F478543
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 272 | 740 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0009313|Ga0466967_0009313_5549_6223 |
| Length | 224 |
| Sequence | LISHIIEVLSEFIIRVIATGGYPGIVLLMAIESACIPLPSEVIMPFSGALTLGIVASQYGREPFTLLWVATAGALGCNLGSLVAYEIGAFGGRPLIERYGRYVLMSENELNLTDRFFRKYGDVTVFVCRLLPVVRTFIALPAGIARMPRLRFHVYTFLGSWPWCLMLAWIGAKLGERWHTDPRLKEWFHRFDAVIGGIITLAVVWFVXXXXRHRIKTSGDRVIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 118 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 119 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 222 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.3 |
| Rhizosphere | 92.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_2357773 | 2162886012 | Bacteria | 1127 |
| 2 | MBSR1b_contig_4104914 | 2162886012 | Bacteria | 1127 |
| 3 | LJNas_1001663 | 3300000546 | Bacteria | 3012 |
| 4 | JGI24748J21848_1004860 | 3300002074 | Bacteria | 1548 |
| 5 | Ga0065715_10011916 | 3300005293 | Bacteria | 3474 |
| 6 | Ga0070658_10252225 | 3300005327 | Unclassified | 1497 |
| 7 | Ga0070676_10168073 | 3300005328 | Bacteria | 1416 |
| 8 | Ga0070683_100004265 | 3300005329 | Bacteria | 11732 |
| 9 | Ga0070683_100105372 | 3300005329 | Bacteria | 2658 |
| 10 | Ga0070683_100171020 | 3300005329 | Bacteria | 2063 |
| 11 | Ga0070690_100005060 | 3300005330 | Bacteria | 7390 |
| 12 | Ga0070670_100006784 | 3300005331 | Bacteria | 9695 |
| 13 | Ga0070670_100017561 | 3300005331 | Bacteria | 6139 |
| 14 | Ga0070670_100194738 | 3300005331 | Bacteria | 1761 |
| 15 | Ga0068869_100005202 | 3300005334 | Bacteria | 8169 |
| 16 | Ga0068869_100016098 | 3300005334 | Bacteria | 5035 |
| 17 | Ga0070666_10040737 | 3300005335 | Bacteria | 3101 |
| 18 | Ga0070680_100050994 | 3300005336 | Bacteria | 3376 |
| 19 | Ga0070680_100285882 | 3300005336 | Bacteria | 1398 |
| 20 | Ga0070682_100008130 | 3300005337 | Bacteria | 5916 |
| 21 | Ga0070682_100052488 | 3300005337 | Bacteria | 2551 |
| 22 | Ga0070682_100241713 | 3300005337 | Bacteria | 1296 |
| 23 | Ga0068868_100002026 | 3300005338 | Bacteria | 13925 |
| 24 | Ga0068868_100013694 | 3300005338 | Bacteria | 5957 |
| 25 | Ga0068868_100019739 | 3300005338 | Bacteria | 5054 |
| 26 | Ga0068868_100021622 | 3300005338 | Unclassified | 4845 |
| 27 | Ga0068868_100095358 | 3300005338 | Bacteria | 2401 |
| 28 | Ga0068868_100295824 | 3300005338 | Bacteria | 1374 |
| 29 | Ga0070660_100006065 | 3300005339 | Bacteria | 8357 |
| 30 | Ga0070660_100060293 | 3300005339 | Bacteria | 2944 |
| 31 | Ga0070687_100142822 | 3300005343 | Bacteria | 1396 |
| 32 | Ga0070661_100001267 | 3300005344 | Bacteria | 17752 |
| 33 | Ga0070661_100025961 | 3300005344 | Bacteria | 4210 |
| 34 | Ga0070661_100167188 | 3300005344 | Bacteria | 1669 |
| 35 | Ga0070692_10368934 | 3300005345 | Bacteria | 897 |
| 36 | Ga0070668_100005814 | 3300005347 | Bacteria | 9149 |
| 37 | Ga0070668_100067915 | 3300005347 | Bacteria | 2770 |
| 38 | Ga0070675_100739173 | 3300005354 | Unclassified | 897 |
| 39 | Ga0070675_101031738 | 3300005354 | Bacteria | 755 |
| 40 | Ga0070671_100262621 | 3300005355 | Bacteria | 1467 |
| 41 | Ga0070671_100824051 | 3300005355 | Bacteria | 809 |
| 42 | Ga0070674_100006696 | 3300005356 | Bacteria | 6740 |
| 43 | Ga0070673_100001501 | 3300005364 | Bacteria | 13696 |
| 44 | Ga0070673_100038009 | 3300005364 | Bacteria | 3672 |
| 45 | Ga0070659_100037926 | 3300005366 | Bacteria | 3758 |
| 46 | Ga0070667_100361708 | 3300005367 | Bacteria | 1315 |
| 47 | Ga0070667_100558858 | 3300005367 | Bacteria | 1052 |
| 48 | Ga0070667_100560020 | 3300005367 | Bacteria | 1051 |
| 49 | Ga0070709_10000616 | 3300005434 | Bacteria | 20414 |
| 50 | Ga0070709_10076720 | 3300005434 | Bacteria | 2171 |
| 51 | Ga0070709_10079037 | 3300005434 | Bacteria | 2141 |
| 52 | Ga0070709_10204821 | 3300005434 | Bacteria | 1399 |
| 53 | Ga0070709_10535131 | 3300005434 | Bacteria | 895 |
| 54 | Ga0070714_100016644 | 3300005435 | Bacteria | 5943 |
| 55 | Ga0070714_100080762 | 3300005435 | Unclassified | 2829 |
| 56 | Ga0070714_100182619 | 3300005435 | Bacteria | 1909 |
| 57 | Ga0070714_100447572 | 3300005435 | Bacteria | 1226 |
| 58 | Ga0070714_100468304 | 3300005435 | Unclassified | 1198 |
| 59 | Ga0070713_100002930 | 3300005436 | Bacteria | 11181 |
| 60 | Ga0070713_100005635 | 3300005436 | Bacteria | 8588 |
| 61 | Ga0070713_100013379 | 3300005436 | Bacteria | 6056 |
| 62 | Ga0070713_100027072 | 3300005436 | Bacteria | 4511 |
| 63 | Ga0070713_100029464 | 3300005436 | Unclassified | 4349 |
| 64 | Ga0070713_100111385 | 3300005436 | Bacteria | 2387 |
| 65 | Ga0070713_100244727 | 3300005436 | Bacteria | 1634 |
| 66 | Ga0070710_10150299 | 3300005437 | Bacteria | 1436 |
| 67 | Ga0070710_10388694 | 3300005437 | Unclassified | 932 |
| 68 | Ga0070711_100001964 | 3300005439 | Bacteria | 11538 |
| 69 | Ga0070711_100008149 | 3300005439 | Bacteria | 6406 |
| 70 | Ga0070711_100022258 | 3300005439 | Bacteria | 4106 |
| 71 | Ga0070711_100028655 | 3300005439 | Bacteria | 3667 |
| 72 | Ga0070711_100166528 | 3300005439 | Bacteria | 1676 |
| 73 | Ga0070705_100082611 | 3300005440 | Unclassified | 1977 |
| 74 | Ga0070705_100102487 | 3300005440 | Bacteria | 1810 |
| 75 | Ga0070708_100002464 | 3300005445 | Bacteria | 14311 |
| 76 | Ga0070708_100003650 | 3300005445 | Bacteria | 12068 |
| 77 | Ga0070708_100007742 | 3300005445 | Bacteria | 8605 |
| 78 | Ga0070708_100078771 | 3300005445 | Bacteria | 2979 |
| 79 | Ga0070708_100285794 | 3300005445 | Bacteria | 1552 |
| 80 | Ga0070708_100628969 | 3300005445 | Bacteria | 1012 |
| 81 | Ga0070708_100706516 | 3300005445 | Unclassified | 949 |
| 82 | Ga0070663_100002712 | 3300005455 | Bacteria | 10016 |
| 83 | Ga0070678_100022680 | 3300005456 | Bacteria | 4166 |
| 84 | Ga0070662_100015183 | 3300005457 | Bacteria | 5154 |
| 85 | Ga0070662_100165504 | 3300005457 | Bacteria | 1733 |
| 86 | Ga0070681_10000394 | 3300005458 | Bacteria | 35340 |
| 87 | Ga0070681_10006170 | 3300005458 | Bacteria | 11642 |
| 88 | Ga0070681_10212150 | 3300005458 | Bacteria | 1852 |
| 89 | Ga0068867_100070899 | 3300005459 | Bacteria | 2606 |
| 90 | Ga0070706_100001186 | 3300005467 | Bacteria | 27906 |
| 91 | Ga0070706_100001941 | 3300005467 | Bacteria | 21314 |
| 92 | Ga0070706_100044540 | 3300005467 | Bacteria | 4099 |
| 93 | Ga0070706_100173048 | 3300005467 | Bacteria | 2016 |
| 94 | Ga0070706_100469537 | 3300005467 | Unclassified | 1171 |
| 95 | Ga0070707_100001843 | 3300005468 | Bacteria | 20354 |
| 96 | Ga0070707_100170263 | 3300005468 | Bacteria | 2122 |
| 97 | Ga0070707_100196285 | 3300005468 | Bacteria | 1968 |
| 98 | Ga0070707_100202869 | 3300005468 | Bacteria | 1933 |
| 99 | Ga0070707_100234615 | 3300005468 | Bacteria | 1785 |
| 100 | Ga0070707_100427786 | 3300005468 | Unclassified | 1284 |
| 101 | Ga0070707_100895892 | 3300005468 | Bacteria | 852 |
| 102 | Ga0070698_100000758 | 3300005471 | Bacteria | 34912 |
| 103 | Ga0070698_100013035 | 3300005471 | Bacteria | 8801 |
| 104 | Ga0070698_100019235 | 3300005471 | Bacteria | 7174 |
| 105 | Ga0070699_100001097 | 3300005518 | Bacteria | 25198 |
| 106 | Ga0070699_100012112 | 3300005518 | Bacteria | 7444 |
| 107 | Ga0070699_100183301 | 3300005518 | Bacteria | 1858 |
| 108 | Ga0070699_100184504 | 3300005518 | Bacteria | 1852 |
| 109 | Ga0070679_100003147 | 3300005530 | Bacteria | 15080 |
| 110 | Ga0070679_100169328 | 3300005530 | Bacteria | 2157 |
| 111 | Ga0070679_100197934 | 3300005530 | Bacteria | 1976 |
| 112 | Ga0070679_100728138 | 3300005530 | Bacteria | 935 |
| 113 | Ga0070684_100169466 | 3300005535 | Bacteria | 1983 |
| 114 | Ga0070697_100000107 | 3300005536 | Bacteria | 65460 |
| 115 | Ga0070697_100000353 | 3300005536 | Bacteria | 36186 |
| 116 | Ga0070697_100011022 | 3300005536 | Bacteria | 7062 |
| 117 | Ga0070697_100021934 | 3300005536 | Bacteria | 5066 |
| 118 | Ga0070697_100041359 | 3300005536 | Bacteria | 3730 |
| 119 | Ga0070697_100195106 | 3300005536 | Bacteria | 1719 |
| 120 | Ga0070697_100232296 | 3300005536 | Unclassified | 1573 |
| 121 | Ga0070697_100478484 | 3300005536 | Bacteria | 1087 |
| 122 | Ga0068853_100094337 | 3300005539 | Bacteria | 2636 |
| 123 | Ga0070672_100016320 | 3300005543 | Bacteria | 5315 |
| 124 | Ga0070686_100029896 | 3300005544 | Bacteria | 3318 |
| 125 | Ga0070695_100030579 | 3300005545 | Bacteria | 3354 |
| 126 | Ga0070696_100021981 | 3300005546 | Bacteria | 4329 |
| 127 | Ga0070696_100118457 | 3300005546 | Unclassified | 1914 |
| 128 | Ga0070696_100118652 | 3300005546 | Bacteria | 1913 |
| 129 | Ga0070696_100270059 | 3300005546 | Unclassified | 1293 |
| 130 | Ga0070693_100328840 | 3300005547 | Bacteria | 1039 |
| 131 | Ga0070693_100336138 | 3300005547 | Bacteria | 1029 |
| 132 | Ga0070665_100004403 | 3300005548 | Bacteria | 14805 |
| 133 | Ga0070665_100599578 | 3300005548 | Bacteria | 1114 |
| 134 | Ga0070704_100223129 | 3300005549 | Bacteria | 1533 |
| 135 | Ga0070704_100617549 | 3300005549 | Unclassified | 954 |
| 136 | Ga0068855_100000363 | 3300005563 | Bacteria | 56220 |
| 137 | Ga0068855_100017122 | 3300005563 | Bacteria | 8719 |
| 138 | Ga0068855_100026911 | 3300005563 | Bacteria | 6882 |
| 139 | Ga0068855_100089317 | 3300005563 | Bacteria | 3558 |
| 140 | Ga0068855_100140727 | 3300005563 | Bacteria | 2751 |
| 141 | Ga0068855_100141947 | 3300005563 | Bacteria | 2736 |
| 142 | Ga0068855_100797148 | 3300005563 | Bacteria | 1004 |
| 143 | Ga0070664_100002997 | 3300005564 | Bacteria | 13659 |
| 144 | Ga0070664_100017999 | 3300005564 | Bacteria | 5801 |
| 145 | Ga0070664_100051695 | 3300005564 | Bacteria | 3479 |
| 146 | Ga0070664_100054826 | 3300005564 | Bacteria | 3384 |
| 147 | Ga0070664_100072469 | 3300005564 | Unclassified | 2954 |
| 148 | Ga0068857_100007012 | 3300005577 | Bacteria | 9697 |
| 149 | Ga0068857_100007495 | 3300005577 | Bacteria | 9392 |
| 150 | Ga0068857_100030777 | 3300005577 | Bacteria | 4741 |
| 151 | Ga0068857_100083853 | 3300005577 | Bacteria | 2848 |
| 152 | Ga0068857_100256982 | 3300005577 | Bacteria | 1603 |
| 153 | Ga0068854_100019834 | 3300005578 | Bacteria | 4537 |
| 154 | Ga0068854_100019906 | 3300005578 | Bacteria | 4531 |
| 155 | Ga0068854_100024465 | 3300005578 | Bacteria | 4135 |
| 156 | Ga0068854_100069721 | 3300005578 | Bacteria | 2568 |
| 157 | Ga0068854_100125325 | 3300005578 | Bacteria | 1955 |
| 158 | Ga0068854_100285975 | 3300005578 | Bacteria | 1329 |
| 159 | Ga0068856_100000567 | 3300005614 | Bacteria | 40443 |
| 160 | Ga0068856_100001253 | 3300005614 | Bacteria | 26694 |
| 161 | Ga0068856_100005099 | 3300005614 | Bacteria | 12982 |
| 162 | Ga0068856_100014173 | 3300005614 | Bacteria | 7706 |
| 163 | Ga0068856_100019487 | 3300005614 | Bacteria | 6585 |
| 164 | Ga0068856_100042725 | 3300005614 | Unclassified | 4460 |
| 165 | Ga0068856_100187811 | 3300005614 | Bacteria | 2080 |
| 166 | Ga0070702_100062406 | 3300005615 | Bacteria | 2173 |
| 167 | Ga0068852_100019826 | 3300005616 | Bacteria | 5333 |
| 168 | Ga0068852_100149480 | 3300005616 | Bacteria | 2171 |
| 169 | Ga0068852_100286745 | 3300005616 | Bacteria | 1589 |
| 170 | Ga0068852_100653742 | 3300005616 | Bacteria | 1059 |
| 171 | Ga0068859_100002574 | 3300005617 | Bacteria | 18434 |
| 172 | Ga0068859_100005456 | 3300005617 | Bacteria | 12936 |
| 173 | Ga0068859_100172492 | 3300005617 | Bacteria | 2244 |
| 174 | Ga0068859_100256708 | 3300005617 | Unclassified | 1839 |
| 175 | Ga0068864_100035678 | 3300005618 | Bacteria | 4234 |
| 176 | Ga0068864_100036809 | 3300005618 | Unclassified | 4173 |
| 177 | Ga0068866_10002392 | 3300005718 | Bacteria | 7771 |
| 178 | Ga0068866_10002717 | 3300005718 | Bacteria | 7297 |
| 179 | Ga0068861_100261058 | 3300005719 | Bacteria | 1483 |
| 180 | Ga0068851_10007348 | 3300005834 | Bacteria | 5054 |
| 181 | Ga0068870_10015186 | 3300005840 | Bacteria | 3649 |
| 182 | Ga0068863_100053166 | 3300005841 | Bacteria | 3838 |
| 183 | Ga0068863_100172280 | 3300005841 | Unclassified | 2076 |
| 184 | Ga0068863_100330661 | 3300005841 | Unclassified | 1481 |
| 185 | Ga0068858_100001949 | 3300005842 | Bacteria | 21049 |
| 186 | Ga0068858_100018785 | 3300005842 | Bacteria | 6466 |
| 187 | Ga0068858_100047672 | 3300005842 | Bacteria | 3971 |
| 188 | Ga0068858_100051233 | 3300005842 | Bacteria | 3819 |
| 189 | Ga0068860_100013886 | 3300005843 | Bacteria | 7897 |
| 190 | Ga0068860_100013919 | 3300005843 | Bacteria | 7887 |
| 191 | Ga0068860_100338348 | 3300005843 | Bacteria | 1479 |
| 192 | Ga0068862_100017838 | 3300005844 | Bacteria | 5910 |
| 193 | Ga0068862_100020812 | 3300005844 | Bacteria | 5480 |
| 194 | Ga0068862_100076645 | 3300005844 | Bacteria | 2894 |
| 195 | Ga0070717_10001372 | 3300006028 | Bacteria | 16771 |
| 196 | Ga0070717_10005442 | 3300006028 | Bacteria | 9293 |
| 197 | Ga0070717_10023154 | 3300006028 | Bacteria | 4917 |
| 198 | Ga0070717_10032222 | 3300006028 | Bacteria | 4222 |
| 199 | Ga0070717_10037031 | 3300006028 | Bacteria | 3959 |
| 200 | Ga0070717_10057743 | 3300006028 | Bacteria | 3208 |
| 201 | Ga0070717_10213647 | 3300006028 | Bacteria | 1694 |
| 202 | Ga0070717_10282760 | 3300006028 | Bacteria | 1472 |
| 203 | Ga0070717_11220297 | 3300006028 | Bacteria | 684 |
| 204 | Ga0070715_10097254 | 3300006163 | Bacteria | 1366 |
| 205 | Ga0070715_10225387 | 3300006163 | Bacteria | 966 |
| 206 | Ga0070716_100003475 | 3300006173 | Bacteria | 7424 |
| 207 | Ga0070716_100021185 | 3300006173 | Bacteria | 3422 |
| 208 | Ga0070716_100114679 | 3300006173 | Bacteria | 1676 |
| 209 | Ga0070716_100263214 | 3300006173 | Bacteria | 1181 |
| 210 | Ga0070712_100007843 | 3300006175 | Bacteria | 6687 |
| 211 | Ga0070712_100022710 | 3300006175 | Unclassified | 4136 |
| 212 | Ga0070712_100035393 | 3300006175 | Unclassified | 3389 |
| 213 | Ga0097621_100000085 | 3300006237 | Bacteria | 50268 |
| 214 | Ga0097621_100002310 | 3300006237 | Bacteria | 13062 |
| 215 | Ga0097621_100005323 | 3300006237 | Bacteria | 9063 |
| 216 | Ga0097621_100009628 | 3300006237 | Bacteria | 7024 |
| 217 | Ga0097621_100011556 | 3300006237 | Bacteria | 6507 |
| 218 | Ga0097621_100053550 | 3300006237 | Bacteria | 3289 |
| 219 | Ga0097621_100107138 | 3300006237 | Bacteria | 2358 |
| 220 | Ga0097621_100210938 | 3300006237 | Unclassified | 1690 |
| 221 | Ga0097621_100251479 | 3300006237 | Bacteria | 1548 |
| 222 | Ga0097621_100326432 | 3300006237 | Bacteria | 1360 |
| 223 | Ga0068871_100000849 | 3300006358 | Bacteria | 20448 |
| 224 | Ga0068871_100001152 | 3300006358 | Bacteria | 17738 |
| 225 | Ga0068871_100002644 | 3300006358 | Bacteria | 12239 |
| 226 | Ga0068871_100050117 | 3300006358 | Bacteria | 3377 |
| 227 | Ga0068871_100087565 | 3300006358 | Bacteria | 2589 |
| 228 | Ga0068871_100107485 | 3300006358 | Bacteria | 2343 |
| 229 | Ga0068871_100240643 | 3300006358 | Bacteria | 1573 |
| 230 | Ga0068871_100270673 | 3300006358 | Bacteria | 1484 |
| 231 | Ga0075433_10000310 | 3300006852 | Bacteria | 29590 |
| 232 | Ga0075434_100001515 | 3300006871 | Bacteria | 19639 |
| 233 | Ga0075434_100003635 | 3300006871 | Bacteria | 13771 |
| 234 | Ga0075434_100008451 | 3300006871 | Bacteria | 9574 |
| 235 | Ga0068865_100023722 | 3300006881 | Bacteria | 4020 |
| 236 | Ga0068865_100040872 | 3300006881 | Unclassified | 3153 |
| 237 | Ga0068865_100122818 | 3300006881 | Bacteria | 1934 |
| 238 | Ga0075436_100002566 | 3300006914 | Bacteria | 12505 |
| 239 | Ga0075436_100083301 | 3300006914 | Bacteria | 2219 |
| 240 | Ga0097620_100002574 | 3300006931 | Bacteria | 18434 |
| 241 | Ga0097620_100005456 | 3300006931 | Bacteria | 12936 |
| 242 | Ga0097620_100172484 | 3300006931 | Bacteria | 2244 |
| 243 | Ga0097620_100256708 | 3300006931 | Unclassified | 1839 |
| 244 | Ga0075435_100000683 | 3300007076 | Bacteria | 21031 |
| 245 | Ga0075435_100116142 | 3300007076 | Bacteria | 2229 |
| 246 | Ga0075435_100297163 | 3300007076 | Bacteria | 1381 |
| 247 | Ga0075435_100327232 | 3300007076 | Bacteria | 1312 |
| 248 | Ga0075435_100397917 | 3300007076 | Bacteria | 1184 |
| 249 | Ga0099794_10020087 | 3300007265 | Bacteria | 3020 |
| 250 | Ga0099795_10050590 | 3300007788 | Bacteria | 1512 |
| 251 | Ga0105240_10015732 | 3300009093 | Bacteria | 10267 |
| 252 | Ga0105240_10059592 | 3300009093 | Bacteria | 4763 |
| 253 | Ga0105240_10068049 | 3300009093 | Bacteria | 4412 |
| 254 | Ga0105240_10187516 | 3300009093 | Bacteria | 2435 |
| 255 | Ga0105245_10092535 | 3300009098 | Bacteria | 2784 |
| 256 | Ga0105245_10249019 | 3300009098 | Bacteria | 1725 |
| 257 | Ga0105247_10003382 | 3300009101 | Bacteria | 10429 |
| 258 | Ga0105247_10007088 | 3300009101 | Bacteria | 6884 |
| 259 | Ga0105247_10081606 | 3300009101 | Bacteria | 2039 |
| 260 | Ga0114129_10066372 | 3300009147 | Bacteria | 5034 |
| 261 | Ga0114129_10368271 | 3300009147 | Bacteria | 1900 |
| 262 | Ga0105243_10114212 | 3300009148 | Bacteria | 2266 |
| 263 | Ga0105241_10005955 | 3300009174 | Bacteria | 8992 |
| 264 | Ga0105241_10016466 | 3300009174 | Bacteria | 5423 |
| 265 | Ga0105241_10033908 | 3300009174 | Bacteria | 3834 |
| 266 | Ga0105241_10088013 | 3300009174 | Unclassified | 2445 |
| 267 | Ga0105241_10111525 | 3300009174 | Bacteria | 2190 |
| 268 | Ga0105241_10196119 | 3300009174 | Bacteria | 1684 |
| 269 | Ga0105242_10017634 | 3300009176 | Bacteria | 5568 |
| 270 | Ga0105242_10024113 | 3300009176 | Bacteria | 4803 |
| 271 | Ga0105242_10035519 | 3300009176 | Bacteria | 3997 |
| 272 | Ga0105242_10039415 | 3300009176 | Bacteria | 3803 |
| 273 | Ga0105242_10430487 | 3300009176 | Bacteria | 1239 |
| 274 | Ga0105248_10088691 | 3300009177 | Bacteria | 3481 |
| 275 | Ga0105248_10165076 | 3300009177 | Unclassified | 2497 |
| 276 | Ga0105248_10166896 | 3300009177 | Bacteria | 2481 |
| 277 | Ga0105248_10695516 | 3300009177 | Bacteria | 1147 |
| 278 | Ga0105237_10023675 | 3300009545 | Bacteria | 6289 |
| 279 | Ga0105237_10066134 | 3300009545 | Bacteria | 3610 |
| 280 | Ga0105237_10076870 | 3300009545 | Unclassified | 3328 |
| 281 | Ga0105237_10141864 | 3300009545 | Unclassified | 2397 |
| 282 | Ga0105237_10261227 | 3300009545 | Unclassified | 1734 |
| 283 | Ga0105237_10515262 | 3300009545 | Bacteria | 1202 |
| 284 | Ga0105237_11095164 | 3300009545 | Unclassified | 803 |
| 285 | Ga0105238_10001062 | 3300009551 | Bacteria | 27743 |
| 286 | Ga0105238_10103856 | 3300009551 | Bacteria | 2823 |
| 287 | Ga0105238_10829387 | 3300009551 | Unclassified | 941 |
| 288 | Ga0105249_10007882 | 3300009553 | Bacteria | 9278 |
| 289 | Ga0105249_10042627 | 3300009553 | Bacteria | 4129 |
| 290 | Ga0099796_10074838 | 3300010159 | Bacteria | 1230 |
| 291 | Ga0105239_10010258 | 3300010375 | Bacteria | 10490 |
| 292 | Ga0105239_10025677 | 3300010375 | Bacteria | 6488 |
| 293 | Ga0105239_10135395 | 3300010375 | Bacteria | 2742 |
| 294 | Ga0105239_10357982 | 3300010375 | Bacteria | 1648 |
| 295 | Ga0105239_10681252 | 3300010375 | Bacteria | 1175 |
| 296 | Ga0105239_11135423 | 3300010375 | Bacteria | 900 |
| 297 | Ga0105246_10001225 | 3300011119 | Bacteria | 15024 |
| 298 | Ga0105246_10014314 | 3300011119 | Bacteria | 4988 |
| 299 | Ga0157373_10003701 | 3300013100 | Bacteria | 11569 |
| 300 | Ga0157373_10027170 | 3300013100 | Bacteria | 4129 |
| 301 | Ga0157373_10183599 | 3300013100 | Bacteria | 1473 |
| 302 | Ga0157371_10007268 | 3300013102 | Bacteria | 8997 |
| 303 | Ga0157371_10008322 | 3300013102 | Bacteria | 8281 |
| 304 | Ga0157371_10123618 | 3300013102 | Unclassified | 1840 |
| 305 | Ga0157371_10126323 | 3300013102 | Bacteria | 1819 |
| 306 | Ga0157370_10032415 | 3300013104 | Bacteria | 5103 |
| 307 | Ga0157370_10251075 | 3300013104 | Bacteria | 1636 |
| 308 | Ga0157370_10569299 | 3300013104 | Bacteria | 1038 |
| 309 | Ga0157369_10000386 | 3300013105 | Bacteria | 58547 |
| 310 | Ga0157369_10022554 | 3300013105 | Bacteria | 7023 |
| 311 | Ga0157369_10574698 | 3300013105 | Bacteria | 1164 |
| 312 | Ga0157369_10584251 | 3300013105 | Bacteria | 1153 |
| 313 | Ga0157374_10000253 | 3300013296 | Bacteria | 49319 |
| 314 | Ga0157374_10000453 | 3300013296 | Bacteria | 37355 |
| 315 | Ga0157374_10000609 | 3300013296 | Bacteria | 31684 |
| 316 | Ga0157374_10003439 | 3300013296 | Bacteria | 13302 |
| 317 | Ga0157374_10020887 | 3300013296 | Bacteria | 5817 |
| 318 | Ga0157374_10252326 | 3300013296 | Bacteria | 1736 |
| 319 | Ga0157374_10381540 | 3300013296 | Bacteria | 1404 |
| 320 | Ga0157374_10459018 | 3300013296 | Bacteria | 1276 |
| 321 | Ga0157374_10533625 | 3300013296 | Bacteria | 1180 |
| 322 | Ga0157378_10000117 | 3300013297 | Bacteria | 76732 |
| 323 | Ga0157378_10000321 | 3300013297 | Bacteria | 47154 |
| 324 | Ga0157378_10000344 | 3300013297 | Bacteria | 45774 |
| 325 | Ga0157378_10001717 | 3300013297 | Bacteria | 19681 |
| 326 | Ga0157378_10076181 | 3300013297 | Bacteria | 3022 |
| 327 | Ga0157378_10121398 | 3300013297 | Bacteria | 2409 |
| 328 | Ga0163162_10008600 | 3300013306 | Bacteria | 9951 |
| 329 | Ga0163162_10008790 | 3300013306 | Bacteria | 9820 |
| 330 | Ga0163162_10013645 | 3300013306 | Bacteria | 7937 |
| 331 | Ga0163162_10068095 | 3300013306 | Bacteria | 3611 |
| 332 | Ga0163162_10144719 | 3300013306 | Bacteria | 2492 |
| 333 | Ga0163162_10357365 | 3300013306 | Bacteria | 1594 |
| 334 | Ga0163162_10500805 | 3300013306 | Bacteria | 1345 |
| 335 | Ga0157372_10000500 | 3300013307 | Bacteria | 43103 |
| 336 | Ga0157372_10004725 | 3300013307 | Bacteria | 14467 |
| 337 | Ga0157372_10007417 | 3300013307 | Bacteria | 11664 |
| 338 | Ga0157372_10008139 | 3300013307 | Bacteria | 11151 |
| 339 | Ga0157372_10019084 | 3300013307 | Bacteria | 7382 |
| 340 | Ga0157372_10035970 | 3300013307 | Bacteria | 5454 |
| 341 | Ga0157372_10065584 | 3300013307 | Bacteria | 4077 |
| 342 | Ga0157372_10154041 | 3300013307 | Unclassified | 2654 |
| 343 | Ga0157375_10050921 | 3300013308 | Bacteria | 4064 |
| 344 | Ga0157375_10080633 | 3300013308 | Unclassified | 3293 |
| 345 | Ga0157375_10315092 | 3300013308 | Bacteria | 1729 |
| 346 | Ga0157375_10646634 | 3300013308 | Bacteria | 1214 |
| 347 | Ga0163163_10000595 | 3300014325 | Bacteria | 31716 |
| 348 | Ga0163163_10008436 | 3300014325 | Bacteria | 9155 |
| 349 | Ga0163163_10076653 | 3300014325 | Bacteria | 3338 |
| 350 | Ga0163163_10271446 | 3300014325 | Unclassified | 1747 |
| 351 | Ga0182008_10016296 | 3300014497 | Unclassified | 3862 |
| 352 | Ga0182008_10057313 | 3300014497 | Bacteria | 1923 |
| 353 | Ga0157377_10001292 | 3300014745 | Bacteria | 10725 |
| 354 | Ga0157379_10003837 | 3300014968 | Bacteria | 12814 |
| 355 | Ga0157379_10009864 | 3300014968 | Bacteria | 8319 |
| 356 | Ga0157379_10051006 | 3300014968 | Unclassified | 3695 |
| 357 | Ga0157379_10066713 | 3300014968 | Bacteria | 3217 |
| 358 | Ga0157379_10206870 | 3300014968 | Bacteria | 1775 |
| 359 | Ga0157376_10018804 | 3300014969 | Bacteria | 5309 |
| 360 | Ga0157376_10029983 | 3300014969 | Bacteria | 4337 |
| 361 | Ga0157376_10107726 | 3300014969 | Unclassified | 2447 |
| 362 | Ga0157376_10129367 | 3300014969 | Bacteria | 2250 |
| 363 | Ga0157376_10687946 | 3300014969 | Bacteria | 1027 |
| 364 | Ga0157376_10789075 | 3300014969 | Unclassified | 962 |
| 365 | Ga0182007_10003470 | 3300015262 | Bacteria | 7425 |
| 366 | Ga0182007_10027429 | 3300015262 | Bacteria | 1964 |
| 367 | Ga0182005_1009874 | 3300015265 | Unclassified | 2760 |
| 368 | Ga0163161_10002771 | 3300017792 | Bacteria | 12447 |
| 369 | Ga0213872_10014339 | 3300021361 | Bacteria | 3698 |
| 370 | Ga0213871_10010658 | 3300021441 | Bacteria | 2091 |
| 371 | Ga0213871_10088726 | 3300021441 | Bacteria | 894 |
| 372 | Ga0224569_100267 | 3300022732 | Unclassified | 4352 |
| 373 | Ga0224572_1000996 | 3300024225 | Bacteria | 3909 |
| 374 | Ga0228598_1000385 | 3300024227 | Bacteria | 8838 |
| 375 | Ga0228598_1000850 | 3300024227 | Bacteria | 6604 |
| 376 | Ga0228598_1006462 | 3300024227 | Unclassified | 2426 |
| 377 | Ga0207656_10005405 | 3300025321 | Bacteria | 4512 |
| 378 | Ga0207656_10211470 | 3300025321 | Bacteria | 940 |
| 379 | Ga0207682_10167585 | 3300025893 | Bacteria | 998 |
| 380 | Ga0207692_10028883 | 3300025898 | Bacteria | 2629 |
| 381 | Ga0207692_10457656 | 3300025898 | Unclassified | 804 |
| 382 | Ga0207642_10012301 | 3300025899 | Bacteria | 3086 |
| 383 | Ga0207642_10065030 | 3300025899 | Bacteria | 1712 |
| 384 | Ga0207710_10094019 | 3300025900 | Unclassified | 1407 |
| 385 | Ga0207688_10006690 | 3300025901 | Bacteria | 6273 |
| 386 | Ga0207680_10002514 | 3300025903 | Bacteria | 8551 |
| 387 | Ga0207647_10018466 | 3300025904 | Bacteria | 4713 |
| 388 | Ga0207647_10064322 | 3300025904 | Bacteria | 2229 |
| 389 | Ga0207685_10087108 | 3300025905 | Bacteria | 1306 |
| 390 | Ga0207699_10000566 | 3300025906 | Bacteria | 18209 |
| 391 | Ga0207699_10003269 | 3300025906 | Bacteria | 7723 |
| 392 | Ga0207645_10000273 | 3300025907 | Bacteria | 42696 |
| 393 | Ga0207645_10009069 | 3300025907 | Bacteria | 6904 |
| 394 | Ga0207643_10006633 | 3300025908 | Bacteria | 6207 |
| 395 | Ga0207684_10004278 | 3300025910 | Bacteria | 13529 |
| 396 | Ga0207684_10007499 | 3300025910 | Bacteria | 9819 |
| 397 | Ga0207684_10148053 | 3300025910 | Unclassified | 2020 |
| 398 | Ga0207684_10189169 | 3300025910 | Bacteria | 1775 |
| 399 | Ga0207684_10269505 | 3300025910 | Unclassified | 1469 |
| 400 | Ga0207684_10279082 | 3300025910 | Bacteria | 1441 |
| 401 | Ga0207654_10002570 | 3300025911 | Bacteria | 9211 |
| 402 | Ga0207654_10010110 | 3300025911 | Bacteria | 4799 |
| 403 | Ga0207654_10011434 | 3300025911 | Bacteria | 4530 |
| 404 | Ga0207654_10013790 | 3300025911 | Bacteria | 4163 |
| 405 | Ga0207654_10076885 | 3300025911 | Bacteria | 1999 |
| 406 | Ga0207654_10101876 | 3300025911 | Unclassified | 1770 |
| 407 | Ga0207707_10008181 | 3300025912 | Bacteria | 9075 |
| 408 | Ga0207707_10276716 | 3300025912 | Bacteria | 1454 |
| 409 | Ga0207707_10771385 | 3300025912 | Bacteria | 803 |
| 410 | Ga0207695_10004625 | 3300025913 | Bacteria | 18666 |
| 411 | Ga0207695_10025559 | 3300025913 | Bacteria | 6608 |
| 412 | Ga0207695_10033887 | 3300025913 | Bacteria | 5560 |
| 413 | Ga0207671_10029651 | 3300025914 | Bacteria | 4084 |
| 414 | Ga0207671_10086349 | 3300025914 | Unclassified | 2358 |
| 415 | Ga0207671_10091035 | 3300025914 | Bacteria | 2298 |
| 416 | Ga0207671_10295368 | 3300025914 | Unclassified | 1280 |
| 417 | Ga0207693_10000076 | 3300025915 | Bacteria | 88185 |
| 418 | Ga0207693_10007915 | 3300025915 | Bacteria | 8732 |
| 419 | Ga0207693_10011894 | 3300025915 | Bacteria | 7036 |
| 420 | Ga0207693_10017801 | 3300025915 | Bacteria | 5665 |
| 421 | Ga0207693_10042918 | 3300025915 | Bacteria | 3560 |
| 422 | Ga0207663_10019378 | 3300025916 | Bacteria | 3832 |
| 423 | Ga0207663_10019551 | 3300025916 | Bacteria | 3819 |
| 424 | Ga0207663_10020169 | 3300025916 | Bacteria | 3771 |
| 425 | Ga0207663_10083785 | 3300025916 | Unclassified | 2095 |
| 426 | Ga0207663_10120176 | 3300025916 | Bacteria | 1798 |
| 427 | Ga0207663_10337230 | 3300025916 | Unclassified | 1138 |
| 428 | Ga0207663_10708940 | 3300025916 | Bacteria | 797 |
| 429 | Ga0207663_10787518 | 3300025916 | Unclassified | 757 |
| 430 | Ga0207660_10247934 | 3300025917 | Bacteria | 1405 |
| 431 | Ga0207660_10333057 | 3300025917 | Bacteria | 1214 |
| 432 | Ga0207662_10011456 | 3300025918 | Bacteria | 4920 |
| 433 | Ga0207662_10152871 | 3300025918 | Bacteria | 1469 |
| 434 | Ga0207657_10000628 | 3300025919 | Bacteria | 37475 |
| 435 | Ga0207657_10002319 | 3300025919 | Bacteria | 20621 |
| 436 | Ga0207657_10010598 | 3300025919 | Bacteria | 9186 |
| 437 | Ga0207649_10003871 | 3300025920 | Bacteria | 8161 |
| 438 | Ga0207649_10171276 | 3300025920 | Bacteria | 1513 |
| 439 | Ga0207652_10322587 | 3300025921 | Bacteria | 1394 |
| 440 | Ga0207652_10640248 | 3300025921 | Bacteria | 951 |
| 441 | Ga0207652_11029684 | 3300025921 | Bacteria | 722 |
| 442 | Ga0207646_10001171 | 3300025922 | Bacteria | 33235 |
| 443 | Ga0207646_10003289 | 3300025922 | Bacteria | 18402 |
| 444 | Ga0207646_10240092 | 3300025922 | Unclassified | 1637 |
| 445 | Ga0207646_10488242 | 3300025922 | Bacteria | 1110 |
| 446 | Ga0207681_10009802 | 3300025923 | Bacteria | 5860 |
| 447 | Ga0207694_10000816 | 3300025924 | Bacteria | 27837 |
| 448 | Ga0207694_10048076 | 3300025924 | Bacteria | 3300 |
| 449 | Ga0207694_10064323 | 3300025924 | Bacteria | 2859 |
| 450 | Ga0207694_10190336 | 3300025924 | Bacteria | 1666 |
| 451 | Ga0207650_10000036 | 3300025925 | Bacteria | 214579 |
| 452 | Ga0207650_10011352 | 3300025925 | Bacteria | 6130 |
| 453 | Ga0207650_10239834 | 3300025925 | Bacteria | 1465 |
| 454 | Ga0207650_10899346 | 3300025925 | Bacteria | 752 |
| 455 | Ga0207659_10023383 | 3300025926 | Unclassified | 4123 |
| 456 | Ga0207687_10011597 | 3300025927 | Bacteria | 5762 |
| 457 | Ga0207687_10019765 | 3300025927 | Bacteria | 4465 |
| 458 | Ga0207687_10155287 | 3300025927 | Bacteria | 1750 |
| 459 | Ga0207687_10542550 | 3300025927 | Bacteria | 975 |
| 460 | Ga0207700_10005478 | 3300025928 | Bacteria | 7606 |
| 461 | Ga0207700_10022498 | 3300025928 | Bacteria | 4329 |
| 462 | Ga0207700_10059461 | 3300025928 | Unclassified | 2891 |
| 463 | Ga0207700_10704173 | 3300025928 | Bacteria | 902 |
| 464 | Ga0207700_10720186 | 3300025928 | Bacteria | 891 |
| 465 | Ga0207664_10011150 | 3300025929 | Bacteria | 6371 |
| 466 | Ga0207664_10074274 | 3300025929 | Bacteria | 2746 |
| 467 | Ga0207664_10975218 | 3300025929 | Bacteria | 760 |
| 468 | Ga0207644_10022145 | 3300025931 | Bacteria | 4338 |
| 469 | Ga0207690_10013794 | 3300025932 | Bacteria | 4866 |
| 470 | Ga0207706_10000165 | 3300025933 | Bacteria | 73590 |
| 471 | Ga0207706_10008281 | 3300025933 | Bacteria | 9592 |
| 472 | Ga0207706_10010021 | 3300025933 | Bacteria | 8682 |
| 473 | Ga0207686_10014823 | 3300025934 | Bacteria | 4350 |
| 474 | Ga0207686_10197194 | 3300025934 | Bacteria | 1439 |
| 475 | Ga0207709_10032709 | 3300025935 | Bacteria | 3048 |
| 476 | Ga0207670_10087390 | 3300025936 | Bacteria | 2196 |
| 477 | Ga0207704_10022377 | 3300025938 | Bacteria | 3385 |
| 478 | Ga0207704_10077093 | 3300025938 | Unclassified | 2138 |
| 479 | Ga0207704_10110705 | 3300025938 | Bacteria | 1855 |
| 480 | Ga0207704_10177049 | 3300025938 | Bacteria | 1537 |
| 481 | Ga0207665_10000574 | 3300025939 | Bacteria | 24696 |
| 482 | Ga0207665_10003888 | 3300025939 | Bacteria | 9991 |
| 483 | Ga0207665_10004799 | 3300025939 | Bacteria | 9003 |
| 484 | Ga0207665_10165295 | 3300025939 | Unclassified | 1594 |
| 485 | Ga0207665_10228603 | 3300025939 | Unclassified | 1366 |
| 486 | Ga0207665_10295494 | 3300025939 | Bacteria | 1209 |
| 487 | Ga0207691_10012527 | 3300025940 | Bacteria | 8129 |
| 488 | Ga0207711_10002093 | 3300025941 | Bacteria | 18016 |
| 489 | Ga0207711_10012064 | 3300025941 | Bacteria | 7183 |
| 490 | Ga0207711_10059374 | 3300025941 | Bacteria | 3293 |
| 491 | Ga0207711_10174258 | 3300025941 | Bacteria | 1953 |
| 492 | Ga0207689_10001192 | 3300025942 | Bacteria | 24972 |
| 493 | Ga0207689_10025271 | 3300025942 | Bacteria | 4977 |
| 494 | Ga0207689_10130112 | 3300025942 | Bacteria | 2071 |
| 495 | Ga0207661_10518080 | 3300025944 | Bacteria | 1090 |
| 496 | Ga0207679_10007222 | 3300025945 | Bacteria | 7039 |
| 497 | Ga0207679_10013609 | 3300025945 | Bacteria | 5334 |
| 498 | Ga0207679_10095908 | 3300025945 | Bacteria | 2307 |
| 499 | Ga0207679_10210098 | 3300025945 | Bacteria | 1631 |
| 500 | Ga0207679_10343090 | 3300025945 | Bacteria | 1299 |
| 501 | Ga0207667_10001662 | 3300025949 | Bacteria | 28037 |
| 502 | Ga0207667_10002616 | 3300025949 | Bacteria | 22316 |
| 503 | Ga0207667_10009669 | 3300025949 | Bacteria | 11342 |
| 504 | Ga0207667_10067545 | 3300025949 | Bacteria | 3724 |
| 505 | Ga0207667_10242463 | 3300025949 | Bacteria | 1844 |
| 506 | Ga0207667_11337504 | 3300025949 | Bacteria | 692 |
| 507 | Ga0207651_10005431 | 3300025960 | Bacteria | 6541 |
| 508 | Ga0207651_10132204 | 3300025960 | Bacteria | 1912 |
| 509 | Ga0207668_10010385 | 3300025972 | Bacteria | 5625 |
| 510 | Ga0207668_10057446 | 3300025972 | Bacteria | 2714 |
| 511 | Ga0207640_10014822 | 3300025981 | Bacteria | 4496 |
| 512 | Ga0207640_10043454 | 3300025981 | Bacteria | 2872 |
| 513 | Ga0207640_10099957 | 3300025981 | Bacteria | 2031 |
| 514 | Ga0207640_10113094 | 3300025981 | Bacteria | 1929 |
| 515 | Ga0207658_10014425 | 3300025986 | Bacteria | 5409 |
| 516 | Ga0207658_10120941 | 3300025986 | Unclassified | 2088 |
| 517 | Ga0207658_10572913 | 3300025986 | Unclassified | 1012 |
| 518 | Ga0207677_10002758 | 3300026023 | Bacteria | 9276 |
| 519 | Ga0207677_10015908 | 3300026023 | Unclassified | 4441 |
| 520 | Ga0207677_10051976 | 3300026023 | Bacteria | 2781 |
| 521 | Ga0207677_10061860 | 3300026023 | Bacteria | 2594 |
| 522 | Ga0207677_10406042 | 3300026023 | Bacteria | 1156 |
| 523 | Ga0207703_10050524 | 3300026035 | Unclassified | 3366 |
| 524 | Ga0207703_10140480 | 3300026035 | Unclassified | 2095 |
| 525 | Ga0207703_10158650 | 3300026035 | Bacteria | 1979 |
| 526 | Ga0207703_10246162 | 3300026035 | Bacteria | 1609 |
| 527 | Ga0207639_10299361 | 3300026041 | Bacteria | 1421 |
| 528 | Ga0207639_10350976 | 3300026041 | Bacteria | 1317 |
| 529 | Ga0207678_10001477 | 3300026067 | Bacteria | 21564 |
| 530 | Ga0207678_10006194 | 3300026067 | Bacteria | 10629 |
| 531 | Ga0207708_10325338 | 3300026075 | Unclassified | 1255 |
| 532 | Ga0207702_10000216 | 3300026078 | Bacteria | 67884 |
| 533 | Ga0207702_10011343 | 3300026078 | Bacteria | 7430 |
| 534 | Ga0207702_10031251 | 3300026078 | Bacteria | 4437 |
| 535 | Ga0207702_10042012 | 3300026078 | Bacteria | 3834 |
| 536 | Ga0207702_10105163 | 3300026078 | Bacteria | 2500 |
| 537 | Ga0207702_10198529 | 3300026078 | Unclassified | 1858 |
| 538 | Ga0207702_10267601 | 3300026078 | Bacteria | 1611 |
| 539 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 540 | Ga0207641_10080966 | 3300026088 | Bacteria | 2819 |
| 541 | Ga0207641_10175245 | 3300026088 | Bacteria | 1961 |
| 542 | Ga0207641_10665775 | 3300026088 | Unclassified | 1023 |
| 543 | Ga0207648_10000326 | 3300026089 | Bacteria | 52122 |
| 544 | Ga0207648_10070581 | 3300026089 | Bacteria | 3045 |
| 545 | Ga0207648_10169567 | 3300026089 | Unclassified | 1929 |
| 546 | Ga0207676_10000092 | 3300026095 | Bacteria | 80704 |
| 547 | Ga0207676_10024247 | 3300026095 | Bacteria | 4487 |
| 548 | Ga0207674_10000016 | 3300026116 | Bacteria | 182470 |
| 549 | Ga0207674_10001619 | 3300026116 | Bacteria | 28985 |
| 550 | Ga0207674_10004568 | 3300026116 | Bacteria | 16625 |
| 551 | Ga0207674_10068835 | 3300026116 | Bacteria | 3561 |
| 552 | Ga0207674_10141993 | 3300026116 | Bacteria | 2361 |
| 553 | Ga0207675_100299587 | 3300026118 | Bacteria | 1566 |
| 554 | Ga0207675_100408925 | 3300026118 | Unclassified | 1338 |
| 555 | Ga0207683_10000359 | 3300026121 | Bacteria | 41891 |
| 556 | Ga0207698_10039920 | 3300026142 | Bacteria | 3482 |
| 557 | Ga0207698_10065753 | 3300026142 | Bacteria | 2850 |
| 558 | Ga0207698_10415253 | 3300026142 | Bacteria | 1290 |
| 559 | Ga0207698_10424828 | 3300026142 | Bacteria | 1276 |
| 560 | Ga0209966_1006354 | 3300027695 | Bacteria | 2050 |
| 561 | Ga0265356_1003425 | 3300028017 | Bacteria | 2007 |
| 562 | Ga0268266_10032227 | 3300028379 | Unclassified | 4453 |
| 563 | Ga0268266_10074112 | 3300028379 | Bacteria | 2955 |
| 564 | Ga0268266_11056269 | 3300028379 | Bacteria | 786 |
| 565 | Ga0268265_10185706 | 3300028380 | Bacteria | 1790 |
| 566 | Ga0268265_10232062 | 3300028380 | Bacteria | 1622 |
| 567 | Ga0268264_10012944 | 3300028381 | Bacteria | 6860 |
| 568 | Ga0268264_10018752 | 3300028381 | Bacteria | 5657 |
| 569 | Ga0268264_10196641 | 3300028381 | Bacteria | 1841 |
| 570 | Ga0265326_10049232 | 3300028558 | Bacteria | 1194 |
| 571 | Ga0265338_10048803 | 3300028800 | Unclassified | 3846 |
| 572 | Ga0265338_10297899 | 3300028800 | Unclassified | 1173 |
| 573 | Ga0265762_1000876 | 3300030760 | Bacteria | 5361 |
| 574 | Ga0265762_1002847 | 3300030760 | Bacteria | 3093 |
| 575 | Ga0265765_1003260 | 3300030879 | Bacteria | 1619 |
| 576 | Ga0265760_10000115 | 3300031090 | Bacteria | 20404 |
| 577 | Ga0265760_10012217 | 3300031090 | Unclassified | 2454 |
| 578 | Ga0265330_10019280 | 3300031235 | Bacteria | 3128 |
| 579 | Ga0265339_10034914 | 3300031249 | Bacteria | 2824 |
| 580 | Ga0265316_10009500 | 3300031344 | Bacteria | 8957 |
| 581 | Ga0265316_10079402 | 3300031344 | Unclassified | 2518 |
| 582 | Ga0265314_10068053 | 3300031711 | Bacteria | 2395 |
| 583 | Ga0265342_10102944 | 3300031712 | Unclassified | 1624 |
| 584 | Ga0307416_100040214 | 3300032002 | Bacteria | 3630 |
| 585 | Ga0373926_0025305 | 3300035083 | Unclassified | 2070 |
| 586 | Ga0373932_0034487 | 3300035112 | Bacteria | 1426 |
| 587 | Ga0373936_0014608 | 3300035113 | Unclassified | 3006 |
| 588 | Ga0373954_0009994 | 3300035118 | Bacteria | 4180 |
| 589 | Ga0373957_0235068 | 3300035120 | Bacteria | 769 |
| 590 | Ga0373943_0014495 | 3300035170 | Bacteria | 3570 |
| 591 | Ga0373955_0118165 | 3300035172 | Bacteria | 1539 |
| 592 | Ga0373924_0066136 | 3300035410 | Bacteria | 1519 |
| 593 | Ga0373924_0158515 | 3300035410 | Bacteria | 992 |
| 594 | Ga0373931_0022342 | 3300035691 | Bacteria | 3183 |
| 595 | Ga0373931_0030429 | 3300035691 | Unclassified | 2779 |
| 596 | Ga0373931_0046211 | 3300035691 | Bacteria | 2301 |
| 597 | Ga0373931_0295883 | 3300035691 | Bacteria | 998 |
| 598 | Ga0373935_0011877 | 3300035692 | Bacteria | 5232 |
| 599 | Ga0373935_0130922 | 3300035692 | Bacteria | 1686 |
| 600 | Ga0373927_0042338 | 3300035695 | Bacteria | 2950 |
| 601 | Ga0373927_0058548 | 3300035695 | Bacteria | 2492 |
| 602 | Ga0373933_0002035 | 3300035724 | Bacteria | 11627 |
| 603 | Ga0373933_0170947 | 3300035724 | Bacteria | 1383 |
| 604 | Ga0373933_0180862 | 3300035724 | Bacteria | 1345 |
| 605 | Ga0373933_0208370 | 3300035724 | Unclassified | 1252 |
| 606 | Ga0373947_0009012 | 3300035725 | Bacteria | 5738 |
| 607 | Ga0373947_0106009 | 3300035725 | Unclassified | 1771 |
| 608 | Ga0373937_0016558 | 3300036401 | Bacteria | 6547 |
| 609 | Ga0373937_0077543 | 3300036401 | Bacteria | 3071 |
| 610 | Ga0373937_0163615 | 3300036401 | Unclassified | 2086 |
| 611 | Ga0373937_0440844 | 3300036401 | Bacteria | 1236 |
| 612 | Ga0373937_0561488 | 3300036401 | Unclassified | 1084 |
| 613 | Ga0373937_0573281 | 3300036401 | Unclassified | 1072 |
| 614 | Ga0373925_0010044 | 3300037068 | Bacteria | 6876 |
| 615 | Ga0373925_0122239 | 3300037068 | Bacteria | 2022 |
| 616 | Ga0373925_0188415 | 3300037068 | Bacteria | 1636 |
| 617 | Ga0395905_0274320 | 3300037471 | Bacteria | 1572 |
| 618 | Ga0395905_0315721 | 3300037471 | Unclassified | 1452 |
| 619 | Ga0395901_0316397 | 3300038443 | Bacteria | 1616 |
| 620 | Ga0436365_1781692 | 3300039437 | Bacteria | 1028 |
| 621 | Ga0436360_0517554 | 3300039438 | Bacteria | 902 |
| 622 | Ga0436360_1370952 | 3300039438 | Bacteria | 3422 |
| 623 | Ga0436361_0976825 | 3300039447 | Bacteria | 780 |
| 624 | Ga0436363_0859318 | 3300039450 | Unclassified | 2046 |
| 625 | Ga0436363_1170876 | 3300039450 | Bacteria | 830 |
| 626 | Ga0436362_0529442 | 3300039453 | Unclassified | 1269 |
| 627 | Ga0451839_0809308 | 3300041496 | Bacteria | 735 |
| 628 | Ga0439448_0076326 | 3300042005 | Bacteria | 1121 |
| 629 | Ga0451577_0001499 | 3300042876 | Bacteria | 30880 |
| 630 | Ga0453683_0032487 | 3300044673 | Bacteria | 3294 |
| 631 | Ga0453683_0075125 | 3300044673 | Bacteria | 2116 |
| 632 | Ga0466963_0003785 | 3300044694 | Bacteria | 8722 |
| 633 | Ga0466963_0457517 | 3300044694 | Unclassified | 901 |
| 634 | Ga0453684_0000698 | 3300044712 | Bacteria | 119496 |
| 635 | Ga0466957_0028175 | 3300044842 | Bacteria | 3343 |
| 636 | Ga0451576_0022087 | 3300045051 | Bacteria | 6905 |
| 637 | Ga0451576_0023250 | 3300045051 | Bacteria | 6713 |
| 638 | Ga0451576_0170681 | 3300045051 | Bacteria | 2270 |
| 639 | Ga0451576_0332666 | 3300045051 | Bacteria | 1590 |
| 640 | Ga0466967_0009313 | 3300045976 | Bacteria | 7277 |
| 641 | Ga0466967_0077881 | 3300045976 | Bacteria | 2985 |
| 642 | Ga0495590_0123319 | 3300046457 | Bacteria | 929 |
| 643 | Ga0495580_0000204 | 3300046472 | Bacteria | 45607 |
| 644 | Ga0495580_0000219 | 3300046472 | Bacteria | 44268 |
| 645 | Ga0495580_0001024 | 3300046472 | Bacteria | 24541 |
| 646 | Ga0495580_0006948 | 3300046472 | Bacteria | 9131 |
| 647 | Ga0495580_0010147 | 3300046472 | Bacteria | 7357 |
| 648 | Ga0495580_0029342 | 3300046472 | Unclassified | 3993 |
| 649 | Ga0495580_0049396 | 3300046472 | Unclassified | 2977 |
| 650 | Ga0495580_0072278 | 3300046472 | Bacteria | 2409 |
| 651 | Ga0495582_0003159 | 3300046473 | Bacteria | 9248 |
| 652 | Ga0495594_0069803 | 3300046499 | Unclassified | 1952 |
| 653 | Ga0495665_0001183 | 3300046531 | Bacteria | 13898 |
| 654 | Ga0495587_0367202 | 3300046536 | Bacteria | 801 |
| 655 | Ga0495667_0042172 | 3300046559 | Bacteria | 3026 |
| 656 | Ga0495625_0000571 | 3300046660 | Bacteria | 53797 |
| 657 | Ga0495635_0180255 | 3300046663 | Unclassified | 1436 |
| 658 | Ga0495635_0220685 | 3300046663 | Unclassified | 1282 |
| 659 | Ga0495588_0166416 | 3300046674 | Unclassified | 1166 |
| 660 | Ga0495623_0097929 | 3300046679 | Bacteria | 1791 |
| 661 | Ga0495658_0052261 | 3300046683 | Unclassified | 2317 |
| 662 | Ga0495669_0080479 | 3300046684 | Bacteria | 1495 |
| 663 | Ga0495581_0086874 | 3300047315 | Unclassified | 1813 |
| 664 | Ga0495636_0239861 | 3300047318 | Bacteria | 836 |
| 665 | Ga0495674_0349563 | 3300047319 | Bacteria | 1200 |
| 666 | Ga0495674_0548793 | 3300047319 | Unclassified | 920 |
| 667 | Ga0495684_0339936 | 3300047471 | Unclassified | 1068 |
| 668 | Ga0495684_0407606 | 3300047471 | Unclassified | 953 |
| 669 | Ga0495602_0073160 | 3300048088 | Bacteria | 2919 |
| 670 | Ga0495602_0152229 | 3300048088 | Bacteria | 1816 |
| 671 | Ga0496100_0065436 | 3300048903 | Unclassified | 2409 |
| 672 | Ga0496100_0091545 | 3300048903 | Unclassified | 2076 |
| 673 | Ga0496100_0097159 | 3300048903 | Bacteria | 2022 |
| 674 | Ga0496100_0128813 | 3300048903 | Bacteria | 1780 |
| 675 | Ga0496101_0038318 | 3300048904 | Bacteria | 3404 |
| 676 | Ga0496101_0268269 | 3300048904 | Bacteria | 1332 |
| 677 | Ga0496101_0468688 | 3300048904 | Bacteria | 994 |
| 678 | Ga0496102_0004659 | 3300048905 | Bacteria | 11601 |
| 679 | Ga0496102_0034222 | 3300048905 | Bacteria | 4569 |
| 680 | Ga0496102_0035418 | 3300048905 | Bacteria | 4493 |
| 681 | Ga0496102_0041429 | 3300048905 | Bacteria | 4170 |
| 682 | Ga0496102_0110529 | 3300048905 | Bacteria | 2562 |
| 683 | Ga0496102_0245318 | 3300048905 | Unclassified | 1689 |
| 684 | Ga0496102_0404013 | 3300048905 | Bacteria | 1284 |
| 685 | Ga0496102_0765306 | 3300048905 | Bacteria | 888 |
| 686 | Ga0496103_0000974 | 3300048906 | Bacteria | 20261 |
| 687 | Ga0496103_0068110 | 3300048906 | Bacteria | 2224 |
| 688 | Ga0496104_0032081 | 3300048907 | Unclassified | 4889 |
| 689 | Ga0496104_0039109 | 3300048907 | Bacteria | 4440 |
| 690 | Ga0496104_0083008 | 3300048907 | Bacteria | 3056 |
| 691 | Ga0496104_0179604 | 3300048907 | Bacteria | 2027 |
| 692 | Ga0496104_0190016 | 3300048907 | Unclassified | 1965 |
| 693 | Ga0496104_1087585 | 3300048907 | Bacteria | 703 |
| 694 | Ga0496105_0314552 | 3300048908 | Bacteria | 1256 |
| 695 | Ga0496105_0337293 | 3300048908 | Bacteria | 1206 |
| 696 | Ga0496105_0608680 | 3300048908 | Bacteria | 847 |
| 697 | Ga0496106_0266486 | 3300048909 | Bacteria | 1371 |
| 698 | Ga0496106_0286723 | 3300048909 | Unclassified | 1320 |
| 699 | Ga0496107_0051119 | 3300048910 | Bacteria | 2980 |
| 700 | Ga0496107_0118686 | 3300048910 | Unclassified | 1948 |
| 701 | Ga0496107_0136383 | 3300048910 | Bacteria | 1813 |
| 702 | Ga0496108_0017665 | 3300048911 | Bacteria | 5837 |
| 703 | Ga0496108_0888696 | 3300048911 | Bacteria | 765 |
| 704 | Ga0496109_0000524 | 3300048912 | Bacteria | 32521 |
| 705 | Ga0496109_0062942 | 3300048912 | Bacteria | 3393 |
| 706 | Ga0496109_0292638 | 3300048912 | Bacteria | 1535 |
| 707 | Ga0496110_0001679 | 3300048913 | Bacteria | 16247 |
| 708 | Ga0496110_0152029 | 3300048913 | Bacteria | 2096 |
| 709 | Ga0496111_0046363 | 3300048914 | Unclassified | 3130 |
| 710 | Ga0496111_0144538 | 3300048914 | Unclassified | 1763 |
| 711 | Ga0496112_0000645 | 3300048915 | Bacteria | 24241 |
| 712 | Ga0496112_0000753 | 3300048915 | Bacteria | 22676 |
| 713 | Ga0496112_0003806 | 3300048915 | Bacteria | 12612 |
| 714 | Ga0496112_0020118 | 3300048915 | Bacteria | 6319 |
| 715 | Ga0496112_0108004 | 3300048915 | Bacteria | 2753 |
| 716 | Ga0496112_0185071 | 3300048915 | Unclassified | 2046 |
| 717 | Ga0496112_0361511 | 3300048915 | Bacteria | 1393 |
| 718 | Ga0496112_0475784 | 3300048915 | Bacteria | 1186 |
| 719 | Ga0496113_0016848 | 3300048916 | Bacteria | 5057 |
| 720 | Ga0496113_0245314 | 3300048916 | Bacteria | 1429 |
| 721 | Ga0496114_0077357 | 3300048917 | Bacteria | 2805 |
| 722 | Ga0496115_0027517 | 3300048918 | Bacteria | 4448 |
| 723 | Ga0496115_0368790 | 3300048918 | Bacteria | 1169 |
| 724 | Ga0496115_0837118 | 3300048918 | Bacteria | 714 |
| 725 | Ga0501298_011581 | 3300049521 | Bacteria | 1534 |
| 726 | Ga0501083_0037263 | 3300049744 | Bacteria | 3313 |
| 727 | nmdc:mga05p37_519527_c1 | 3300050507 | Bacteria | 1362 |
| 728 | nmdc:mga0n895_12417_c1 | 3300050512 | Bacteria | 7640 |
| 729 | nmdc:mga0n895_5233_c1 | 3300050512 | Bacteria | 10810 |
| 730 | nmdc:mga0n895_7198_c1 | 3300050512 | Bacteria | 9526 |
| 731 | nmdc:mga0rr50_362294_c1 | 3300050513 | Bacteria | 1220 |
| 732 | nmdc:mga0rr50_40379_c1 | 3300050513 | Bacteria | 3392 |
| 733 | nmdc:mga0rr50_563_c1 | 3300050513 | Bacteria | 19875 |
| 734 | nmdc:mga08x19_52431_c1 | 3300050514 | Bacteria | 2624 |
| 735 | nmdc:mga0a205_279_c1 | 3300050515 | Bacteria | 37324 |
| 736 | Ga0495619_0102182 | 3300053085 | Bacteria | 1952 |
| 737 | Ga0495619_0127146 | 3300053085 | Bacteria | 1750 |
| 738 | Ga0495619_0342115 | 3300053085 | Unclassified | 1035 |
| 739 | Ga0501084_0017102 | 3300054114 | Bacteria | 6024 |
| 740 | Ga0501084_0514520 | 3300054114 | Bacteria | 1012 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021441 | Ga0213871_10010658 | Ga0213871_100106582 | 185 |
| 2 | 3300039438 | Ga0436360_1370952 | Ga0436360_1370952_1512_2150 | 185 |
| 3 | 3300039447 | Ga0436361_0976825 | Ga0436361_0976825_113_751 | 185 |
| 4 | 3300021361 | Ga0213872_10014339 | Ga0213872_100143394 | 186 |
| 5 | 3300035118 | Ga0373954_0009994 | Ga0373954_0009994_716_1342 | 186 |
| 6 | 3300035410 | Ga0373924_0066136 | Ga0373924_0066136_173_799 | 186 |
| 7 | 3300035724 | Ga0373933_0002035 | Ga0373933_0002035_7148_7774 | 186 |
| 8 | 3300036401 | Ga0373937_0016558 | Ga0373937_0016558_5699_6325 | 186 |
| 9 | 3300046559 | Ga0495667_0042172 | Ga0495667_0042172_1196_1822 | 186 |
| 10 | 3300053085 | Ga0495619_0102182 | Ga0495619_0102182_1000_1626 | 186 |
| 11 | 3300025922 | Ga0207646_10240092 | Ga0207646_102400922 | 188 |
| 12 | 3300039437 | Ga0436365_1781692 | Ga0436365_1781692_350_988 | 188 |
| 13 | 3300039450 | Ga0436363_1170876 | Ga0436363_1170876_57_695 | 188 |
| 14 | 3300025986 | Ga0207658_10572913 | Ga0207658_105729132 | 189 |
| 15 | 3300005328 | Ga0070676_10168073 | Ga0070676_101680731 | 190 |
| 16 | 3300005331 | Ga0070670_100017561 | Ga0070670_1000175616 | 190 |
| 17 | 3300005334 | Ga0068869_100016098 | Ga0068869_1000160981 | 190 |
| 18 | 3300005336 | Ga0070680_100050994 | Ga0070680_1000509942 | 190 |
| 19 | 3300005337 | Ga0070682_100241713 | Ga0070682_1002417132 | 190 |
| 20 | 3300005338 | Ga0068868_100013694 | Ga0068868_1000136946 | 190 |
| 21 | 3300005338 | Ga0068868_100095358 | Ga0068868_1000953583 | 190 |
| 22 | 3300005344 | Ga0070661_100025961 | Ga0070661_1000259616 | 190 |
| 23 | 3300005354 | Ga0070675_101031738 | Ga0070675_1010317381 | 190 |
| 24 | 3300005364 | Ga0070673_100038009 | Ga0070673_1000380092 | 190 |
| 25 | 3300005367 | Ga0070667_100558858 | Ga0070667_1005588582 | 190 |
| 26 | 3300005436 | Ga0070713_100111385 | Ga0070713_1001113852 | 190 |
| 27 | 3300005440 | Ga0070705_100082611 | Ga0070705_1000826112 | 190 |
| 28 | 3300005458 | Ga0070681_10000394 | Ga0070681_1000039426 | 190 |
| 29 | 3300005458 | Ga0070681_10006170 | Ga0070681_1000617010 | 190 |
| 30 | 3300005459 | Ga0068867_100070899 | Ga0068867_1000708994 | 190 |
| 31 | 3300005530 | Ga0070679_100003147 | Ga0070679_1000031474 | 190 |
| 32 | 3300005530 | Ga0070679_100728138 | Ga0070679_1007281382 | 190 |
| 33 | 3300005535 | Ga0070684_100169466 | Ga0070684_1001694663 | 190 |
| 34 | 3300005563 | Ga0068855_100000363 | Ga0068855_10000036334 | 190 |
| 35 | 3300005563 | Ga0068855_100017122 | Ga0068855_1000171222 | 190 |
| 36 | 3300005563 | Ga0068855_100026911 | Ga0068855_1000269113 | 190 |
| 37 | 3300005564 | Ga0070664_100002997 | Ga0070664_1000029976 | 190 |
| 38 | 3300005564 | Ga0070664_100054826 | Ga0070664_1000548264 | 190 |
| 39 | 3300005577 | Ga0068857_100007495 | Ga0068857_1000074954 | 190 |
| 40 | 3300005577 | Ga0068857_100083853 | Ga0068857_1000838532 | 190 |
| 41 | 3300005578 | Ga0068854_100019906 | Ga0068854_1000199066 | 190 |
| 42 | 3300005578 | Ga0068854_100069721 | Ga0068854_1000697213 | 190 |
| 43 | 3300005614 | Ga0068856_100000567 | Ga0068856_10000056724 | 190 |
| 44 | 3300005614 | Ga0068856_100001253 | Ga0068856_10000125320 | 190 |
| 45 | 3300005614 | Ga0068856_100005099 | Ga0068856_1000050992 | 190 |
| 46 | 3300005616 | Ga0068852_100149480 | Ga0068852_1001494803 | 190 |
| 47 | 3300005616 | Ga0068852_100286745 | Ga0068852_1002867453 | 190 |
| 48 | 3300005616 | Ga0068852_100653742 | Ga0068852_1006537422 | 190 |
| 49 | 3300005617 | Ga0068859_100005456 | Ga0068859_1000054566 | 190 |
| 50 | 3300005618 | Ga0068864_100035678 | Ga0068864_1000356785 | 190 |
| 51 | 3300005718 | Ga0068866_10002392 | Ga0068866_100023924 | 190 |
| 52 | 3300005719 | Ga0068861_100261058 | Ga0068861_1002610583 | 190 |
| 53 | 3300005841 | Ga0068863_100053166 | Ga0068863_1000531665 | 190 |
| 54 | 3300005842 | Ga0068858_100047672 | Ga0068858_1000476725 | 190 |
| 55 | 3300005843 | Ga0068860_100013919 | Ga0068860_1000139191 | 190 |
| 56 | 3300006028 | Ga0070717_10213647 | Ga0070717_102136472 | 190 |
| 57 | 3300006237 | Ga0097621_100000085 | Ga0097621_10000008533 | 190 |
| 58 | 3300006237 | Ga0097621_100011556 | Ga0097621_1000115562 | 190 |
| 59 | 3300006237 | Ga0097621_100107138 | Ga0097621_1001071383 | 190 |
| 60 | 3300006358 | Ga0068871_100000849 | Ga0068871_1000008493 | 190 |
| 61 | 3300006358 | Ga0068871_100001152 | Ga0068871_10000115215 | 190 |
| 62 | 3300006358 | Ga0068871_100050117 | Ga0068871_1000501173 | 190 |
| 63 | 3300006881 | Ga0068865_100122818 | Ga0068865_1001228182 | 190 |
| 64 | 3300006931 | Ga0097620_100005456 | Ga0097620_1000054566 | 190 |
| 65 | 3300009093 | Ga0105240_10015732 | Ga0105240_100157326 | 190 |
| 66 | 3300009093 | Ga0105240_10068049 | Ga0105240_100680494 | 190 |
| 67 | 3300009174 | Ga0105241_10088013 | Ga0105241_100880131 | 190 |
| 68 | 3300009176 | Ga0105242_10035519 | Ga0105242_100355194 | 190 |
| 69 | 3300009545 | Ga0105237_10515262 | Ga0105237_105152623 | 190 |
| 70 | 3300009551 | Ga0105238_10001062 | Ga0105238_100010628 | 190 |
| 71 | 3300010375 | Ga0105239_10135395 | Ga0105239_101353952 | 190 |
| 72 | 3300010375 | Ga0105239_11135423 | Ga0105239_111354232 | 190 |
| 73 | 3300013100 | Ga0157373_10183599 | Ga0157373_101835993 | 190 |
| 74 | 3300013102 | Ga0157371_10123618 | Ga0157371_101236182 | 190 |
| 75 | 3300013102 | Ga0157371_10126323 | Ga0157371_101263232 | 190 |
| 76 | 3300013105 | Ga0157369_10000386 | Ga0157369_1000038619 | 190 |
| 77 | 3300013105 | Ga0157369_10584251 | Ga0157369_105842512 | 190 |
| 78 | 3300013296 | Ga0157374_10000253 | Ga0157374_1000025332 | 190 |
| 79 | 3300013296 | Ga0157374_10000453 | Ga0157374_1000045319 | 190 |
| 80 | 3300013296 | Ga0157374_10000609 | Ga0157374_1000060941 | 190 |
| 81 | 3300013297 | Ga0157378_10000117 | Ga0157378_1000011741 | 190 |
| 82 | 3300013297 | Ga0157378_10000321 | Ga0157378_1000032110 | 190 |
| 83 | 3300013297 | Ga0157378_10001717 | Ga0157378_100017173 | 190 |
| 84 | 3300013307 | Ga0157372_10000500 | Ga0157372_1000050024 | 190 |
| 85 | 3300013307 | Ga0157372_10007417 | Ga0157372_1000741711 | 190 |
| 86 | 3300013307 | Ga0157372_10008139 | Ga0157372_100081398 | 190 |
| 87 | 3300025899 | Ga0207642_10012301 | Ga0207642_100123012 | 190 |
| 88 | 3300025911 | Ga0207654_10010110 | Ga0207654_100101104 | 190 |
| 89 | 3300025911 | Ga0207654_10101876 | Ga0207654_101018763 | 190 |
| 90 | 3300025912 | Ga0207707_10008181 | Ga0207707_100081816 | 190 |
| 91 | 3300025913 | Ga0207695_10033887 | Ga0207695_100338877 | 190 |
| 92 | 3300025916 | Ga0207663_10708940 | Ga0207663_107089401 | 190 |
| 93 | 3300025917 | Ga0207660_10247934 | Ga0207660_102479341 | 190 |
| 94 | 3300025917 | Ga0207660_10333057 | Ga0207660_103330572 | 190 |
| 95 | 3300025920 | Ga0207649_10171276 | Ga0207649_101712762 | 190 |
| 96 | 3300025921 | Ga0207652_10322587 | Ga0207652_103225872 | 190 |
| 97 | 3300025921 | Ga0207652_10640248 | Ga0207652_106402482 | 190 |
| 98 | 3300025924 | Ga0207694_10000816 | Ga0207694_1000081619 | 190 |
| 99 | 3300025925 | Ga0207650_10011352 | Ga0207650_100113523 | 190 |
| 100 | 3300025938 | Ga0207704_10110705 | Ga0207704_101107053 | 190 |
| 101 | 3300025942 | Ga0207689_10130112 | Ga0207689_101301123 | 190 |
| 102 | 3300025945 | Ga0207679_10095908 | Ga0207679_100959082 | 190 |
| 103 | 3300025945 | Ga0207679_10343090 | Ga0207679_103430902 | 190 |
| 104 | 3300025949 | Ga0207667_10001662 | Ga0207667_1000166219 | 190 |
| 105 | 3300025949 | Ga0207667_10009669 | Ga0207667_100096696 | 190 |
| 106 | 3300025960 | Ga0207651_10132204 | Ga0207651_101322042 | 190 |
| 107 | 3300025981 | Ga0207640_10099957 | Ga0207640_100999573 | 190 |
| 108 | 3300026023 | Ga0207677_10051976 | Ga0207677_100519763 | 190 |
| 109 | 3300026035 | Ga0207703_10140480 | Ga0207703_101404802 | 190 |
| 110 | 3300026041 | Ga0207639_10350976 | Ga0207639_103509762 | 190 |
| 111 | 3300026078 | Ga0207702_10000216 | Ga0207702_1000021619 | 190 |
| 112 | 3300026078 | Ga0207702_10011343 | Ga0207702_100113432 | 190 |
| 113 | 3300026078 | Ga0207702_10105163 | Ga0207702_101051632 | 190 |
| 114 | 3300026088 | Ga0207641_10665775 | Ga0207641_106657751 | 190 |
| 115 | 3300026089 | Ga0207648_10070581 | Ga0207648_100705813 | 190 |
| 116 | 3300026095 | Ga0207676_10024247 | Ga0207676_100242473 | 190 |
| 117 | 3300026116 | Ga0207674_10001619 | Ga0207674_100016194 | 190 |
| 118 | 3300026116 | Ga0207674_10004568 | Ga0207674_1000456813 | 190 |
| 119 | 3300026118 | Ga0207675_100299587 | Ga0207675_1002995873 | 190 |
| 120 | 3300026142 | Ga0207698_10039920 | Ga0207698_100399204 | 190 |
| 121 | 3300026142 | Ga0207698_10415253 | Ga0207698_104152532 | 190 |
| 122 | 3300028381 | Ga0268264_10196641 | Ga0268264_101966412 | 190 |
| 123 | 3300035691 | Ga0373931_0046211 | Ga0373931_0046211_198_830 | 190 |
| 124 | 3300048905 | Ga0496102_0035418 | Ga0496102_0035418_1487_2110 | 190 |
| 125 | 3300048907 | Ga0496104_0032081 | Ga0496104_0032081_3060_3683 | 190 |
| 126 | 3300048908 | Ga0496105_0314552 | Ga0496105_0314552_287_910 | 190 |
| 127 | 3300048915 | Ga0496112_0000753 | Ga0496112_0000753_16496_17119 | 190 |
| 128 | 3300048915 | Ga0496112_0108004 | Ga0496112_0108004_353_985 | 190 |
| 129 | 3300007076 | Ga0075435_100327232 | Ga0075435_1003272322 | 191 |
| 130 | 3300025928 | Ga0207700_10720186 | Ga0207700_107201861 | 191 |
| 131 | 3300035120 | Ga0373957_0235068 | Ga0373957_0235068_68_691 | 191 |
| 132 | 3300035410 | Ga0373924_0158515 | Ga0373924_0158515_246_890 | 191 |
| 133 | 3300046472 | Ga0495580_0000219 | Ga0495580_0000219_42701_43324 | 191 |
| 134 | 3300046536 | Ga0495587_0367202 | Ga0495587_0367202_143_766 | 191 |
| 135 | 3300047319 | Ga0495674_0349563 | Ga0495674_0349563_155_799 | 191 |
| 136 | 3300047319 | Ga0495674_0548793 | Ga0495674_0548793_25_648 | 191 |
| 137 | 3300048088 | Ga0495602_0073160 | Ga0495602_0073160_164_787 | 191 |
| 138 | 3300013104 | Ga0157370_10569299 | Ga0157370_105692991 | 192 |
| 139 | 3300035724 | Ga0373933_0208370 | Ga0373933_0208370_99_743 | 192 |
| 140 | 3300042876 | Ga0451577_0001499 | Ga0451577_0001499_26992_27615 | 192 |
| 141 | 3300044673 | Ga0453683_0032487 | Ga0453683_0032487_1259_1882 | 192 |
| 142 | 3300044712 | Ga0453684_0000698 | Ga0453684_0000698_106063_106686 | 192 |
| 143 | 3300045051 | Ga0451576_0023250 | Ga0451576_0023250_2852_3475 | 192 |
| 144 | 3300005530 | Ga0070679_100197934 | Ga0070679_1001979341 | 193 |
| 145 | 3300025921 | Ga0207652_11029684 | Ga0207652_110296841 | 193 |
| 146 | 3300041496 | Ga0451839_0809308 | Ga0451839_0809308_136_717 | 193 |
| 147 | 3300054114 | Ga0501084_0017102 | Ga0501084_0017102_2355_2990 | 193 |
| 148 | 3300044673 | Ga0453683_0075125 | Ga0453683_0075125_42_665 | 194 |
| 149 | 3300005334 | Ga0068869_100005202 | Ga0068869_1000052028 | 196 |
| 150 | 3300005338 | Ga0068868_100021622 | Ga0068868_1000216224 | 196 |
| 151 | 3300005345 | Ga0070692_10368934 | Ga0070692_103689341 | 196 |
| 152 | 3300005563 | Ga0068855_100140727 | Ga0068855_1001407274 | 196 |
| 153 | 3300005617 | Ga0068859_100256708 | Ga0068859_1002567082 | 196 |
| 154 | 3300005841 | Ga0068863_100172280 | Ga0068863_1001722803 | 196 |
| 155 | 3300005842 | Ga0068858_100001949 | Ga0068858_10000194914 | 196 |
| 156 | 3300005843 | Ga0068860_100013886 | Ga0068860_1000138864 | 196 |
| 157 | 3300006237 | Ga0097621_100210938 | Ga0097621_1002109382 | 196 |
| 158 | 3300006358 | Ga0068871_100270673 | Ga0068871_1002706732 | 196 |
| 159 | 3300006881 | Ga0068865_100040872 | Ga0068865_1000408723 | 196 |
| 160 | 3300006931 | Ga0097620_100256708 | Ga0097620_1002567082 | 196 |
| 161 | 3300009177 | Ga0105248_10165076 | Ga0105248_101650763 | 196 |
| 162 | 3300009545 | Ga0105237_10076870 | Ga0105237_100768704 | 196 |
| 163 | 3300009551 | Ga0105238_10829387 | Ga0105238_108293871 | 196 |
| 164 | 3300010375 | Ga0105239_10010258 | Ga0105239_100102586 | 196 |
| 165 | 3300013296 | Ga0157374_10020887 | Ga0157374_100208875 | 196 |
| 166 | 3300013306 | Ga0163162_10008600 | Ga0163162_100086005 | 196 |
| 167 | 3300013308 | Ga0157375_10315092 | Ga0157375_103150922 | 196 |
| 168 | 3300014968 | Ga0157379_10051006 | Ga0157379_100510064 | 196 |
| 169 | 3300014969 | Ga0157376_10107726 | Ga0157376_101077264 | 196 |
| 170 | 3300025899 | Ga0207642_10065030 | Ga0207642_100650303 | 196 |
| 171 | 3300025904 | Ga0207647_10018466 | Ga0207647_100184666 | 196 |
| 172 | 3300025914 | Ga0207671_10086349 | Ga0207671_100863491 | 196 |
| 173 | 3300025938 | Ga0207704_10077093 | Ga0207704_100770933 | 196 |
| 174 | 3300025942 | Ga0207689_10001192 | Ga0207689_100011925 | 196 |
| 175 | 3300026023 | Ga0207677_10015908 | Ga0207677_100159084 | 196 |
| 176 | 3300026035 | Ga0207703_10050524 | Ga0207703_100505244 | 196 |
| 177 | 3300026075 | Ga0207708_10325338 | Ga0207708_103253381 | 196 |
| 178 | 3300026089 | Ga0207648_10169567 | Ga0207648_101695671 | 196 |
| 179 | 3300026118 | Ga0207675_100408925 | Ga0207675_1004089251 | 196 |
| 180 | 3300028381 | Ga0268264_10012944 | Ga0268264_100129446 | 196 |
| 181 | 3300048905 | Ga0496102_0245318 | Ga0496102_0245318_743_1366 | 196 |
| 182 | 3300048914 | Ga0496111_0144538 | Ga0496111_0144538_515_1138 | 196 |
| 183 | 3300048915 | Ga0496112_0003806 | Ga0496112_0003806_4224_4847 | 196 |
| 184 | 3300048918 | Ga0496115_0837118 | Ga0496115_0837118_59_682 | 196 |
| 185 | 3300005434 | Ga0070709_10000616 | Ga0070709_100006164 | 197 |
| 186 | 3300005436 | Ga0070713_100002930 | Ga0070713_10000293011 | 197 |
| 187 | 3300005436 | Ga0070713_100029464 | Ga0070713_1000294643 | 197 |
| 188 | 3300005437 | Ga0070710_10388694 | Ga0070710_103886941 | 197 |
| 189 | 3300005439 | Ga0070711_100008149 | Ga0070711_1000081495 | 197 |
| 190 | 3300006175 | Ga0070712_100022710 | Ga0070712_1000227104 | 197 |
| 191 | 3300007076 | Ga0075435_100397917 | Ga0075435_1003979172 | 197 |
| 192 | 3300013297 | Ga0157378_10076181 | Ga0157378_100761811 | 197 |
| 193 | 3300025898 | Ga0207692_10028883 | Ga0207692_100288833 | 197 |
| 194 | 3300025915 | Ga0207693_10000076 | Ga0207693_1000007612 | 197 |
| 195 | 3300025915 | Ga0207693_10017801 | Ga0207693_100178017 | 197 |
| 196 | 3300025916 | Ga0207663_10019551 | Ga0207663_100195514 | 197 |
| 197 | 3300025928 | Ga0207700_10059461 | Ga0207700_100594611 | 197 |
| 198 | 3300025939 | Ga0207665_10003888 | Ga0207665_100038886 | 197 |
| 199 | 3300044694 | Ga0466963_0003785 | Ga0466963_0003785_790_1464 | 197 |
| 200 | 3300044842 | Ga0466957_0028175 | Ga0466957_0028175_1409_2083 | 197 |
| 201 | 3300048915 | Ga0496112_0185071 | Ga0496112_0185071_1432_2025 | 197 |
| 202 | 3300005367 | Ga0070667_100361708 | Ga0070667_1003617083 | 198 |
| 203 | 3300005547 | Ga0070693_100336138 | Ga0070693_1003361381 | 198 |
| 204 | 3300005578 | Ga0068854_100285975 | Ga0068854_1002859752 | 198 |
| 205 | 3300005615 | Ga0070702_100062406 | Ga0070702_1000624063 | 198 |
| 206 | 3300006028 | Ga0070717_11220297 | Ga0070717_112202971 | 198 |
| 207 | 3300006237 | Ga0097621_100002310 | Ga0097621_1000023102 | 198 |
| 208 | 3300006358 | Ga0068871_100002644 | Ga0068871_1000026444 | 198 |
| 209 | 3300009176 | Ga0105242_10039415 | Ga0105242_100394153 | 198 |
| 210 | 3300009177 | Ga0105248_10088691 | Ga0105248_100886913 | 198 |
| 211 | 3300013297 | Ga0157378_10000344 | Ga0157378_100003445 | 198 |
| 212 | 3300025906 | Ga0207699_10000566 | Ga0207699_1000056616 | 199 |
| 213 | 3300025938 | Ga0207704_10177049 | Ga0207704_101770492 | 199 |
| 214 | 3300025941 | Ga0207711_10059374 | Ga0207711_100593743 | 199 |
| 215 | 3300005436 | Ga0070713_100244727 | Ga0070713_1002447272 | 200 |
| 216 | 3300025929 | Ga0207664_10074274 | Ga0207664_100742742 | 200 |
| 217 | 3300006028 | Ga0070717_10005442 | Ga0070717_100054424 | 201 |
| 218 | 3300021441 | Ga0213871_10088726 | Ga0213871_100887261 | 201 |
| 219 | 3300036401 | Ga0373937_0561488 | Ga0373937_0561488_154_786 | 201 |
| 220 | 3300039438 | Ga0436360_0517554 | Ga0436360_0517554_76_702 | 201 |
| 221 | 3300045051 | Ga0451576_0170681 | Ga0451576_0170681_904_1530 | 201 |
| 222 | 3300006173 | Ga0070716_100263214 | Ga0070716_1002632142 | 203 |
| 223 | 3300025939 | Ga0207665_10295494 | Ga0207665_102954942 | 203 |
| 224 | 3300046660 | Ga0495625_0000571 | Ga0495625_0000571_9648_10298 | 204 |
| 225 | 3300027695 | Ga0209966_1006354 | Ga0209966_10063544 | 205 |
| 226 | 3300000546 | LJNas_1001663 | LJNas_10016633 | 206 |
| 227 | 3300005468 | Ga0070707_100427786 | Ga0070707_1004277862 | 206 |
| 228 | 3300005518 | Ga0070699_100001097 | Ga0070699_1000010972 | 206 |
| 229 | 3300005536 | Ga0070697_100232296 | Ga0070697_1002322961 | 206 |
| 230 | 3300025910 | Ga0207684_10007499 | Ga0207684_100074996 | 206 |
| 231 | 3300025922 | Ga0207646_10001171 | Ga0207646_1000117128 | 206 |
| 232 | 3300025928 | Ga0207700_10704173 | Ga0207700_107041731 | 206 |
| 233 | 3300030879 | Ga0265765_1003260 | Ga0265765_10032601 | 206 |
| 234 | 3300031090 | Ga0265760_10012217 | Ga0265760_100122172 | 206 |
| 235 | 3300002074 | JGI24748J21848_1004860 | JGI24748J21848_10048603 | 207 |
| 236 | 3300005329 | Ga0070683_100004265 | Ga0070683_1000042656 | 207 |
| 237 | 3300005329 | Ga0070683_100105372 | Ga0070683_1001053723 | 207 |
| 238 | 3300005330 | Ga0070690_100005060 | Ga0070690_1000050603 | 207 |
| 239 | 3300005331 | Ga0070670_100006784 | Ga0070670_1000067848 | 207 |
| 240 | 3300005335 | Ga0070666_10040737 | Ga0070666_100407374 | 207 |
| 241 | 3300005336 | Ga0070680_100285882 | Ga0070680_1002858822 | 207 |
| 242 | 3300005337 | Ga0070682_100008130 | Ga0070682_1000081304 | 207 |
| 243 | 3300005338 | Ga0068868_100002026 | Ga0068868_1000020268 | 207 |
| 244 | 3300005338 | Ga0068868_100019739 | Ga0068868_1000197392 | 207 |
| 245 | 3300005339 | Ga0070660_100006065 | Ga0070660_10000606510 | 207 |
| 246 | 3300005343 | Ga0070687_100142822 | Ga0070687_1001428222 | 207 |
| 247 | 3300005344 | Ga0070661_100001267 | Ga0070661_1000012676 | 207 |
| 248 | 3300005347 | Ga0070668_100005814 | Ga0070668_1000058148 | 207 |
| 249 | 3300005347 | Ga0070668_100067915 | Ga0070668_1000679151 | 207 |
| 250 | 3300005355 | Ga0070671_100262621 | Ga0070671_1002626211 | 207 |
| 251 | 3300005356 | Ga0070674_100006696 | Ga0070674_1000066963 | 207 |
| 252 | 3300005364 | Ga0070673_100001501 | Ga0070673_1000015013 | 207 |
| 253 | 3300005366 | Ga0070659_100037926 | Ga0070659_1000379264 | 207 |
| 254 | 3300005367 | Ga0070667_100560020 | Ga0070667_1005600202 | 207 |
| 255 | 3300005434 | Ga0070709_10535131 | Ga0070709_105351311 | 207 |
| 256 | 3300005435 | Ga0070714_100016644 | Ga0070714_1000166443 | 207 |
| 257 | 3300005435 | Ga0070714_100080762 | Ga0070714_1000807624 | 207 |
| 258 | 3300005435 | Ga0070714_100468304 | Ga0070714_1004683042 | 207 |
| 259 | 3300005436 | Ga0070713_100005635 | Ga0070713_1000056357 | 207 |
| 260 | 3300005436 | Ga0070713_100013379 | Ga0070713_1000133792 | 207 |
| 261 | 3300005439 | Ga0070711_100001964 | Ga0070711_1000019648 | 207 |
| 262 | 3300005439 | Ga0070711_100166528 | Ga0070711_1001665282 | 207 |
| 263 | 3300005440 | Ga0070705_100102487 | Ga0070705_1001024872 | 207 |
| 264 | 3300005445 | Ga0070708_100003650 | Ga0070708_1000036504 | 207 |
| 265 | 3300005455 | Ga0070663_100002712 | Ga0070663_1000027126 | 207 |
| 266 | 3300005456 | Ga0070678_100022680 | Ga0070678_1000226804 | 207 |
| 267 | 3300005457 | Ga0070662_100015183 | Ga0070662_1000151835 | 207 |
| 268 | 3300005467 | Ga0070706_100001186 | Ga0070706_10000118614 | 207 |
| 269 | 3300005467 | Ga0070706_100173048 | Ga0070706_1001730484 | 207 |
| 270 | 3300005468 | Ga0070707_100170263 | Ga0070707_1001702631 | 207 |
| 271 | 3300005468 | Ga0070707_100202869 | Ga0070707_1002028692 | 207 |
| 272 | 3300005471 | Ga0070698_100013035 | Ga0070698_10001303510 | 207 |
| 273 | 3300005536 | Ga0070697_100000353 | Ga0070697_10000035317 | 207 |
| 274 | 3300005539 | Ga0068853_100094337 | Ga0068853_1000943372 | 207 |
| 275 | 3300005543 | Ga0070672_100016320 | Ga0070672_1000163205 | 207 |
| 276 | 3300005544 | Ga0070686_100029896 | Ga0070686_1000298963 | 207 |
| 277 | 3300005546 | Ga0070696_100021981 | Ga0070696_1000219814 | 207 |
| 278 | 3300005546 | Ga0070696_100118457 | Ga0070696_1001184573 | 207 |
| 279 | 3300005546 | Ga0070696_100118652 | Ga0070696_1001186523 | 207 |
| 280 | 3300005547 | Ga0070693_100328840 | Ga0070693_1003288401 | 207 |
| 281 | 3300005548 | Ga0070665_100004403 | Ga0070665_1000044034 | 207 |
| 282 | 3300005548 | Ga0070665_100599578 | Ga0070665_1005995782 | 207 |
| 283 | 3300005549 | Ga0070704_100617549 | Ga0070704_1006175491 | 207 |
| 284 | 3300005563 | Ga0068855_100089317 | Ga0068855_1000893173 | 207 |
| 285 | 3300005563 | Ga0068855_100141947 | Ga0068855_1001419473 | 207 |
| 286 | 3300005564 | Ga0070664_100051695 | Ga0070664_1000516953 | 207 |
| 287 | 3300005564 | Ga0070664_100072469 | Ga0070664_1000724692 | 207 |
| 288 | 3300005577 | Ga0068857_100007012 | Ga0068857_1000070126 | 207 |
| 289 | 3300005577 | Ga0068857_100030777 | Ga0068857_1000307773 | 207 |
| 290 | 3300005578 | Ga0068854_100019834 | Ga0068854_1000198344 | 207 |
| 291 | 3300005578 | Ga0068854_100024465 | Ga0068854_1000244656 | 207 |
| 292 | 3300005614 | Ga0068856_100019487 | Ga0068856_1000194874 | 207 |
| 293 | 3300005614 | Ga0068856_100042725 | Ga0068856_1000427254 | 207 |
| 294 | 3300005616 | Ga0068852_100019826 | Ga0068852_1000198263 | 207 |
| 295 | 3300005617 | Ga0068859_100002574 | Ga0068859_1000025743 | 207 |
| 296 | 3300005617 | Ga0068859_100172492 | Ga0068859_1001724922 | 207 |
| 297 | 3300005618 | Ga0068864_100036809 | Ga0068864_1000368096 | 207 |
| 298 | 3300005718 | Ga0068866_10002717 | Ga0068866_100027175 | 207 |
| 299 | 3300005834 | Ga0068851_10007348 | Ga0068851_100073484 | 207 |
| 300 | 3300005840 | Ga0068870_10015186 | Ga0068870_100151862 | 207 |
| 301 | 3300005841 | Ga0068863_100330661 | Ga0068863_1003306613 | 207 |
| 302 | 3300005842 | Ga0068858_100018785 | Ga0068858_1000187854 | 207 |
| 303 | 3300005842 | Ga0068858_100051233 | Ga0068858_1000512334 | 207 |
| 304 | 3300005843 | Ga0068860_100338348 | Ga0068860_1003383482 | 207 |
| 305 | 3300005844 | Ga0068862_100017838 | Ga0068862_1000178387 | 207 |
| 306 | 3300005844 | Ga0068862_100020812 | Ga0068862_1000208124 | 207 |
| 307 | 3300005844 | Ga0068862_100076645 | Ga0068862_1000766452 | 207 |
| 308 | 3300006028 | Ga0070717_10001372 | Ga0070717_100013724 | 207 |
| 309 | 3300006028 | Ga0070717_10023154 | Ga0070717_100231545 | 207 |
| 310 | 3300006028 | Ga0070717_10037031 | Ga0070717_100370314 | 207 |
| 311 | 3300006028 | Ga0070717_10057743 | Ga0070717_100577435 | 207 |
| 312 | 3300006028 | Ga0070717_10282760 | Ga0070717_102827603 | 207 |
| 313 | 3300006163 | Ga0070715_10225387 | Ga0070715_102253872 | 207 |
| 314 | 3300006173 | Ga0070716_100003475 | Ga0070716_1000034755 | 207 |
| 315 | 3300006173 | Ga0070716_100021185 | Ga0070716_1000211854 | 207 |
| 316 | 3300006173 | Ga0070716_100114679 | Ga0070716_1001146793 | 207 |
| 317 | 3300006175 | Ga0070712_100035393 | Ga0070712_1000353934 | 207 |
| 318 | 3300006237 | Ga0097621_100005323 | Ga0097621_1000053234 | 207 |
| 319 | 3300006237 | Ga0097621_100009628 | Ga0097621_1000096283 | 207 |
| 320 | 3300006237 | Ga0097621_100251479 | Ga0097621_1002514792 | 207 |
| 321 | 3300006358 | Ga0068871_100087565 | Ga0068871_1000875654 | 207 |
| 322 | 3300006358 | Ga0068871_100107485 | Ga0068871_1001074853 | 207 |
| 323 | 3300006358 | Ga0068871_100240643 | Ga0068871_1002406432 | 207 |
| 324 | 3300006881 | Ga0068865_100023722 | Ga0068865_1000237225 | 207 |
| 325 | 3300006914 | Ga0075436_100002566 | Ga0075436_10000256613 | 207 |
| 326 | 3300006914 | Ga0075436_100083301 | Ga0075436_1000833013 | 207 |
| 327 | 3300006931 | Ga0097620_100002574 | Ga0097620_1000025743 | 207 |
| 328 | 3300006931 | Ga0097620_100172484 | Ga0097620_1001724842 | 207 |
| 329 | 3300007076 | Ga0075435_100297163 | Ga0075435_1002971632 | 207 |
| 330 | 3300007265 | Ga0099794_10020087 | Ga0099794_100200873 | 207 |
| 331 | 3300009093 | Ga0105240_10059592 | Ga0105240_100595924 | 207 |
| 332 | 3300009098 | Ga0105245_10092535 | Ga0105245_100925354 | 207 |
| 333 | 3300009098 | Ga0105245_10249019 | Ga0105245_102490192 | 207 |
| 334 | 3300009101 | Ga0105247_10003382 | Ga0105247_100033826 | 207 |
| 335 | 3300009101 | Ga0105247_10007088 | Ga0105247_100070886 | 207 |
| 336 | 3300009101 | Ga0105247_10081606 | Ga0105247_100816062 | 207 |
| 337 | 3300009148 | Ga0105243_10114212 | Ga0105243_101142123 | 207 |
| 338 | 3300009174 | Ga0105241_10016466 | Ga0105241_100164662 | 207 |
| 339 | 3300009174 | Ga0105241_10033908 | Ga0105241_100339083 | 207 |
| 340 | 3300009174 | Ga0105241_10111525 | Ga0105241_101115252 | 207 |
| 341 | 3300009174 | Ga0105241_10196119 | Ga0105241_101961191 | 207 |
| 342 | 3300009176 | Ga0105242_10017634 | Ga0105242_100176346 | 207 |
| 343 | 3300009176 | Ga0105242_10024113 | Ga0105242_100241134 | 207 |
| 344 | 3300009176 | Ga0105242_10430487 | Ga0105242_104304872 | 207 |
| 345 | 3300009177 | Ga0105248_10166896 | Ga0105248_101668963 | 207 |
| 346 | 3300009545 | Ga0105237_10023675 | Ga0105237_100236754 | 207 |
| 347 | 3300009545 | Ga0105237_10261227 | Ga0105237_102612273 | 207 |
| 348 | 3300009551 | Ga0105238_10103856 | Ga0105238_101038562 | 207 |
| 349 | 3300009553 | Ga0105249_10007882 | Ga0105249_100078828 | 207 |
| 350 | 3300009553 | Ga0105249_10042627 | Ga0105249_100426273 | 207 |
| 351 | 3300010375 | Ga0105239_10025677 | Ga0105239_100256773 | 207 |
| 352 | 3300010375 | Ga0105239_10357982 | Ga0105239_103579823 | 207 |
| 353 | 3300010375 | Ga0105239_10681252 | Ga0105239_106812522 | 207 |
| 354 | 3300011119 | Ga0105246_10001225 | Ga0105246_1000122514 | 207 |
| 355 | 3300011119 | Ga0105246_10014314 | Ga0105246_100143143 | 207 |
| 356 | 3300013100 | Ga0157373_10027170 | Ga0157373_100271703 | 207 |
| 357 | 3300013102 | Ga0157371_10007268 | Ga0157371_100072683 | 207 |
| 358 | 3300013102 | Ga0157371_10008322 | Ga0157371_100083224 | 207 |
| 359 | 3300013105 | Ga0157369_10022554 | Ga0157369_100225548 | 207 |
| 360 | 3300013296 | Ga0157374_10003439 | Ga0157374_100034396 | 207 |
| 361 | 3300013296 | Ga0157374_10381540 | Ga0157374_103815402 | 207 |
| 362 | 3300013296 | Ga0157374_10459018 | Ga0157374_104590182 | 207 |
| 363 | 3300013296 | Ga0157374_10533625 | Ga0157374_105336252 | 207 |
| 364 | 3300013297 | Ga0157378_10121398 | Ga0157378_101213982 | 207 |
| 365 | 3300013306 | Ga0163162_10008790 | Ga0163162_100087905 | 207 |
| 366 | 3300013306 | Ga0163162_10013645 | Ga0163162_100136454 | 207 |
| 367 | 3300013306 | Ga0163162_10068095 | Ga0163162_100680952 | 207 |
| 368 | 3300013306 | Ga0163162_10144719 | Ga0163162_101447192 | 207 |
| 369 | 3300013307 | Ga0157372_10004725 | Ga0157372_1000472514 | 207 |
| 370 | 3300013307 | Ga0157372_10019084 | Ga0157372_100190844 | 207 |
| 371 | 3300013307 | Ga0157372_10065584 | Ga0157372_100655844 | 207 |
| 372 | 3300013307 | Ga0157372_10154041 | Ga0157372_101540413 | 207 |
| 373 | 3300013308 | Ga0157375_10050921 | Ga0157375_100509213 | 207 |
| 374 | 3300013308 | Ga0157375_10080633 | Ga0157375_100806333 | 207 |
| 375 | 3300013308 | Ga0157375_10646634 | Ga0157375_106466342 | 207 |
| 376 | 3300014325 | Ga0163163_10000595 | Ga0163163_1000059528 | 207 |
| 377 | 3300014325 | Ga0163163_10008436 | Ga0163163_100084365 | 207 |
| 378 | 3300014325 | Ga0163163_10076653 | Ga0163163_100766535 | 207 |
| 379 | 3300014745 | Ga0157377_10001292 | Ga0157377_100012923 | 207 |
| 380 | 3300014968 | Ga0157379_10003837 | Ga0157379_1000383711 | 207 |
| 381 | 3300014968 | Ga0157379_10009864 | Ga0157379_100098646 | 207 |
| 382 | 3300014968 | Ga0157379_10206870 | Ga0157379_102068703 | 207 |
| 383 | 3300014969 | Ga0157376_10029983 | Ga0157376_100299833 | 207 |
| 384 | 3300014969 | Ga0157376_10129367 | Ga0157376_101293671 | 207 |
| 385 | 3300014969 | Ga0157376_10687946 | Ga0157376_106879462 | 207 |
| 386 | 3300017792 | Ga0163161_10002771 | Ga0163161_100027715 | 207 |
| 387 | 3300022732 | Ga0224569_100267 | Ga0224569_1002674 | 207 |
| 388 | 3300024225 | Ga0224572_1000996 | Ga0224572_10009962 | 207 |
| 389 | 3300024227 | Ga0228598_1000850 | Ga0228598_10008502 | 207 |
| 390 | 3300024227 | Ga0228598_1006462 | Ga0228598_10064621 | 207 |
| 391 | 3300025321 | Ga0207656_10005405 | Ga0207656_100054054 | 207 |
| 392 | 3300025893 | Ga0207682_10167585 | Ga0207682_101675852 | 207 |
| 393 | 3300025900 | Ga0207710_10094019 | Ga0207710_100940192 | 207 |
| 394 | 3300025901 | Ga0207688_10006690 | Ga0207688_100066902 | 207 |
| 395 | 3300025903 | Ga0207680_10002514 | Ga0207680_100025144 | 207 |
| 396 | 3300025904 | Ga0207647_10064322 | Ga0207647_100643222 | 207 |
| 397 | 3300025905 | Ga0207685_10087108 | Ga0207685_100871082 | 207 |
| 398 | 3300025907 | Ga0207645_10000273 | Ga0207645_1000027334 | 207 |
| 399 | 3300025907 | Ga0207645_10009069 | Ga0207645_100090695 | 207 |
| 400 | 3300025908 | Ga0207643_10006633 | Ga0207643_100066336 | 207 |
| 401 | 3300025910 | Ga0207684_10189169 | Ga0207684_101891693 | 207 |
| 402 | 3300025910 | Ga0207684_10269505 | Ga0207684_102695052 | 207 |
| 403 | 3300025910 | Ga0207684_10279082 | Ga0207684_102790822 | 207 |
| 404 | 3300025911 | Ga0207654_10002570 | Ga0207654_1000257011 | 207 |
| 405 | 3300025911 | Ga0207654_10013790 | Ga0207654_100137904 | 207 |
| 406 | 3300025911 | Ga0207654_10076885 | Ga0207654_100768853 | 207 |
| 407 | 3300025912 | Ga0207707_10276716 | Ga0207707_102767161 | 207 |
| 408 | 3300025913 | Ga0207695_10004625 | Ga0207695_1000462510 | 207 |
| 409 | 3300025913 | Ga0207695_10025559 | Ga0207695_100255592 | 207 |
| 410 | 3300025914 | Ga0207671_10029651 | Ga0207671_100296514 | 207 |
| 411 | 3300025914 | Ga0207671_10295368 | Ga0207671_102953682 | 207 |
| 412 | 3300025915 | Ga0207693_10011894 | Ga0207693_100118947 | 207 |
| 413 | 3300025916 | Ga0207663_10083785 | Ga0207663_100837853 | 207 |
| 414 | 3300025916 | Ga0207663_10787518 | Ga0207663_107875181 | 207 |
| 415 | 3300025918 | Ga0207662_10011456 | Ga0207662_100114565 | 207 |
| 416 | 3300025918 | Ga0207662_10152871 | Ga0207662_101528712 | 207 |
| 417 | 3300025919 | Ga0207657_10002319 | Ga0207657_1000231916 | 207 |
| 418 | 3300025919 | Ga0207657_10010598 | Ga0207657_100105986 | 207 |
| 419 | 3300025920 | Ga0207649_10003871 | Ga0207649_100038717 | 207 |
| 420 | 3300025923 | Ga0207681_10009802 | Ga0207681_100098025 | 207 |
| 421 | 3300025924 | Ga0207694_10048076 | Ga0207694_100480762 | 207 |
| 422 | 3300025924 | Ga0207694_10064323 | Ga0207694_100643234 | 207 |
| 423 | 3300025925 | Ga0207650_10000036 | Ga0207650_1000003645 | 207 |
| 424 | 3300025925 | Ga0207650_10899346 | Ga0207650_108993461 | 207 |
| 425 | 3300025926 | Ga0207659_10023383 | Ga0207659_100233835 | 207 |
| 426 | 3300025927 | Ga0207687_10011597 | Ga0207687_100115973 | 207 |
| 427 | 3300025927 | Ga0207687_10019765 | Ga0207687_100197654 | 207 |
| 428 | 3300025927 | Ga0207687_10155287 | Ga0207687_101552872 | 207 |
| 429 | 3300025927 | Ga0207687_10542550 | Ga0207687_105425502 | 207 |
| 430 | 3300025928 | Ga0207700_10005478 | Ga0207700_100054783 | 207 |
| 431 | 3300025929 | Ga0207664_10011150 | Ga0207664_100111506 | 207 |
| 432 | 3300025931 | Ga0207644_10022145 | Ga0207644_100221453 | 207 |
| 433 | 3300025932 | Ga0207690_10013794 | Ga0207690_100137944 | 207 |
| 434 | 3300025933 | Ga0207706_10000165 | Ga0207706_1000016561 | 207 |
| 435 | 3300025933 | Ga0207706_10008281 | Ga0207706_100082816 | 207 |
| 436 | 3300025934 | Ga0207686_10014823 | Ga0207686_100148236 | 207 |
| 437 | 3300025934 | Ga0207686_10197194 | Ga0207686_101971942 | 207 |
| 438 | 3300025935 | Ga0207709_10032709 | Ga0207709_100327094 | 207 |
| 439 | 3300025936 | Ga0207670_10087390 | Ga0207670_100873903 | 207 |
| 440 | 3300025938 | Ga0207704_10022377 | Ga0207704_100223774 | 207 |
| 441 | 3300025939 | Ga0207665_10004799 | Ga0207665_100047994 | 207 |
| 442 | 3300025939 | Ga0207665_10165295 | Ga0207665_101652952 | 207 |
| 443 | 3300025940 | Ga0207691_10012527 | Ga0207691_100125275 | 207 |
| 444 | 3300025941 | Ga0207711_10002093 | Ga0207711_1000209318 | 207 |
| 445 | 3300025941 | Ga0207711_10012064 | Ga0207711_100120644 | 207 |
| 446 | 3300025941 | Ga0207711_10174258 | Ga0207711_101742582 | 207 |
| 447 | 3300025942 | Ga0207689_10025271 | Ga0207689_100252714 | 207 |
| 448 | 3300025944 | Ga0207661_10518080 | Ga0207661_105180801 | 207 |
| 449 | 3300025945 | Ga0207679_10007222 | Ga0207679_100072225 | 207 |
| 450 | 3300025945 | Ga0207679_10013609 | Ga0207679_100136094 | 207 |
| 451 | 3300025949 | Ga0207667_10002616 | Ga0207667_1000261620 | 207 |
| 452 | 3300025949 | Ga0207667_10067545 | Ga0207667_100675453 | 207 |
| 453 | 3300025960 | Ga0207651_10005431 | Ga0207651_100054315 | 207 |
| 454 | 3300025972 | Ga0207668_10010385 | Ga0207668_100103854 | 207 |
| 455 | 3300025972 | Ga0207668_10057446 | Ga0207668_100574462 | 207 |
| 456 | 3300025981 | Ga0207640_10014822 | Ga0207640_100148222 | 207 |
| 457 | 3300025981 | Ga0207640_10043454 | Ga0207640_100434543 | 207 |
| 458 | 3300025986 | Ga0207658_10014425 | Ga0207658_100144255 | 207 |
| 459 | 3300025986 | Ga0207658_10120941 | Ga0207658_101209413 | 207 |
| 460 | 3300026023 | Ga0207677_10002758 | Ga0207677_100027586 | 207 |
| 461 | 3300026023 | Ga0207677_10061860 | Ga0207677_100618603 | 207 |
| 462 | 3300026035 | Ga0207703_10158650 | Ga0207703_101586503 | 207 |
| 463 | 3300026035 | Ga0207703_10246162 | Ga0207703_102461622 | 207 |
| 464 | 3300026067 | Ga0207678_10001477 | Ga0207678_100014776 | 207 |
| 465 | 3300026067 | Ga0207678_10006194 | Ga0207678_100061945 | 207 |
| 466 | 3300026078 | Ga0207702_10042012 | Ga0207702_100420122 | 207 |
| 467 | 3300026078 | Ga0207702_10198529 | Ga0207702_101985293 | 207 |
| 468 | 3300026088 | Ga0207641_10000009 | Ga0207641_1000000961 | 207 |
| 469 | 3300026088 | Ga0207641_10175245 | Ga0207641_101752452 | 207 |
| 470 | 3300026089 | Ga0207648_10000326 | Ga0207648_1000032613 | 207 |
| 471 | 3300026095 | Ga0207676_10000092 | Ga0207676_100000927 | 207 |
| 472 | 3300026116 | Ga0207674_10000016 | Ga0207674_10000016127 | 207 |
| 473 | 3300026116 | Ga0207674_10068835 | Ga0207674_100688354 | 207 |
| 474 | 3300026121 | Ga0207683_10000359 | Ga0207683_1000035934 | 207 |
| 475 | 3300026142 | Ga0207698_10065753 | Ga0207698_100657534 | 207 |
| 476 | 3300026142 | Ga0207698_10424828 | Ga0207698_104248282 | 207 |
| 477 | 3300028379 | Ga0268266_10032227 | Ga0268266_100322274 | 207 |
| 478 | 3300028379 | Ga0268266_10074112 | Ga0268266_100741123 | 207 |
| 479 | 3300028379 | Ga0268266_11056269 | Ga0268266_110562691 | 207 |
| 480 | 3300028380 | Ga0268265_10185706 | Ga0268265_101857063 | 207 |
| 481 | 3300028380 | Ga0268265_10232062 | Ga0268265_102320622 | 207 |
| 482 | 3300028381 | Ga0268264_10018752 | Ga0268264_100187522 | 207 |
| 483 | 3300030760 | Ga0265762_1000876 | Ga0265762_10008765 | 207 |
| 484 | 3300031090 | Ga0265760_10000115 | Ga0265760_1000011515 | 207 |
| 485 | 3300031712 | Ga0265342_10102944 | Ga0265342_101029443 | 207 |
| 486 | 3300035083 | Ga0373926_0025305 | Ga0373926_0025305_163_786 | 207 |
| 487 | 3300035112 | Ga0373932_0034487 | Ga0373932_0034487_346_969 | 207 |
| 488 | 3300035113 | Ga0373936_0014608 | Ga0373936_0014608_1877_2500 | 207 |
| 489 | 3300035170 | Ga0373943_0014495 | Ga0373943_0014495_1032_1655 | 207 |
| 490 | 3300035691 | Ga0373931_0022342 | Ga0373931_0022342_2219_2842 | 207 |
| 491 | 3300035691 | Ga0373931_0030429 | Ga0373931_0030429_582_1205 | 207 |
| 492 | 3300035692 | Ga0373935_0011877 | Ga0373935_0011877_2383_3006 | 207 |
| 493 | 3300035692 | Ga0373935_0130922 | Ga0373935_0130922_187_810 | 207 |
| 494 | 3300035695 | Ga0373927_0042338 | Ga0373927_0042338_698_1321 | 207 |
| 495 | 3300035724 | Ga0373933_0170947 | Ga0373933_0170947_613_1236 | 207 |
| 496 | 3300035724 | Ga0373933_0180862 | Ga0373933_0180862_294_917 | 207 |
| 497 | 3300035725 | Ga0373947_0009012 | Ga0373947_0009012_2544_3167 | 207 |
| 498 | 3300036401 | Ga0373937_0163615 | Ga0373937_0163615_447_1091 | 207 |
| 499 | 3300036401 | Ga0373937_0440844 | Ga0373937_0440844_126_749 | 207 |
| 500 | 3300036401 | Ga0373937_0573281 | Ga0373937_0573281_20_664 | 207 |
| 501 | 3300037068 | Ga0373925_0010044 | Ga0373925_0010044_4378_5001 | 207 |
| 502 | 3300037068 | Ga0373925_0188415 | Ga0373925_0188415_827_1450 | 207 |
| 503 | 3300039450 | Ga0436363_0859318 | Ga0436363_0859318_878_1501 | 207 |
| 504 | 3300042005 | Ga0439448_0076326 | Ga0439448_0076326_61_684 | 207 |
| 505 | 3300045051 | Ga0451576_0332666 | Ga0451576_0332666_21_644 | 207 |
| 506 | 3300045976 | Ga0466967_0009313 | Ga0466967_0009313_5549_6223 | 207 |
| 507 | 3300046472 | Ga0495580_0006948 | Ga0495580_0006948_2178_2801 | 207 |
| 508 | 3300046472 | Ga0495580_0010147 | Ga0495580_0010147_1247_1870 | 207 |
| 509 | 3300046473 | Ga0495582_0003159 | Ga0495582_0003159_5931_6554 | 207 |
| 510 | 3300046531 | Ga0495665_0001183 | Ga0495665_0001183_3954_4577 | 207 |
| 511 | 3300046663 | Ga0495635_0220685 | Ga0495635_0220685_581_1204 | 207 |
| 512 | 3300046679 | Ga0495623_0097929 | Ga0495623_0097929_661_1284 | 207 |
| 513 | 3300046683 | Ga0495658_0052261 | Ga0495658_0052261_1246_1869 | 207 |
| 514 | 3300046684 | Ga0495669_0080479 | Ga0495669_0080479_797_1420 | 207 |
| 515 | 3300047471 | Ga0495684_0407606 | Ga0495684_0407606_112_735 | 207 |
| 516 | 3300048088 | Ga0495602_0152229 | Ga0495602_0152229_1147_1770 | 207 |
| 517 | 3300048903 | Ga0496100_0091545 | Ga0496100_0091545_459_1082 | 207 |
| 518 | 3300048903 | Ga0496100_0097159 | Ga0496100_0097159_91_714 | 207 |
| 519 | 3300048903 | Ga0496100_0128813 | Ga0496100_0128813_528_1151 | 207 |
| 520 | 3300048904 | Ga0496101_0038318 | Ga0496101_0038318_1268_1891 | 207 |
| 521 | 3300048904 | Ga0496101_0468688 | Ga0496101_0468688_279_902 | 207 |
| 522 | 3300048905 | Ga0496102_0004659 | Ga0496102_0004659_6103_6726 | 207 |
| 523 | 3300048905 | Ga0496102_0034222 | Ga0496102_0034222_1604_2227 | 207 |
| 524 | 3300048905 | Ga0496102_0404013 | Ga0496102_0404013_469_1092 | 207 |
| 525 | 3300048906 | Ga0496103_0000974 | Ga0496103_0000974_303_926 | 207 |
| 526 | 3300048906 | Ga0496103_0068110 | Ga0496103_0068110_1163_1786 | 207 |
| 527 | 3300048907 | Ga0496104_0039109 | Ga0496104_0039109_40_663 | 207 |
| 528 | 3300048907 | Ga0496104_0083008 | Ga0496104_0083008_2345_2968 | 207 |
| 529 | 3300048907 | Ga0496104_0179604 | Ga0496104_0179604_396_1019 | 207 |
| 530 | 3300048907 | Ga0496104_0190016 | Ga0496104_0190016_762_1385 | 207 |
| 531 | 3300048907 | Ga0496104_1087585 | Ga0496104_1087585_21_656 | 207 |
| 532 | 3300048908 | Ga0496105_0337293 | Ga0496105_0337293_165_788 | 207 |
| 533 | 3300048908 | Ga0496105_0608680 | Ga0496105_0608680_88_711 | 207 |
| 534 | 3300048909 | Ga0496106_0266486 | Ga0496106_0266486_703_1326 | 207 |
| 535 | 3300048909 | Ga0496106_0286723 | Ga0496106_0286723_325_948 | 207 |
| 536 | 3300048910 | Ga0496107_0051119 | Ga0496107_0051119_91_714 | 207 |
| 537 | 3300048910 | Ga0496107_0136383 | Ga0496107_0136383_39_662 | 207 |
| 538 | 3300048911 | Ga0496108_0017665 | Ga0496108_0017665_381_1004 | 207 |
| 539 | 3300048911 | Ga0496108_0888696 | Ga0496108_0888696_81_704 | 207 |
| 540 | 3300048912 | Ga0496109_0000524 | Ga0496109_0000524_8142_8765 | 207 |
| 541 | 3300048912 | Ga0496109_0062942 | Ga0496109_0062942_2740_3363 | 207 |
| 542 | 3300048913 | Ga0496110_0001679 | Ga0496110_0001679_12371_12994 | 207 |
| 543 | 3300048914 | Ga0496111_0046363 | Ga0496111_0046363_2398_3021 | 207 |
| 544 | 3300048915 | Ga0496112_0000645 | Ga0496112_0000645_14256_14879 | 207 |
| 545 | 3300048915 | Ga0496112_0020118 | Ga0496112_0020118_2244_2879 | 207 |
| 546 | 3300048915 | Ga0496112_0475784 | Ga0496112_0475784_348_971 | 207 |
| 547 | 3300048916 | Ga0496113_0016848 | Ga0496113_0016848_996_1619 | 207 |
| 548 | 3300048917 | Ga0496114_0077357 | Ga0496114_0077357_325_948 | 207 |
| 549 | 3300048918 | Ga0496115_0027517 | Ga0496115_0027517_2110_2733 | 207 |
| 550 | 3300050513 | nmdc:mga0rr50_362294_c1 | nmdc:mga0rr50_362294_c1_98_721 | 207 |
| 551 | 3300050514 | nmdc:mga08x19_52431_c1 | nmdc:mga08x19_52431_c1_196_819 | 207 |
| 552 | 3300053085 | Ga0495619_0127146 | Ga0495619_0127146_222_845 | 207 |
| 553 | 2162886012 | MBSR1b_contig_2357773 | MBSR1b_0144.00000530 | 208 |
| 554 | 2162886012 | MBSR1b_contig_4104914 | MBSR1b_0130.00002630 | 208 |
| 555 | 3300005293 | Ga0065715_10011916 | Ga0065715_100119164 | 208 |
| 556 | 3300005327 | Ga0070658_10252225 | Ga0070658_102522253 | 208 |
| 557 | 3300005329 | Ga0070683_100171020 | Ga0070683_1001710202 | 208 |
| 558 | 3300005331 | Ga0070670_100194738 | Ga0070670_1001947382 | 208 |
| 559 | 3300005337 | Ga0070682_100052488 | Ga0070682_1000524882 | 208 |
| 560 | 3300005338 | Ga0068868_100295824 | Ga0068868_1002958241 | 208 |
| 561 | 3300005339 | Ga0070660_100060293 | Ga0070660_1000602935 | 208 |
| 562 | 3300005344 | Ga0070661_100167188 | Ga0070661_1001671881 | 208 |
| 563 | 3300005354 | Ga0070675_100739173 | Ga0070675_1007391732 | 208 |
| 564 | 3300005355 | Ga0070671_100824051 | Ga0070671_1008240511 | 208 |
| 565 | 3300005434 | Ga0070709_10076720 | Ga0070709_100767202 | 208 |
| 566 | 3300005434 | Ga0070709_10079037 | Ga0070709_100790373 | 208 |
| 567 | 3300005434 | Ga0070709_10204821 | Ga0070709_102048212 | 208 |
| 568 | 3300005435 | Ga0070714_100182619 | Ga0070714_1001826192 | 208 |
| 569 | 3300005435 | Ga0070714_100447572 | Ga0070714_1004475722 | 208 |
| 570 | 3300005436 | Ga0070713_100027072 | Ga0070713_1000270723 | 208 |
| 571 | 3300005437 | Ga0070710_10150299 | Ga0070710_101502992 | 208 |
| 572 | 3300005439 | Ga0070711_100022258 | Ga0070711_1000222582 | 208 |
| 573 | 3300005439 | Ga0070711_100028655 | Ga0070711_1000286555 | 208 |
| 574 | 3300005445 | Ga0070708_100002464 | Ga0070708_1000024643 | 208 |
| 575 | 3300005445 | Ga0070708_100007742 | Ga0070708_1000077427 | 208 |
| 576 | 3300005445 | Ga0070708_100078771 | Ga0070708_1000787714 | 208 |
| 577 | 3300005445 | Ga0070708_100285794 | Ga0070708_1002857942 | 208 |
| 578 | 3300005445 | Ga0070708_100628969 | Ga0070708_1006289692 | 208 |
| 579 | 3300005445 | Ga0070708_100706516 | Ga0070708_1007065161 | 208 |
| 580 | 3300005457 | Ga0070662_100165504 | Ga0070662_1001655042 | 208 |
| 581 | 3300005458 | Ga0070681_10212150 | Ga0070681_102121501 | 208 |
| 582 | 3300005467 | Ga0070706_100001941 | Ga0070706_10000194115 | 208 |
| 583 | 3300005467 | Ga0070706_100044540 | Ga0070706_1000445401 | 208 |
| 584 | 3300005467 | Ga0070706_100469537 | Ga0070706_1004695372 | 208 |
| 585 | 3300005468 | Ga0070707_100001843 | Ga0070707_1000018437 | 208 |
| 586 | 3300005468 | Ga0070707_100196285 | Ga0070707_1001962852 | 208 |
| 587 | 3300005468 | Ga0070707_100234615 | Ga0070707_1002346153 | 208 |
| 588 | 3300005468 | Ga0070707_100895892 | Ga0070707_1008958921 | 208 |
| 589 | 3300005471 | Ga0070698_100000758 | Ga0070698_10000075835 | 208 |
| 590 | 3300005471 | Ga0070698_100019235 | Ga0070698_1000192355 | 208 |
| 591 | 3300005518 | Ga0070699_100012112 | Ga0070699_1000121123 | 208 |
| 592 | 3300005518 | Ga0070699_100183301 | Ga0070699_1001833012 | 208 |
| 593 | 3300005518 | Ga0070699_100184504 | Ga0070699_1001845043 | 208 |
| 594 | 3300005530 | Ga0070679_100169328 | Ga0070679_1001693281 | 208 |
| 595 | 3300005536 | Ga0070697_100000107 | Ga0070697_10000010724 | 208 |
| 596 | 3300005536 | Ga0070697_100011022 | Ga0070697_1000110227 | 208 |
| 597 | 3300005536 | Ga0070697_100021934 | Ga0070697_1000219342 | 208 |
| 598 | 3300005536 | Ga0070697_100041359 | Ga0070697_1000413594 | 208 |
| 599 | 3300005536 | Ga0070697_100195106 | Ga0070697_1001951061 | 208 |
| 600 | 3300005536 | Ga0070697_100478484 | Ga0070697_1004784842 | 208 |
| 601 | 3300005545 | Ga0070695_100030579 | Ga0070695_1000305795 | 208 |
| 602 | 3300005546 | Ga0070696_100270059 | Ga0070696_1002700592 | 208 |
| 603 | 3300005549 | Ga0070704_100223129 | Ga0070704_1002231292 | 208 |
| 604 | 3300005563 | Ga0068855_100797148 | Ga0068855_1007971482 | 208 |
| 605 | 3300005564 | Ga0070664_100017999 | Ga0070664_1000179994 | 208 |
| 606 | 3300005577 | Ga0068857_100256982 | Ga0068857_1002569822 | 208 |
| 607 | 3300005578 | Ga0068854_100125325 | Ga0068854_1001253253 | 208 |
| 608 | 3300005614 | Ga0068856_100014173 | Ga0068856_1000141736 | 208 |
| 609 | 3300005614 | Ga0068856_100187811 | Ga0068856_1001878113 | 208 |
| 610 | 3300006028 | Ga0070717_10032222 | Ga0070717_100322225 | 208 |
| 611 | 3300006163 | Ga0070715_10097254 | Ga0070715_100972542 | 208 |
| 612 | 3300006175 | Ga0070712_100007843 | Ga0070712_1000078438 | 208 |
| 613 | 3300006237 | Ga0097621_100053550 | Ga0097621_1000535503 | 208 |
| 614 | 3300006237 | Ga0097621_100326432 | Ga0097621_1003264322 | 208 |
| 615 | 3300006852 | Ga0075433_10000310 | Ga0075433_100003107 | 208 |
| 616 | 3300006871 | Ga0075434_100001515 | Ga0075434_1000015154 | 208 |
| 617 | 3300006871 | Ga0075434_100003635 | Ga0075434_1000036357 | 208 |
| 618 | 3300006871 | Ga0075434_100008451 | Ga0075434_1000084515 | 208 |
| 619 | 3300007076 | Ga0075435_100000683 | Ga0075435_10000068313 | 208 |
| 620 | 3300007076 | Ga0075435_100116142 | Ga0075435_1001161422 | 208 |
| 621 | 3300007788 | Ga0099795_10050590 | Ga0099795_100505901 | 208 |
| 622 | 3300009093 | Ga0105240_10187516 | Ga0105240_101875162 | 208 |
| 623 | 3300009147 | Ga0114129_10066372 | Ga0114129_100663723 | 208 |
| 624 | 3300009147 | Ga0114129_10368271 | Ga0114129_103682712 | 208 |
| 625 | 3300009174 | Ga0105241_10005955 | Ga0105241_100059556 | 208 |
| 626 | 3300009177 | Ga0105248_10695516 | Ga0105248_106955161 | 208 |
| 627 | 3300009545 | Ga0105237_10066134 | Ga0105237_100661344 | 208 |
| 628 | 3300009545 | Ga0105237_10141864 | Ga0105237_101418644 | 208 |
| 629 | 3300009545 | Ga0105237_11095164 | Ga0105237_110951641 | 208 |
| 630 | 3300010159 | Ga0099796_10074838 | Ga0099796_100748382 | 208 |
| 631 | 3300013100 | Ga0157373_10003701 | Ga0157373_1000370110 | 208 |
| 632 | 3300013104 | Ga0157370_10032415 | Ga0157370_100324155 | 208 |
| 633 | 3300013104 | Ga0157370_10251075 | Ga0157370_102510753 | 208 |
| 634 | 3300013105 | Ga0157369_10574698 | Ga0157369_105746981 | 208 |
| 635 | 3300013296 | Ga0157374_10252326 | Ga0157374_102523262 | 208 |
| 636 | 3300013306 | Ga0163162_10357365 | Ga0163162_103573653 | 208 |
| 637 | 3300013306 | Ga0163162_10500805 | Ga0163162_105008051 | 208 |
| 638 | 3300013307 | Ga0157372_10035970 | Ga0157372_100359705 | 208 |
| 639 | 3300014325 | Ga0163163_10271446 | Ga0163163_102714463 | 208 |
| 640 | 3300014497 | Ga0182008_10016296 | Ga0182008_100162964 | 208 |
| 641 | 3300014497 | Ga0182008_10057313 | Ga0182008_100573132 | 208 |
| 642 | 3300014968 | Ga0157379_10066713 | Ga0157379_100667133 | 208 |
| 643 | 3300014969 | Ga0157376_10018804 | Ga0157376_100188046 | 208 |
| 644 | 3300014969 | Ga0157376_10789075 | Ga0157376_107890752 | 208 |
| 645 | 3300015262 | Ga0182007_10003470 | Ga0182007_100034709 | 208 |
| 646 | 3300015262 | Ga0182007_10027429 | Ga0182007_100274292 | 208 |
| 647 | 3300015265 | Ga0182005_1009874 | Ga0182005_10098742 | 208 |
| 648 | 3300024227 | Ga0228598_1000385 | Ga0228598_10003853 | 208 |
| 649 | 3300025321 | Ga0207656_10211470 | Ga0207656_102114701 | 208 |
| 650 | 3300025898 | Ga0207692_10457656 | Ga0207692_104576561 | 208 |
| 651 | 3300025906 | Ga0207699_10003269 | Ga0207699_100032694 | 208 |
| 652 | 3300025910 | Ga0207684_10004278 | Ga0207684_100042783 | 208 |
| 653 | 3300025910 | Ga0207684_10148053 | Ga0207684_101480532 | 208 |
| 654 | 3300025911 | Ga0207654_10011434 | Ga0207654_100114343 | 208 |
| 655 | 3300025912 | Ga0207707_10771385 | Ga0207707_107713851 | 208 |
| 656 | 3300025914 | Ga0207671_10091035 | Ga0207671_100910353 | 208 |
| 657 | 3300025915 | Ga0207693_10007915 | Ga0207693_100079156 | 208 |
| 658 | 3300025915 | Ga0207693_10042918 | Ga0207693_100429183 | 208 |
| 659 | 3300025916 | Ga0207663_10019378 | Ga0207663_100193784 | 208 |
| 660 | 3300025916 | Ga0207663_10020169 | Ga0207663_100201696 | 208 |
| 661 | 3300025916 | Ga0207663_10120176 | Ga0207663_101201762 | 208 |
| 662 | 3300025916 | Ga0207663_10337230 | Ga0207663_103372302 | 208 |
| 663 | 3300025919 | Ga0207657_10000628 | Ga0207657_100006283 | 208 |
| 664 | 3300025922 | Ga0207646_10003289 | Ga0207646_1000328915 | 208 |
| 665 | 3300025922 | Ga0207646_10488242 | Ga0207646_104882422 | 208 |
| 666 | 3300025924 | Ga0207694_10190336 | Ga0207694_101903362 | 208 |
| 667 | 3300025925 | Ga0207650_10239834 | Ga0207650_102398342 | 208 |
| 668 | 3300025928 | Ga0207700_10022498 | Ga0207700_100224983 | 208 |
| 669 | 3300025929 | Ga0207664_10975218 | Ga0207664_109752181 | 208 |
| 670 | 3300025933 | Ga0207706_10010021 | Ga0207706_100100216 | 208 |
| 671 | 3300025939 | Ga0207665_10000574 | Ga0207665_1000057418 | 208 |
| 672 | 3300025939 | Ga0207665_10228603 | Ga0207665_102286032 | 208 |
| 673 | 3300025945 | Ga0207679_10210098 | Ga0207679_102100983 | 208 |
| 674 | 3300025949 | Ga0207667_10242463 | Ga0207667_102424631 | 208 |
| 675 | 3300025949 | Ga0207667_11337504 | Ga0207667_113375041 | 208 |
| 676 | 3300025981 | Ga0207640_10113094 | Ga0207640_101130943 | 208 |
| 677 | 3300026023 | Ga0207677_10406042 | Ga0207677_104060421 | 208 |
| 678 | 3300026041 | Ga0207639_10299361 | Ga0207639_102993612 | 208 |
| 679 | 3300026078 | Ga0207702_10031251 | Ga0207702_100312515 | 208 |
| 680 | 3300026078 | Ga0207702_10267601 | Ga0207702_102676011 | 208 |
| 681 | 3300026088 | Ga0207641_10080966 | Ga0207641_100809663 | 208 |
| 682 | 3300026116 | Ga0207674_10141993 | Ga0207674_101419933 | 208 |
| 683 | 3300028017 | Ga0265356_1003425 | Ga0265356_10034252 | 208 |
| 684 | 3300028558 | Ga0265326_10049232 | Ga0265326_100492322 | 208 |
| 685 | 3300028800 | Ga0265338_10048803 | Ga0265338_100488034 | 208 |
| 686 | 3300028800 | Ga0265338_10297899 | Ga0265338_102978991 | 208 |
| 687 | 3300030760 | Ga0265762_1002847 | Ga0265762_10028473 | 208 |
| 688 | 3300031235 | Ga0265330_10019280 | Ga0265330_100192802 | 208 |
| 689 | 3300031249 | Ga0265339_10034914 | Ga0265339_100349141 | 208 |
| 690 | 3300031344 | Ga0265316_10009500 | Ga0265316_100095003 | 208 |
| 691 | 3300031344 | Ga0265316_10079402 | Ga0265316_100794023 | 208 |
| 692 | 3300031711 | Ga0265314_10068053 | Ga0265314_100680534 | 208 |
| 693 | 3300032002 | Ga0307416_100040214 | Ga0307416_1000402144 | 208 |
| 694 | 3300035172 | Ga0373955_0118165 | Ga0373955_0118165_706_1341 | 208 |
| 695 | 3300035691 | Ga0373931_0295883 | Ga0373931_0295883_21_650 | 208 |
| 696 | 3300035695 | Ga0373927_0058548 | Ga0373927_0058548_927_1556 | 208 |
| 697 | 3300035725 | Ga0373947_0106009 | Ga0373947_0106009_352_978 | 208 |
| 698 | 3300036401 | Ga0373937_0077543 | Ga0373937_0077543_1589_2224 | 208 |
| 699 | 3300037068 | Ga0373925_0122239 | Ga0373925_0122239_920_1549 | 208 |
| 700 | 3300037471 | Ga0395905_0274320 | Ga0395905_0274320_58_690 | 208 |
| 701 | 3300037471 | Ga0395905_0315721 | Ga0395905_0315721_488_1126 | 208 |
| 702 | 3300038443 | Ga0395901_0316397 | Ga0395901_0316397_583_1227 | 208 |
| 703 | 3300039453 | Ga0436362_0529442 | Ga0436362_0529442_273_908 | 208 |
| 704 | 3300044694 | Ga0466963_0457517 | Ga0466963_0457517_130_789 | 208 |
| 705 | 3300045051 | Ga0451576_0022087 | Ga0451576_0022087_1811_2443 | 208 |
| 706 | 3300045976 | Ga0466967_0077881 | Ga0466967_0077881_441_1079 | 208 |
| 707 | 3300046457 | Ga0495590_0123319 | Ga0495590_0123319_182_814 | 208 |
| 708 | 3300046472 | Ga0495580_0000204 | Ga0495580_0000204_20063_20689 | 208 |
| 709 | 3300046472 | Ga0495580_0001024 | Ga0495580_0001024_12562_13188 | 208 |
| 710 | 3300046472 | Ga0495580_0029342 | Ga0495580_0029342_1310_1936 | 208 |
| 711 | 3300046472 | Ga0495580_0049396 | Ga0495580_0049396_1960_2595 | 208 |
| 712 | 3300046472 | Ga0495580_0072278 | Ga0495580_0072278_430_1059 | 208 |
| 713 | 3300046499 | Ga0495594_0069803 | Ga0495594_0069803_1205_1831 | 208 |
| 714 | 3300046663 | Ga0495635_0180255 | Ga0495635_0180255_538_1173 | 208 |
| 715 | 3300046674 | Ga0495588_0166416 | Ga0495588_0166416_354_980 | 208 |
| 716 | 3300047315 | Ga0495581_0086874 | Ga0495581_0086874_1000_1635 | 208 |
| 717 | 3300047318 | Ga0495636_0239861 | Ga0495636_0239861_53_679 | 208 |
| 718 | 3300047471 | Ga0495684_0339936 | Ga0495684_0339936_92_727 | 208 |
| 719 | 3300048903 | Ga0496100_0065436 | Ga0496100_0065436_1431_2057 | 208 |
| 720 | 3300048904 | Ga0496101_0268269 | Ga0496101_0268269_63_689 | 208 |
| 721 | 3300048905 | Ga0496102_0041429 | Ga0496102_0041429_2408_3034 | 208 |
| 722 | 3300048905 | Ga0496102_0110529 | Ga0496102_0110529_834_1460 | 208 |
| 723 | 3300048905 | Ga0496102_0765306 | Ga0496102_0765306_181_810 | 208 |
| 724 | 3300048910 | Ga0496107_0118686 | Ga0496107_0118686_59_685 | 208 |
| 725 | 3300048912 | Ga0496109_0292638 | Ga0496109_0292638_301_927 | 208 |
| 726 | 3300048913 | Ga0496110_0152029 | Ga0496110_0152029_589_1215 | 208 |
| 727 | 3300048915 | Ga0496112_0361511 | Ga0496112_0361511_74_703 | 208 |
| 728 | 3300048916 | Ga0496113_0245314 | Ga0496113_0245314_406_1032 | 208 |
| 729 | 3300048918 | Ga0496115_0368790 | Ga0496115_0368790_338_967 | 208 |
| 730 | 3300049521 | Ga0501298_011581 | Ga0501298_011581_881_1513 | 208 |
| 731 | 3300049744 | Ga0501083_0037263 | Ga0501083_0037263_855_1481 | 208 |
| 732 | 3300050507 | nmdc:mga05p37_519527_c1 | nmdc:mga05p37_519527_c1_622_1257 | 208 |
| 733 | 3300050512 | nmdc:mga0n895_12417_c1 | nmdc:mga0n895_12417_c1_1179_1805 | 208 |
| 734 | 3300050512 | nmdc:mga0n895_5233_c1 | nmdc:mga0n895_5233_c1_2890_3516 | 208 |
| 735 | 3300050512 | nmdc:mga0n895_7198_c1 | nmdc:mga0n895_7198_c1_3949_4575 | 208 |
| 736 | 3300050513 | nmdc:mga0rr50_40379_c1 | nmdc:mga0rr50_40379_c1_637_1263 | 208 |
| 737 | 3300050513 | nmdc:mga0rr50_563_c1 | nmdc:mga0rr50_563_c1_8658_9284 | 208 |
| 738 | 3300050515 | nmdc:mga0a205_279_c1 | nmdc:mga0a205_279_c1_34173_34799 | 208 |
| 739 | 3300053085 | Ga0495619_0342115 | Ga0495619_0342115_322_957 | 208 |
| 740 | 3300054114 | Ga0501084_0514520 | Ga0501084_0514520_226_852 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8giw-assembly2.cif.gz_D | c143k variant of citrate synthase (cita) in mycobacterium tuberculosis | 0.3979 | 35 | 167 |
| 8gmi-assembly4.cif.gz_H | citrate synthase (cita) in mycobacterium tuberculosis modified by ebselen at c143 residue | 0.3674 | 44 | 167 |
| 8s9d-assembly1.cif.gz_A-2 | c143s variant of citrate synthase (cita) in mycobacterium tuberculosis | 0.3516 | 21 | 167 |
| 8gm9-assembly2.cif.gz_C | structure of citrate synthase(cita) in mycobacterium tuberculosis | 0.3486 | 29 | 167 |
| 8glb-assembly2.cif.gz_B | selenomethionine derivatized citrate synthase (cita) in mycobacterium tuberculosis with pyruvate | 0.3348 | 21 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8143 | 36 | 163 | 1.10.1760.20 |
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8017 | 36 | 163 | 1.10.1760.20 |
| af_P9WN27_598_833_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.4803 | 19 | 84 | 3.30.460.10 |
| af_Q9NAG1_1_333_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3487 | 2 | 122 | 1.20.1070.10 |
| af_J3QNS5_224_388_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3459 | 25 | 168 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3MN71-F1-model_v4 | DedA family protein | 0.9459 | 1 | 178 |
GO:0005886
|
| AF-A0A698C407-F1-model_v4 | deleted | 0.9401 | 3 | 163 |
|
| AF-A0A431JC60-F1-model_v4 | deleted | 0.9315 | 2 | 156 |
|
| AF-A0A7C3MN71-F1-model_v4 | DedA family protein | 0.9308 | 1 | 178 |
GO:0005886
|
| AF-A0A847PBR6-F1-model_v4 | DedA family protein | 0.9283 | 5 | 169 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar