ga0495675_0021623 | Ga0495675_0021623_2336_3331 | 316 |
| 101 | 3300048928 | Ga0496125_0000712 | Ga0496125_0000712_22654_23649 | 316 |
| 102 | 3300048929 | Ga0496126_0033543 | Ga0496126_0033543_1383_2378 | 316 |
| 103 | 3300053077 | Ga0495601_0054936 | Ga0495601_0054936_704_1699 | 316 |
| 104 | 3300053084 | Ga0495595_0018616 | Ga0495595_0018616_227_1222 | 316 |
| 105 | 3300036401 | Ga0373937_0186402 | Ga0373937_0186402_484_1479 | 317 |
| 106 | 3300037466 | Ga0395898_0475872 | Ga0395898_0475872_66_1058 | 317 |
| 107 | 3300049579 | Ga0501043_0012964 | Ga0501043_0012964_1215_2207 | 317 |
| 108 | 3300049823 | Ga0501044_0047107 | Ga0501044_0047107_2792_3784 | 317 |
| 109 | 3300013307 | Ga0157372_10022136 | Ga0157372_100221368 | 318 |
| 110 | 3300021377 | Ga0213874_10047879 | Ga0213874_100478792 | 318 |
| 111 | 3300039450 | Ga0436363_0577232 | Ga0436363_0577232_745_1719 | 318 |
| 112 | 3300048928 | Ga0496125_0000504 | Ga0496125_0000504_40895_41890 | 318 |
| 113 | 3300049571 | Ga0501034_0208184 | Ga0501034_0208184_872_1882 | 318 |
| 114 | 3300049581 | Ga0501047_0003830 | Ga0501047_0003830_5732_6697 | 318 |
| 115 | 3300049588 | Ga0501072_0103621 | Ga0501072_0103621_863_1828 | 318 |
| 116 | 3300049589 | Ga0501073_0028874 | Ga0501073_0028874_1967_2932 | 318 |
| 117 | 3300049590 | Ga0501074_0259238 | Ga0501074_0259238_192_1157 | 318 |
| 118 | 3300049742 | Ga0501080_0125088 | Ga0501080_0125088_1092_2057 | 318 |
| 119 | 3300054114 | Ga0501084_0043895 | Ga0501084_0043895_842_1807 | 318 |
| 120 | 3300039447 | Ga0436361_1030557 | Ga0436361_1030557_3054_4019 | 320 |
| 121 | 3300049572 | Ga0501036_0245793 | Ga0501036_0245793_424_1428 | 320 |
| 122 | 3300049581 | Ga0501047_0039347 | Ga0501047_0039347_187_1191 | 320 |
| 123 | 3300049586 | Ga0501070_0315373 | Ga0501070_0315373_108_1112 | 320 |
| 124 | 3300049822 | Ga0501035_0081230 | Ga0501035_0081230_1802_2806 | 320 |
| 125 | 3300049823 | Ga0501044_0078587 | Ga0501044_0078587_473_1477 | 320 |
| 126 | 3300005327 | Ga0070658_10186629 | Ga0070658_101866291 | 321 |
| 127 | 3300005336 | Ga0070680_100014584 | Ga0070680_1000145845 | 321 |
| 128 | 3300005530 | Ga0070679_100080354 | Ga0070679_1000803542 | 321 |
| 129 | 3300006038 | Ga0075365_10064627 | Ga0075365_100646272 | 321 |
| 130 | 3300006178 | Ga0075367_10011614 | Ga0075367_100116142 | 321 |
| 131 | 3300009093 | Ga0105240_10259063 | Ga0105240_102590632 | 321 |
| 132 | 3300025912 | Ga0207707_10076775 | Ga0207707_100767752 | 321 |
| 133 | 3300025949 | Ga0207667_10018138 | Ga0207667_100181386 | 321 |
| 134 | 3300026078 | Ga0207702_10378359 | Ga0207702_103783592 | 321 |
| 135 | 3300050491 | nmdc:mga00v17_100836_c1 | nmdc:mga00v17_100836_c1_184_1194 | 321 |
| 136 | 3300053130 | Ga0500642_0011629 | Ga0500642_0011629_1326_2330 | 324 |
| 137 | iso_pu_bacteria | 2643221651 | 2644291323 | 325 |
| 138 | iso_pu_bacteria | 2513237098 | 2513674843 | 326 |
| 139 | iso_pu_bacteria | 8056681323 | 8056684798 | 326 |
| 140 | 3300005434 | Ga0070709_10003646 | Ga0070709_100036462 | 327 |
| 141 | 3300005437 | Ga0070710_10003153 | Ga0070710_100031532 | 327 |
| 142 | 3300006173 | Ga0070716_100001133 | Ga0070716_1000011338 | 327 |
| 143 | 3300025898 | Ga0207692_10002722 | Ga0207692_100027222 | 327 |
| 144 | 3300025916 | Ga0207663_10032337 | Ga0207663_100323372 | 327 |
| 145 | 3300025939 | Ga0207665_10002674 | Ga0207665_100026742 | 327 |
| 146 | 3300048924 | Ga0496121_0011806 | Ga0496121_0011806_1647_2630 | 327 |
| 147 | 3300048924 | Ga0496121_0076263 | Ga0496121_0076263_1210_2211 | 327 |
| 148 | iso_pu_bacteria | 2508501042 | 2508692747 | 327 |
| 149 | iso_pu_bacteria | 2508501128 | 2509152986 | 327 |
| 150 | iso_pu_bacteria | 2513237092 | 2513621793 | 327 |
| 151 | iso_pu_bacteria | 2513237094 | 2513636763 | 327 |
| 152 | iso_pu_bacteria | 2513237095 | 2513647585 | 327 |
| 153 | iso_pu_bacteria | 2513237096 | 2513654158 | 327 |
| 154 | iso_pu_bacteria | 2513237101 | 2513697097 | 327 |
| 155 | iso_pu_bacteria | 2513237137 | 2513856913 | 327 |
| 156 | iso_pu_bacteria | 2513237139 | 2513878712 | 327 |
| 157 | iso_pu_bacteria | 2513237145 | 2513918498 | 327 |
| 158 | iso_pu_bacteria | 2513237161 | 2514009360 | 327 |
| 159 | iso_pu_bacteria | 2515154112 | 2515626144 | 327 |
| 160 | iso_pu_bacteria | 2517572143 | 2517891267 | 327 |
| 161 | iso_pu_bacteria | 2524023228 | 2524533538 | 327 |
| 162 | iso_pu_bacteria | 2602042107 | 2603860885 | 327 |
| 163 | iso_pu_bacteria | 2617270735 | 2617346867 | 327 |
| 164 | iso_pu_bacteria | 2667528175 | 2671123797 | 327 |
| 165 | iso_pu_bacteria | 2721755755 | 2723843623 | 327 |
| 166 | iso_pu_bacteria | 2728368998 | 2728749964 | 327 |
| 167 | iso_pu_bacteria | 2791355197 | 2793066621 | 327 |
| 168 | iso_pu_bacteria | 2791355199 | 2793083856 | 327 |
| 169 | iso_pu_bacteria | 2802429603 | 2805921361 | 327 |
| 170 | iso_pu_bacteria | 2816332527 | 2818236621 | 327 |
| 171 | iso_pu_bacteria | 2824600985 | 2824605195 | 327 |
| 172 | iso_pu_bacteria | 2824609381 | 2824615514 | 327 |
| 173 | iso_pu_bacteria | 2824653114 | 2824656401 | 327 |
| 174 | iso_pu_bacteria | 2824671348 | 2824673701 | 327 |
| 175 | iso_pu_bacteria | 2824687955 | 2824690668 | 327 |
| 176 | iso_pu_bacteria | 2824696289 | 2824700821 | 327 |
| 177 | iso_pu_bacteria | 2824704595 | 2824709828 | 327 |
| 178 | iso_pu_bacteria | 2824753945 | 2824756052 | 327 |
| 179 | iso_pu_bacteria | 2824763712 | 2824767590 | 327 |
| 180 | iso_pu_bacteria | 2824773399 | 2824775056 | 327 |
| 181 | iso_pu_bacteria | 2838122688 | 2838129289 | 327 |
| 182 | iso_pu_bacteria | 2841941048 | 2841948055 | 327 |
| 183 | iso_pu_bacteria | 2841949485 | 2841953548 | 327 |
| 184 | iso_pu_bacteria | 2841957949 | 2841962854 | 327 |
| 185 | iso_pu_bacteria | 2841966195 | 2841973047 | 327 |
| 186 | iso_pu_bacteria | 2841974524 | 2841978276 | 327 |
| 187 | iso_pu_bacteria | 2841983080 | 2841990495 | 327 |
| 188 | iso_pu_bacteria | 2847930680 | 2847937391 | 327 |
| 189 | iso_pu_bacteria | 2847939898 | 2847947815 | 327 |
| 190 | iso_pu_bacteria | 2857524615 | 2857524663 | 327 |
| 191 | iso_pu_bacteria | 2874590934 | 2874598708 | 327 |
| 192 | iso_pu_bacteria | 2874604998 | 2874607165 | 327 |
| 193 | iso_pu_bacteria | 2874628541 | 2874634936 | 327 |
| 194 | iso_pu_bacteria | 2874645413 | 2874652163 | 327 |
| 195 | iso_pu_bacteria | 2876771140 | 2876778747 | 327 |
| 196 | iso_pu_bacteria | 2876808645 | 2876811214 | 327 |
| 197 | iso_pu_bacteria | 2876818435 | 2876824358 | 327 |
| 198 | iso_pu_bacteria | 2879074833 | 2879082540 | 327 |
| 199 | iso_pu_bacteria | 2879083081 | 2879086692 | 327 |
| 200 | iso_pu_bacteria | 2879110137 | 2879114052 | 327 |
| 201 | iso_pu_bacteria | 2879127579 | 2879131457 | 327 |
| 202 | iso_pu_bacteria | 2879142872 | 2879147903 | 327 |
| 203 | iso_pu_bacteria | 2881665667 | 2881666653 | 327 |
| 204 | iso_pu_bacteria | 2885374607 | 2885376569 | 327 |
| 205 | iso_pu_bacteria | 2888378607 | 2888385522 | 327 |
| 206 | iso_pu_bacteria | 2888419890 | 2888425653 | 327 |
| 207 | iso_pu_bacteria | 2893066018 | 2893069183 | 327 |
| 208 | iso_pu_bacteria | 2903748898 | 2903754636 | 327 |
| 209 | iso_pu_bacteria | 2904699407 | 2904701175 | 327 |
| 210 | iso_pu_bacteria | 2904711408 | 2904711903 | 327 |
| 211 | iso_pu_bacteria | 2906610324 | 2906616451 | 327 |
| 212 | iso_pu_bacteria | 2906626472 | 2906627664 | 327 |
| 213 | iso_pu_bacteria | 2906635258 | 2906640007 | 327 |
| 214 | iso_pu_bacteria | 2906643746 | 2906647362 | 327 |
| 215 | iso_pu_bacteria | 2906660503 | 2906662947 | 327 |
| 216 | iso_pu_bacteria | 2908739725 | 2908741596 | 327 |
| 217 | iso_pu_bacteria | 2908756301 | 2908759231 | 327 |
| 218 | iso_pu_bacteria | 2919073203 | 2919078545 | 327 |
| 219 | iso_pu_bacteria | 2922368715 | 2922372333 | 327 |
| 220 | iso_pu_bacteria | 2922386360 | 2922386884 | 327 |
| 221 | iso_pu_bacteria | 2922425934 | 2922431542 | 327 |
| 222 | iso_pu_bacteria | 2929615660 | 2929621095 | 327 |
| 223 | iso_pu_bacteria | 2929624759 | 2929626074 | 327 |
| 224 | iso_pu_bacteria | 2932794094 | 2932795083 | 327 |
| 225 | iso_pu_bacteria | 2932801729 | 2932805611 | 327 |
| 226 | iso_pu_bacteria | 2933577622 | 2933583035 | 327 |
| 227 | iso_pu_bacteria | 2935630451 | 2935636154 | 327 |
| 228 | iso_pu_bacteria | 2935648319 | 2935652070 | 327 |
| 229 | iso_pu_bacteria | 2935656913 | 2935659957 | 327 |
| 230 | iso_pu_bacteria | 2935675223 | 2935676481 | 327 |
| 231 | iso_pu_bacteria | 2935883170 | 2935885811 | 327 |
| 232 | iso_pu_bacteria | 2935959822 | 2935962786 | 327 |
| 233 | iso_pu_bacteria | 2935975950 | 2935976448 | 327 |
| 234 | iso_pu_bacteria | 2935984226 | 2935987102 | 327 |
| 235 | iso_pu_bacteria | 2936011229 | 2936014373 | 327 |
| 236 | iso_pu_bacteria | 2936019824 | 2936023787 | 327 |
| 237 | iso_pu_bacteria | 2936028420 | 2936031430 | 327 |
| 238 | iso_pu_bacteria | 2936046547 | 2936049479 | 327 |
| 239 | iso_pu_bacteria | 2936055302 | 2936062229 | 327 |
| 240 | iso_pu_bacteria | 2941507105 | 2941512785 | 327 |
| 241 | iso_pu_bacteria | 2941515067 | 2941520648 | 327 |
| 242 | iso_pu_bacteria | 2941523033 | 2941528662 | 327 |
| 243 | iso_pu_bacteria | 2941531003 | 2941531279 | 327 |
| 244 | iso_pu_bacteria | 3005474847 | 3005481337 | 327 |
| 245 | iso_pu_bacteria | 8006926726 | 8006928904 | 327 |
| 246 | iso_pu_bacteria | 8006933436 | 8006939373 | 327 |
| 247 | iso_pu_bacteria | 8006964411 | 8006968824 | 327 |
| 248 | iso_pu_bacteria | 8006973647 | 8006979028 | 327 |
| 249 | iso_pu_bacteria | 8006984368 | 8006984503 | 327 |
| 250 | iso_pu_bacteria | 8006994254 | 8006997131 | 327 |
| 251 | iso_pu_bacteria | 8016583857 | 8016594433 | 327 |
| 252 | iso_pu_bacteria | 8016630954 | 8016639098 | 327 |
| 253 | iso_pu_bacteria | 8019565922 | 8019575347 | 327 |
| 254 | iso_pu_bacteria | 8019619141 | 8019619887 | 327 |
| 255 | iso_pu_bacteria | 8019668869 | 8019670658 | 327 |
| 256 | iso_pu_bacteria | 8019678201 | 8019685574 | 327 |
| 257 | iso_pu_bacteria | 8055742211 | 8055745042 | 327 |
| 258 | iso_pu_bacteria | 8056673599 | 8056677486 | 327 |
| 259 | iso_pu_bacteria | 8056689827 | 8056690722 | 327 |
| 260 | 3300005614 | Ga0068856_100000340 | Ga0068856_10000034020 | 328 |
| 261 | 3300026078 | Ga0207702_10000371 | Ga0207702_1000037129 | 328 |
| 262 | 3300035116 | Ga0373945_0056831 | Ga0373945_0056831_326_1312 | 328 |
| 263 | 3300035170 | Ga0373943_0003731 | Ga0373943_0003731_5560_6546 | 328 |
| 264 | 3300035171 | Ga0373946_0013143 | Ga0373946_0013143_924_1910 | 328 |
| 265 | 3300035695 | Ga0373927_0001301 | Ga0373927_0001301_16920_17906 | 328 |
| 266 | 3300035725 | Ga0373947_0000180 | Ga0373947_0000180_30340_31326 | 328 |
| 267 | 3300036401 | Ga0373937_0010170 | Ga0373937_0010170_1380_2366 | 328 |
| 268 | 3300037068 | Ga0373925_0003959 | Ga0373925_0003959_428_1414 | 328 |
| 269 | 3300046455 | Ga0495603_0000040 | Ga0495603_0000040_48077_49063 | 328 |
| 270 | 3300046459 | Ga0495629_0000165 | Ga0495629_0000165_21113_22099 | 328 |
| 271 | 3300046461 | Ga0495641_0001743 | Ga0495641_0001743_12661_13647 | 328 |
| 272 | 3300046472 | Ga0495580_0011797 | Ga0495580_0011797_5728_6714 | 328 |
| 273 | 3300046473 | Ga0495582_0000020 | Ga0495582_0000020_24752_25738 | 328 |
| 274 | 3300046475 | Ga0495639_0000011 | Ga0495639_0000011_17400_18386 | 328 |
| 275 | 3300046476 | Ga0495662_0006153 | Ga0495662_0006153_32_1018 | 328 |
| 276 | 3300046529 | Ga0495652_0015364 | Ga0495652_0015364_5830_6816 | 328 |
| 277 | 3300046531 | Ga0495665_0000035 | Ga0495665_0000035_15739_16725 | 328 |
| 278 | 3300046533 | Ga0495640_0013357 | Ga0495640_0013357_484_1470 | 328 |
| 279 | 3300046557 | Ga0495622_0006195 | Ga0495622_0006195_2071_3057 | 328 |
| 280 | 3300046642 | Ga0495634_0000553 | Ga0495634_0000553_29477_30463 | 328 |
| 281 | 3300046663 | Ga0495635_0001030 | Ga0495635_0001030_6981_7967 | 328 |
| 282 | 3300046680 | Ga0495646_0017794 | Ga0495646_0017794_2068_3054 | 328 |
| 283 | 3300046683 | Ga0495658_0000900 | Ga0495658_0000900_1877_2863 | 328 |
| 284 | 3300046690 | Ga0495624_0000138 | Ga0495624_0000138_49696_50682 | 328 |
| 285 | 3300047315 | Ga0495581_0000001 | Ga0495581_0000001_30089_31075 | 328 |
| 286 | 3300047319 | Ga0495674_0001044 | Ga0495674_0001044_7529_8515 | 328 |
| 287 | 3300047321 | Ga0495676_0026328 | Ga0495676_0026328_3164_4150 | 328 |
| 288 | 3300047471 | Ga0495684_0037624 | Ga0495684_0037624_76_1062 | 328 |
| 289 | 3300047673 | Ga0495593_0000006 | Ga0495593_0000006_58151_59137 | 328 |
| 290 | 3300048929 | Ga0496126_0088670 | Ga0496126_0088670_433_1419 | 328 |
| 291 | 3300049581 | Ga0501047_0431990 | Ga0501047_0431990_92_1114 | 328 |
| 292 | 3300053150 | Ga0500603_001215 | Ga0500603_001215_3704_4690 | 328 |
| 293 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_127147_128151 | 328 |
| 294 | iso_pu_bacteria | 2513237104 | 2513720741 | 328 |
| 295 | 3300005983 | Ga0081540_1005983 | Ga0081540_10059832 | 329 |
| 296 | 3300031249 | Ga0265339_10003547 | Ga0265339_100035474 | 329 |
| 297 | iso_pu_bacteria | 2904690495 | 2904694205 | 329 |
| 298 | 3300005456 | Ga0070678_100097677 | Ga0070678_1000976772 | 330 |
| 299 | 3300025284 | Ga0209130_1013576 | Ga0209130_10135762 | 330 |
| 300 | 3300025295 | Ga0209564_1000385 | Ga0209564_100038551 | 330 |
| 301 | 3300025926 | Ga0207659_10260409 | Ga0207659_102604091 | 330 |
| 302 | 3300044719 | Ga0466971_0104934 | Ga0466971_0104934_145_1203 | 330 |
| 303 | 3300048924 | Ga0496121_0081704 | Ga0496121_0081704_1172_2179 | 330 |
| 304 | 3300003203 | JGI25406J46586_10000050 | JGI25406J46586_100000503 | 331 |
| 305 | 3300003215 | JGI25153J46596_10008915 | JGI25153J46596_100089153 | 331 |
| 306 | 3300003354 | JGI25160J50197_1001490 | JGI25160J50197_10014903 | 331 |
| 307 | 3300003354 | JGI25160J50197_1002236 | JGI25160J50197_10022368 | 331 |
| 308 | 3300003659 | JGI25404J52841_10005298 | JGI25404J52841_100052982 | 331 |
| 309 | 3300003659 | JGI25404J52841_10021596 | JGI25404J52841_100215962 | 331 |
| 310 | 3300005327 | Ga0070658_10099686 | Ga0070658_100996862 | 331 |
| 311 | 3300005327 | Ga0070658_10109993 | Ga0070658_101099933 | 331 |
| 312 | 3300005334 | Ga0068869_100029935 | Ga0068869_1000299352 | 331 |
| 313 | 3300005336 | Ga0070680_100004719 | Ga0070680_1000047195 | 331 |
| 314 | 3300005336 | Ga0070680_100255953 | Ga0070680_1002559531 | 331 |
| 315 | 3300005338 | Ga0068868_100076601 | Ga0068868_1000766012 | 331 |
| 316 | 3300005339 | Ga0070660_100009169 | Ga0070660_1000091692 | 331 |
| 317 | 3300005340 | Ga0070689_100138200 | Ga0070689_1001382002 | 331 |
| 318 | 3300005344 | Ga0070661_100071579 | Ga0070661_1000715792 | 331 |
| 319 | 3300005344 | Ga0070661_100076977 | Ga0070661_1000769772 | 331 |
| 320 | 3300005344 | Ga0070661_100147483 | Ga0070661_1001474832 | 331 |
| 321 | 3300005347 | Ga0070668_100156147 | Ga0070668_1001561472 | 331 |
| 322 | 3300005347 | Ga0070668_100237573 | Ga0070668_1002375732 | 331 |
| 323 | 3300005354 | Ga0070675_100150308 | Ga0070675_1001503082 | 331 |
| 324 | 3300005366 | Ga0070659_100031867 | Ga0070659_1000318672 | 331 |
| 325 | 3300005436 | Ga0070713_100067392 | Ga0070713_1000673922 | 331 |
| 326 | 3300005436 | Ga0070713_100094645 | Ga0070713_1000946452 | 331 |
| 327 | 3300005437 | Ga0070710_10130331 | Ga0070710_101303311 | 331 |
| 328 | 3300005439 | Ga0070711_100007740 | Ga0070711_1000077406 | 331 |
| 329 | 3300005445 | Ga0070708_100108943 | Ga0070708_1001089432 | 331 |
| 330 | 3300005455 | Ga0070663_100016024 | Ga0070663_1000160242 | 331 |
| 331 | 3300005455 | Ga0070663_100051004 | Ga0070663_1000510042 | 331 |
| 332 | 3300005455 | Ga0070663_100080349 | Ga0070663_1000803492 | 331 |
| 333 | 3300005455 | Ga0070663_100228043 | Ga0070663_1002280431 | 331 |
| 334 | 3300005456 | Ga0070678_100035925 | Ga0070678_1000359252 | 331 |
| 335 | 3300005456 | Ga0070678_100254636 | Ga0070678_1002546362 | 331 |
| 336 | 3300005457 | Ga0070662_100053581 | Ga0070662_1000535812 | 331 |
| 337 | 3300005458 | Ga0070681_10042060 | Ga0070681_100420602 | 331 |
| 338 | 3300005471 | Ga0070698_100031641 | Ga0070698_1000316412 | 331 |
| 339 | 3300005530 | Ga0070679_100015108 | Ga0070679_1000151086 | 331 |
| 340 | 3300005530 | Ga0070679_100022377 | Ga0070679_1000223772 | 331 |
| 341 | 3300005535 | Ga0070684_100010908 | Ga0070684_1000109086 | 331 |
| 342 | 3300005539 | Ga0068853_100001884 | Ga0068853_1000018842 | 331 |
| 343 | 3300005539 | Ga0068853_100132729 | Ga0068853_1001327291 | 331 |
| 344 | 3300005548 | Ga0070665_100012656 | Ga0070665_1000126562 | 331 |
| 345 | 3300005548 | Ga0070665_100027888 | Ga0070665_1000278883 | 331 |
| 346 | 3300005563 | Ga0068855_100019655 | Ga0068855_1000196553 | 331 |
| 347 | 3300005564 | Ga0070664_100112233 | Ga0070664_1001122332 | 331 |
| 348 | 3300005577 | Ga0068857_100013449 | Ga0068857_1000134496 | 331 |
| 349 | 3300005616 | Ga0068852_100007926 | Ga0068852_1000079261 | 331 |
| 350 | 3300005616 | Ga0068852_100070224 | Ga0068852_1000702242 | 331 |
| 351 | 3300005616 | Ga0068852_100167947 | Ga0068852_1001679472 | 331 |
| 352 | 3300005616 | Ga0068852_100292596 | Ga0068852_1002925962 | 331 |
| 353 | 3300005617 | Ga0068859_100525050 | Ga0068859_1005250502 | 331 |
| 354 | 3300005618 | Ga0068864_100109305 | Ga0068864_1001093052 | 331 |
| 355 | 3300005718 | Ga0068866_10227760 | Ga0068866_102277601 | 331 |
| 356 | 3300005834 | Ga0068851_10003888 | Ga0068851_100038883 | 331 |
| 357 | 3300005843 | Ga0068860_100000399 | Ga0068860_10000039946 | 331 |
| 358 | 3300005844 | Ga0068862_100079066 | Ga0068862_1000790662 | 331 |
| 359 | 3300005844 | Ga0068862_100298078 | Ga0068862_1002980782 | 331 |
| 360 | 3300005937 | Ga0081455_10004053 | Ga0081455_100040536 | 331 |
| 361 | 3300005937 | Ga0081455_10191473 | Ga0081455_101914732 | 331 |
| 362 | 3300005983 | Ga0081540_1018369 | Ga0081540_10183693 | 331 |
| 363 | 3300005983 | Ga0081540_1018679 | Ga0081540_10186795 | 331 |
| 364 | 3300005983 | Ga0081540_1032906 | Ga0081540_10329062 | 331 |
| 365 | 3300005983 | Ga0081540_1039319 | Ga0081540_10393192 | 331 |
| 366 | 3300005983 | Ga0081540_1052450 | Ga0081540_10524502 | 331 |
| 367 | 3300005985 | Ga0081539_10000325 | Ga0081539_1000032558 | 331 |
| 368 | 3300005985 | Ga0081539_10000542 | Ga0081539_1000054248 | 331 |
| 369 | 3300006028 | Ga0070717_10025752 | Ga0070717_100257522 | 331 |
| 370 | 3300006028 | Ga0070717_10044557 | Ga0070717_100445574 | 331 |
| 371 | 3300006028 | Ga0070717_10134868 | Ga0070717_101348682 | 331 |
| 372 | 3300006038 | Ga0075365_10168477 | Ga0075365_101684772 | 331 |
| 373 | 3300006048 | Ga0075363_100169824 | Ga0075363_1001698242 | 331 |
| 374 | 3300006175 | Ga0070712_100047312 | Ga0070712_1000473122 | 331 |
| 375 | 3300006177 | Ga0075362_10032532 | Ga0075362_100325322 | 331 |
| 376 | 3300006178 | Ga0075367_10044740 | Ga0075367_100447402 | 331 |
| 377 | 3300006186 | Ga0075369_10027159 | Ga0075369_100271592 | 331 |
| 378 | 3300006186 | Ga0075369_10057238 | Ga0075369_100572382 | 331 |
| 379 | 3300006195 | Ga0075366_10098245 | Ga0075366_100982451 | 331 |
| 380 | 3300006353 | Ga0075370_10071674 | Ga0075370_100716741 | 331 |
| 381 | 3300006353 | Ga0075370_10186447 | Ga0075370_101864471 | 331 |
| 382 | 3300006358 | Ga0068871_100017334 | Ga0068871_1000173344 | 331 |
| 383 | 3300006871 | Ga0075434_100408743 | Ga0075434_1004087431 | 331 |
| 384 | 3300006931 | Ga0097620_100525050 | Ga0097620_1005250502 | 331 |
| 385 | 3300006942 | Ga0099824_1009448 | Ga0099824_10094486 | 331 |
| 386 | 3300006943 | Ga0099822_1000072 | Ga0099822_10000725 | 331 |
| 387 | 3300007076 | Ga0075435_100362900 | Ga0075435_1003629002 | 331 |
| 388 | 3300009093 | Ga0105240_10005923 | Ga0105240_1000592311 | 331 |
| 389 | 3300009093 | Ga0105240_10168707 | Ga0105240_101687072 | 331 |
| 390 | 3300009094 | Ga0111539_10116537 | Ga0111539_101165372 | 331 |
| 391 | 3300009098 | Ga0105245_10015073 | Ga0105245_100150734 | 331 |
| 392 | 3300009148 | Ga0105243_10042686 | Ga0105243_100426861 | 331 |
| 393 | 3300009174 | Ga0105241_10047862 | Ga0105241_100478622 | 331 |
| 394 | 3300009174 | Ga0105241_10074158 | Ga0105241_100741582 | 331 |
| 395 | 3300009176 | Ga0105242_10407420 | Ga0105242_104074202 | 331 |
| 396 | 3300009177 | Ga0105248_10273135 | Ga0105248_102731352 | 331 |
| 397 | 3300009177 | Ga0105248_10331401 | Ga0105248_103314012 | 331 |
| 398 | 3300009177 | Ga0105248_10454131 | Ga0105248_104541312 | 331 |
| 399 | 3300009545 | Ga0105237_10005891 | Ga0105237_1000589110 | 331 |
| 400 | 3300009545 | Ga0105237_10052535 | Ga0105237_100525352 | 331 |
| 401 | 3300009545 | Ga0105237_10193235 | Ga0105237_101932352 | 331 |
| 402 | 3300009551 | Ga0105238_10024022 | Ga0105238_100240222 | 331 |
| 403 | 3300009551 | Ga0105238_10390547 | Ga0105238_103905471 | 331 |
| 404 | 3300009553 | Ga0105249_10261413 | Ga0105249_102614132 | 331 |
| 405 | 3300009553 | Ga0105249_10611897 | Ga0105249_106118971 | 331 |
| 406 | 3300010159 | Ga0099796_10003203 | Ga0099796_100032032 | 331 |
| 407 | 3300010159 | Ga0099796_10008560 | Ga0099796_100085601 | 331 |
| 408 | 3300010375 | Ga0105239_10005379 | Ga0105239_1000537911 | 331 |
| 409 | 3300010375 | Ga0105239_10074580 | Ga0105239_100745802 | 331 |
| 410 | 3300010375 | Ga0105239_10080906 | Ga0105239_100809063 | 331 |
| 411 | 3300011119 | Ga0105246_10156475 | Ga0105246_101564752 | 331 |
| 412 | 3300013104 | Ga0157370_10061963 | Ga0157370_100619632 | 331 |
| 413 | 3300013105 | Ga0157369_10041084 | Ga0157369_100410842 | 331 |
| 414 | 3300013296 | Ga0157374_10119370 | Ga0157374_101193701 | 331 |
| 415 | 3300013296 | Ga0157374_10152904 | Ga0157374_101529042 | 331 |
| 416 | 3300013296 | Ga0157374_10375567 | Ga0157374_103755672 | 331 |
| 417 | 3300013296 | Ga0157374_10561997 | Ga0157374_105619972 | 331 |
| 418 | 3300013297 | Ga0157378_10014292 | Ga0157378_100142926 | 331 |
| 419 | 3300013306 | Ga0163162_10008402 | Ga0163162_100084028 | 331 |
| 420 | 3300013306 | Ga0163162_10401977 | Ga0163162_104019772 | 331 |
| 421 | 3300014325 | Ga0163163_10072203 | Ga0163163_100722032 | 331 |
| 422 | 3300014968 | Ga0157379_10190689 | Ga0157379_101906892 | 331 |
| 423 | 3300014969 | Ga0157376_10137758 | Ga0157376_101377582 | 331 |
| 424 | 3300014969 | Ga0157376_10540482 | Ga0157376_105404821 | 331 |
| 425 | 3300017792 | Ga0163161_10354110 | Ga0163161_103541101 | 331 |
| 426 | 3300021361 | Ga0213872_10023809 | Ga0213872_100238092 | 331 |
| 427 | 3300021384 | Ga0213876_10027818 | Ga0213876_100278182 | 331 |
| 428 | 3300025261 | Ga0209233_1003471 | Ga0209233_10034714 | 331 |
| 429 | 3300025295 | Ga0209564_1013271 | Ga0209564_10132712 | 331 |
| 430 | 3300025297 | Ga0209758_1000651 | Ga0209758_100065137 | 331 |
| 431 | 3300025297 | Ga0209758_1004669 | Ga0209758_10046693 | 331 |
| 432 | 3300025302 | Ga0207426_1000270 | Ga0207426_100027040 | 331 |
| 433 | 3300025315 | Ga0207697_10029127 | Ga0207697_100291272 | 331 |
| 434 | 3300025321 | Ga0207656_10073224 | Ga0207656_100732242 | 331 |
| 435 | 3300025898 | Ga0207692_10005822 | Ga0207692_100058223 | 331 |
| 436 | 3300025898 | Ga0207692_10172714 | Ga0207692_101727141 | 331 |
| 437 | 3300025900 | Ga0207710_10115243 | Ga0207710_101152432 | 331 |
| 438 | 3300025905 | Ga0207685_10028538 | Ga0207685_100285382 | 331 |
| 439 | 3300025906 | Ga0207699_10024900 | Ga0207699_100249002 | 331 |
| 440 | 3300025906 | Ga0207699_10207114 | Ga0207699_102071142 | 331 |
| 441 | 3300025909 | Ga0207705_10087032 | Ga0207705_100870323 | 331 |
| 442 | 3300025909 | Ga0207705_10116850 | Ga0207705_101168502 | 331 |
| 443 | 3300025912 | Ga0207707_10016399 | Ga0207707_100163993 | 331 |
| 444 | 3300025913 | Ga0207695_10050774 | Ga0207695_100507742 | 331 |
| 445 | 3300025913 | Ga0207695_10054700 | Ga0207695_100547002 | 331 |
| 446 | 3300025914 | Ga0207671_10031752 | Ga0207671_100317523 | 331 |
| 447 | 3300025914 | Ga0207671_10231988 | Ga0207671_102319882 | 331 |
| 448 | 3300025915 | Ga0207693_10126568 | Ga0207693_101265682 | 331 |
| 449 | 3300025916 | Ga0207663_10101688 | Ga0207663_101016882 | 331 |
| 450 | 3300025917 | Ga0207660_10001275 | Ga0207660_100012752 | 331 |
| 451 | 3300025917 | Ga0207660_10226171 | Ga0207660_102261712 | 331 |
| 452 | 3300025919 | Ga0207657_10002026 | Ga0207657_100020262 | 331 |
| 453 | 3300025920 | Ga0207649_10255794 | Ga0207649_102557942 | 331 |
| 454 | 3300025921 | Ga0207652_10000750 | Ga0207652_1000075024 | 331 |
| 455 | 3300025921 | Ga0207652_10010784 | Ga0207652_100107842 | 331 |
| 456 | 3300025923 | Ga0207681_10138095 | Ga0207681_101380952 | 331 |
| 457 | 3300025924 | Ga0207694_10003753 | Ga0207694_100037533 | 331 |
| 458 | 3300025924 | Ga0207694_10165378 | Ga0207694_101653782 | 331 |
| 459 | 3300025927 | Ga0207687_10029932 | Ga0207687_100299321 | 331 |
| 460 | 3300025928 | Ga0207700_10070672 | Ga0207700_100706722 | 331 |
| 461 | 3300025928 | Ga0207700_10116568 | Ga0207700_101165682 | 331 |
| 462 | 3300025932 | Ga0207690_10079292 | Ga0207690_100792922 | 331 |
| 463 | 3300025933 | Ga0207706_10157808 | Ga0207706_101578082 | 331 |
| 464 | 3300025935 | Ga0207709_10041379 | Ga0207709_100413791 | 331 |
| 465 | 3300025936 | Ga0207670_10150021 | Ga0207670_101500212 | 331 |
| 466 | 3300025937 | Ga0207669_10141525 | Ga0207669_101415251 | 331 |
| 467 | 3300025940 | Ga0207691_10132535 | Ga0207691_101325352 | 331 |
| 468 | 3300025940 | Ga0207691_10306910 | Ga0207691_103069102 | 331 |
| 469 | 3300025941 | Ga0207711_10105448 | Ga0207711_101054482 | 331 |
| 470 | 3300025942 | Ga0207689_10158597 | Ga0207689_101585972 | 331 |
| 471 | 3300025944 | Ga0207661_10048506 | Ga0207661_100485062 | 331 |
| 472 | 3300025944 | Ga0207661_10125464 | Ga0207661_101254641 | 331 |
| 473 | 3300025945 | Ga0207679_10070558 | Ga0207679_100705582 | 331 |
| 474 | 3300025945 | Ga0207679_10150400 | Ga0207679_101504002 | 331 |
| 475 | 3300025949 | Ga0207667_10008531 | Ga0207667_100085318 | 331 |
| 476 | 3300025949 | Ga0207667_10052933 | Ga0207667_100529332 | 331 |
| 477 | 3300025960 | Ga0207651_10172271 | Ga0207651_101722712 | 331 |
| 478 | 3300026023 | Ga0207677_10103045 | Ga0207677_101030452 | 331 |
| 479 | 3300026035 | Ga0207703_10095890 | Ga0207703_100958902 | 331 |
| 480 | 3300026035 | Ga0207703_10131761 | Ga0207703_101317612 | 331 |
| 481 | 3300026035 | Ga0207703_10180724 | Ga0207703_101807242 | 331 |
| 482 | 3300026035 | Ga0207703_10476527 | Ga0207703_104765271 | 331 |
| 483 | 3300026041 | Ga0207639_10003675 | Ga0207639_100036752 | 331 |
| 484 | 3300026067 | Ga0207678_10053086 | Ga0207678_100530862 | 331 |
| 485 | 3300026067 | Ga0207678_10072041 | Ga0207678_100720412 | 331 |
| 486 | 3300026067 | Ga0207678_10083348 | Ga0207678_100833482 | 331 |
| 487 | 3300026067 | Ga0207678_10137255 | Ga0207678_101372552 | 331 |
| 488 | 3300026067 | Ga0207678_10188825 | Ga0207678_101888252 | 331 |
| 489 | 3300026067 | Ga0207678_10193435 | Ga0207678_101934351 | 331 |
| 490 | 3300026075 | Ga0207708_10109018 | Ga0207708_101090182 | 331 |
| 491 | 3300026075 | Ga0207708_10344112 | Ga0207708_103441122 | 331 |
| 492 | 3300026078 | Ga0207702_10325583 | Ga0207702_103255832 | 331 |
| 493 | 3300026095 | Ga0207676_10126646 | Ga0207676_101266462 | 331 |
| 494 | 3300026095 | Ga0207676_10143134 | Ga0207676_101431342 | 331 |
| 495 | 3300026116 | Ga0207674_10020168 | Ga0207674_100201685 | 331 |
| 496 | 3300026116 | Ga0207674_10525771 | Ga0207674_105257711 | 331 |
| 497 | 3300026118 | Ga0207675_100273435 | Ga0207675_1002734352 | 331 |
| 498 | 3300026121 | Ga0207683_10021269 | Ga0207683_100212692 | 331 |
| 499 | 3300026121 | Ga0207683_10183843 | Ga0207683_101838432 | 331 |
| 500 | 3300026142 | Ga0207698_10038868 | Ga0207698_100388683 | 331 |
| 501 | 3300026142 | Ga0207698_10187372 | Ga0207698_101873722 | 331 |
| 502 | 3300026142 | Ga0207698_10246508 | Ga0207698_102465081 | 331 |
| 503 | 3300027296 | Ga0209389_1000001 | Ga0209389_100000163 | 331 |
| 504 | 3300027296 | Ga0209389_1000014 | Ga0209389_1000014109 | 331 |
| 505 | 3300027357 | Ga0209589_1000011 | Ga0209589_1000011149 | 331 |
| 506 | 3300027357 | Ga0209589_1000020 | Ga0209589_1000020109 | 331 |
| 507 | 3300027361 | Ga0209489_100012 | Ga0209489_100012149 | 331 |
| 508 | 3300027361 | Ga0209489_100060 | Ga0209489_10006068 | 331 |
| 509 | 3300027361 | Ga0209489_102213 | Ga0209489_10221337 | 331 |
| 510 | 3300027363 | Ga0209700_100007 | Ga0209700_100007341 | 331 |
| 511 | 3300027363 | Ga0209700_100019 | Ga0209700_100019149 | 331 |
| 512 | 3300027671 | Ga0209588_1001736 | Ga0209588_10017362 | 331 |
| 513 | 3300027907 | Ga0207428_10193849 | Ga0207428_101938492 | 331 |
| 514 | 3300028379 | Ga0268266_10003127 | Ga0268266_1000312711 | 331 |
| 515 | 3300028379 | Ga0268266_10026938 | Ga0268266_100269382 | 331 |
| 516 | 3300028379 | Ga0268266_10068734 | Ga0268266_100687342 | 331 |
| 517 | 3300028379 | Ga0268266_10184106 | Ga0268266_101841062 | 331 |
| 518 | 3300028379 | Ga0268266_10247990 | Ga0268266_102479901 | 331 |
| 519 | 3300028380 | Ga0268265_10070120 | Ga0268265_100701202 | 331 |
| 520 | 3300028381 | Ga0268264_10001991 | Ga0268264_1000199110 | 331 |
| 521 | 3300028558 | Ga0265326_10019700 | Ga0265326_100197002 | 331 |
| 522 | 3300028573 | Ga0265334_10063647 | Ga0265334_100636471 | 331 |
| 523 | 3300028577 | Ga0265318_10082152 | Ga0265318_100821521 | 331 |
| 524 | 3300028666 | Ga0265336_10000251 | Ga0265336_1000025129 | 331 |
| 525 | 3300028786 | Ga0307517_10001377 | Ga0307517_100013772 | 331 |
| 526 | 3300028794 | Ga0307515_10015737 | Ga0307515_1001573710 | 331 |
| 527 | 3300028794 | Ga0307515_10292228 | Ga0307515_102922281 | 331 |
| 528 | 3300028800 | Ga0265338_10000582 | Ga0265338_1000058229 | 331 |
| 529 | 3300030521 | Ga0307511_10186809 | Ga0307511_101868091 | 331 |
| 530 | 3300031235 | Ga0265330_10058738 | Ga0265330_100587382 | 331 |
| 531 | 3300031241 | Ga0265325_10030259 | Ga0265325_100302592 | 331 |
| 532 | 3300031250 | Ga0265331_10015945 | Ga0265331_100159452 | 331 |
| 533 | 3300031507 | Ga0307509_10031346 | Ga0307509_100313463 | 331 |
| 534 | 3300031507 | Ga0307509_10092253 | Ga0307509_100922532 | 331 |
| 535 | 3300031616 | Ga0307508_10000015 | Ga0307508_10000015160 | 331 |
| 536 | 3300031616 | Ga0307508_10076362 | Ga0307508_100763622 | 331 |
| 537 | 3300031616 | Ga0307508_10119666 | Ga0307508_101196662 | 331 |
| 538 | 3300031730 | Ga0307516_10099436 | Ga0307516_100994362 | 331 |
| 539 | 3300031730 | Ga0307516_10173172 | Ga0307516_101731721 | 331 |
| 540 | 3300031911 | Ga0307412_10110355 | Ga0307412_101103552 | 331 |
| 541 | 3300032002 | Ga0307416_100209455 | Ga0307416_1002094552 | 331 |
| 542 | 3300032126 | Ga0307415_100104096 | Ga0307415_1001040962 | 331 |
| 543 | 3300033179 | Ga0307507_10041557 | Ga0307507_100415572 | 331 |
| 544 | 3300033180 | Ga0307510_10023663 | Ga0307510_100236636 | 331 |
| 545 | 3300033180 | Ga0307510_10050267 | Ga0307510_100502671 | 331 |
| 546 | 3300033180 | Ga0307510_10121371 | Ga0307510_101213712 | 331 |
| 547 | 3300033442 | Ga0315911_1000002 | Ga0315911_100000262 | 331 |
| 548 | 3300033544 | Ga0316215_1001502 | Ga0316215_10015021 | 331 |
| 549 | 3300035086 | Ga0373934_0025731 | Ga0373934_0025731_88_1086 | 331 |
| 550 | 3300035111 | Ga0373923_0016759 | Ga0373923_0016759_1490_2488 | 331 |
| 551 | 3300035117 | Ga0373953_0000552 | Ga0373953_0000552_1859_2857 | 331 |
| 552 | 3300035118 | Ga0373954_0000416 | Ga0373954_0000416_10756_11754 | 331 |
| 553 | 3300035119 | Ga0373956_0000642 | Ga0373956_0000642_13091_14089 | 331 |
| 554 | 3300035172 | Ga0373955_0000572 | Ga0373955_0000572_9842_10840 | 331 |
| 555 | 3300035410 | Ga0373924_0045322 | Ga0373924_0045322_548_1546 | 331 |
| 556 | 3300035692 | Ga0373935_0052701 | Ga0373935_0052701_1354_2349 | 331 |
| 557 | 3300035692 | Ga0373935_0202421 | Ga0373935_0202421_222_1217 | 331 |
| 558 | 3300035695 | Ga0373927_0018657 | Ga0373927_0018657_3236_4231 | 331 |
| 559 | 3300035695 | Ga0373927_0109288 | Ga0373927_0109288_507_1502 | 331 |
| 560 | 3300035724 | Ga0373933_0000270 | Ga0373933_0000270_7298_8296 | 331 |
| 561 | 3300035724 | Ga0373933_0000296 | Ga0373933_0000296_15085_16080 | 331 |
| 562 | 3300035725 | Ga0373947_0007716 | Ga0373947_0007716_5165_6160 | 331 |
| 563 | 3300035725 | Ga0373947_0022378 | Ga0373947_0022378_1274_2269 | 331 |
| 564 | 3300036401 | Ga0373937_0007677 | Ga0373937_0007677_5371_6369 | 331 |
| 565 | 3300037068 | Ga0373925_0043342 | Ga0373925_0043342_174_1169 | 331 |
| 566 | 3300037312 | Ga0395899_0039304 | Ga0395899_0039304_2208_3203 | 331 |
| 567 | 3300037418 | Ga0395900_0000939 | Ga0395900_0000939_23229_24224 | 331 |
| 568 | 3300037418 | Ga0395900_0003215 | Ga0395900_0003215_3422_4417 | 331 |
| 569 | 3300037466 | Ga0395898_0010196 | Ga0395898_0010196_7636_8631 | 331 |
| 570 | 3300037466 | Ga0395898_0011912 | Ga0395898_0011912_2433_3428 | 331 |
| 571 | 3300037466 | Ga0395898_0105086 | Ga0395898_0105086_486_1481 | 331 |
| 572 | 3300037471 | Ga0395905_0088612 | Ga0395905_0088612_574_1572 | 331 |
| 573 | 3300037471 | Ga0395905_0417902 | Ga0395905_0417902_35_1030 | 331 |
| 574 | 3300038443 | Ga0395901_0038620 | Ga0395901_0038620_912_1907 | 331 |
| 575 | 3300038443 | Ga0395901_0112942 | Ga0395901_0112942_504_1499 | 331 |
| 576 | 3300039447 | Ga0436361_0192375 | Ga0436361_0192375_411_1406 | 331 |
| 577 | 3300046454 | Ga0495592_0008493 | Ga0495592_0008493_2823_3821 | 331 |
| 578 | 3300046455 | Ga0495603_0024269 | Ga0495603_0024269_1553_2548 | 331 |
| 579 | 3300046455 | Ga0495603_0054696 | Ga0495603_0054696_752_1747 | 331 |
| 580 | 3300046455 | Ga0495603_0066955 | Ga0495603_0066955_921_1916 | 331 |
| 581 | 3300046459 | Ga0495629_0000077 | Ga0495629_0000077_43689_44687 | 331 |
| 582 | 3300046460 | Ga0495638_0018541 | Ga0495638_0018541_1680_2675 | 331 |
| 583 | 3300046460 | Ga0495638_0088644 | Ga0495638_0088644_350_1345 | 331 |
| 584 | 3300046460 | Ga0495638_0191218 | Ga0495638_0191218_120_1115 | 331 |
| 585 | 3300046462 | Ga0495651_0000839 | Ga0495651_0000839_1966_2964 | 331 |
| 586 | 3300046462 | Ga0495651_0043164 | Ga0495651_0043164_106_1101 | 331 |
| 587 | 3300046463 | Ga0495653_0000769 | Ga0495653_0000769_5349_6347 | 331 |
| 588 | 3300046475 | Ga0495639_0015632 | Ga0495639_0015632_1272_2267 | 331 |
| 589 | 3300046475 | Ga0495639_0061269 | Ga0495639_0061269_530_1525 | 331 |
| 590 | 3300046491 | Ga0495584_0038653 | Ga0495584_0038653_47_1042 | 331 |
| 591 | 3300046492 | Ga0495585_0044596 | Ga0495585_0044596_1359_2354 | 331 |
| 592 | 3300046492 | Ga0495585_0087442 | Ga0495585_0087442_600_1595 | 331 |
| 593 | 3300046507 | Ga0495606_0029307 | Ga0495606_0029307_1621_2616 | 331 |
| 594 | 3300046507 | Ga0495606_0102289 | Ga0495606_0102289_85_1080 | 331 |
| 595 | 3300046511 | Ga0495608_0002598 | Ga0495608_0002598_9134_10132 | 331 |
| 596 | 3300046512 | Ga0495610_0053558 | Ga0495610_0053558_407_1402 | 331 |
| 597 | 3300046514 | Ga0495618_0023818 | Ga0495618_0023818_35_1033 | 331 |
| 598 | 3300046516 | Ga0495628_0015464 | Ga0495628_0015464_5267_6265 | 331 |
| 599 | 3300046522 | Ga0495643_0129046 | Ga0495643_0129046_52_1047 | 331 |
| 600 | 3300046523 | Ga0495644_0032174 | Ga0495644_0032174_368_1363 | 331 |
| 601 | 3300046524 | Ga0495648_0005256 | Ga0495648_0005256_4602_5597 | 331 |
| 602 | 3300046524 | Ga0495648_0107560 | Ga0495648_0107560_461_1459 | 331 |
| 603 | 3300046525 | Ga0495663_0020274 | Ga0495663_0020274_180_1175 | 331 |
| 604 | 3300046529 | Ga0495652_0010743 | Ga0495652_0010743_6542_7540 | 331 |
| 605 | 3300046533 | Ga0495640_0007431 | Ga0495640_0007431_2511_3509 | 331 |
| 606 | 3300046533 | Ga0495640_0103148 | Ga0495640_0103148_636_1631 | 331 |
| 607 | 3300046536 | Ga0495587_0003203 | Ga0495587_0003203_8964_9962 | 331 |
| 608 | 3300046557 | Ga0495622_0052574 | Ga0495622_0052574_817_1812 | 331 |
| 609 | 3300046559 | Ga0495667_0001596 | Ga0495667_0001596_9185_10183 | 331 |
| 610 | 3300046615 | Ga0495656_0004563 | Ga0495656_0004563_1149_2144 | 331 |
| 611 | 3300046616 | Ga0495668_0107709 | Ga0495668_0107709_401_1396 | 331 |
| 612 | 3300046616 | Ga0495668_0109421 | Ga0495668_0109421_151_1146 | 331 |
| 613 | 3300046616 | Ga0495668_0213594 | Ga0495668_0213594_15_1010 | 331 |
| 614 | 3300046642 | Ga0495634_0064893 | Ga0495634_0064893_566_1564 | 331 |
| 615 | 3300046648 | Ga0495611_0151302 | Ga0495611_0151302_18_1013 | 331 |
| 616 | 3300046663 | Ga0495635_0000160 | Ga0495635_0000160_38312_39310 | 331 |
| 617 | 3300046664 | Ga0495659_0022724 | Ga0495659_0022724_247_1242 | 331 |
| 618 | 3300046664 | Ga0495659_0086208 | Ga0495659_0086208_173_1168 | 331 |
| 619 | 3300046674 | Ga0495588_0123080 | Ga0495588_0123080_308_1303 | 331 |
| 620 | 3300046675 | Ga0495657_0011085 | Ga0495657_0011085_4902_5900 | 331 |
| 621 | 3300046678 | Ga0495599_0001355 | Ga0495599_0001355_9185_10183 | 331 |
| 622 | 3300046679 | Ga0495623_0007375 | Ga0495623_0007375_3164_4162 | 331 |
| 623 | 3300046689 | Ga0495613_0105538 | Ga0495613_0105538_580_1575 | 331 |
| 624 | 3300046694 | Ga0495649_0154931 | Ga0495649_0154931_56_1051 | 331 |
| 625 | 3300046809 | Ga0495600_0000248 | Ga0495600_0000248_10117_11115 | 331 |
| 626 | 3300047317 | Ga0495604_0000443 | Ga0495604_0000443_10338_11336 | 331 |
| 627 | 3300047321 | Ga0495676_0058173 | Ga0495676_0058173_1768_2763 | 331 |
| 628 | 3300047322 | Ga0495680_0002003 | Ga0495680_0002003_18412_19410 | 331 |
| 629 | 3300047443 | Ga0495687_069680 | Ga0495687_069680_255_1250 | 331 |
| 630 | 3300047444 | Ga0495675_0000857 | Ga0495675_0000857_6775_7773 | 331 |
| 631 | 3300047471 | Ga0495684_0000068 | Ga0495684_0000068_18356_19354 | 331 |
| 632 | 3300047673 | Ga0495593_0000215 | Ga0495593_0000215_867_1865 | 331 |
| 633 | 3300048088 | Ga0495602_0026301 | Ga0495602_0026301_4391_5389 | 331 |
| 634 | 3300048903 | Ga0496100_0003644 | Ga0496100_0003644_5217_6212 | 331 |
| 635 | 3300048904 | Ga0496101_0041170 | Ga0496101_0041170_1643_2638 | 331 |
| 636 | 3300048905 | Ga0496102_0012975 | Ga0496102_0012975_217_1212 | 331 |
| 637 | 3300048906 | Ga0496103_0038852 | Ga0496103_0038852_745_1740 | 331 |
| 638 | 3300048907 | Ga0496104_0169532 | Ga0496104_0169532_488_1483 | 331 |
| 639 | 3300048908 | Ga0496105_0017824 | Ga0496105_0017824_1508_2503 | 331 |
| 640 | 3300048908 | Ga0496105_0176634 | Ga0496105_0176634_243_1238 | 331 |
| 641 | 3300048909 | Ga0496106_0005689 | Ga0496106_0005689_6102_7097 | 331 |
| 642 | 3300048909 | Ga0496106_0072134 | Ga0496106_0072134_57_1052 | 331 |
| 643 | 3300048909 | Ga0496106_0118924 | Ga0496106_0118924_341_1336 | 331 |
| 644 | 3300048910 | Ga0496107_0002113 | Ga0496107_0002113_6106_7101 | 331 |
| 645 | 3300048911 | Ga0496108_0066977 | Ga0496108_0066977_754_1749 | 331 |
| 646 | 3300048911 | Ga0496108_0121901 | Ga0496108_0121901_264_1259 | 331 |
| 647 | 3300048911 | Ga0496108_0172973 | Ga0496108_0172973_606_1649 | 331 |
| 648 | 3300048912 | Ga0496109_0199957 | Ga0496109_0199957_111_1106 | 331 |
| 649 | 3300048913 | Ga0496110_0021514 | Ga0496110_0021514_2556_3551 | 331 |
| 650 | 3300048913 | Ga0496110_0339063 | Ga0496110_0339063_224_1219 | 331 |
| 651 | 3300048915 | Ga0496112_0000044 | Ga0496112_0000044_69074_70075 | 331 |
| 652 | 3300048915 | Ga0496112_0014847 | Ga0496112_0014847_6188_7183 | 331 |
| 653 | 3300048915 | Ga0496112_0118903 | Ga0496112_0118903_232_1227 | 331 |
| 654 | 3300048915 | Ga0496112_0240439 | Ga0496112_0240439_27_1022 | 331 |
| 655 | 3300048915 | Ga0496112_0324962 | Ga0496112_0324962_368_1363 | 331 |
| 656 | 3300048916 | Ga0496113_0020886 | Ga0496113_0020886_1505_2500 | 331 |
| 657 | 3300048916 | Ga0496113_0044619 | Ga0496113_0044619_1822_2817 | 331 |
| 658 | 3300048918 | Ga0496115_0004269 | Ga0496115_0004269_7758_8753 | 331 |
| 659 | 3300048918 | Ga0496115_0359541 | Ga0496115_0359541_32_1027 | 331 |
| 660 | 3300048919 | Ga0496116_0001178 | Ga0496116_0001178_28684_29679 | 331 |
| 661 | 3300048920 | Ga0496117_0045212 | Ga0496117_0045212_752_1747 | 331 |
| 662 | 3300048921 | Ga0496118_0003016 | Ga0496118_0003016_5026_6021 | 331 |
| 663 | 3300048922 | Ga0496119_0153040 | Ga0496119_0153040_24_1019 | 331 |
| 664 | 3300048923 | Ga0496120_0015097 | Ga0496120_0015097_3547_4542 | 331 |
| 665 | 3300048923 | Ga0496120_0049551 | Ga0496120_0049551_407_1402 | 331 |
| 666 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_159345_160340 | 331 |
| 667 | 3300048924 | Ga0496121_0001244 | Ga0496121_0001244_29787_30782 | 331 |
| 668 | 3300048924 | Ga0496121_0006260 | Ga0496121_0006260_5226_6221 | 331 |
| 669 | 3300048924 | Ga0496121_0096357 | Ga0496121_0096357_797_1792 | 331 |
| 670 | 3300048924 | Ga0496121_0103269 | Ga0496121_0103269_1154_2149 | 331 |
| 671 | 3300048924 | Ga0496121_0153828 | Ga0496121_0153828_473_1468 | 331 |
| 672 | 3300048924 | Ga0496121_0162398 | Ga0496121_0162398_38_1033 | 331 |
| 673 | 3300048924 | Ga0496121_0184230 | Ga0496121_0184230_222_1217 | 331 |
| 674 | 3300048926 | Ga0496123_0144346 | Ga0496123_0144346_194_1189 | 331 |
| 675 | 3300048927 | Ga0496124_0019158 | Ga0496124_0019158_175_1170 | 331 |
| 676 | 3300048927 | Ga0496124_0237910 | Ga0496124_0237910_327_1322 | 331 |
| 677 | 3300048928 | Ga0496125_0000998 | Ga0496125_0000998_20673_21668 | 331 |
| 678 | 3300048928 | Ga0496125_0005652 | Ga0496125_0005652_6337_7332 | 331 |
| 679 | 3300048928 | Ga0496125_0007928 | Ga0496125_0007928_7801_8811 | 331 |
| 680 | 3300048928 | Ga0496125_0018155 | Ga0496125_0018155_2191_3186 | 331 |
| 681 | 3300048928 | Ga0496125_0062865 | Ga0496125_0062865_772_1767 | 331 |
| 682 | 3300048928 | Ga0496125_0107391 | Ga0496125_0107391_794_1789 | 331 |
| 683 | 3300048929 | Ga0496126_0007108 | Ga0496126_0007108_8566_9561 | 331 |
| 684 | 3300048929 | Ga0496126_0032076 | Ga0496126_0032076_3005_4000 | 331 |
| 685 | 3300048929 | Ga0496126_0066222 | Ga0496126_0066222_1257_2252 | 331 |
| 686 | 3300048929 | Ga0496126_0357805 | Ga0496126_0357805_158_1153 | 331 |
| 687 | 3300049460 | Ga0495682_0005698 | Ga0495682_0005698_1906_2901 | 331 |
| 688 | 3300049460 | Ga0495682_0063488 | Ga0495682_0063488_30_1028 | 331 |
| 689 | 3300050491 | nmdc:mga00v17_162262_c1 | nmdc:mga00v17_162262_c1_261_1256 | 331 |
| 690 | 3300050492 | nmdc:mga0yw44_130805_c1 | nmdc:mga0yw44_130805_c1_202_1197 | 331 |
| 691 | 3300050492 | nmdc:mga0yw44_136992_c1 | nmdc:mga0yw44_136992_c1_271_1266 | 331 |
| 692 | 3300050492 | nmdc:mga0yw44_69043_c1 | nmdc:mga0yw44_69043_c1_357_1352 | 331 |
| 693 | 3300050492 | nmdc:mga0yw44_96917_c1 | nmdc:mga0yw44_96917_c1_776_1771 | 331 |
| 694 | 3300050495 | nmdc:mga04h51_7798_c1 | nmdc:mga04h51_7798_c1_1026_2021 | 331 |
| 695 | 3300050496 | nmdc:mga07m45_160947_c1 | nmdc:mga07m45_160947_c1_205_1200 | 331 |
| 696 | 3300050507 | nmdc:mga05p37_13452_c1 | nmdc:mga05p37_13452_c1_1654_2649 | 331 |
| 697 | 3300050516 | nmdc:mga0sz30_16268_c1 | nmdc:mga0sz30_16268_c1_88_1083 | 331 |
| 698 | 3300050516 | nmdc:mga0sz30_60931_c1 | nmdc:mga0sz30_60931_c1_166_1161 | 331 |
| 699 | 3300053077 | Ga0495601_0027716 | Ga0495601_0027716_2358_3356 | 331 |
| 700 | 3300053084 | Ga0495595_0000543 | Ga0495595_0000543_9324_10322 | 331 |
| 701 | 3300053085 | Ga0495619_0022259 | Ga0495619_0022259_2708_3703 | 331 |
| 702 | 3300053085 | Ga0495619_0245538 | Ga0495619_0245538_20_1015 | 331 |
| 703 | 3300053087 | Ga0500643_000069 | Ga0500643_000069_31462_32457 | 331 |
| 704 | 3300053093 | Ga0500651_0127028 | Ga0500651_0127028_357_1352 | 331 |
| 705 | 3300053094 | Ga0500566_0001531 | Ga0500566_0001531_3949_4947 | 331 |
| 706 | 3300053096 | Ga0500641_0006118 | Ga0500641_0006118_2359_3354 | 331 |
| 707 | 3300053103 | Ga0500555_007493 | Ga0500555_007493_201_1196 | 331 |
| 708 | 3300053104 | Ga0500556_0000015 | Ga0500556_0000015_184193_185188 | 331 |
| 709 | 3300053109 | Ga0500569_004477 | Ga0500569_004477_257_1252 | 331 |
| 710 | 3300053111 | Ga0500572_000742 | Ga0500572_000742_130_1134 | 331 |
| 711 | 3300053116 | Ga0500592_010843 | Ga0500592_010843_106_1101 | 331 |
| 712 | 3300053119 | Ga0500595_000200 | Ga0500595_000200_18869_19867 | 331 |
| 713 | 3300053119 | Ga0500595_002044 | Ga0500595_002044_4529_5524 | 331 |
| 714 | 3300053119 | Ga0500595_003639 | Ga0500595_003639_3369_4364 | 331 |
| 715 | 3300053121 | Ga0500607_075569 | Ga0500607_075569_41_1036 | 331 |
| 716 | 3300053130 | Ga0500642_0000019 | Ga0500642_0000019_106055_107050 | 331 |
| 717 | 3300053130 | Ga0500642_0050795 | Ga0500642_0050795_441_1436 | 331 |
| 718 | 3300053131 | Ga0500652_004088 | Ga0500652_004088_3287_4282 | 331 |
| 719 | 3300053134 | Ga0500658_0048535 | Ga0500658_0048535_384_1379 | 331 |
| 720 | 3300053136 | Ga0500559_0000396 | Ga0500559_0000396_14630_15625 | 331 |
| 721 | 3300053136 | Ga0500559_0001660 | Ga0500559_0001660_10932_11936 | 331 |
| 722 | 3300053139 | Ga0500568_0004509 | Ga0500568_0004509_1666_2661 | 331 |
| 723 | 3300053139 | Ga0500568_0015661 | Ga0500568_0015661_812_1807 | 331 |
| 724 | 3300053142 | Ga0500577_0000054 | Ga0500577_0000054_11101_12105 | 331 |
| 725 | 3300053145 | Ga0500586_000408 | Ga0500586_000408_1595_2590 | 331 |
| 726 | 3300053150 | Ga0500603_032993 | Ga0500603_032993_31_1029 | 331 |
| 727 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_46046_47041 | 331 |
| 728 | 3300053153 | Ga0500616_0022364 | Ga0500616_0022364_176_1174 | 331 |
| 729 | 3300053156 | Ga0500622_0022547 | Ga0500622_0022547_264_1262 | 331 |
| 730 | 3300053156 | Ga0500622_0042068 | Ga0500622_0042068_857_1852 | 331 |
| 731 | 3300053156 | Ga0500622_0118010 | Ga0500622_0118010_120_1115 | 331 |
| 732 | 3300053158 | Ga0500627_0025475 | Ga0500627_0025475_757_1752 | 331 |
| 733 | 3300053161 | Ga0500634_0037717 | Ga0500634_0037717_1530_2525 | 331 |
| 734 | 3300053162 | Ga0500638_005976 | Ga0500638_005976_3861_4859 | 331 |
| 735 | 3300053177 | Ga0500636_0000616 | Ga0500636_0000616_4496_5491 | 331 |
| 736 | 3300053178 | Ga0500637_0000144 | Ga0500637_0000144_19297_20295 | 331 |
| 737 | 3300053733 | Ga0500552_006897 | Ga0500552_006897_243_1238 | 331 |
| 738 | 3300053735 | Ga0500596_001679 | Ga0500596_001679_136_1140 | 331 |
| 739 | 3300053736 | Ga0500599_000340 | Ga0500599_000340_482_1480 | 331 |
| 740 | 3300053737 | Ga0500601_000035 | Ga0500601_000035_4002_4997 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a7g-assembly1.cif.gz_A | soluble epoxide hydrolase in complex with tk90 | 0.8844 | 6 | 327 |
| 7p4k-assembly1.cif.gz_A | soluble epoxide hydrolase in complex with fl217 | 0.8732 | 3 | 327 |
| 5alv-assembly1.cif.gz_A | ligand complex structure of soluble epoxide hydrolase | 0.8728 | 3 | 327 |
| 5ak6-assembly1.cif.gz_A-2 | ligand complex structure of soluble epoxide hydrolase | 0.8708 | 6 | 327 |
| 5akk-assembly1.cif.gz_A-2 | ligand complex structure of soluble epoxide hydrolase | 0.8707 | 6 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8658 | 1 | 97 | 3.40.50.12270 |
| 5cw2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8629 | 5 | 324 | 3.40.50.1820 |
| af_B6SUW2_10_323_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8585 | 3 | 331 | 3.40.50.1820 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8571 | 1 | 97 | 3.40.50.12270 |
| af_B6SUW2_10_323_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8559 | 3 | 331 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T0QJH6-F1-model_v4 | Alpha/beta hydrolase family protein | 0.9338 | 6 | 138 |
GO:0016787
|
| AF-A0A1I3U8I9-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9263 | 84 | 331 |
GO:0003824
|
| AF-A0A2X2MRA0-F1-model_v4 | deleted | 0.9257 | 30 | 328 |
|
| AF-B5GUK2-F1-model_v4 | Putative epoxide hydrolase | 0.9256 | 3 | 328 |
GO:0016787
|
| AF-A0A401TTW0-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9221 | 138 | 331 |
GO:0004301
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar