F478548

General Info

Members Datasets Scaffolds Average Seq Length
740 464 621 328

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0172973|Ga0496108_0172973_606_1649
Length 347
Sequence VAVFRQGHAEEKERLTMLEMPPLQFAQTNGIRMGYYEAGPKTDTPPVILCHGWPEIAFSWRHQLKALAAAGIRVIAPDQRGYGATDRPEPVESYDMEHLTGDLVGLLDHLKIDKAIFVGHDWGGFIVWQMPLRHIDRVAGVVGVNTPHTDRAPADPIELFRKRFGEHMYIVQFQDPSRSADKVFNSRVEQTFDAFMRMPVPRSDTTPEDPPTAGVGASARLNLAFPQMVANYDAKHDPRTPILSPEEKQVFVDTFTKSGFTGGINWYRNMSRNWQRSADIDHKVRVPSLMIMAENDRVLPPSAADGMEKIIPDLEKYLVRGSGHWTQQEKPDEVSAKLIEWRKRRFG

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2791355199
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
32 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
33 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
34 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
35 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
36 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
37 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
38 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
39 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
40 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
41 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
42 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
43 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
44 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
48 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
49 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
50 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
51 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
52 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
53 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
54 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
55 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
56 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
57 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
58 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
59 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
60 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
61 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
62 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
63 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
64 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
65 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
66 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
67 2904699407
68 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
69 2906610324
70 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
71 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
72 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
73 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
74 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
75 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
76 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
77 2922368715
78 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
79 2922425934
80 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
81 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
82 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
83 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
84 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
85 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
86 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
87 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
88 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
89 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
90 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
91 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
92 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
93 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
94 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
95 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
96 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
97 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
98 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
99 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
100 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
101 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
102 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
103 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
105 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
106 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
108 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
109 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
110 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
111 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
112 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
122 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
128 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
129 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
130 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
136 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
137 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
138 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
139 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
140 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
141 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
142 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
143 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
144 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
145 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
146 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
147 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
148 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
149 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
150 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
151 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
152 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
153 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
154 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
155 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
156 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
157 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
158 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
161 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
187 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
188 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
189 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
242 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
243 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
244 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
245 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
251 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
252 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
253 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
254 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
257 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
258 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
271 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
275 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
304 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
321 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
324 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
333 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
334 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
335 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
345 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
346 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
400 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
416 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
417 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
418 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
421 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
422 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
425 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
426 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
427 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
428 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
431 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
432 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
433 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
434 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
435 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
436 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
437 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
438 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
439 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
440 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
443 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
444 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
445 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
446 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
447 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
448 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
449 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
450 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
451 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
452 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
453 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
454 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
455 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
456 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
457 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
458 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
459 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
460 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
461 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
462 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
463 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
464 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.49
Metatranscriptomes 0
Isolates 15.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.54
Nodule 12.7
Rhizoplane 4.05
Rhizosphere 60.14
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000050 3300003203 Bacteria 54388
2 JGI25153J46596_10008915 3300003215 Bacteria 4733
3 JGI25160J50197_1001490 3300003354 Bacteria 11633
4 JGI25160J50197_1002236 3300003354 Bacteria 9086
5 JGI25404J52841_10005298 3300003659 Bacteria 2661
6 JGI25404J52841_10021596 3300003659 Bacteria 1393
7 Ga0070658_10099686 3300005327 Bacteria 2400
8 Ga0070658_10109993 3300005327 Bacteria 2282
9 Ga0070658_10186629 3300005327 Bacteria 1746
10 Ga0068869_100029935 3300005334 Bacteria 3818
11 Ga0070680_100004719 3300005336 Bacteria 10256
12 Ga0070680_100014584 3300005336 Bacteria 6146
13 Ga0070680_100255953 3300005336 Bacteria 1481
14 Ga0068868_100076601 3300005338 Bacteria 2674
15 Ga0070660_100009169 3300005339 Bacteria 6948
16 Ga0070660_100094591 3300005339 Bacteria 2361
17 Ga0070689_100138200 3300005340 Bacteria 1958
18 Ga0070661_100071579 3300005344 Bacteria 2551
19 Ga0070661_100076977 3300005344 Bacteria 2459
20 Ga0070661_100147483 3300005344 Bacteria 1777
21 Ga0070668_100156147 3300005347 Bacteria 1848
22 Ga0070668_100237573 3300005347 Bacteria 1508
23 Ga0070675_100150308 3300005354 Bacteria 1996
24 Ga0070659_100031867 3300005366 Bacteria 4086
25 Ga0070709_10003646 3300005434 Bacteria 8262
26 Ga0070709_10009472 3300005434 Bacteria 5376
27 Ga0070714_100007489 3300005435 Bacteria 8495
28 Ga0070714_100142015 3300005435 Bacteria 2156
29 Ga0070713_100001931 3300005436 Bacteria 13391
30 Ga0070713_100067392 3300005436 Bacteria 3013
31 Ga0070713_100094645 3300005436 Bacteria 2576
32 Ga0070710_10000550 3300005437 Bacteria 17724
33 Ga0070710_10003153 3300005437 Bacteria 7815
34 Ga0070710_10130331 3300005437 Bacteria 1533
35 Ga0070711_100002127 3300005439 Bacteria 11224
36 Ga0070711_100007740 3300005439 Bacteria 6545
37 Ga0070711_100070950 3300005439 Bacteria 2454
38 Ga0070708_100108943 3300005445 Bacteria 2544
39 Ga0070663_100016024 3300005455 Bacteria 4854
40 Ga0070663_100051004 3300005455 Bacteria 2945
41 Ga0070663_100080349 3300005455 Bacteria 2394
42 Ga0070663_100228043 3300005455 Bacteria 1465
43 Ga0070678_100035925 3300005456 Bacteria 3464
44 Ga0070678_100097677 3300005456 Bacteria 2269
45 Ga0070678_100254636 3300005456 Bacteria 1473
46 Ga0070662_100053581 3300005457 Bacteria 2920
47 Ga0070681_10042060 3300005458 Bacteria 4580
48 Ga0070698_100031641 3300005471 Bacteria 5484
49 Ga0070679_100015108 3300005530 Bacteria 7421
50 Ga0070679_100022377 3300005530 Bacteria 6179
51 Ga0070679_100080354 3300005530 Bacteria 3249
52 Ga0070684_100010908 3300005535 Bacteria 7221
53 Ga0068853_100001884 3300005539 Bacteria 15451
54 Ga0068853_100132729 3300005539 Bacteria 2230
55 Ga0070665_100012656 3300005548 Bacteria 8497
56 Ga0070665_100027888 3300005548 Bacteria 5686
57 Ga0068855_100019655 3300005563 Bacteria 8112
58 Ga0070664_100112233 3300005564 Bacteria 2380
59 Ga0068857_100013449 3300005577 Bacteria 7129
60 Ga0068856_100000340 3300005614 Bacteria 51206
61 Ga0068852_100007926 3300005616 Bacteria 7780
62 Ga0068852_100070224 3300005616 Bacteria 3072
63 Ga0068852_100167947 3300005616 Bacteria 2054
64 Ga0068852_100292596 3300005616 Bacteria 1574
65 Ga0068859_100525050 3300005617 Bacteria 1279
66 Ga0068864_100109305 3300005618 Bacteria 2461
67 Ga0068866_10227760 3300005718 Bacteria 1129
68 Ga0068851_10003888 3300005834 Bacteria 6682
69 Ga0068860_100000399 3300005843 Bacteria 56959
70 Ga0068862_100079066 3300005844 Bacteria 2850
71 Ga0068862_100298078 3300005844 Bacteria 1482
72 Ga0081455_10004053 3300005937 Bacteria 16599
73 Ga0081455_10191473 3300005937 Bacteria 1540
74 Ga0081540_1005983 3300005983 Bacteria 8958
75 Ga0081540_1018369 3300005983 Bacteria 4292
76 Ga0081540_1018679 3300005983 Bacteria 4244
77 Ga0081540_1032906 3300005983 Bacteria 2823
78 Ga0081540_1039319 3300005983 Bacteria 2481
79 Ga0081540_1052450 3300005983 Bacteria 2008
80 Ga0081539_10000325 3300005985 Bacteria 106431
81 Ga0081539_10000542 3300005985 Bacteria 78012
82 Ga0070717_10010145 3300006028 Bacteria 7093
83 Ga0070717_10025752 3300006028 Bacteria 4684
84 Ga0070717_10044557 3300006028 Bacteria 3624
85 Ga0070717_10134868 3300006028 Bacteria 2125
86 Ga0075365_10064627 3300006038 Bacteria 2452
87 Ga0075365_10168477 3300006038 Bacteria 1528
88 Ga0075363_100169824 3300006048 Bacteria 1238
89 Ga0070715_10000126 3300006163 Bacteria 18112
90 Ga0070716_100001133 3300006173 Bacteria 11734
91 Ga0070716_100006711 3300006173 Bacteria 5636
92 Ga0070712_100013177 3300006175 Bacteria 5276
93 Ga0070712_100047312 3300006175 Bacteria 2976
94 Ga0070712_100086776 3300006175 Bacteria 2281
95 Ga0075362_10032532 3300006177 Bacteria 2263
96 Ga0075367_10011614 3300006178 Bacteria 4669
97 Ga0075367_10044740 3300006178 Bacteria 2596
98 Ga0075369_10027159 3300006186 Bacteria 2391
99 Ga0075369_10057238 3300006186 Bacteria 1695
100 Ga0075366_10098245 3300006195 Bacteria 1756
101 Ga0075370_10071674 3300006353 Bacteria 1982
102 Ga0075370_10186447 3300006353 Bacteria 1221
103 Ga0068871_100017334 3300006358 Bacteria 5447
104 Ga0075434_100408743 3300006871 Bacteria 1378
105 Ga0097620_100525050 3300006931 Bacteria 1279
106 Ga0099824_1006123 3300006942 Bacteria 16665
107 Ga0099824_1009448 3300006942 Bacteria 12008
108 Ga0099822_1000072 3300006943 Bacteria 55118
109 Ga0075435_100362900 3300007076 Bacteria 1243
110 Ga0105240_10005923 3300009093 Bacteria 18106
111 Ga0105240_10168707 3300009093 Bacteria 2594
112 Ga0105240_10259063 3300009093 Bacteria 2007
113 Ga0111539_10116537 3300009094 Bacteria 3132
114 Ga0105245_10015073 3300009098 Bacteria 6735
115 Ga0105243_10042686 3300009148 Bacteria 3551
116 Ga0105241_10047862 3300009174 Bacteria 3252
117 Ga0105241_10074158 3300009174 Bacteria 2650
118 Ga0105242_10407420 3300009176 Bacteria 1271
119 Ga0105248_10273135 3300009177 Bacteria 1903
120 Ga0105248_10331401 3300009177 Bacteria 1714
121 Ga0105248_10454131 3300009177 Bacteria 1444
122 Ga0105237_10005891 3300009545 Bacteria 13744
123 Ga0105237_10052535 3300009545 Bacteria 4090
124 Ga0105237_10193235 3300009545 Bacteria 2035
125 Ga0105238_10024022 3300009551 Bacteria 6216
126 Ga0105238_10390547 3300009551 Bacteria 1384
127 Ga0105249_10261413 3300009553 Bacteria 1720
128 Ga0105249_10611897 3300009553 Bacteria 1145
129 Ga0099796_10003203 3300010159 Bacteria 3752
130 Ga0099796_10008560 3300010159 Bacteria 2731
131 Ga0105239_10005379 3300010375 Bacteria 15037
132 Ga0105239_10074580 3300010375 Bacteria 3730
133 Ga0105239_10080906 3300010375 Bacteria 3575
134 Ga0105246_10156475 3300011119 Bacteria 1731
135 Ga0157370_10061963 3300013104 Bacteria 3549
136 Ga0157369_10041084 3300013105 Bacteria 5049
137 Ga0157374_10119370 3300013296 Bacteria 2544
138 Ga0157374_10152904 3300013296 Bacteria 2244
139 Ga0157374_10242269 3300013296 Bacteria 1773
140 Ga0157374_10375567 3300013296 Bacteria 1415
141 Ga0157374_10561997 3300013296 Bacteria 1149
142 Ga0157378_10014292 3300013297 Bacteria 6950
143 Ga0163162_10008402 3300013306 Bacteria 10070
144 Ga0163162_10401977 3300013306 Bacteria 1502
145 Ga0157372_10022136 3300013307 Bacteria 6876
146 Ga0157375_10339602 3300013308 Bacteria 1667
147 Ga0163163_10072203 3300014325 Bacteria 3440
148 Ga0157379_10190689 3300014968 Bacteria 1852
149 Ga0157376_10137758 3300014969 Bacteria 2186
150 Ga0157376_10540482 3300014969 Bacteria 1152
151 Ga0163161_10354110 3300017792 Bacteria 1168
152 Ga0213872_10023809 3300021361 Bacteria 2816
153 Ga0213874_10047879 3300021377 Unclassified 1302
154 Ga0213876_10001347 3300021384 Bacteria 15365
155 Ga0213876_10027818 3300021384 Bacteria 2982
156 Ga0209233_1003471 3300025261 Bacteria 5548
157 Ga0209130_1013576 3300025284 Bacteria 2081
158 Ga0209564_1000385 3300025295 Bacteria 80273
159 Ga0209564_1013271 3300025295 Bacteria 3518
160 Ga0209758_1000651 3300025297 Bacteria 52531
161 Ga0209758_1004669 3300025297 Bacteria 11205
162 Ga0207426_1000270 3300025302 Bacteria 108404
163 Ga0207697_10029127 3300025315 Bacteria 2259
164 Ga0207656_10073224 3300025321 Bacteria 1527
165 Ga0207692_10000608 3300025898 Bacteria 12589
166 Ga0207692_10002722 3300025898 Bacteria 6818
167 Ga0207692_10005822 3300025898 Bacteria 4967
168 Ga0207692_10172714 3300025898 Bacteria 1253
169 Ga0207710_10115243 3300025900 Bacteria 1279
170 Ga0207685_10004333 3300025905 Bacteria 3594
171 Ga0207685_10028538 3300025905 Bacteria 1966
172 Ga0207699_10024900 3300025906 Bacteria 3279
173 Ga0207699_10037019 3300025906 Bacteria 2785
174 Ga0207699_10207114 3300025906 Bacteria 1332
175 Ga0207705_10087032 3300025909 Bacteria 2284
176 Ga0207705_10116850 3300025909 Bacteria 1975
177 Ga0207707_10016399 3300025912 Bacteria 6462
178 Ga0207707_10076775 3300025912 Bacteria 2915
179 Ga0207695_10050774 3300025913 Bacteria 4360
180 Ga0207695_10054700 3300025913 Bacteria 4165
181 Ga0207671_10031752 3300025914 Bacteria 3934
182 Ga0207671_10231988 3300025914 Bacteria 1448
183 Ga0207693_10000683 3300025915 Bacteria 30507
184 Ga0207693_10044030 3300025915 Bacteria 3508
185 Ga0207693_10126568 3300025915 Bacteria 2008
186 Ga0207663_10001947 3300025916 Bacteria 9768
187 Ga0207663_10032337 3300025916 Bacteria 3105
188 Ga0207663_10101688 3300025916 Bacteria 1931
189 Ga0207660_10001275 3300025917 Bacteria 16907
190 Ga0207660_10226171 3300025917 Bacteria 1470
191 Ga0207657_10002026 3300025919 Bacteria 21899
192 Ga0207649_10255794 3300025920 Bacteria 1263
193 Ga0207652_10000750 3300025921 Bacteria 31226
194 Ga0207652_10010784 3300025921 Bacteria 7361
195 Ga0207681_10138095 3300025923 Bacteria 1812
196 Ga0207694_10003753 3300025924 Bacteria 12036
197 Ga0207694_10165378 3300025924 Bacteria 1789
198 Ga0207659_10260409 3300025926 Bacteria 1411
199 Ga0207687_10029932 3300025927 Bacteria 3666
200 Ga0207700_10027779 3300025928 Bacteria 3968
201 Ga0207700_10070672 3300025928 Bacteria 2685
202 Ga0207700_10116568 3300025928 Bacteria 2158
203 Ga0207664_10026050 3300025929 Bacteria 4415
204 Ga0207690_10079292 3300025932 Bacteria 2288
205 Ga0207706_10157808 3300025933 Bacteria 1995
206 Ga0207709_10041379 3300025935 Bacteria 2765
207 Ga0207670_10150021 3300025936 Bacteria 1729
208 Ga0207669_10141525 3300025937 Bacteria 1670
209 Ga0207665_10000339 3300025939 Bacteria 32422
210 Ga0207665_10002674 3300025939 Bacteria 11972
211 Ga0207691_10132535 3300025940 Bacteria 2200
212 Ga0207691_10306910 3300025940 Bacteria 1362
213 Ga0207711_10105448 3300025941 Bacteria 2500
214 Ga0207689_10158597 3300025942 Bacteria 1865
215 Ga0207661_10048506 3300025944 Bacteria 3375
216 Ga0207661_10125464 3300025944 Bacteria 2192
217 Ga0207679_10070558 3300025945 Bacteria 2633
218 Ga0207679_10150400 3300025945 Bacteria 1894
219 Ga0207667_10008531 3300025949 Bacteria 12165
220 Ga0207667_10018138 3300025949 Bacteria 7901
221 Ga0207667_10052933 3300025949 Bacteria 4273
222 Ga0207651_10172271 3300025960 Bacteria 1708
223 Ga0207677_10103045 3300026023 Bacteria 2105
224 Ga0207703_10095890 3300026035 Bacteria 2503
225 Ga0207703_10131761 3300026035 Bacteria 2160
226 Ga0207703_10180724 3300026035 Bacteria 1861
227 Ga0207703_10476527 3300026035 Bacteria 1169
228 Ga0207639_10003675 3300026041 Bacteria 10307
229 Ga0207678_10053086 3300026067 Bacteria 3494
230 Ga0207678_10072041 3300026067 Bacteria 2961
231 Ga0207678_10083348 3300026067 Bacteria 2735
232 Ga0207678_10137255 3300026067 Bacteria 2086
233 Ga0207678_10188825 3300026067 Bacteria 1760
234 Ga0207678_10193435 3300026067 Bacteria 1739
235 Ga0207708_10109018 3300026075 Bacteria 2148
236 Ga0207708_10344112 3300026075 Bacteria 1222
237 Ga0207702_10000371 3300026078 Bacteria 51217
238 Ga0207702_10325583 3300026078 Bacteria 1465
239 Ga0207702_10378359 3300026078 Bacteria 1361
240 Ga0207676_10126646 3300026095 Bacteria 2164
241 Ga0207676_10143134 3300026095 Bacteria 2049
242 Ga0207674_10020168 3300026116 Bacteria 7209
243 Ga0207674_10525771 3300026116 Bacteria 1143
244 Ga0207675_100273435 3300026118 Bacteria 1640
245 Ga0207683_10021269 3300026121 Bacteria 5551
246 Ga0207683_10183843 3300026121 Bacteria 1896
247 Ga0207698_10038868 3300026142 Bacteria 3520
248 Ga0207698_10187372 3300026142 Bacteria 1839
249 Ga0207698_10246508 3300026142 Bacteria 1632
250 Ga0209389_1000001 3300027296 Bacteria 463799
251 Ga0209389_1000014 3300027296 Bacteria 188621
252 Ga0209589_1000011 3300027357 Bacteria 236981
253 Ga0209589_1000020 3300027357 Bacteria 188617
254 Ga0209489_100012 3300027361 Bacteria 236981
255 Ga0209489_100060 3300027361 Bacteria 147091
256 Ga0209489_102213 3300027361 Bacteria 39761
257 Ga0209700_100007 3300027363 Bacteria 454608
258 Ga0209700_100019 3300027363 Bacteria 236981
259 Ga0209588_1001736 3300027671 Bacteria 5767
260 Ga0207428_10193849 3300027907 Bacteria 1531
261 Ga0268266_10003127 3300028379 Bacteria 16840
262 Ga0268266_10026938 3300028379 Bacteria 4890
263 Ga0268266_10068734 3300028379 Bacteria 3068
264 Ga0268266_10184106 3300028379 Bacteria 1904
265 Ga0268266_10247990 3300028379 Bacteria 1646
266 Ga0268265_10070120 3300028380 Bacteria 2724
267 Ga0268264_10001991 3300028381 Bacteria 18360
268 Ga0265326_10019700 3300028558 Bacteria 1938
269 Ga0265334_10063647 3300028573 Bacteria 1386
270 Ga0265318_10082152 3300028577 Bacteria 1189
271 Ga0265336_10000251 3300028666 Bacteria 38092
272 Ga0307517_10001377 3300028786 Bacteria 40867
273 Ga0307515_10015737 3300028794 Bacteria 13916
274 Ga0307515_10292228 3300028794 Bacteria 1324
275 Ga0265338_10000582 3300028800 Bacteria 64301
276 Ga0307511_10186809 3300030521 Bacteria 1104
277 Ga0265330_10058738 3300031235 Bacteria 1676
278 Ga0265325_10030259 3300031241 Bacteria 2904
279 Ga0265339_10003547 3300031249 Bacteria 10912
280 Ga0265331_10015945 3300031250 Bacteria 3955
281 Ga0307509_10031346 3300031507 Bacteria 5871
282 Ga0307509_10092253 3300031507 Bacteria 3096
283 Ga0307508_10000015 3300031616 Bacteria 210182
284 Ga0307508_10076362 3300031616 Bacteria 2928
285 Ga0307508_10119666 3300031616 Bacteria 2235
286 Ga0307516_10099436 3300031730 Bacteria 2726
287 Ga0307516_10173172 3300031730 Bacteria 1897
288 Ga0307412_10110355 3300031911 Bacteria 1963
289 Ga0307416_100209455 3300032002 Bacteria 1858
290 Ga0307415_100104096 3300032126 Bacteria 2090
291 Ga0307507_10041557 3300033179 Bacteria 4598
292 Ga0307510_10023663 3300033180 Bacteria 7117
293 Ga0307510_10050267 3300033180 Bacteria 4425
294 Ga0307510_10121371 3300033180 Bacteria 2317
295 Ga0315911_1000002 3300033442 Bacteria 926833
296 Ga0316215_1001502 3300033544 Bacteria 2239
297 Ga0373934_0025731 3300035086 Bacteria 2281
298 Ga0373923_0016759 3300035111 Bacteria 2791
299 Ga0373945_0056831 3300035116 Bacteria 1452
300 Ga0373953_0000552 3300035117 Bacteria 10385
301 Ga0373953_0011362 3300035117 Bacteria 3123
302 Ga0373954_0000416 3300035118 Bacteria 15875
303 Ga0373956_0000642 3300035119 Bacteria 14377
304 Ga0373956_0076405 3300035119 Bacteria 1532
305 Ga0373943_0003731 3300035170 Bacteria 6929
306 Ga0373946_0013143 3300035171 Bacteria 3107
307 Ga0373955_0000572 3300035172 Bacteria 15637
308 Ga0373955_0097636 3300035172 Bacteria 1682
309 Ga0373924_0045322 3300035410 Bacteria 1809
310 Ga0373935_0052701 3300035692 Bacteria 2587
311 Ga0373935_0202421 3300035692 Bacteria 1372
312 Ga0373927_0001301 3300035695 Bacteria 18871
313 Ga0373927_0018657 3300035695 Bacteria 4554
314 Ga0373927_0020028 3300035695 Bacteria 4387
315 Ga0373927_0109288 3300035695 Bacteria 1801
316 Ga0373933_0000270 3300035724 Bacteria 33800
317 Ga0373933_0000296 3300035724 Bacteria 32065
318 Ga0373933_0096432 3300035724 Bacteria 1830
319 Ga0373947_0000180 3300035725 Bacteria 34668
320 Ga0373947_0007716 3300035725 Bacteria 6220
321 Ga0373947_0022378 3300035725 Bacteria 3666
322 Ga0373937_0007677 3300036401 Bacteria 9345
323 Ga0373937_0010170 3300036401 Bacteria 8206
324 Ga0373937_0186402 3300036401 Bacteria 1949
325 Ga0373925_0003959 3300037068 Bacteria 11291
326 Ga0373925_0043342 3300037068 Bacteria 3339
327 Ga0395899_0039304 3300037312 Bacteria 3542
328 Ga0395900_0000939 3300037418 Bacteria 38089
329 Ga0395900_0003215 3300037418 Bacteria 17688
330 Ga0395898_0010196 3300037466 Bacteria 9838
331 Ga0395898_0011912 3300037466 Bacteria 9007
332 Ga0395898_0105086 3300037466 Bacteria 2708
333 Ga0395898_0475872 3300037466 Bacteria 1188
334 Ga0395905_0088612 3300037471 Bacteria 2900
335 Ga0395905_0417902 3300037471 Bacteria 1237
336 Ga0395901_0038620 3300038443 Bacteria 4938
337 Ga0395901_0112942 3300038443 Bacteria 2853
338 Ga0395901_0627801 3300038443 Bacteria 1080
339 Ga0436365_1475839 3300039437 Bacteria 9395
340 Ga0436361_0192375 3300039447 Bacteria 5642
341 Ga0436361_1030557 3300039447 Bacteria 5905
342 Ga0436363_0577232 3300039450 Bacteria 5397
343 Ga0466971_0104934 3300044719 Bacteria 1301
344 Ga0495617_080729 3300046452 Bacteria 1065
345 Ga0495592_0008493 3300046454 Bacteria 7707
346 Ga0495592_0104004 3300046454 Bacteria 2019
347 Ga0495603_0000040 3300046455 Bacteria 55056
348 Ga0495603_0024269 3300046455 Bacteria 3667
349 Ga0495603_0054696 3300046455 Bacteria 2365
350 Ga0495603_0066955 3300046455 Bacteria 2115
351 Ga0495590_0069497 3300046457 Bacteria 1234
352 Ga0495629_0000077 3300046459 Bacteria 85931
353 Ga0495629_0000165 3300046459 Bacteria 58366
354 Ga0495629_0038030 3300046459 Bacteria 3391
355 Ga0495638_0018541 3300046460 Bacteria 4620
356 Ga0495638_0088644 3300046460 Bacteria 1868
357 Ga0495638_0191218 3300046460 Bacteria 1161
358 Ga0495641_0001743 3300046461 Bacteria 18153
359 Ga0495651_0000839 3300046462 Bacteria 23890
360 Ga0495651_0043164 3300046462 Bacteria 3499
361 Ga0495651_0058459 3300046462 Bacteria 2958
362 Ga0495653_0000769 3300046463 Bacteria 24618
363 Ga0495653_0078386 3300046463 Bacteria 2450
364 Ga0495580_0011797 3300046472 Bacteria 6745
365 Ga0495582_0000020 3300046473 Bacteria 88349
366 Ga0495605_0089205 3300046474 Bacteria 1431
367 Ga0495639_0000011 3300046475 Bacteria 92268
368 Ga0495639_0015632 3300046475 Bacteria 3292
369 Ga0495639_0061269 3300046475 Bacteria 1725
370 Ga0495662_0006153 3300046476 Bacteria 6000
371 Ga0495662_0053307 3300046476 Bacteria 1953
372 Ga0495664_0155242 3300046477 Bacteria 1388
373 Ga0495584_0038653 3300046491 Bacteria 2412
374 Ga0495585_0044596 3300046492 Bacteria 2477
375 Ga0495585_0087442 3300046492 Bacteria 1682
376 Ga0495606_0029307 3300046507 Bacteria 3867
377 Ga0495606_0102289 3300046507 Bacteria 1742
378 Ga0495608_0002598 3300046511 Bacteria 12980
379 Ga0495608_0003283 3300046511 Bacteria 11554
380 Ga0495610_0053558 3300046512 Bacteria 1953
381 Ga0495618_0023818 3300046514 Bacteria 3790
382 Ga0495628_0015464 3300046516 Bacteria 6372
383 Ga0495628_0022286 3300046516 Bacteria 5204
384 Ga0495630_0087793 3300046517 Bacteria 2349
385 Ga0495643_0129046 3300046522 Bacteria 1271
386 Ga0495644_0032174 3300046523 Bacteria 1982
387 Ga0495648_0005256 3300046524 Bacteria 10818
388 Ga0495648_0107560 3300046524 Bacteria 1524
389 Ga0495663_0020274 3300046525 Bacteria 1907
390 Ga0495652_0010743 3300046529 Bacteria 8297
391 Ga0495652_0015364 3300046529 Bacteria 6854
392 Ga0495652_0068870 3300046529 Bacteria 2963
393 Ga0495665_0000035 3300046531 Bacteria 53229
394 Ga0495640_0007431 3300046533 Bacteria 8611
395 Ga0495640_0013357 3300046533 Bacteria 6239
396 Ga0495640_0040689 3300046533 Bacteria 3253
397 Ga0495640_0103148 3300046533 Bacteria 1871
398 Ga0495586_0227424 3300046535 Bacteria 1061
399 Ga0495587_0003203 3300046536 Bacteria 10935
400 Ga0495587_0059895 3300046536 Bacteria 2233
401 Ga0495645_0067550 3300046543 Bacteria 2581
402 Ga0495622_0006195 3300046557 Bacteria 5555
403 Ga0495622_0052574 3300046557 Bacteria 1890
404 Ga0495667_0001596 3300046559 Bacteria 15032
405 Ga0495656_0004563 3300046615 Bacteria 4749
406 Ga0495668_0107709 3300046616 Bacteria 1524
407 Ga0495668_0109421 3300046616 Bacteria 1511
408 Ga0495668_0213594 3300046616 Bacteria 1056
409 Ga0495634_0000553 3300046642 Bacteria 36653
410 Ga0495634_0019446 3300046642 Bacteria 4826
411 Ga0495634_0064893 3300046642 Bacteria 2420
412 Ga0495611_0111758 3300046648 Bacteria 1272
413 Ga0495611_0151302 3300046648 Bacteria 1083
414 Ga0495635_0000160 3300046663 Bacteria 41557
415 Ga0495635_0001030 3300046663 Bacteria 18443
416 Ga0495635_0053167 3300046663 Bacteria 2790
417 Ga0495659_0022724 3300046664 Bacteria 2125
418 Ga0495659_0086208 3300046664 Bacteria 1199
419 Ga0495588_0123080 3300046674 Bacteria 1367
420 Ga0495657_0011085 3300046675 Bacteria 6757
421 Ga0495657_0265723 3300046675 Bacteria 1030
422 Ga0495599_0001355 3300046678 Bacteria 13990
423 Ga0495599_0032836 3300046678 Bacteria 3259
424 Ga0495623_0007375 3300046679 Bacteria 7138
425 Ga0495623_0009192 3300046679 Bacteria 6411
426 Ga0495646_0017794 3300046680 Bacteria 4505
427 Ga0495658_0000900 3300046683 Bacteria 15945
428 Ga0495613_0105538 3300046689 Bacteria 2034
429 Ga0495624_0000138 3300046690 Bacteria 52220
430 Ga0495649_0154931 3300046694 Bacteria 1203
431 Ga0495600_0000248 3300046809 Bacteria 29398
432 Ga0495600_0015435 3300046809 Bacteria 4827
433 Ga0495581_0000001 3300047315 Bacteria 104278
434 Ga0495604_0000443 3300047317 Bacteria 36693
435 Ga0495604_0184741 3300047317 Bacteria 1456
436 Ga0495604_0222460 3300047317 Bacteria 1299
437 Ga0495674_0001044 3300047319 Bacteria 26638
438 Ga0495674_0085523 3300047319 Bacteria 2701
439 Ga0495674_0093050 3300047319 Bacteria 2573
440 Ga0495676_0026328 3300047321 Bacteria 5010
441 Ga0495676_0058173 3300047321 Bacteria 3043
442 Ga0495680_0002003 3300047322 Bacteria 21375
443 Ga0495680_0007102 3300047322 Bacteria 10313
444 Ga0495680_0022043 3300047322 Bacteria 5319
445 Ga0495687_069680 3300047443 Bacteria 1415
446 Ga0495675_0000857 3300047444 Bacteria 18584
447 Ga0495675_0021623 3300047444 Bacteria 4098
448 Ga0495684_0000068 3300047471 Bacteria 70808
449 Ga0495684_0037624 3300047471 Bacteria 3712
450 Ga0495593_0000006 3300047673 Bacteria 90370
451 Ga0495593_0000215 3300047673 Bacteria 30493
452 Ga0495602_0026301 3300048088 Bacteria 5614
453 Ga0496100_0003644 3300048903 Bacteria 8054
454 Ga0496101_0041170 3300048904 Bacteria 3293
455 Ga0496102_0012975 3300048905 Bacteria 7216
456 Ga0496103_0038852 3300048906 Bacteria 2923
457 Ga0496104_0169532 3300048907 Bacteria 2093
458 Ga0496105_0017824 3300048908 Bacteria 5697
459 Ga0496105_0176634 3300048908 Bacteria 1749
460 Ga0496106_0005689 3300048909 Bacteria 9219
461 Ga0496106_0072134 3300048909 Bacteria 2640
462 Ga0496106_0118924 3300048909 Bacteria 2064
463 Ga0496107_0002113 3300048910 Bacteria 12728
464 Ga0496107_0097049 3300048910 Bacteria 2157
465 Ga0496108_0066977 3300048911 Bacteria 3028
466 Ga0496108_0121901 3300048911 Bacteria 2237
467 Ga0496108_0172973 3300048911 Bacteria 1869
468 Ga0496109_0199957 3300048912 Bacteria 1878
469 Ga0496110_0021514 3300048913 Bacteria 5463
470 Ga0496110_0339063 3300048913 Bacteria 1369
471 Ga0496112_0000044 3300048915 Bacteria 86865
472 Ga0496112_0013612 3300048915 Bacteria 7518
473 Ga0496112_0014847 3300048915 Bacteria 7244
474 Ga0496112_0118903 3300048915 Bacteria 2612
475 Ga0496112_0240439 3300048915 Bacteria 1763
476 Ga0496112_0324962 3300048915 Bacteria 1482
477 Ga0496113_0020886 3300048916 Bacteria 4612
478 Ga0496113_0044619 3300048916 Bacteria 3285
479 Ga0496115_0004269 3300048918 Bacteria 10342
480 Ga0496115_0359541 3300048918 Bacteria 1186
481 Ga0496116_0001178 3300048919 Bacteria 30717
482 Ga0496117_0045212 3300048920 Bacteria 3183
483 Ga0496118_0003016 3300048921 Bacteria 21744
484 Ga0496118_0226717 3300048921 Bacteria 1082
485 Ga0496119_0153040 3300048922 Bacteria 1234
486 Ga0496120_0015097 3300048923 Bacteria 5111
487 Ga0496120_0049551 3300048923 Bacteria 2410
488 Ga0496121_0000041 3300048924 Bacteria 346686
489 Ga0496121_0001244 3300048924 Bacteria 44194
490 Ga0496121_0006260 3300048924 Bacteria 14894
491 Ga0496121_0011806 3300048924 Bacteria 9625
492 Ga0496121_0076263 3300048924 Bacteria 2674
493 Ga0496121_0081704 3300048924 Bacteria 2557
494 Ga0496121_0096357 3300048924 Bacteria 2296
495 Ga0496121_0103269 3300048924 Bacteria 2193
496 Ga0496121_0153828 3300048924 Bacteria 1689
497 Ga0496121_0162398 3300048924 Bacteria 1632
498 Ga0496121_0184230 3300048924 Bacteria 1503
499 Ga0496123_0144346 3300048926 Bacteria 1295
500 Ga0496124_0019158 3300048927 Bacteria 6384
501 Ga0496124_0237910 3300048927 Bacteria 1356
502 Ga0496125_0000504 3300048928 Bacteria 67902
503 Ga0496125_0000712 3300048928 Bacteria 54983
504 Ga0496125_0000998 3300048928 Bacteria 44135
505 Ga0496125_0005652 3300048928 Bacteria 13798
506 Ga0496125_0007928 3300048928 Bacteria 11213
507 Ga0496125_0018155 3300048928 Bacteria 6685
508 Ga0496125_0062865 3300048928 Bacteria 2965
509 Ga0496125_0107391 3300048928 Bacteria 2034
510 Ga0496126_0007108 3300048929 Bacteria 12332
511 Ga0496126_0032076 3300048929 Bacteria 4954
512 Ga0496126_0033543 3300048929 Bacteria 4828
513 Ga0496126_0066222 3300048929 Bacteria 3230
514 Ga0496126_0088670 3300048929 Bacteria 2724
515 Ga0496126_0357805 3300048929 Bacteria 1193
516 Ga0496126_0414614 3300048929 Bacteria 1090
517 Ga0495682_0005698 3300049460 Bacteria 5143
518 Ga0495682_0063488 3300049460 Bacteria 1332
519 Ga0501032_0002299 3300049569 Bacteria 14998
520 Ga0501033_0000091 3300049570 Bacteria 85666
521 Ga0501034_0000039 3300049571 Bacteria 237357
522 Ga0501034_0208184 3300049571 Bacteria 1912
523 Ga0501036_0000052 3300049572 Bacteria 74795
524 Ga0501036_0245793 3300049572 Bacteria 1500
525 Ga0501037_0000025 3300049573 Bacteria 143276
526 Ga0501038_0002924 3300049574 Bacteria 15925
527 Ga0501039_0003915 3300049575 Bacteria 11185
528 Ga0501043_0000928 3300049579 Bacteria 25941
529 Ga0501043_0012964 3300049579 Bacteria 6516
530 Ga0501043_0415218 3300049579 Bacteria 1015
531 Ga0501046_0000231 3300049580 Bacteria 57655
532 Ga0501047_0000457 3300049581 Bacteria 45136
533 Ga0501047_0003830 3300049581 Bacteria 14145
534 Ga0501047_0039347 3300049581 Bacteria 4574
535 Ga0501047_0431990 3300049581 Bacteria 1148
536 Ga0501048_0000218 3300049582 Bacteria 37734
537 Ga0501068_0023915 3300049584 Bacteria 3583
538 Ga0501070_0002829 3300049586 Bacteria 15142
539 Ga0501070_0181783 3300049586 Bacteria 1730
540 Ga0501070_0315373 3300049586 Bacteria 1272
541 Ga0501072_0103621 3300049588 Bacteria 2261
542 Ga0501073_0000877 3300049589 Bacteria 21517
543 Ga0501073_0028874 3300049589 Bacteria 3963
544 Ga0501074_0000273 3300049590 Bacteria 29590
545 Ga0501074_0259238 3300049590 Bacteria 1236
546 Ga0501079_0011695 3300049741 Bacteria 6704
547 Ga0501080_0000124 3300049742 Bacteria 54519
548 Ga0501080_0125088 3300049742 Bacteria 2381
549 Ga0501083_0000785 3300049744 Bacteria 20828
550 Ga0501035_0000052 3300049822 Bacteria 143038
551 Ga0501035_0081230 3300049822 Bacteria 2861
552 Ga0501044_0000217 3300049823 Bacteria 73242
553 Ga0501044_0047107 3300049823 Bacteria 4460
554 Ga0501044_0078587 3300049823 Bacteria 3343
555 Ga0501045_0100442 3300049824 Bacteria 2141
556 nmdc:mga00v17_100836_c1 3300050491 Bacteria 1822
557 nmdc:mga00v17_162262_c1 3300050491 Bacteria 1439
558 nmdc:mga0yw44_130805_c1 3300050492 Bacteria 1625
559 nmdc:mga0yw44_136992_c1 3300050492 Bacteria 1589
560 nmdc:mga0yw44_330785_c1 3300050492 Bacteria 1024
561 nmdc:mga0yw44_69043_c1 3300050492 Bacteria 2188
562 nmdc:mga0yw44_96917_c1 3300050492 Bacteria 1873
563 nmdc:mga04h51_7798_c1 3300050495 Bacteria 2841
564 nmdc:mga07m45_160947_c1 3300050496 Bacteria 1303
565 nmdc:mga05p37_13452_c1 3300050507 Bacteria 9806
566 nmdc:mga0sz30_16268_c1 3300050516 Bacteria 2951
567 nmdc:mga0sz30_60931_c1 3300050516 Bacteria 1612
568 Ga0495601_0027716 3300053077 Bacteria 3504
569 Ga0495601_0054936 3300053077 Bacteria 2520
570 Ga0495595_0000543 3300053084 Bacteria 14425
571 Ga0495595_0018616 3300053084 Bacteria 3003
572 Ga0495619_0022259 3300053085 Bacteria 4054
573 Ga0495619_0245538 3300053085 Bacteria 1241
574 Ga0500643_000069 3300053087 Bacteria 116366
575 Ga0500651_0127028 3300053093 Bacteria 1544
576 Ga0500566_0001531 3300053094 Bacteria 13576
577 Ga0500641_0006118 3300053096 Bacteria 4264
578 Ga0500555_007493 3300053103 Bacteria 3100
579 Ga0500556_0000015 3300053104 Bacteria 202598
580 Ga0500569_004477 3300053109 Bacteria 2940
581 Ga0500572_000742 3300053111 Bacteria 10514
582 Ga0500592_010843 3300053116 Bacteria 1454
583 Ga0500595_000200 3300053119 Bacteria 40977
584 Ga0500595_002044 3300053119 Bacteria 10308
585 Ga0500595_003639 3300053119 Bacteria 7137
586 Ga0500607_075569 3300053121 Bacteria 1729
587 Ga0500642_0000019 3300053130 Bacteria 159944
588 Ga0500642_0011629 3300053130 Bacteria 3156
589 Ga0500642_0050795 3300053130 Bacteria 1829
590 Ga0500652_004088 3300053131 Bacteria 4481
591 Ga0500658_0048535 3300053134 Bacteria 1726
592 Ga0500658_0138636 3300053134 Bacteria 1089
593 Ga0500658_0153361 3300053134 Bacteria 1039
594 Ga0500559_0000396 3300053136 Bacteria 31631
595 Ga0500559_0001660 3300053136 Bacteria 12308
596 Ga0500568_0004509 3300053139 Bacteria 7420
597 Ga0500568_0015661 3300053139 Bacteria 3391
598 Ga0500577_0000054 3300053142 Bacteria 25499
599 Ga0500586_000408 3300053145 Bacteria 8598
600 Ga0500589_093384 3300053147 Bacteria 1320
601 Ga0500590_107700 3300053148 Bacteria 1328
602 Ga0500603_001215 3300053150 Bacteria 5985
603 Ga0500603_032993 3300053150 Bacteria 1346
604 Ga0500604_0054152 3300053151 Bacteria 1245
605 Ga0500616_0000034 3300053153 Bacteria 396651
606 Ga0500616_0000041 3300053153 Bacteria 359328
607 Ga0500616_0022364 3300053153 Bacteria 3531
608 Ga0500622_0022547 3300053156 Bacteria 3337
609 Ga0500622_0042068 3300053156 Bacteria 2375
610 Ga0500622_0118010 3300053156 Bacteria 1290
611 Ga0500627_0025475 3300053158 Bacteria 2431
612 Ga0500634_0037717 3300053161 Bacteria 2628
613 Ga0500638_005976 3300053162 Bacteria 4925
614 Ga0500636_0000616 3300053177 Bacteria 19257
615 Ga0500637_0000144 3300053178 Bacteria 26094
616 Ga0500552_006897 3300053733 Bacteria 1291
617 Ga0500596_001679 3300053735 Bacteria 4478
618 Ga0500599_000340 3300053736 Bacteria 4623
619 Ga0500601_000035 3300053737 Bacteria 28001
620 Ga0501084_0000683 3300054114 Bacteria 25896
621 Ga0501084_0043895 3300054114 Bacteria 3741

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0069497 Ga0495590_0069497_379_1224 281
2 3300048929 Ga0496126_0414614 Ga0496126_0414614_26_916 291
3 3300035695 Ga0373927_0020028 Ga0373927_0020028_23_901 292
4 3300048910 Ga0496107_0097049 Ga0496107_0097049_1241_2125 294
5 iso_pu_bacteria 8019638758 8019646667 295
6 3300049579 Ga0501043_0415218 Ga0501043_0415218_76_996 297
7 3300047322 Ga0495680_0007102 Ga0495680_0007102_38_940 300
8 3300038443 Ga0395901_0627801 Ga0395901_0627801_125_1069 301
9 3300048915 Ga0496112_0013612 Ga0496112_0013612_852_1847 305
10 3300048921 Ga0496118_0226717 Ga0496118_0226717_144_1067 307
11 3300053148 Ga0500590_107700 Ga0500590_107700_384_1307 307
12 iso_pu_bacteria 2513237141 2513891187 309
13 3300006175 Ga0070712_100086776 Ga0070712_1000867762 310
14 3300013296 Ga0157374_10242269 Ga0157374_102422692 310
15 3300013308 Ga0157375_10339602 Ga0157375_103396022 310
16 3300025915 Ga0207693_10044030 Ga0207693_100440302 310
17 3300005435 Ga0070714_100142015 Ga0070714_1001420152 311
18 3300005439 Ga0070711_100070950 Ga0070711_1000709502 311
19 3300053147 Ga0500589_093384 Ga0500589_093384_171_1166 311
20 3300053151 Ga0500604_0054152 Ga0500604_0054152_14_1009 311
21 3300049741 Ga0501079_0011695 Ga0501079_0011695_69_1055 312
22 3300047317 Ga0495604_0222460 Ga0495604_0222460_74_1069 313
23 3300005339 Ga0070660_100094591 Ga0070660_1000945912 314
24 3300006942 Ga0099824_1006123 Ga0099824_10061232 315
25 3300021384 Ga0213876_10001347 Ga0213876_100013478 315
26 3300039437 Ga0436365_1475839 Ga0436365_1475839_7890_8891 315
27 3300046452 Ga0495617_080729 Ga0495617_080729_10_957 315
28 3300046474 Ga0495605_0089205 Ga0495605_0089205_13_960 315
29 3300046648 Ga0495611_0111758 Ga0495611_0111758_310_1257 315
30 3300046675 Ga0495657_0265723 Ga0495657_0265723_51_998 315
31 3300049569 Ga0501032_0002299 Ga0501032_0002299_6002_6997 315
32 3300049570 Ga0501033_0000091 Ga0501033_0000091_23007_24002 315
33 3300049571 Ga0501034_0000039 Ga0501034_0000039_128621_129616 315
34 3300049572 Ga0501036_0000052 Ga0501036_0000052_56526_57521 315
35 3300049573 Ga0501037_0000025 Ga0501037_0000025_31189_32184 315
36 3300049574 Ga0501038_0002924 Ga0501038_0002924_8044_9039 315
37 3300049575 Ga0501039_0003915 Ga0501039_0003915_9687_10682 315
38 3300049579 Ga0501043_0000928 Ga0501043_0000928_7672_8667 315
39 3300049580 Ga0501046_0000231 Ga0501046_0000231_52347_53342 315
40 3300049581 Ga0501047_0000457 Ga0501047_0000457_8705_9700 315
41 3300049582 Ga0501048_0000218 Ga0501048_0000218_28880_29875 315
42 3300049584 Ga0501068_0023915 Ga0501068_0023915_572_1567 315
43 3300049586 Ga0501070_0002829 Ga0501070_0002829_6862_7857 315
44 3300049586 Ga0501070_0181783 Ga0501070_0181783_73_1068 315
45 3300049589 Ga0501073_0000877 Ga0501073_0000877_5534_6529 315
46 3300049590 Ga0501074_0000273 Ga0501074_0000273_20451_21446 315
47 3300049742 Ga0501080_0000124 Ga0501080_0000124_14825_15820 315
48 3300049744 Ga0501083_0000785 Ga0501083_0000785_5830_6825 315
49 3300049822 Ga0501035_0000052 Ga0501035_0000052_71028_72023 315
50 3300049823 Ga0501044_0000217 Ga0501044_0000217_54973_55968 315
51 3300049824 Ga0501045_0100442 Ga0501045_0100442_408_1403 315
52 3300050492 nmdc:mga0yw44_330785_c1 nmdc:mga0yw44_330785_c1_23_970 315
53 3300053134 Ga0500658_0138636 Ga0500658_0138636_14_961 315
54 3300053134 Ga0500658_0153361 Ga0500658_0153361_17_964 315
55 3300054114 Ga0501084_0000683 Ga0501084_0000683_14840_15835 315
56 3300005434 Ga0070709_10009472 Ga0070709_100094721 316
57 3300005435 Ga0070714_100007489 Ga0070714_1000074895 316
58 3300005436 Ga0070713_100001931 Ga0070713_1000019317 316
59 3300005437 Ga0070710_10000550 Ga0070710_100005508 316
60 3300005439 Ga0070711_100002127 Ga0070711_1000021273 316
61 3300006028 Ga0070717_10010145 Ga0070717_100101454 316
62 3300006163 Ga0070715_10000126 Ga0070715_1000012616 316
63 3300006173 Ga0070716_100006711 Ga0070716_1000067112 316
64 3300006175 Ga0070712_100013177 Ga0070712_1000131772 316
65 3300025898 Ga0207692_10000608 Ga0207692_100006088 316
66 3300025905 Ga0207685_10004333 Ga0207685_100043332 316
67 3300025906 Ga0207699_10037019 Ga0207699_100370192 316
68 3300025915 Ga0207693_10000683 Ga0207693_1000068315 316
69 3300025916 Ga0207663_10001947 Ga0207663_100019477 316
70 3300025928 Ga0207700_10027779 Ga0207700_100277792 316
71 3300025929 Ga0207664_10026050 Ga0207664_100260502 316
72 3300025939 Ga0207665_10000339 Ga0207665_1000033913 316
73 3300035117 Ga0373953_0011362 Ga0373953_0011362_1312_2307 316
74 3300035119 Ga0373956_0076405 Ga0373956_0076405_361_1356 316
75 3300035172 Ga0373955_0097636 Ga0373955_0097636_348_1343 316
76 3300035724 Ga0373933_0096432 Ga0373933_0096432_798_1793 316
77 3300046454 Ga0495592_0104004 Ga0495592_0104004_979_1974 316
78 3300046459 Ga0495629_0038030 Ga0495629_0038030_463_1458 316
79 3300046462 Ga0495651_0058459 Ga0495651_0058459_257_1252 316
80 3300046463 Ga0495653_0078386 Ga0495653_0078386_935_1930 316
81 3300046476 Ga0495662_0053307 Ga0495662_0053307_653_1651 316
82 3300046477 Ga0495664_0155242 Ga0495664_0155242_11_1006 316
83 3300046511 Ga0495608_0003283 Ga0495608_0003283_7864_8859 316
84 3300046516 Ga0495628_0022286 Ga0495628_0022286_1073_2068 316
85 3300046517 Ga0495630_0087793 Ga0495630_0087793_360_1355 316
86 3300046529 Ga0495652_0068870 Ga0495652_0068870_1801_2796 316
87 3300046533 Ga0495640_0040689 Ga0495640_0040689_1568_2563 316
88 3300046535 Ga0495586_0227424 Ga0495586_0227424_12_1007 316
89 3300046536 Ga0495587_0059895 Ga0495587_0059895_1006_2001 316
90 3300046543 Ga0495645_0067550 Ga0495645_0067550_879_1874 316
91 3300046642 Ga0495634_0019446 Ga0495634_0019446_2300_3295 316
92 3300046663 Ga0495635_0053167 Ga0495635_0053167_232_1227 316
93 3300046678 Ga0495599_0032836 Ga0495599_0032836_321_1316 316
94 3300046679 Ga0495623_0009192 Ga0495623_0009192_2021_3016 316
95 3300046809 Ga0495600_0015435 Ga0495600_0015435_1569_2564 316
96 3300047317 Ga0495604_0184741 Ga0495604_0184741_230_1225 316
97 3300047319 Ga0495674_0085523 Ga0495674_0085523_36_1031 316
98 3300047319 Ga0495674_0093050 Ga0495674_0093050_1427_2422 316
99 3300047322 Ga0495680_0022043 Ga0495680_0022043_865_1860 316
100 3300047444 Ga0495675_0021623 Ga0495675_0021623_2336_3331 316
101 3300048928 Ga0496125_0000712 Ga0496125_0000712_22654_23649 316
102 3300048929 Ga0496126_0033543 Ga0496126_0033543_1383_2378 316
103 3300053077 Ga0495601_0054936 Ga0495601_0054936_704_1699 316
104 3300053084 Ga0495595_0018616 Ga0495595_0018616_227_1222 316
105 3300036401 Ga0373937_0186402 Ga0373937_0186402_484_1479 317
106 3300037466 Ga0395898_0475872 Ga0395898_0475872_66_1058 317
107 3300049579 Ga0501043_0012964 Ga0501043_0012964_1215_2207 317
108 3300049823 Ga0501044_0047107 Ga0501044_0047107_2792_3784 317
109 3300013307 Ga0157372_10022136 Ga0157372_100221368 318
110 3300021377 Ga0213874_10047879 Ga0213874_100478792 318
111 3300039450 Ga0436363_0577232 Ga0436363_0577232_745_1719 318
112 3300048928 Ga0496125_0000504 Ga0496125_0000504_40895_41890 318
113 3300049571 Ga0501034_0208184 Ga0501034_0208184_872_1882 318
114 3300049581 Ga0501047_0003830 Ga0501047_0003830_5732_6697 318
115 3300049588 Ga0501072_0103621 Ga0501072_0103621_863_1828 318
116 3300049589 Ga0501073_0028874 Ga0501073_0028874_1967_2932 318
117 3300049590 Ga0501074_0259238 Ga0501074_0259238_192_1157 318
118 3300049742 Ga0501080_0125088 Ga0501080_0125088_1092_2057 318
119 3300054114 Ga0501084_0043895 Ga0501084_0043895_842_1807 318
120 3300039447 Ga0436361_1030557 Ga0436361_1030557_3054_4019 320
121 3300049572 Ga0501036_0245793 Ga0501036_0245793_424_1428 320
122 3300049581 Ga0501047_0039347 Ga0501047_0039347_187_1191 320
123 3300049586 Ga0501070_0315373 Ga0501070_0315373_108_1112 320
124 3300049822 Ga0501035_0081230 Ga0501035_0081230_1802_2806 320
125 3300049823 Ga0501044_0078587 Ga0501044_0078587_473_1477 320
126 3300005327 Ga0070658_10186629 Ga0070658_101866291 321
127 3300005336 Ga0070680_100014584 Ga0070680_1000145845 321
128 3300005530 Ga0070679_100080354 Ga0070679_1000803542 321
129 3300006038 Ga0075365_10064627 Ga0075365_100646272 321
130 3300006178 Ga0075367_10011614 Ga0075367_100116142 321
131 3300009093 Ga0105240_10259063 Ga0105240_102590632 321
132 3300025912 Ga0207707_10076775 Ga0207707_100767752 321
133 3300025949 Ga0207667_10018138 Ga0207667_100181386 321
134 3300026078 Ga0207702_10378359 Ga0207702_103783592 321
135 3300050491 nmdc:mga00v17_100836_c1 nmdc:mga00v17_100836_c1_184_1194 321
136 3300053130 Ga0500642_0011629 Ga0500642_0011629_1326_2330 324
137 iso_pu_bacteria 2643221651 2644291323 325
138 iso_pu_bacteria 2513237098 2513674843 326
139 iso_pu_bacteria 8056681323 8056684798 326
140 3300005434 Ga0070709_10003646 Ga0070709_100036462 327
141 3300005437 Ga0070710_10003153 Ga0070710_100031532 327
142 3300006173 Ga0070716_100001133 Ga0070716_1000011338 327
143 3300025898 Ga0207692_10002722 Ga0207692_100027222 327
144 3300025916 Ga0207663_10032337 Ga0207663_100323372 327
145 3300025939 Ga0207665_10002674 Ga0207665_100026742 327
146 3300048924 Ga0496121_0011806 Ga0496121_0011806_1647_2630 327
147 3300048924 Ga0496121_0076263 Ga0496121_0076263_1210_2211 327
148 iso_pu_bacteria 2508501042 2508692747 327
149 iso_pu_bacteria 2508501128 2509152986 327
150 iso_pu_bacteria 2513237092 2513621793 327
151 iso_pu_bacteria 2513237094 2513636763 327
152 iso_pu_bacteria 2513237095 2513647585 327
153 iso_pu_bacteria 2513237096 2513654158 327
154 iso_pu_bacteria 2513237101 2513697097 327
155 iso_pu_bacteria 2513237137 2513856913 327
156 iso_pu_bacteria 2513237139 2513878712 327
157 iso_pu_bacteria 2513237145 2513918498 327
158 iso_pu_bacteria 2513237161 2514009360 327
159 iso_pu_bacteria 2515154112 2515626144 327
160 iso_pu_bacteria 2517572143 2517891267 327
161 iso_pu_bacteria 2524023228 2524533538 327
162 iso_pu_bacteria 2602042107 2603860885 327
163 iso_pu_bacteria 2617270735 2617346867 327
164 iso_pu_bacteria 2667528175 2671123797 327
165 iso_pu_bacteria 2721755755 2723843623 327
166 iso_pu_bacteria 2728368998 2728749964 327
167 iso_pu_bacteria 2791355197 2793066621 327
168 iso_pu_bacteria 2791355199 2793083856 327
169 iso_pu_bacteria 2802429603 2805921361 327
170 iso_pu_bacteria 2816332527 2818236621 327
171 iso_pu_bacteria 2824600985 2824605195 327
172 iso_pu_bacteria 2824609381 2824615514 327
173 iso_pu_bacteria 2824653114 2824656401 327
174 iso_pu_bacteria 2824671348 2824673701 327
175 iso_pu_bacteria 2824687955 2824690668 327
176 iso_pu_bacteria 2824696289 2824700821 327
177 iso_pu_bacteria 2824704595 2824709828 327
178 iso_pu_bacteria 2824753945 2824756052 327
179 iso_pu_bacteria 2824763712 2824767590 327
180 iso_pu_bacteria 2824773399 2824775056 327
181 iso_pu_bacteria 2838122688 2838129289 327
182 iso_pu_bacteria 2841941048 2841948055 327
183 iso_pu_bacteria 2841949485 2841953548 327
184 iso_pu_bacteria 2841957949 2841962854 327
185 iso_pu_bacteria 2841966195 2841973047 327
186 iso_pu_bacteria 2841974524 2841978276 327
187 iso_pu_bacteria 2841983080 2841990495 327
188 iso_pu_bacteria 2847930680 2847937391 327
189 iso_pu_bacteria 2847939898 2847947815 327
190 iso_pu_bacteria 2857524615 2857524663 327
191 iso_pu_bacteria 2874590934 2874598708 327
192 iso_pu_bacteria 2874604998 2874607165 327
193 iso_pu_bacteria 2874628541 2874634936 327
194 iso_pu_bacteria 2874645413 2874652163 327
195 iso_pu_bacteria 2876771140 2876778747 327
196 iso_pu_bacteria 2876808645 2876811214 327
197 iso_pu_bacteria 2876818435 2876824358 327
198 iso_pu_bacteria 2879074833 2879082540 327
199 iso_pu_bacteria 2879083081 2879086692 327
200 iso_pu_bacteria 2879110137 2879114052 327
201 iso_pu_bacteria 2879127579 2879131457 327
202 iso_pu_bacteria 2879142872 2879147903 327
203 iso_pu_bacteria 2881665667 2881666653 327
204 iso_pu_bacteria 2885374607 2885376569 327
205 iso_pu_bacteria 2888378607 2888385522 327
206 iso_pu_bacteria 2888419890 2888425653 327
207 iso_pu_bacteria 2893066018 2893069183 327
208 iso_pu_bacteria 2903748898 2903754636 327
209 iso_pu_bacteria 2904699407 2904701175 327
210 iso_pu_bacteria 2904711408 2904711903 327
211 iso_pu_bacteria 2906610324 2906616451 327
212 iso_pu_bacteria 2906626472 2906627664 327
213 iso_pu_bacteria 2906635258 2906640007 327
214 iso_pu_bacteria 2906643746 2906647362 327
215 iso_pu_bacteria 2906660503 2906662947 327
216 iso_pu_bacteria 2908739725 2908741596 327
217 iso_pu_bacteria 2908756301 2908759231 327
218 iso_pu_bacteria 2919073203 2919078545 327
219 iso_pu_bacteria 2922368715 2922372333 327
220 iso_pu_bacteria 2922386360 2922386884 327
221 iso_pu_bacteria 2922425934 2922431542 327
222 iso_pu_bacteria 2929615660 2929621095 327
223 iso_pu_bacteria 2929624759 2929626074 327
224 iso_pu_bacteria 2932794094 2932795083 327
225 iso_pu_bacteria 2932801729 2932805611 327
226 iso_pu_bacteria 2933577622 2933583035 327
227 iso_pu_bacteria 2935630451 2935636154 327
228 iso_pu_bacteria 2935648319 2935652070 327
229 iso_pu_bacteria 2935656913 2935659957 327
230 iso_pu_bacteria 2935675223 2935676481 327
231 iso_pu_bacteria 2935883170 2935885811 327
232 iso_pu_bacteria 2935959822 2935962786 327
233 iso_pu_bacteria 2935975950 2935976448 327
234 iso_pu_bacteria 2935984226 2935987102 327
235 iso_pu_bacteria 2936011229 2936014373 327
236 iso_pu_bacteria 2936019824 2936023787 327
237 iso_pu_bacteria 2936028420 2936031430 327
238 iso_pu_bacteria 2936046547 2936049479 327
239 iso_pu_bacteria 2936055302 2936062229 327
240 iso_pu_bacteria 2941507105 2941512785 327
241 iso_pu_bacteria 2941515067 2941520648 327
242 iso_pu_bacteria 2941523033 2941528662 327
243 iso_pu_bacteria 2941531003 2941531279 327
244 iso_pu_bacteria 3005474847 3005481337 327
245 iso_pu_bacteria 8006926726 8006928904 327
246 iso_pu_bacteria 8006933436 8006939373 327
247 iso_pu_bacteria 8006964411 8006968824 327
248 iso_pu_bacteria 8006973647 8006979028 327
249 iso_pu_bacteria 8006984368 8006984503 327
250 iso_pu_bacteria 8006994254 8006997131 327
251 iso_pu_bacteria 8016583857 8016594433 327
252 iso_pu_bacteria 8016630954 8016639098 327
253 iso_pu_bacteria 8019565922 8019575347 327
254 iso_pu_bacteria 8019619141 8019619887 327
255 iso_pu_bacteria 8019668869 8019670658 327
256 iso_pu_bacteria 8019678201 8019685574 327
257 iso_pu_bacteria 8055742211 8055745042 327
258 iso_pu_bacteria 8056673599 8056677486 327
259 iso_pu_bacteria 8056689827 8056690722 327
260 3300005614 Ga0068856_100000340 Ga0068856_10000034020 328
261 3300026078 Ga0207702_10000371 Ga0207702_1000037129 328
262 3300035116 Ga0373945_0056831 Ga0373945_0056831_326_1312 328
263 3300035170 Ga0373943_0003731 Ga0373943_0003731_5560_6546 328
264 3300035171 Ga0373946_0013143 Ga0373946_0013143_924_1910 328
265 3300035695 Ga0373927_0001301 Ga0373927_0001301_16920_17906 328
266 3300035725 Ga0373947_0000180 Ga0373947_0000180_30340_31326 328
267 3300036401 Ga0373937_0010170 Ga0373937_0010170_1380_2366 328
268 3300037068 Ga0373925_0003959 Ga0373925_0003959_428_1414 328
269 3300046455 Ga0495603_0000040 Ga0495603_0000040_48077_49063 328
270 3300046459 Ga0495629_0000165 Ga0495629_0000165_21113_22099 328
271 3300046461 Ga0495641_0001743 Ga0495641_0001743_12661_13647 328
272 3300046472 Ga0495580_0011797 Ga0495580_0011797_5728_6714 328
273 3300046473 Ga0495582_0000020 Ga0495582_0000020_24752_25738 328
274 3300046475 Ga0495639_0000011 Ga0495639_0000011_17400_18386 328
275 3300046476 Ga0495662_0006153 Ga0495662_0006153_32_1018 328
276 3300046529 Ga0495652_0015364 Ga0495652_0015364_5830_6816 328
277 3300046531 Ga0495665_0000035 Ga0495665_0000035_15739_16725 328
278 3300046533 Ga0495640_0013357 Ga0495640_0013357_484_1470 328
279 3300046557 Ga0495622_0006195 Ga0495622_0006195_2071_3057 328
280 3300046642 Ga0495634_0000553 Ga0495634_0000553_29477_30463 328
281 3300046663 Ga0495635_0001030 Ga0495635_0001030_6981_7967 328
282 3300046680 Ga0495646_0017794 Ga0495646_0017794_2068_3054 328
283 3300046683 Ga0495658_0000900 Ga0495658_0000900_1877_2863 328
284 3300046690 Ga0495624_0000138 Ga0495624_0000138_49696_50682 328
285 3300047315 Ga0495581_0000001 Ga0495581_0000001_30089_31075 328
286 3300047319 Ga0495674_0001044 Ga0495674_0001044_7529_8515 328
287 3300047321 Ga0495676_0026328 Ga0495676_0026328_3164_4150 328
288 3300047471 Ga0495684_0037624 Ga0495684_0037624_76_1062 328
289 3300047673 Ga0495593_0000006 Ga0495593_0000006_58151_59137 328
290 3300048929 Ga0496126_0088670 Ga0496126_0088670_433_1419 328
291 3300049581 Ga0501047_0431990 Ga0501047_0431990_92_1114 328
292 3300053150 Ga0500603_001215 Ga0500603_001215_3704_4690 328
293 3300053153 Ga0500616_0000034 Ga0500616_0000034_127147_128151 328
294 iso_pu_bacteria 2513237104 2513720741 328
295 3300005983 Ga0081540_1005983 Ga0081540_10059832 329
296 3300031249 Ga0265339_10003547 Ga0265339_100035474 329
297 iso_pu_bacteria 2904690495 2904694205 329
298 3300005456 Ga0070678_100097677 Ga0070678_1000976772 330
299 3300025284 Ga0209130_1013576 Ga0209130_10135762 330
300 3300025295 Ga0209564_1000385 Ga0209564_100038551 330
301 3300025926 Ga0207659_10260409 Ga0207659_102604091 330
302 3300044719 Ga0466971_0104934 Ga0466971_0104934_145_1203 330
303 3300048924 Ga0496121_0081704 Ga0496121_0081704_1172_2179 330
304 3300003203 JGI25406J46586_10000050 JGI25406J46586_100000503 331
305 3300003215 JGI25153J46596_10008915 JGI25153J46596_100089153 331
306 3300003354 JGI25160J50197_1001490 JGI25160J50197_10014903 331
307 3300003354 JGI25160J50197_1002236 JGI25160J50197_10022368 331
308 3300003659 JGI25404J52841_10005298 JGI25404J52841_100052982 331
309 3300003659 JGI25404J52841_10021596 JGI25404J52841_100215962 331
310 3300005327 Ga0070658_10099686 Ga0070658_100996862 331
311 3300005327 Ga0070658_10109993 Ga0070658_101099933 331
312 3300005334 Ga0068869_100029935 Ga0068869_1000299352 331
313 3300005336 Ga0070680_100004719 Ga0070680_1000047195 331
314 3300005336 Ga0070680_100255953 Ga0070680_1002559531 331
315 3300005338 Ga0068868_100076601 Ga0068868_1000766012 331
316 3300005339 Ga0070660_100009169 Ga0070660_1000091692 331
317 3300005340 Ga0070689_100138200 Ga0070689_1001382002 331
318 3300005344 Ga0070661_100071579 Ga0070661_1000715792 331
319 3300005344 Ga0070661_100076977 Ga0070661_1000769772 331
320 3300005344 Ga0070661_100147483 Ga0070661_1001474832 331
321 3300005347 Ga0070668_100156147 Ga0070668_1001561472 331
322 3300005347 Ga0070668_100237573 Ga0070668_1002375732 331
323 3300005354 Ga0070675_100150308 Ga0070675_1001503082 331
324 3300005366 Ga0070659_100031867 Ga0070659_1000318672 331
325 3300005436 Ga0070713_100067392 Ga0070713_1000673922 331
326 3300005436 Ga0070713_100094645 Ga0070713_1000946452 331
327 3300005437 Ga0070710_10130331 Ga0070710_101303311 331
328 3300005439 Ga0070711_100007740 Ga0070711_1000077406 331
329 3300005445 Ga0070708_100108943 Ga0070708_1001089432 331
330 3300005455 Ga0070663_100016024 Ga0070663_1000160242 331
331 3300005455 Ga0070663_100051004 Ga0070663_1000510042 331
332 3300005455 Ga0070663_100080349 Ga0070663_1000803492 331
333 3300005455 Ga0070663_100228043 Ga0070663_1002280431 331
334 3300005456 Ga0070678_100035925 Ga0070678_1000359252 331
335 3300005456 Ga0070678_100254636 Ga0070678_1002546362 331
336 3300005457 Ga0070662_100053581 Ga0070662_1000535812 331
337 3300005458 Ga0070681_10042060 Ga0070681_100420602 331
338 3300005471 Ga0070698_100031641 Ga0070698_1000316412 331
339 3300005530 Ga0070679_100015108 Ga0070679_1000151086 331
340 3300005530 Ga0070679_100022377 Ga0070679_1000223772 331
341 3300005535 Ga0070684_100010908 Ga0070684_1000109086 331
342 3300005539 Ga0068853_100001884 Ga0068853_1000018842 331
343 3300005539 Ga0068853_100132729 Ga0068853_1001327291 331
344 3300005548 Ga0070665_100012656 Ga0070665_1000126562 331
345 3300005548 Ga0070665_100027888 Ga0070665_1000278883 331
346 3300005563 Ga0068855_100019655 Ga0068855_1000196553 331
347 3300005564 Ga0070664_100112233 Ga0070664_1001122332 331
348 3300005577 Ga0068857_100013449 Ga0068857_1000134496 331
349 3300005616 Ga0068852_100007926 Ga0068852_1000079261 331
350 3300005616 Ga0068852_100070224 Ga0068852_1000702242 331
351 3300005616 Ga0068852_100167947 Ga0068852_1001679472 331
352 3300005616 Ga0068852_100292596 Ga0068852_1002925962 331
353 3300005617 Ga0068859_100525050 Ga0068859_1005250502 331
354 3300005618 Ga0068864_100109305 Ga0068864_1001093052 331
355 3300005718 Ga0068866_10227760 Ga0068866_102277601 331
356 3300005834 Ga0068851_10003888 Ga0068851_100038883 331
357 3300005843 Ga0068860_100000399 Ga0068860_10000039946 331
358 3300005844 Ga0068862_100079066 Ga0068862_1000790662 331
359 3300005844 Ga0068862_100298078 Ga0068862_1002980782 331
360 3300005937 Ga0081455_10004053 Ga0081455_100040536 331
361 3300005937 Ga0081455_10191473 Ga0081455_101914732 331
362 3300005983 Ga0081540_1018369 Ga0081540_10183693 331
363 3300005983 Ga0081540_1018679 Ga0081540_10186795 331
364 3300005983 Ga0081540_1032906 Ga0081540_10329062 331
365 3300005983 Ga0081540_1039319 Ga0081540_10393192 331
366 3300005983 Ga0081540_1052450 Ga0081540_10524502 331
367 3300005985 Ga0081539_10000325 Ga0081539_1000032558 331
368 3300005985 Ga0081539_10000542 Ga0081539_1000054248 331
369 3300006028 Ga0070717_10025752 Ga0070717_100257522 331
370 3300006028 Ga0070717_10044557 Ga0070717_100445574 331
371 3300006028 Ga0070717_10134868 Ga0070717_101348682 331
372 3300006038 Ga0075365_10168477 Ga0075365_101684772 331
373 3300006048 Ga0075363_100169824 Ga0075363_1001698242 331
374 3300006175 Ga0070712_100047312 Ga0070712_1000473122 331
375 3300006177 Ga0075362_10032532 Ga0075362_100325322 331
376 3300006178 Ga0075367_10044740 Ga0075367_100447402 331
377 3300006186 Ga0075369_10027159 Ga0075369_100271592 331
378 3300006186 Ga0075369_10057238 Ga0075369_100572382 331
379 3300006195 Ga0075366_10098245 Ga0075366_100982451 331
380 3300006353 Ga0075370_10071674 Ga0075370_100716741 331
381 3300006353 Ga0075370_10186447 Ga0075370_101864471 331
382 3300006358 Ga0068871_100017334 Ga0068871_1000173344 331
383 3300006871 Ga0075434_100408743 Ga0075434_1004087431 331
384 3300006931 Ga0097620_100525050 Ga0097620_1005250502 331
385 3300006942 Ga0099824_1009448 Ga0099824_10094486 331
386 3300006943 Ga0099822_1000072 Ga0099822_10000725 331
387 3300007076 Ga0075435_100362900 Ga0075435_1003629002 331
388 3300009093 Ga0105240_10005923 Ga0105240_1000592311 331
389 3300009093 Ga0105240_10168707 Ga0105240_101687072 331
390 3300009094 Ga0111539_10116537 Ga0111539_101165372 331
391 3300009098 Ga0105245_10015073 Ga0105245_100150734 331
392 3300009148 Ga0105243_10042686 Ga0105243_100426861 331
393 3300009174 Ga0105241_10047862 Ga0105241_100478622 331
394 3300009174 Ga0105241_10074158 Ga0105241_100741582 331
395 3300009176 Ga0105242_10407420 Ga0105242_104074202 331
396 3300009177 Ga0105248_10273135 Ga0105248_102731352 331
397 3300009177 Ga0105248_10331401 Ga0105248_103314012 331
398 3300009177 Ga0105248_10454131 Ga0105248_104541312 331
399 3300009545 Ga0105237_10005891 Ga0105237_1000589110 331
400 3300009545 Ga0105237_10052535 Ga0105237_100525352 331
401 3300009545 Ga0105237_10193235 Ga0105237_101932352 331
402 3300009551 Ga0105238_10024022 Ga0105238_100240222 331
403 3300009551 Ga0105238_10390547 Ga0105238_103905471 331
404 3300009553 Ga0105249_10261413 Ga0105249_102614132 331
405 3300009553 Ga0105249_10611897 Ga0105249_106118971 331
406 3300010159 Ga0099796_10003203 Ga0099796_100032032 331
407 3300010159 Ga0099796_10008560 Ga0099796_100085601 331
408 3300010375 Ga0105239_10005379 Ga0105239_1000537911 331
409 3300010375 Ga0105239_10074580 Ga0105239_100745802 331
410 3300010375 Ga0105239_10080906 Ga0105239_100809063 331
411 3300011119 Ga0105246_10156475 Ga0105246_101564752 331
412 3300013104 Ga0157370_10061963 Ga0157370_100619632 331
413 3300013105 Ga0157369_10041084 Ga0157369_100410842 331
414 3300013296 Ga0157374_10119370 Ga0157374_101193701 331
415 3300013296 Ga0157374_10152904 Ga0157374_101529042 331
416 3300013296 Ga0157374_10375567 Ga0157374_103755672 331
417 3300013296 Ga0157374_10561997 Ga0157374_105619972 331
418 3300013297 Ga0157378_10014292 Ga0157378_100142926 331
419 3300013306 Ga0163162_10008402 Ga0163162_100084028 331
420 3300013306 Ga0163162_10401977 Ga0163162_104019772 331
421 3300014325 Ga0163163_10072203 Ga0163163_100722032 331
422 3300014968 Ga0157379_10190689 Ga0157379_101906892 331
423 3300014969 Ga0157376_10137758 Ga0157376_101377582 331
424 3300014969 Ga0157376_10540482 Ga0157376_105404821 331
425 3300017792 Ga0163161_10354110 Ga0163161_103541101 331
426 3300021361 Ga0213872_10023809 Ga0213872_100238092 331
427 3300021384 Ga0213876_10027818 Ga0213876_100278182 331
428 3300025261 Ga0209233_1003471 Ga0209233_10034714 331
429 3300025295 Ga0209564_1013271 Ga0209564_10132712 331
430 3300025297 Ga0209758_1000651 Ga0209758_100065137 331
431 3300025297 Ga0209758_1004669 Ga0209758_10046693 331
432 3300025302 Ga0207426_1000270 Ga0207426_100027040 331
433 3300025315 Ga0207697_10029127 Ga0207697_100291272 331
434 3300025321 Ga0207656_10073224 Ga0207656_100732242 331
435 3300025898 Ga0207692_10005822 Ga0207692_100058223 331
436 3300025898 Ga0207692_10172714 Ga0207692_101727141 331
437 3300025900 Ga0207710_10115243 Ga0207710_101152432 331
438 3300025905 Ga0207685_10028538 Ga0207685_100285382 331
439 3300025906 Ga0207699_10024900 Ga0207699_100249002 331
440 3300025906 Ga0207699_10207114 Ga0207699_102071142 331
441 3300025909 Ga0207705_10087032 Ga0207705_100870323 331
442 3300025909 Ga0207705_10116850 Ga0207705_101168502 331
443 3300025912 Ga0207707_10016399 Ga0207707_100163993 331
444 3300025913 Ga0207695_10050774 Ga0207695_100507742 331
445 3300025913 Ga0207695_10054700 Ga0207695_100547002 331
446 3300025914 Ga0207671_10031752 Ga0207671_100317523 331
447 3300025914 Ga0207671_10231988 Ga0207671_102319882 331
448 3300025915 Ga0207693_10126568 Ga0207693_101265682 331
449 3300025916 Ga0207663_10101688 Ga0207663_101016882 331
450 3300025917 Ga0207660_10001275 Ga0207660_100012752 331
451 3300025917 Ga0207660_10226171 Ga0207660_102261712 331
452 3300025919 Ga0207657_10002026 Ga0207657_100020262 331
453 3300025920 Ga0207649_10255794 Ga0207649_102557942 331
454 3300025921 Ga0207652_10000750 Ga0207652_1000075024 331
455 3300025921 Ga0207652_10010784 Ga0207652_100107842 331
456 3300025923 Ga0207681_10138095 Ga0207681_101380952 331
457 3300025924 Ga0207694_10003753 Ga0207694_100037533 331
458 3300025924 Ga0207694_10165378 Ga0207694_101653782 331
459 3300025927 Ga0207687_10029932 Ga0207687_100299321 331
460 3300025928 Ga0207700_10070672 Ga0207700_100706722 331
461 3300025928 Ga0207700_10116568 Ga0207700_101165682 331
462 3300025932 Ga0207690_10079292 Ga0207690_100792922 331
463 3300025933 Ga0207706_10157808 Ga0207706_101578082 331
464 3300025935 Ga0207709_10041379 Ga0207709_100413791 331
465 3300025936 Ga0207670_10150021 Ga0207670_101500212 331
466 3300025937 Ga0207669_10141525 Ga0207669_101415251 331
467 3300025940 Ga0207691_10132535 Ga0207691_101325352 331
468 3300025940 Ga0207691_10306910 Ga0207691_103069102 331
469 3300025941 Ga0207711_10105448 Ga0207711_101054482 331
470 3300025942 Ga0207689_10158597 Ga0207689_101585972 331
471 3300025944 Ga0207661_10048506 Ga0207661_100485062 331
472 3300025944 Ga0207661_10125464 Ga0207661_101254641 331
473 3300025945 Ga0207679_10070558 Ga0207679_100705582 331
474 3300025945 Ga0207679_10150400 Ga0207679_101504002 331
475 3300025949 Ga0207667_10008531 Ga0207667_100085318 331
476 3300025949 Ga0207667_10052933 Ga0207667_100529332 331
477 3300025960 Ga0207651_10172271 Ga0207651_101722712 331
478 3300026023 Ga0207677_10103045 Ga0207677_101030452 331
479 3300026035 Ga0207703_10095890 Ga0207703_100958902 331
480 3300026035 Ga0207703_10131761 Ga0207703_101317612 331
481 3300026035 Ga0207703_10180724 Ga0207703_101807242 331
482 3300026035 Ga0207703_10476527 Ga0207703_104765271 331
483 3300026041 Ga0207639_10003675 Ga0207639_100036752 331
484 3300026067 Ga0207678_10053086 Ga0207678_100530862 331
485 3300026067 Ga0207678_10072041 Ga0207678_100720412 331
486 3300026067 Ga0207678_10083348 Ga0207678_100833482 331
487 3300026067 Ga0207678_10137255 Ga0207678_101372552 331
488 3300026067 Ga0207678_10188825 Ga0207678_101888252 331
489 3300026067 Ga0207678_10193435 Ga0207678_101934351 331
490 3300026075 Ga0207708_10109018 Ga0207708_101090182 331
491 3300026075 Ga0207708_10344112 Ga0207708_103441122 331
492 3300026078 Ga0207702_10325583 Ga0207702_103255832 331
493 3300026095 Ga0207676_10126646 Ga0207676_101266462 331
494 3300026095 Ga0207676_10143134 Ga0207676_101431342 331
495 3300026116 Ga0207674_10020168 Ga0207674_100201685 331
496 3300026116 Ga0207674_10525771 Ga0207674_105257711 331
497 3300026118 Ga0207675_100273435 Ga0207675_1002734352 331
498 3300026121 Ga0207683_10021269 Ga0207683_100212692 331
499 3300026121 Ga0207683_10183843 Ga0207683_101838432 331
500 3300026142 Ga0207698_10038868 Ga0207698_100388683 331
501 3300026142 Ga0207698_10187372 Ga0207698_101873722 331
502 3300026142 Ga0207698_10246508 Ga0207698_102465081 331
503 3300027296 Ga0209389_1000001 Ga0209389_100000163 331
504 3300027296 Ga0209389_1000014 Ga0209389_1000014109 331
505 3300027357 Ga0209589_1000011 Ga0209589_1000011149 331
506 3300027357 Ga0209589_1000020 Ga0209589_1000020109 331
507 3300027361 Ga0209489_100012 Ga0209489_100012149 331
508 3300027361 Ga0209489_100060 Ga0209489_10006068 331
509 3300027361 Ga0209489_102213 Ga0209489_10221337 331
510 3300027363 Ga0209700_100007 Ga0209700_100007341 331
511 3300027363 Ga0209700_100019 Ga0209700_100019149 331
512 3300027671 Ga0209588_1001736 Ga0209588_10017362 331
513 3300027907 Ga0207428_10193849 Ga0207428_101938492 331
514 3300028379 Ga0268266_10003127 Ga0268266_1000312711 331
515 3300028379 Ga0268266_10026938 Ga0268266_100269382 331
516 3300028379 Ga0268266_10068734 Ga0268266_100687342 331
517 3300028379 Ga0268266_10184106 Ga0268266_101841062 331
518 3300028379 Ga0268266_10247990 Ga0268266_102479901 331
519 3300028380 Ga0268265_10070120 Ga0268265_100701202 331
520 3300028381 Ga0268264_10001991 Ga0268264_1000199110 331
521 3300028558 Ga0265326_10019700 Ga0265326_100197002 331
522 3300028573 Ga0265334_10063647 Ga0265334_100636471 331
523 3300028577 Ga0265318_10082152 Ga0265318_100821521 331
524 3300028666 Ga0265336_10000251 Ga0265336_1000025129 331
525 3300028786 Ga0307517_10001377 Ga0307517_100013772 331
526 3300028794 Ga0307515_10015737 Ga0307515_1001573710 331
527 3300028794 Ga0307515_10292228 Ga0307515_102922281 331
528 3300028800 Ga0265338_10000582 Ga0265338_1000058229 331
529 3300030521 Ga0307511_10186809 Ga0307511_101868091 331
530 3300031235 Ga0265330_10058738 Ga0265330_100587382 331
531 3300031241 Ga0265325_10030259 Ga0265325_100302592 331
532 3300031250 Ga0265331_10015945 Ga0265331_100159452 331
533 3300031507 Ga0307509_10031346 Ga0307509_100313463 331
534 3300031507 Ga0307509_10092253 Ga0307509_100922532 331
535 3300031616 Ga0307508_10000015 Ga0307508_10000015160 331
536 3300031616 Ga0307508_10076362 Ga0307508_100763622 331
537 3300031616 Ga0307508_10119666 Ga0307508_101196662 331
538 3300031730 Ga0307516_10099436 Ga0307516_100994362 331
539 3300031730 Ga0307516_10173172 Ga0307516_101731721 331
540 3300031911 Ga0307412_10110355 Ga0307412_101103552 331
541 3300032002 Ga0307416_100209455 Ga0307416_1002094552 331
542 3300032126 Ga0307415_100104096 Ga0307415_1001040962 331
543 3300033179 Ga0307507_10041557 Ga0307507_100415572 331
544 3300033180 Ga0307510_10023663 Ga0307510_100236636 331
545 3300033180 Ga0307510_10050267 Ga0307510_100502671 331
546 3300033180 Ga0307510_10121371 Ga0307510_101213712 331
547 3300033442 Ga0315911_1000002 Ga0315911_100000262 331
548 3300033544 Ga0316215_1001502 Ga0316215_10015021 331
549 3300035086 Ga0373934_0025731 Ga0373934_0025731_88_1086 331
550 3300035111 Ga0373923_0016759 Ga0373923_0016759_1490_2488 331
551 3300035117 Ga0373953_0000552 Ga0373953_0000552_1859_2857 331
552 3300035118 Ga0373954_0000416 Ga0373954_0000416_10756_11754 331
553 3300035119 Ga0373956_0000642 Ga0373956_0000642_13091_14089 331
554 3300035172 Ga0373955_0000572 Ga0373955_0000572_9842_10840 331
555 3300035410 Ga0373924_0045322 Ga0373924_0045322_548_1546 331
556 3300035692 Ga0373935_0052701 Ga0373935_0052701_1354_2349 331
557 3300035692 Ga0373935_0202421 Ga0373935_0202421_222_1217 331
558 3300035695 Ga0373927_0018657 Ga0373927_0018657_3236_4231 331
559 3300035695 Ga0373927_0109288 Ga0373927_0109288_507_1502 331
560 3300035724 Ga0373933_0000270 Ga0373933_0000270_7298_8296 331
561 3300035724 Ga0373933_0000296 Ga0373933_0000296_15085_16080 331
562 3300035725 Ga0373947_0007716 Ga0373947_0007716_5165_6160 331
563 3300035725 Ga0373947_0022378 Ga0373947_0022378_1274_2269 331
564 3300036401 Ga0373937_0007677 Ga0373937_0007677_5371_6369 331
565 3300037068 Ga0373925_0043342 Ga0373925_0043342_174_1169 331
566 3300037312 Ga0395899_0039304 Ga0395899_0039304_2208_3203 331
567 3300037418 Ga0395900_0000939 Ga0395900_0000939_23229_24224 331
568 3300037418 Ga0395900_0003215 Ga0395900_0003215_3422_4417 331
569 3300037466 Ga0395898_0010196 Ga0395898_0010196_7636_8631 331
570 3300037466 Ga0395898_0011912 Ga0395898_0011912_2433_3428 331
571 3300037466 Ga0395898_0105086 Ga0395898_0105086_486_1481 331
572 3300037471 Ga0395905_0088612 Ga0395905_0088612_574_1572 331
573 3300037471 Ga0395905_0417902 Ga0395905_0417902_35_1030 331
574 3300038443 Ga0395901_0038620 Ga0395901_0038620_912_1907 331
575 3300038443 Ga0395901_0112942 Ga0395901_0112942_504_1499 331
576 3300039447 Ga0436361_0192375 Ga0436361_0192375_411_1406 331
577 3300046454 Ga0495592_0008493 Ga0495592_0008493_2823_3821 331
578 3300046455 Ga0495603_0024269 Ga0495603_0024269_1553_2548 331
579 3300046455 Ga0495603_0054696 Ga0495603_0054696_752_1747 331
580 3300046455 Ga0495603_0066955 Ga0495603_0066955_921_1916 331
581 3300046459 Ga0495629_0000077 Ga0495629_0000077_43689_44687 331
582 3300046460 Ga0495638_0018541 Ga0495638_0018541_1680_2675 331
583 3300046460 Ga0495638_0088644 Ga0495638_0088644_350_1345 331
584 3300046460 Ga0495638_0191218 Ga0495638_0191218_120_1115 331
585 3300046462 Ga0495651_0000839 Ga0495651_0000839_1966_2964 331
586 3300046462 Ga0495651_0043164 Ga0495651_0043164_106_1101 331
587 3300046463 Ga0495653_0000769 Ga0495653_0000769_5349_6347 331
588 3300046475 Ga0495639_0015632 Ga0495639_0015632_1272_2267 331
589 3300046475 Ga0495639_0061269 Ga0495639_0061269_530_1525 331
590 3300046491 Ga0495584_0038653 Ga0495584_0038653_47_1042 331
591 3300046492 Ga0495585_0044596 Ga0495585_0044596_1359_2354 331
592 3300046492 Ga0495585_0087442 Ga0495585_0087442_600_1595 331
593 3300046507 Ga0495606_0029307 Ga0495606_0029307_1621_2616 331
594 3300046507 Ga0495606_0102289 Ga0495606_0102289_85_1080 331
595 3300046511 Ga0495608_0002598 Ga0495608_0002598_9134_10132 331
596 3300046512 Ga0495610_0053558 Ga0495610_0053558_407_1402 331
597 3300046514 Ga0495618_0023818 Ga0495618_0023818_35_1033 331
598 3300046516 Ga0495628_0015464 Ga0495628_0015464_5267_6265 331
599 3300046522 Ga0495643_0129046 Ga0495643_0129046_52_1047 331
600 3300046523 Ga0495644_0032174 Ga0495644_0032174_368_1363 331
601 3300046524 Ga0495648_0005256 Ga0495648_0005256_4602_5597 331
602 3300046524 Ga0495648_0107560 Ga0495648_0107560_461_1459 331
603 3300046525 Ga0495663_0020274 Ga0495663_0020274_180_1175 331
604 3300046529 Ga0495652_0010743 Ga0495652_0010743_6542_7540 331
605 3300046533 Ga0495640_0007431 Ga0495640_0007431_2511_3509 331
606 3300046533 Ga0495640_0103148 Ga0495640_0103148_636_1631 331
607 3300046536 Ga0495587_0003203 Ga0495587_0003203_8964_9962 331
608 3300046557 Ga0495622_0052574 Ga0495622_0052574_817_1812 331
609 3300046559 Ga0495667_0001596 Ga0495667_0001596_9185_10183 331
610 3300046615 Ga0495656_0004563 Ga0495656_0004563_1149_2144 331
611 3300046616 Ga0495668_0107709 Ga0495668_0107709_401_1396 331
612 3300046616 Ga0495668_0109421 Ga0495668_0109421_151_1146 331
613 3300046616 Ga0495668_0213594 Ga0495668_0213594_15_1010 331
614 3300046642 Ga0495634_0064893 Ga0495634_0064893_566_1564 331
615 3300046648 Ga0495611_0151302 Ga0495611_0151302_18_1013 331
616 3300046663 Ga0495635_0000160 Ga0495635_0000160_38312_39310 331
617 3300046664 Ga0495659_0022724 Ga0495659_0022724_247_1242 331
618 3300046664 Ga0495659_0086208 Ga0495659_0086208_173_1168 331
619 3300046674 Ga0495588_0123080 Ga0495588_0123080_308_1303 331
620 3300046675 Ga0495657_0011085 Ga0495657_0011085_4902_5900 331
621 3300046678 Ga0495599_0001355 Ga0495599_0001355_9185_10183 331
622 3300046679 Ga0495623_0007375 Ga0495623_0007375_3164_4162 331
623 3300046689 Ga0495613_0105538 Ga0495613_0105538_580_1575 331
624 3300046694 Ga0495649_0154931 Ga0495649_0154931_56_1051 331
625 3300046809 Ga0495600_0000248 Ga0495600_0000248_10117_11115 331
626 3300047317 Ga0495604_0000443 Ga0495604_0000443_10338_11336 331
627 3300047321 Ga0495676_0058173 Ga0495676_0058173_1768_2763 331
628 3300047322 Ga0495680_0002003 Ga0495680_0002003_18412_19410 331
629 3300047443 Ga0495687_069680 Ga0495687_069680_255_1250 331
630 3300047444 Ga0495675_0000857 Ga0495675_0000857_6775_7773 331
631 3300047471 Ga0495684_0000068 Ga0495684_0000068_18356_19354 331
632 3300047673 Ga0495593_0000215 Ga0495593_0000215_867_1865 331
633 3300048088 Ga0495602_0026301 Ga0495602_0026301_4391_5389 331
634 3300048903 Ga0496100_0003644 Ga0496100_0003644_5217_6212 331
635 3300048904 Ga0496101_0041170 Ga0496101_0041170_1643_2638 331
636 3300048905 Ga0496102_0012975 Ga0496102_0012975_217_1212 331
637 3300048906 Ga0496103_0038852 Ga0496103_0038852_745_1740 331
638 3300048907 Ga0496104_0169532 Ga0496104_0169532_488_1483 331
639 3300048908 Ga0496105_0017824 Ga0496105_0017824_1508_2503 331
640 3300048908 Ga0496105_0176634 Ga0496105_0176634_243_1238 331
641 3300048909 Ga0496106_0005689 Ga0496106_0005689_6102_7097 331
642 3300048909 Ga0496106_0072134 Ga0496106_0072134_57_1052 331
643 3300048909 Ga0496106_0118924 Ga0496106_0118924_341_1336 331
644 3300048910 Ga0496107_0002113 Ga0496107_0002113_6106_7101 331
645 3300048911 Ga0496108_0066977 Ga0496108_0066977_754_1749 331
646 3300048911 Ga0496108_0121901 Ga0496108_0121901_264_1259 331
647 3300048911 Ga0496108_0172973 Ga0496108_0172973_606_1649 331
648 3300048912 Ga0496109_0199957 Ga0496109_0199957_111_1106 331
649 3300048913 Ga0496110_0021514 Ga0496110_0021514_2556_3551 331
650 3300048913 Ga0496110_0339063 Ga0496110_0339063_224_1219 331
651 3300048915 Ga0496112_0000044 Ga0496112_0000044_69074_70075 331
652 3300048915 Ga0496112_0014847 Ga0496112_0014847_6188_7183 331
653 3300048915 Ga0496112_0118903 Ga0496112_0118903_232_1227 331
654 3300048915 Ga0496112_0240439 Ga0496112_0240439_27_1022 331
655 3300048915 Ga0496112_0324962 Ga0496112_0324962_368_1363 331
656 3300048916 Ga0496113_0020886 Ga0496113_0020886_1505_2500 331
657 3300048916 Ga0496113_0044619 Ga0496113_0044619_1822_2817 331
658 3300048918 Ga0496115_0004269 Ga0496115_0004269_7758_8753 331
659 3300048918 Ga0496115_0359541 Ga0496115_0359541_32_1027 331
660 3300048919 Ga0496116_0001178 Ga0496116_0001178_28684_29679 331
661 3300048920 Ga0496117_0045212 Ga0496117_0045212_752_1747 331
662 3300048921 Ga0496118_0003016 Ga0496118_0003016_5026_6021 331
663 3300048922 Ga0496119_0153040 Ga0496119_0153040_24_1019 331
664 3300048923 Ga0496120_0015097 Ga0496120_0015097_3547_4542 331
665 3300048923 Ga0496120_0049551 Ga0496120_0049551_407_1402 331
666 3300048924 Ga0496121_0000041 Ga0496121_0000041_159345_160340 331
667 3300048924 Ga0496121_0001244 Ga0496121_0001244_29787_30782 331
668 3300048924 Ga0496121_0006260 Ga0496121_0006260_5226_6221 331
669 3300048924 Ga0496121_0096357 Ga0496121_0096357_797_1792 331
670 3300048924 Ga0496121_0103269 Ga0496121_0103269_1154_2149 331
671 3300048924 Ga0496121_0153828 Ga0496121_0153828_473_1468 331
672 3300048924 Ga0496121_0162398 Ga0496121_0162398_38_1033 331
673 3300048924 Ga0496121_0184230 Ga0496121_0184230_222_1217 331
674 3300048926 Ga0496123_0144346 Ga0496123_0144346_194_1189 331
675 3300048927 Ga0496124_0019158 Ga0496124_0019158_175_1170 331
676 3300048927 Ga0496124_0237910 Ga0496124_0237910_327_1322 331
677 3300048928 Ga0496125_0000998 Ga0496125_0000998_20673_21668 331
678 3300048928 Ga0496125_0005652 Ga0496125_0005652_6337_7332 331
679 3300048928 Ga0496125_0007928 Ga0496125_0007928_7801_8811 331
680 3300048928 Ga0496125_0018155 Ga0496125_0018155_2191_3186 331
681 3300048928 Ga0496125_0062865 Ga0496125_0062865_772_1767 331
682 3300048928 Ga0496125_0107391 Ga0496125_0107391_794_1789 331
683 3300048929 Ga0496126_0007108 Ga0496126_0007108_8566_9561 331
684 3300048929 Ga0496126_0032076 Ga0496126_0032076_3005_4000 331
685 3300048929 Ga0496126_0066222 Ga0496126_0066222_1257_2252 331
686 3300048929 Ga0496126_0357805 Ga0496126_0357805_158_1153 331
687 3300049460 Ga0495682_0005698 Ga0495682_0005698_1906_2901 331
688 3300049460 Ga0495682_0063488 Ga0495682_0063488_30_1028 331
689 3300050491 nmdc:mga00v17_162262_c1 nmdc:mga00v17_162262_c1_261_1256 331
690 3300050492 nmdc:mga0yw44_130805_c1 nmdc:mga0yw44_130805_c1_202_1197 331
691 3300050492 nmdc:mga0yw44_136992_c1 nmdc:mga0yw44_136992_c1_271_1266 331
692 3300050492 nmdc:mga0yw44_69043_c1 nmdc:mga0yw44_69043_c1_357_1352 331
693 3300050492 nmdc:mga0yw44_96917_c1 nmdc:mga0yw44_96917_c1_776_1771 331
694 3300050495 nmdc:mga04h51_7798_c1 nmdc:mga04h51_7798_c1_1026_2021 331
695 3300050496 nmdc:mga07m45_160947_c1 nmdc:mga07m45_160947_c1_205_1200 331
696 3300050507 nmdc:mga05p37_13452_c1 nmdc:mga05p37_13452_c1_1654_2649 331
697 3300050516 nmdc:mga0sz30_16268_c1 nmdc:mga0sz30_16268_c1_88_1083 331
698 3300050516 nmdc:mga0sz30_60931_c1 nmdc:mga0sz30_60931_c1_166_1161 331
699 3300053077 Ga0495601_0027716 Ga0495601_0027716_2358_3356 331
700 3300053084 Ga0495595_0000543 Ga0495595_0000543_9324_10322 331
701 3300053085 Ga0495619_0022259 Ga0495619_0022259_2708_3703 331
702 3300053085 Ga0495619_0245538 Ga0495619_0245538_20_1015 331
703 3300053087 Ga0500643_000069 Ga0500643_000069_31462_32457 331
704 3300053093 Ga0500651_0127028 Ga0500651_0127028_357_1352 331
705 3300053094 Ga0500566_0001531 Ga0500566_0001531_3949_4947 331
706 3300053096 Ga0500641_0006118 Ga0500641_0006118_2359_3354 331
707 3300053103 Ga0500555_007493 Ga0500555_007493_201_1196 331
708 3300053104 Ga0500556_0000015 Ga0500556_0000015_184193_185188 331
709 3300053109 Ga0500569_004477 Ga0500569_004477_257_1252 331
710 3300053111 Ga0500572_000742 Ga0500572_000742_130_1134 331
711 3300053116 Ga0500592_010843 Ga0500592_010843_106_1101 331
712 3300053119 Ga0500595_000200 Ga0500595_000200_18869_19867 331
713 3300053119 Ga0500595_002044 Ga0500595_002044_4529_5524 331
714 3300053119 Ga0500595_003639 Ga0500595_003639_3369_4364 331
715 3300053121 Ga0500607_075569 Ga0500607_075569_41_1036 331
716 3300053130 Ga0500642_0000019 Ga0500642_0000019_106055_107050 331
717 3300053130 Ga0500642_0050795 Ga0500642_0050795_441_1436 331
718 3300053131 Ga0500652_004088 Ga0500652_004088_3287_4282 331
719 3300053134 Ga0500658_0048535 Ga0500658_0048535_384_1379 331
720 3300053136 Ga0500559_0000396 Ga0500559_0000396_14630_15625 331
721 3300053136 Ga0500559_0001660 Ga0500559_0001660_10932_11936 331
722 3300053139 Ga0500568_0004509 Ga0500568_0004509_1666_2661 331
723 3300053139 Ga0500568_0015661 Ga0500568_0015661_812_1807 331
724 3300053142 Ga0500577_0000054 Ga0500577_0000054_11101_12105 331
725 3300053145 Ga0500586_000408 Ga0500586_000408_1595_2590 331
726 3300053150 Ga0500603_032993 Ga0500603_032993_31_1029 331
727 3300053153 Ga0500616_0000041 Ga0500616_0000041_46046_47041 331
728 3300053153 Ga0500616_0022364 Ga0500616_0022364_176_1174 331
729 3300053156 Ga0500622_0022547 Ga0500622_0022547_264_1262 331
730 3300053156 Ga0500622_0042068 Ga0500622_0042068_857_1852 331
731 3300053156 Ga0500622_0118010 Ga0500622_0118010_120_1115 331
732 3300053158 Ga0500627_0025475 Ga0500627_0025475_757_1752 331
733 3300053161 Ga0500634_0037717 Ga0500634_0037717_1530_2525 331
734 3300053162 Ga0500638_005976 Ga0500638_005976_3861_4859 331
735 3300053177 Ga0500636_0000616 Ga0500636_0000616_4496_5491 331
736 3300053178 Ga0500637_0000144 Ga0500637_0000144_19297_20295 331
737 3300053733 Ga0500552_006897 Ga0500552_006897_243_1238 331
738 3300053735 Ga0500596_001679 Ga0500596_001679_136_1140 331
739 3300053736 Ga0500599_000340 Ga0500599_000340_482_1480 331
740 3300053737 Ga0500601_000035 Ga0500601_000035_4002_4997 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

45

331

0.94

PF12146

Hydrolase_4

Serine aminopeptidase, S33

44

208

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

47

337

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a7g-assembly1.cif.gz_A soluble epoxide hydrolase in complex with tk90 0.8844 6 327
7p4k-assembly1.cif.gz_A soluble epoxide hydrolase in complex with fl217 0.8732 3 327
5alv-assembly1.cif.gz_A ligand complex structure of soluble epoxide hydrolase 0.8728 3 327
5ak6-assembly1.cif.gz_A-2 ligand complex structure of soluble epoxide hydrolase 0.8708 6 327
5akk-assembly1.cif.gz_A-2 ligand complex structure of soluble epoxide hydrolase 0.8707 6 327
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8658 1 97 3.40.50.12270
5cw2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8629 5 324 3.40.50.1820
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8585 3 331 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8571 1 97 3.40.50.12270
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8559 3 331 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2T0QJH6-F1-model_v4 Alpha/beta hydrolase family protein 0.9338 6 138 GO:0016787
AF-A0A1I3U8I9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9263 84 331 GO:0003824
AF-A0A2X2MRA0-F1-model_v4 deleted 0.9257 30 328
AF-B5GUK2-F1-model_v4 Putative epoxide hydrolase 0.9256 3 328 GO:0016787
AF-A0A401TTW0-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9221 138 331 GO:0004301

Feature Viewer

pLDDT pTM Quality
90.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map