F478543

General Info

Members Datasets Scaffolds Average Seq Length
740 272 740 204

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0009313|Ga0466967_0009313_5549_6223
Length 224
Sequence LISHIIEVLSEFIIRVIATGGYPGIVLLMAIESACIPLPSEVIMPFSGALTLGIVASQYGREPFTLLWVATAGALGCNLGSLVAYEIGAFGGRPLIERYGRYVLMSENELNLTDRFFRKYGDVTVFVCRLLPVVRTFIALPAGIARMPRLRFHVYTFLGSWPWCLMLAWIGAKLGERWHTDPRLKEWFHRFDAVIGGIITLAVVWFVXXXXRHRIKTSGDRVIG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.3
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2357773 2162886012 Bacteria 1127
2 MBSR1b_contig_4104914 2162886012 Bacteria 1127
3 LJNas_1001663 3300000546 Bacteria 3012
4 JGI24748J21848_1004860 3300002074 Bacteria 1548
5 Ga0065715_10011916 3300005293 Bacteria 3474
6 Ga0070658_10252225 3300005327 Unclassified 1497
7 Ga0070676_10168073 3300005328 Bacteria 1416
8 Ga0070683_100004265 3300005329 Bacteria 11732
9 Ga0070683_100105372 3300005329 Bacteria 2658
10 Ga0070683_100171020 3300005329 Bacteria 2063
11 Ga0070690_100005060 3300005330 Bacteria 7390
12 Ga0070670_100006784 3300005331 Bacteria 9695
13 Ga0070670_100017561 3300005331 Bacteria 6139
14 Ga0070670_100194738 3300005331 Bacteria 1761
15 Ga0068869_100005202 3300005334 Bacteria 8169
16 Ga0068869_100016098 3300005334 Bacteria 5035
17 Ga0070666_10040737 3300005335 Bacteria 3101
18 Ga0070680_100050994 3300005336 Bacteria 3376
19 Ga0070680_100285882 3300005336 Bacteria 1398
20 Ga0070682_100008130 3300005337 Bacteria 5916
21 Ga0070682_100052488 3300005337 Bacteria 2551
22 Ga0070682_100241713 3300005337 Bacteria 1296
23 Ga0068868_100002026 3300005338 Bacteria 13925
24 Ga0068868_100013694 3300005338 Bacteria 5957
25 Ga0068868_100019739 3300005338 Bacteria 5054
26 Ga0068868_100021622 3300005338 Unclassified 4845
27 Ga0068868_100095358 3300005338 Bacteria 2401
28 Ga0068868_100295824 3300005338 Bacteria 1374
29 Ga0070660_100006065 3300005339 Bacteria 8357
30 Ga0070660_100060293 3300005339 Bacteria 2944
31 Ga0070687_100142822 3300005343 Bacteria 1396
32 Ga0070661_100001267 3300005344 Bacteria 17752
33 Ga0070661_100025961 3300005344 Bacteria 4210
34 Ga0070661_100167188 3300005344 Bacteria 1669
35 Ga0070692_10368934 3300005345 Bacteria 897
36 Ga0070668_100005814 3300005347 Bacteria 9149
37 Ga0070668_100067915 3300005347 Bacteria 2770
38 Ga0070675_100739173 3300005354 Unclassified 897
39 Ga0070675_101031738 3300005354 Bacteria 755
40 Ga0070671_100262621 3300005355 Bacteria 1467
41 Ga0070671_100824051 3300005355 Bacteria 809
42 Ga0070674_100006696 3300005356 Bacteria 6740
43 Ga0070673_100001501 3300005364 Bacteria 13696
44 Ga0070673_100038009 3300005364 Bacteria 3672
45 Ga0070659_100037926 3300005366 Bacteria 3758
46 Ga0070667_100361708 3300005367 Bacteria 1315
47 Ga0070667_100558858 3300005367 Bacteria 1052
48 Ga0070667_100560020 3300005367 Bacteria 1051
49 Ga0070709_10000616 3300005434 Bacteria 20414
50 Ga0070709_10076720 3300005434 Bacteria 2171
51 Ga0070709_10079037 3300005434 Bacteria 2141
52 Ga0070709_10204821 3300005434 Bacteria 1399
53 Ga0070709_10535131 3300005434 Bacteria 895
54 Ga0070714_100016644 3300005435 Bacteria 5943
55 Ga0070714_100080762 3300005435 Unclassified 2829
56 Ga0070714_100182619 3300005435 Bacteria 1909
57 Ga0070714_100447572 3300005435 Bacteria 1226
58 Ga0070714_100468304 3300005435 Unclassified 1198
59 Ga0070713_100002930 3300005436 Bacteria 11181
60 Ga0070713_100005635 3300005436 Bacteria 8588
61 Ga0070713_100013379 3300005436 Bacteria 6056
62 Ga0070713_100027072 3300005436 Bacteria 4511
63 Ga0070713_100029464 3300005436 Unclassified 4349
64 Ga0070713_100111385 3300005436 Bacteria 2387
65 Ga0070713_100244727 3300005436 Bacteria 1634
66 Ga0070710_10150299 3300005437 Bacteria 1436
67 Ga0070710_10388694 3300005437 Unclassified 932
68 Ga0070711_100001964 3300005439 Bacteria 11538
69 Ga0070711_100008149 3300005439 Bacteria 6406
70 Ga0070711_100022258 3300005439 Bacteria 4106
71 Ga0070711_100028655 3300005439 Bacteria 3667
72 Ga0070711_100166528 3300005439 Bacteria 1676
73 Ga0070705_100082611 3300005440 Unclassified 1977
74 Ga0070705_100102487 3300005440 Bacteria 1810
75 Ga0070708_100002464 3300005445 Bacteria 14311
76 Ga0070708_100003650 3300005445 Bacteria 12068
77 Ga0070708_100007742 3300005445 Bacteria 8605
78 Ga0070708_100078771 3300005445 Bacteria 2979
79 Ga0070708_100285794 3300005445 Bacteria 1552
80 Ga0070708_100628969 3300005445 Bacteria 1012
81 Ga0070708_100706516 3300005445 Unclassified 949
82 Ga0070663_100002712 3300005455 Bacteria 10016
83 Ga0070678_100022680 3300005456 Bacteria 4166
84 Ga0070662_100015183 3300005457 Bacteria 5154
85 Ga0070662_100165504 3300005457 Bacteria 1733
86 Ga0070681_10000394 3300005458 Bacteria 35340
87 Ga0070681_10006170 3300005458 Bacteria 11642
88 Ga0070681_10212150 3300005458 Bacteria 1852
89 Ga0068867_100070899 3300005459 Bacteria 2606
90 Ga0070706_100001186 3300005467 Bacteria 27906
91 Ga0070706_100001941 3300005467 Bacteria 21314
92 Ga0070706_100044540 3300005467 Bacteria 4099
93 Ga0070706_100173048 3300005467 Bacteria 2016
94 Ga0070706_100469537 3300005467 Unclassified 1171
95 Ga0070707_100001843 3300005468 Bacteria 20354
96 Ga0070707_100170263 3300005468 Bacteria 2122
97 Ga0070707_100196285 3300005468 Bacteria 1968
98 Ga0070707_100202869 3300005468 Bacteria 1933
99 Ga0070707_100234615 3300005468 Bacteria 1785
100 Ga0070707_100427786 3300005468 Unclassified 1284
101 Ga0070707_100895892 3300005468 Bacteria 852
102 Ga0070698_100000758 3300005471 Bacteria 34912
103 Ga0070698_100013035 3300005471 Bacteria 8801
104 Ga0070698_100019235 3300005471 Bacteria 7174
105 Ga0070699_100001097 3300005518 Bacteria 25198
106 Ga0070699_100012112 3300005518 Bacteria 7444
107 Ga0070699_100183301 3300005518 Bacteria 1858
108 Ga0070699_100184504 3300005518 Bacteria 1852
109 Ga0070679_100003147 3300005530 Bacteria 15080
110 Ga0070679_100169328 3300005530 Bacteria 2157
111 Ga0070679_100197934 3300005530 Bacteria 1976
112 Ga0070679_100728138 3300005530 Bacteria 935
113 Ga0070684_100169466 3300005535 Bacteria 1983
114 Ga0070697_100000107 3300005536 Bacteria 65460
115 Ga0070697_100000353 3300005536 Bacteria 36186
116 Ga0070697_100011022 3300005536 Bacteria 7062
117 Ga0070697_100021934 3300005536 Bacteria 5066
118 Ga0070697_100041359 3300005536 Bacteria 3730
119 Ga0070697_100195106 3300005536 Bacteria 1719
120 Ga0070697_100232296 3300005536 Unclassified 1573
121 Ga0070697_100478484 3300005536 Bacteria 1087
122 Ga0068853_100094337 3300005539 Bacteria 2636
123 Ga0070672_100016320 3300005543 Bacteria 5315
124 Ga0070686_100029896 3300005544 Bacteria 3318
125 Ga0070695_100030579 3300005545 Bacteria 3354
126 Ga0070696_100021981 3300005546 Bacteria 4329
127 Ga0070696_100118457 3300005546 Unclassified 1914
128 Ga0070696_100118652 3300005546 Bacteria 1913
129 Ga0070696_100270059 3300005546 Unclassified 1293
130 Ga0070693_100328840 3300005547 Bacteria 1039
131 Ga0070693_100336138 3300005547 Bacteria 1029
132 Ga0070665_100004403 3300005548 Bacteria 14805
133 Ga0070665_100599578 3300005548 Bacteria 1114
134 Ga0070704_100223129 3300005549 Bacteria 1533
135 Ga0070704_100617549 3300005549 Unclassified 954
136 Ga0068855_100000363 3300005563 Bacteria 56220
137 Ga0068855_100017122 3300005563 Bacteria 8719
138 Ga0068855_100026911 3300005563 Bacteria 6882
139 Ga0068855_100089317 3300005563 Bacteria 3558
140 Ga0068855_100140727 3300005563 Bacteria 2751
141 Ga0068855_100141947 3300005563 Bacteria 2736
142 Ga0068855_100797148 3300005563 Bacteria 1004
143 Ga0070664_100002997 3300005564 Bacteria 13659
144 Ga0070664_100017999 3300005564 Bacteria 5801
145 Ga0070664_100051695 3300005564 Bacteria 3479
146 Ga0070664_100054826 3300005564 Bacteria 3384
147 Ga0070664_100072469 3300005564 Unclassified 2954
148 Ga0068857_100007012 3300005577 Bacteria 9697
149 Ga0068857_100007495 3300005577 Bacteria 9392
150 Ga0068857_100030777 3300005577 Bacteria 4741
151 Ga0068857_100083853 3300005577 Bacteria 2848
152 Ga0068857_100256982 3300005577 Bacteria 1603
153 Ga0068854_100019834 3300005578 Bacteria 4537
154 Ga0068854_100019906 3300005578 Bacteria 4531
155 Ga0068854_100024465 3300005578 Bacteria 4135
156 Ga0068854_100069721 3300005578 Bacteria 2568
157 Ga0068854_100125325 3300005578 Bacteria 1955
158 Ga0068854_100285975 3300005578 Bacteria 1329
159 Ga0068856_100000567 3300005614 Bacteria 40443
160 Ga0068856_100001253 3300005614 Bacteria 26694
161 Ga0068856_100005099 3300005614 Bacteria 12982
162 Ga0068856_100014173 3300005614 Bacteria 7706
163 Ga0068856_100019487 3300005614 Bacteria 6585
164 Ga0068856_100042725 3300005614 Unclassified 4460
165 Ga0068856_100187811 3300005614 Bacteria 2080
166 Ga0070702_100062406 3300005615 Bacteria 2173
167 Ga0068852_100019826 3300005616 Bacteria 5333
168 Ga0068852_100149480 3300005616 Bacteria 2171
169 Ga0068852_100286745 3300005616 Bacteria 1589
170 Ga0068852_100653742 3300005616 Bacteria 1059
171 Ga0068859_100002574 3300005617 Bacteria 18434
172 Ga0068859_100005456 3300005617 Bacteria 12936
173 Ga0068859_100172492 3300005617 Bacteria 2244
174 Ga0068859_100256708 3300005617 Unclassified 1839
175 Ga0068864_100035678 3300005618 Bacteria 4234
176 Ga0068864_100036809 3300005618 Unclassified 4173
177 Ga0068866_10002392 3300005718 Bacteria 7771
178 Ga0068866_10002717 3300005718 Bacteria 7297
179 Ga0068861_100261058 3300005719 Bacteria 1483
180 Ga0068851_10007348 3300005834 Bacteria 5054
181 Ga0068870_10015186 3300005840 Bacteria 3649
182 Ga0068863_100053166 3300005841 Bacteria 3838
183 Ga0068863_100172280 3300005841 Unclassified 2076
184 Ga0068863_100330661 3300005841 Unclassified 1481
185 Ga0068858_100001949 3300005842 Bacteria 21049
186 Ga0068858_100018785 3300005842 Bacteria 6466
187 Ga0068858_100047672 3300005842 Bacteria 3971
188 Ga0068858_100051233 3300005842 Bacteria 3819
189 Ga0068860_100013886 3300005843 Bacteria 7897
190 Ga0068860_100013919 3300005843 Bacteria 7887
191 Ga0068860_100338348 3300005843 Bacteria 1479
192 Ga0068862_100017838 3300005844 Bacteria 5910
193 Ga0068862_100020812 3300005844 Bacteria 5480
194 Ga0068862_100076645 3300005844 Bacteria 2894
195 Ga0070717_10001372 3300006028 Bacteria 16771
196 Ga0070717_10005442 3300006028 Bacteria 9293
197 Ga0070717_10023154 3300006028 Bacteria 4917
198 Ga0070717_10032222 3300006028 Bacteria 4222
199 Ga0070717_10037031 3300006028 Bacteria 3959
200 Ga0070717_10057743 3300006028 Bacteria 3208
201 Ga0070717_10213647 3300006028 Bacteria 1694
202 Ga0070717_10282760 3300006028 Bacteria 1472
203 Ga0070717_11220297 3300006028 Bacteria 684
204 Ga0070715_10097254 3300006163 Bacteria 1366
205 Ga0070715_10225387 3300006163 Bacteria 966
206 Ga0070716_100003475 3300006173 Bacteria 7424
207 Ga0070716_100021185 3300006173 Bacteria 3422
208 Ga0070716_100114679 3300006173 Bacteria 1676
209 Ga0070716_100263214 3300006173 Bacteria 1181
210 Ga0070712_100007843 3300006175 Bacteria 6687
211 Ga0070712_100022710 3300006175 Unclassified 4136
212 Ga0070712_100035393 3300006175 Unclassified 3389
213 Ga0097621_100000085 3300006237 Bacteria 50268
214 Ga0097621_100002310 3300006237 Bacteria 13062
215 Ga0097621_100005323 3300006237 Bacteria 9063
216 Ga0097621_100009628 3300006237 Bacteria 7024
217 Ga0097621_100011556 3300006237 Bacteria 6507
218 Ga0097621_100053550 3300006237 Bacteria 3289
219 Ga0097621_100107138 3300006237 Bacteria 2358
220 Ga0097621_100210938 3300006237 Unclassified 1690
221 Ga0097621_100251479 3300006237 Bacteria 1548
222 Ga0097621_100326432 3300006237 Bacteria 1360
223 Ga0068871_100000849 3300006358 Bacteria 20448
224 Ga0068871_100001152 3300006358 Bacteria 17738
225 Ga0068871_100002644 3300006358 Bacteria 12239
226 Ga0068871_100050117 3300006358 Bacteria 3377
227 Ga0068871_100087565 3300006358 Bacteria 2589
228 Ga0068871_100107485 3300006358 Bacteria 2343
229 Ga0068871_100240643 3300006358 Bacteria 1573
230 Ga0068871_100270673 3300006358 Bacteria 1484
231 Ga0075433_10000310 3300006852 Bacteria 29590
232 Ga0075434_100001515 3300006871 Bacteria 19639
233 Ga0075434_100003635 3300006871 Bacteria 13771
234 Ga0075434_100008451 3300006871 Bacteria 9574
235 Ga0068865_100023722 3300006881 Bacteria 4020
236 Ga0068865_100040872 3300006881 Unclassified 3153
237 Ga0068865_100122818 3300006881 Bacteria 1934
238 Ga0075436_100002566 3300006914 Bacteria 12505
239 Ga0075436_100083301 3300006914 Bacteria 2219
240 Ga0097620_100002574 3300006931 Bacteria 18434
241 Ga0097620_100005456 3300006931 Bacteria 12936
242 Ga0097620_100172484 3300006931 Bacteria 2244
243 Ga0097620_100256708 3300006931 Unclassified 1839
244 Ga0075435_100000683 3300007076 Bacteria 21031
245 Ga0075435_100116142 3300007076 Bacteria 2229
246 Ga0075435_100297163 3300007076 Bacteria 1381
247 Ga0075435_100327232 3300007076 Bacteria 1312
248 Ga0075435_100397917 3300007076 Bacteria 1184
249 Ga0099794_10020087 3300007265 Bacteria 3020
250 Ga0099795_10050590 3300007788 Bacteria 1512
251 Ga0105240_10015732 3300009093 Bacteria 10267
252 Ga0105240_10059592 3300009093 Bacteria 4763
253 Ga0105240_10068049 3300009093 Bacteria 4412
254 Ga0105240_10187516 3300009093 Bacteria 2435
255 Ga0105245_10092535 3300009098 Bacteria 2784
256 Ga0105245_10249019 3300009098 Bacteria 1725
257 Ga0105247_10003382 3300009101 Bacteria 10429
258 Ga0105247_10007088 3300009101 Bacteria 6884
259 Ga0105247_10081606 3300009101 Bacteria 2039
260 Ga0114129_10066372 3300009147 Bacteria 5034
261 Ga0114129_10368271 3300009147 Bacteria 1900
262 Ga0105243_10114212 3300009148 Bacteria 2266
263 Ga0105241_10005955 3300009174 Bacteria 8992
264 Ga0105241_10016466 3300009174 Bacteria 5423
265 Ga0105241_10033908 3300009174 Bacteria 3834
266 Ga0105241_10088013 3300009174 Unclassified 2445
267 Ga0105241_10111525 3300009174 Bacteria 2190
268 Ga0105241_10196119 3300009174 Bacteria 1684
269 Ga0105242_10017634 3300009176 Bacteria 5568
270 Ga0105242_10024113 3300009176 Bacteria 4803
271 Ga0105242_10035519 3300009176 Bacteria 3997
272 Ga0105242_10039415 3300009176 Bacteria 3803
273 Ga0105242_10430487 3300009176 Bacteria 1239
274 Ga0105248_10088691 3300009177 Bacteria 3481
275 Ga0105248_10165076 3300009177 Unclassified 2497
276 Ga0105248_10166896 3300009177 Bacteria 2481
277 Ga0105248_10695516 3300009177 Bacteria 1147
278 Ga0105237_10023675 3300009545 Bacteria 6289
279 Ga0105237_10066134 3300009545 Bacteria 3610
280 Ga0105237_10076870 3300009545 Unclassified 3328
281 Ga0105237_10141864 3300009545 Unclassified 2397
282 Ga0105237_10261227 3300009545 Unclassified 1734
283 Ga0105237_10515262 3300009545 Bacteria 1202
284 Ga0105237_11095164 3300009545 Unclassified 803
285 Ga0105238_10001062 3300009551 Bacteria 27743
286 Ga0105238_10103856 3300009551 Bacteria 2823
287 Ga0105238_10829387 3300009551 Unclassified 941
288 Ga0105249_10007882 3300009553 Bacteria 9278
289 Ga0105249_10042627 3300009553 Bacteria 4129
290 Ga0099796_10074838 3300010159 Bacteria 1230
291 Ga0105239_10010258 3300010375 Bacteria 10490
292 Ga0105239_10025677 3300010375 Bacteria 6488
293 Ga0105239_10135395 3300010375 Bacteria 2742
294 Ga0105239_10357982 3300010375 Bacteria 1648
295 Ga0105239_10681252 3300010375 Bacteria 1175
296 Ga0105239_11135423 3300010375 Bacteria 900
297 Ga0105246_10001225 3300011119 Bacteria 15024
298 Ga0105246_10014314 3300011119 Bacteria 4988
299 Ga0157373_10003701 3300013100 Bacteria 11569
300 Ga0157373_10027170 3300013100 Bacteria 4129
301 Ga0157373_10183599 3300013100 Bacteria 1473
302 Ga0157371_10007268 3300013102 Bacteria 8997
303 Ga0157371_10008322 3300013102 Bacteria 8281
304 Ga0157371_10123618 3300013102 Unclassified 1840
305 Ga0157371_10126323 3300013102 Bacteria 1819
306 Ga0157370_10032415 3300013104 Bacteria 5103
307 Ga0157370_10251075 3300013104 Bacteria 1636
308 Ga0157370_10569299 3300013104 Bacteria 1038
309 Ga0157369_10000386 3300013105 Bacteria 58547
310 Ga0157369_10022554 3300013105 Bacteria 7023
311 Ga0157369_10574698 3300013105 Bacteria 1164
312 Ga0157369_10584251 3300013105 Bacteria 1153
313 Ga0157374_10000253 3300013296 Bacteria 49319
314 Ga0157374_10000453 3300013296 Bacteria 37355
315 Ga0157374_10000609 3300013296 Bacteria 31684
316 Ga0157374_10003439 3300013296 Bacteria 13302
317 Ga0157374_10020887 3300013296 Bacteria 5817
318 Ga0157374_10252326 3300013296 Bacteria 1736
319 Ga0157374_10381540 3300013296 Bacteria 1404
320 Ga0157374_10459018 3300013296 Bacteria 1276
321 Ga0157374_10533625 3300013296 Bacteria 1180
322 Ga0157378_10000117 3300013297 Bacteria 76732
323 Ga0157378_10000321 3300013297 Bacteria 47154
324 Ga0157378_10000344 3300013297 Bacteria 45774
325 Ga0157378_10001717 3300013297 Bacteria 19681
326 Ga0157378_10076181 3300013297 Bacteria 3022
327 Ga0157378_10121398 3300013297 Bacteria 2409
328 Ga0163162_10008600 3300013306 Bacteria 9951
329 Ga0163162_10008790 3300013306 Bacteria 9820
330 Ga0163162_10013645 3300013306 Bacteria 7937
331 Ga0163162_10068095 3300013306 Bacteria 3611
332 Ga0163162_10144719 3300013306 Bacteria 2492
333 Ga0163162_10357365 3300013306 Bacteria 1594
334 Ga0163162_10500805 3300013306 Bacteria 1345
335 Ga0157372_10000500 3300013307 Bacteria 43103
336 Ga0157372_10004725 3300013307 Bacteria 14467
337 Ga0157372_10007417 3300013307 Bacteria 11664
338 Ga0157372_10008139 3300013307 Bacteria 11151
339 Ga0157372_10019084 3300013307 Bacteria 7382
340 Ga0157372_10035970 3300013307 Bacteria 5454
341 Ga0157372_10065584 3300013307 Bacteria 4077
342 Ga0157372_10154041 3300013307 Unclassified 2654
343 Ga0157375_10050921 3300013308 Bacteria 4064
344 Ga0157375_10080633 3300013308 Unclassified 3293
345 Ga0157375_10315092 3300013308 Bacteria 1729
346 Ga0157375_10646634 3300013308 Bacteria 1214
347 Ga0163163_10000595 3300014325 Bacteria 31716
348 Ga0163163_10008436 3300014325 Bacteria 9155
349 Ga0163163_10076653 3300014325 Bacteria 3338
350 Ga0163163_10271446 3300014325 Unclassified 1747
351 Ga0182008_10016296 3300014497 Unclassified 3862
352 Ga0182008_10057313 3300014497 Bacteria 1923
353 Ga0157377_10001292 3300014745 Bacteria 10725
354 Ga0157379_10003837 3300014968 Bacteria 12814
355 Ga0157379_10009864 3300014968 Bacteria 8319
356 Ga0157379_10051006 3300014968 Unclassified 3695
357 Ga0157379_10066713 3300014968 Bacteria 3217
358 Ga0157379_10206870 3300014968 Bacteria 1775
359 Ga0157376_10018804 3300014969 Bacteria 5309
360 Ga0157376_10029983 3300014969 Bacteria 4337
361 Ga0157376_10107726 3300014969 Unclassified 2447
362 Ga0157376_10129367 3300014969 Bacteria 2250
363 Ga0157376_10687946 3300014969 Bacteria 1027
364 Ga0157376_10789075 3300014969 Unclassified 962
365 Ga0182007_10003470 3300015262 Bacteria 7425
366 Ga0182007_10027429 3300015262 Bacteria 1964
367 Ga0182005_1009874 3300015265 Unclassified 2760
368 Ga0163161_10002771 3300017792 Bacteria 12447
369 Ga0213872_10014339 3300021361 Bacteria 3698
370 Ga0213871_10010658 3300021441 Bacteria 2091
371 Ga0213871_10088726 3300021441 Bacteria 894
372 Ga0224569_100267 3300022732 Unclassified 4352
373 Ga0224572_1000996 3300024225 Bacteria 3909
374 Ga0228598_1000385 3300024227 Bacteria 8838
375 Ga0228598_1000850 3300024227 Bacteria 6604
376 Ga0228598_1006462 3300024227 Unclassified 2426
377 Ga0207656_10005405 3300025321 Bacteria 4512
378 Ga0207656_10211470 3300025321 Bacteria 940
379 Ga0207682_10167585 3300025893 Bacteria 998
380 Ga0207692_10028883 3300025898 Bacteria 2629
381 Ga0207692_10457656 3300025898 Unclassified 804
382 Ga0207642_10012301 3300025899 Bacteria 3086
383 Ga0207642_10065030 3300025899 Bacteria 1712
384 Ga0207710_10094019 3300025900 Unclassified 1407
385 Ga0207688_10006690 3300025901 Bacteria 6273
386 Ga0207680_10002514 3300025903 Bacteria 8551
387 Ga0207647_10018466 3300025904 Bacteria 4713
388 Ga0207647_10064322 3300025904 Bacteria 2229
389 Ga0207685_10087108 3300025905 Bacteria 1306
390 Ga0207699_10000566 3300025906 Bacteria 18209
391 Ga0207699_10003269 3300025906 Bacteria 7723
392 Ga0207645_10000273 3300025907 Bacteria 42696
393 Ga0207645_10009069 3300025907 Bacteria 6904
394 Ga0207643_10006633 3300025908 Bacteria 6207
395 Ga0207684_10004278 3300025910 Bacteria 13529
396 Ga0207684_10007499 3300025910 Bacteria 9819
397 Ga0207684_10148053 3300025910 Unclassified 2020
398 Ga0207684_10189169 3300025910 Bacteria 1775
399 Ga0207684_10269505 3300025910 Unclassified 1469
400 Ga0207684_10279082 3300025910 Bacteria 1441
401 Ga0207654_10002570 3300025911 Bacteria 9211
402 Ga0207654_10010110 3300025911 Bacteria 4799
403 Ga0207654_10011434 3300025911 Bacteria 4530
404 Ga0207654_10013790 3300025911 Bacteria 4163
405 Ga0207654_10076885 3300025911 Bacteria 1999
406 Ga0207654_10101876 3300025911 Unclassified 1770
407 Ga0207707_10008181 3300025912 Bacteria 9075
408 Ga0207707_10276716 3300025912 Bacteria 1454
409 Ga0207707_10771385 3300025912 Bacteria 803
410 Ga0207695_10004625 3300025913 Bacteria 18666
411 Ga0207695_10025559 3300025913 Bacteria 6608
412 Ga0207695_10033887 3300025913 Bacteria 5560
413 Ga0207671_10029651 3300025914 Bacteria 4084
414 Ga0207671_10086349 3300025914 Unclassified 2358
415 Ga0207671_10091035 3300025914 Bacteria 2298
416 Ga0207671_10295368 3300025914 Unclassified 1280
417 Ga0207693_10000076 3300025915 Bacteria 88185
418 Ga0207693_10007915 3300025915 Bacteria 8732
419 Ga0207693_10011894 3300025915 Bacteria 7036
420 Ga0207693_10017801 3300025915 Bacteria 5665
421 Ga0207693_10042918 3300025915 Bacteria 3560
422 Ga0207663_10019378 3300025916 Bacteria 3832
423 Ga0207663_10019551 3300025916 Bacteria 3819
424 Ga0207663_10020169 3300025916 Bacteria 3771
425 Ga0207663_10083785 3300025916 Unclassified 2095
426 Ga0207663_10120176 3300025916 Bacteria 1798
427 Ga0207663_10337230 3300025916 Unclassified 1138
428 Ga0207663_10708940 3300025916 Bacteria 797
429 Ga0207663_10787518 3300025916 Unclassified 757
430 Ga0207660_10247934 3300025917 Bacteria 1405
431 Ga0207660_10333057 3300025917 Bacteria 1214
432 Ga0207662_10011456 3300025918 Bacteria 4920
433 Ga0207662_10152871 3300025918 Bacteria 1469
434 Ga0207657_10000628 3300025919 Bacteria 37475
435 Ga0207657_10002319 3300025919 Bacteria 20621
436 Ga0207657_10010598 3300025919 Bacteria 9186
437 Ga0207649_10003871 3300025920 Bacteria 8161
438 Ga0207649_10171276 3300025920 Bacteria 1513
439 Ga0207652_10322587 3300025921 Bacteria 1394
440 Ga0207652_10640248 3300025921 Bacteria 951
441 Ga0207652_11029684 3300025921 Bacteria 722
442 Ga0207646_10001171 3300025922 Bacteria 33235
443 Ga0207646_10003289 3300025922 Bacteria 18402
444 Ga0207646_10240092 3300025922 Unclassified 1637
445 Ga0207646_10488242 3300025922 Bacteria 1110
446 Ga0207681_10009802 3300025923 Bacteria 5860
447 Ga0207694_10000816 3300025924 Bacteria 27837
448 Ga0207694_10048076 3300025924 Bacteria 3300
449 Ga0207694_10064323 3300025924 Bacteria 2859
450 Ga0207694_10190336 3300025924 Bacteria 1666
451 Ga0207650_10000036 3300025925 Bacteria 214579
452 Ga0207650_10011352 3300025925 Bacteria 6130
453 Ga0207650_10239834 3300025925 Bacteria 1465
454 Ga0207650_10899346 3300025925 Bacteria 752
455 Ga0207659_10023383 3300025926 Unclassified 4123
456 Ga0207687_10011597 3300025927 Bacteria 5762
457 Ga0207687_10019765 3300025927 Bacteria 4465
458 Ga0207687_10155287 3300025927 Bacteria 1750
459 Ga0207687_10542550 3300025927 Bacteria 975
460 Ga0207700_10005478 3300025928 Bacteria 7606
461 Ga0207700_10022498 3300025928 Bacteria 4329
462 Ga0207700_10059461 3300025928 Unclassified 2891
463 Ga0207700_10704173 3300025928 Bacteria 902
464 Ga0207700_10720186 3300025928 Bacteria 891
465 Ga0207664_10011150 3300025929 Bacteria 6371
466 Ga0207664_10074274 3300025929 Bacteria 2746
467 Ga0207664_10975218 3300025929 Bacteria 760
468 Ga0207644_10022145 3300025931 Bacteria 4338
469 Ga0207690_10013794 3300025932 Bacteria 4866
470 Ga0207706_10000165 3300025933 Bacteria 73590
471 Ga0207706_10008281 3300025933 Bacteria 9592
472 Ga0207706_10010021 3300025933 Bacteria 8682
473 Ga0207686_10014823 3300025934 Bacteria 4350
474 Ga0207686_10197194 3300025934 Bacteria 1439
475 Ga0207709_10032709 3300025935 Bacteria 3048
476 Ga0207670_10087390 3300025936 Bacteria 2196
477 Ga0207704_10022377 3300025938 Bacteria 3385
478 Ga0207704_10077093 3300025938 Unclassified 2138
479 Ga0207704_10110705 3300025938 Bacteria 1855
480 Ga0207704_10177049 3300025938 Bacteria 1537
481 Ga0207665_10000574 3300025939 Bacteria 24696
482 Ga0207665_10003888 3300025939 Bacteria 9991
483 Ga0207665_10004799 3300025939 Bacteria 9003
484 Ga0207665_10165295 3300025939 Unclassified 1594
485 Ga0207665_10228603 3300025939 Unclassified 1366
486 Ga0207665_10295494 3300025939 Bacteria 1209
487 Ga0207691_10012527 3300025940 Bacteria 8129
488 Ga0207711_10002093 3300025941 Bacteria 18016
489 Ga0207711_10012064 3300025941 Bacteria 7183
490 Ga0207711_10059374 3300025941 Bacteria 3293
491 Ga0207711_10174258 3300025941 Bacteria 1953
492 Ga0207689_10001192 3300025942 Bacteria 24972
493 Ga0207689_10025271 3300025942 Bacteria 4977
494 Ga0207689_10130112 3300025942 Bacteria 2071
495 Ga0207661_10518080 3300025944 Bacteria 1090
496 Ga0207679_10007222 3300025945 Bacteria 7039
497 Ga0207679_10013609 3300025945 Bacteria 5334
498 Ga0207679_10095908 3300025945 Bacteria 2307
499 Ga0207679_10210098 3300025945 Bacteria 1631
500 Ga0207679_10343090 3300025945 Bacteria 1299
501 Ga0207667_10001662 3300025949 Bacteria 28037
502 Ga0207667_10002616 3300025949 Bacteria 22316
503 Ga0207667_10009669 3300025949 Bacteria 11342
504 Ga0207667_10067545 3300025949 Bacteria 3724
505 Ga0207667_10242463 3300025949 Bacteria 1844
506 Ga0207667_11337504 3300025949 Bacteria 692
507 Ga0207651_10005431 3300025960 Bacteria 6541
508 Ga0207651_10132204 3300025960 Bacteria 1912
509 Ga0207668_10010385 3300025972 Bacteria 5625
510 Ga0207668_10057446 3300025972 Bacteria 2714
511 Ga0207640_10014822 3300025981 Bacteria 4496
512 Ga0207640_10043454 3300025981 Bacteria 2872
513 Ga0207640_10099957 3300025981 Bacteria 2031
514 Ga0207640_10113094 3300025981 Bacteria 1929
515 Ga0207658_10014425 3300025986 Bacteria 5409
516 Ga0207658_10120941 3300025986 Unclassified 2088
517 Ga0207658_10572913 3300025986 Unclassified 1012
518 Ga0207677_10002758 3300026023 Bacteria 9276
519 Ga0207677_10015908 3300026023 Unclassified 4441
520 Ga0207677_10051976 3300026023 Bacteria 2781
521 Ga0207677_10061860 3300026023 Bacteria 2594
522 Ga0207677_10406042 3300026023 Bacteria 1156
523 Ga0207703_10050524 3300026035 Unclassified 3366
524 Ga0207703_10140480 3300026035 Unclassified 2095
525 Ga0207703_10158650 3300026035 Bacteria 1979
526 Ga0207703_10246162 3300026035 Bacteria 1609
527 Ga0207639_10299361 3300026041 Bacteria 1421
528 Ga0207639_10350976 3300026041 Bacteria 1317
529 Ga0207678_10001477 3300026067 Bacteria 21564
530 Ga0207678_10006194 3300026067 Bacteria 10629
531 Ga0207708_10325338 3300026075 Unclassified 1255
532 Ga0207702_10000216 3300026078 Bacteria 67884
533 Ga0207702_10011343 3300026078 Bacteria 7430
534 Ga0207702_10031251 3300026078 Bacteria 4437
535 Ga0207702_10042012 3300026078 Bacteria 3834
536 Ga0207702_10105163 3300026078 Bacteria 2500
537 Ga0207702_10198529 3300026078 Unclassified 1858
538 Ga0207702_10267601 3300026078 Bacteria 1611
539 Ga0207641_10000009 3300026088 Bacteria 407901
540 Ga0207641_10080966 3300026088 Bacteria 2819
541 Ga0207641_10175245 3300026088 Bacteria 1961
542 Ga0207641_10665775 3300026088 Unclassified 1023
543 Ga0207648_10000326 3300026089 Bacteria 52122
544 Ga0207648_10070581 3300026089 Bacteria 3045
545 Ga0207648_10169567 3300026089 Unclassified 1929
546 Ga0207676_10000092 3300026095 Bacteria 80704
547 Ga0207676_10024247 3300026095 Bacteria 4487
548 Ga0207674_10000016 3300026116 Bacteria 182470
549 Ga0207674_10001619 3300026116 Bacteria 28985
550 Ga0207674_10004568 3300026116 Bacteria 16625
551 Ga0207674_10068835 3300026116 Bacteria 3561
552 Ga0207674_10141993 3300026116 Bacteria 2361
553 Ga0207675_100299587 3300026118 Bacteria 1566
554 Ga0207675_100408925 3300026118 Unclassified 1338
555 Ga0207683_10000359 3300026121 Bacteria 41891
556 Ga0207698_10039920 3300026142 Bacteria 3482
557 Ga0207698_10065753 3300026142 Bacteria 2850
558 Ga0207698_10415253 3300026142 Bacteria 1290
559 Ga0207698_10424828 3300026142 Bacteria 1276
560 Ga0209966_1006354 3300027695 Bacteria 2050
561 Ga0265356_1003425 3300028017 Bacteria 2007
562 Ga0268266_10032227 3300028379 Unclassified 4453
563 Ga0268266_10074112 3300028379 Bacteria 2955
564 Ga0268266_11056269 3300028379 Bacteria 786
565 Ga0268265_10185706 3300028380 Bacteria 1790
566 Ga0268265_10232062 3300028380 Bacteria 1622
567 Ga0268264_10012944 3300028381 Bacteria 6860
568 Ga0268264_10018752 3300028381 Bacteria 5657
569 Ga0268264_10196641 3300028381 Bacteria 1841
570 Ga0265326_10049232 3300028558 Bacteria 1194
571 Ga0265338_10048803 3300028800 Unclassified 3846
572 Ga0265338_10297899 3300028800 Unclassified 1173
573 Ga0265762_1000876 3300030760 Bacteria 5361
574 Ga0265762_1002847 3300030760 Bacteria 3093
575 Ga0265765_1003260 3300030879 Bacteria 1619
576 Ga0265760_10000115 3300031090 Bacteria 20404
577 Ga0265760_10012217 3300031090 Unclassified 2454
578 Ga0265330_10019280 3300031235 Bacteria 3128
579 Ga0265339_10034914 3300031249 Bacteria 2824
580 Ga0265316_10009500 3300031344 Bacteria 8957
581 Ga0265316_10079402 3300031344 Unclassified 2518
582 Ga0265314_10068053 3300031711 Bacteria 2395
583 Ga0265342_10102944 3300031712 Unclassified 1624
584 Ga0307416_100040214 3300032002 Bacteria 3630
585 Ga0373926_0025305 3300035083 Unclassified 2070
586 Ga0373932_0034487 3300035112 Bacteria 1426
587 Ga0373936_0014608 3300035113 Unclassified 3006
588 Ga0373954_0009994 3300035118 Bacteria 4180
589 Ga0373957_0235068 3300035120 Bacteria 769
590 Ga0373943_0014495 3300035170 Bacteria 3570
591 Ga0373955_0118165 3300035172 Bacteria 1539
592 Ga0373924_0066136 3300035410 Bacteria 1519
593 Ga0373924_0158515 3300035410 Bacteria 992
594 Ga0373931_0022342 3300035691 Bacteria 3183
595 Ga0373931_0030429 3300035691 Unclassified 2779
596 Ga0373931_0046211 3300035691 Bacteria 2301
597 Ga0373931_0295883 3300035691 Bacteria 998
598 Ga0373935_0011877 3300035692 Bacteria 5232
599 Ga0373935_0130922 3300035692 Bacteria 1686
600 Ga0373927_0042338 3300035695 Bacteria 2950
601 Ga0373927_0058548 3300035695 Bacteria 2492
602 Ga0373933_0002035 3300035724 Bacteria 11627
603 Ga0373933_0170947 3300035724 Bacteria 1383
604 Ga0373933_0180862 3300035724 Bacteria 1345
605 Ga0373933_0208370 3300035724 Unclassified 1252
606 Ga0373947_0009012 3300035725 Bacteria 5738
607 Ga0373947_0106009 3300035725 Unclassified 1771
608 Ga0373937_0016558 3300036401 Bacteria 6547
609 Ga0373937_0077543 3300036401 Bacteria 3071
610 Ga0373937_0163615 3300036401 Unclassified 2086
611 Ga0373937_0440844 3300036401 Bacteria 1236
612 Ga0373937_0561488 3300036401 Unclassified 1084
613 Ga0373937_0573281 3300036401 Unclassified 1072
614 Ga0373925_0010044 3300037068 Bacteria 6876
615 Ga0373925_0122239 3300037068 Bacteria 2022
616 Ga0373925_0188415 3300037068 Bacteria 1636
617 Ga0395905_0274320 3300037471 Bacteria 1572
618 Ga0395905_0315721 3300037471 Unclassified 1452
619 Ga0395901_0316397 3300038443 Bacteria 1616
620 Ga0436365_1781692 3300039437 Bacteria 1028
621 Ga0436360_0517554 3300039438 Bacteria 902
622 Ga0436360_1370952 3300039438 Bacteria 3422
623 Ga0436361_0976825 3300039447 Bacteria 780
624 Ga0436363_0859318 3300039450 Unclassified 2046
625 Ga0436363_1170876 3300039450 Bacteria 830
626 Ga0436362_0529442 3300039453 Unclassified 1269
627 Ga0451839_0809308 3300041496 Bacteria 735
628 Ga0439448_0076326 3300042005 Bacteria 1121
629 Ga0451577_0001499 3300042876 Bacteria 30880
630 Ga0453683_0032487 3300044673 Bacteria 3294
631 Ga0453683_0075125 3300044673 Bacteria 2116
632 Ga0466963_0003785 3300044694 Bacteria 8722
633 Ga0466963_0457517 3300044694 Unclassified 901
634 Ga0453684_0000698 3300044712 Bacteria 119496
635 Ga0466957_0028175 3300044842 Bacteria 3343
636 Ga0451576_0022087 3300045051 Bacteria 6905
637 Ga0451576_0023250 3300045051 Bacteria 6713
638 Ga0451576_0170681 3300045051 Bacteria 2270
639 Ga0451576_0332666 3300045051 Bacteria 1590
640 Ga0466967_0009313 3300045976 Bacteria 7277
641 Ga0466967_0077881 3300045976 Bacteria 2985
642 Ga0495590_0123319 3300046457 Bacteria 929
643 Ga0495580_0000204 3300046472 Bacteria 45607
644 Ga0495580_0000219 3300046472 Bacteria 44268
645 Ga0495580_0001024 3300046472 Bacteria 24541
646 Ga0495580_0006948 3300046472 Bacteria 9131
647 Ga0495580_0010147 3300046472 Bacteria 7357
648 Ga0495580_0029342 3300046472 Unclassified 3993
649 Ga0495580_0049396 3300046472 Unclassified 2977
650 Ga0495580_0072278 3300046472 Bacteria 2409
651 Ga0495582_0003159 3300046473 Bacteria 9248
652 Ga0495594_0069803 3300046499 Unclassified 1952
653 Ga0495665_0001183 3300046531 Bacteria 13898
654 Ga0495587_0367202 3300046536 Bacteria 801
655 Ga0495667_0042172 3300046559 Bacteria 3026
656 Ga0495625_0000571 3300046660 Bacteria 53797
657 Ga0495635_0180255 3300046663 Unclassified 1436
658 Ga0495635_0220685 3300046663 Unclassified 1282
659 Ga0495588_0166416 3300046674 Unclassified 1166
660 Ga0495623_0097929 3300046679 Bacteria 1791
661 Ga0495658_0052261 3300046683 Unclassified 2317
662 Ga0495669_0080479 3300046684 Bacteria 1495
663 Ga0495581_0086874 3300047315 Unclassified 1813
664 Ga0495636_0239861 3300047318 Bacteria 836
665 Ga0495674_0349563 3300047319 Bacteria 1200
666 Ga0495674_0548793 3300047319 Unclassified 920
667 Ga0495684_0339936 3300047471 Unclassified 1068
668 Ga0495684_0407606 3300047471 Unclassified 953
669 Ga0495602_0073160 3300048088 Bacteria 2919
670 Ga0495602_0152229 3300048088 Bacteria 1816
671 Ga0496100_0065436 3300048903 Unclassified 2409
672 Ga0496100_0091545 3300048903 Unclassified 2076
673 Ga0496100_0097159 3300048903 Bacteria 2022
674 Ga0496100_0128813 3300048903 Bacteria 1780
675 Ga0496101_0038318 3300048904 Bacteria 3404
676 Ga0496101_0268269 3300048904 Bacteria 1332
677 Ga0496101_0468688 3300048904 Bacteria 994
678 Ga0496102_0004659 3300048905 Bacteria 11601
679 Ga0496102_0034222 3300048905 Bacteria 4569
680 Ga0496102_0035418 3300048905 Bacteria 4493
681 Ga0496102_0041429 3300048905 Bacteria 4170
682 Ga0496102_0110529 3300048905 Bacteria 2562
683 Ga0496102_0245318 3300048905 Unclassified 1689
684 Ga0496102_0404013 3300048905 Bacteria 1284
685 Ga0496102_0765306 3300048905 Bacteria 888
686 Ga0496103_0000974 3300048906 Bacteria 20261
687 Ga0496103_0068110 3300048906 Bacteria 2224
688 Ga0496104_0032081 3300048907 Unclassified 4889
689 Ga0496104_0039109 3300048907 Bacteria 4440
690 Ga0496104_0083008 3300048907 Bacteria 3056
691 Ga0496104_0179604 3300048907 Bacteria 2027
692 Ga0496104_0190016 3300048907 Unclassified 1965
693 Ga0496104_1087585 3300048907 Bacteria 703
694 Ga0496105_0314552 3300048908 Bacteria 1256
695 Ga0496105_0337293 3300048908 Bacteria 1206
696 Ga0496105_0608680 3300048908 Bacteria 847
697 Ga0496106_0266486 3300048909 Bacteria 1371
698 Ga0496106_0286723 3300048909 Unclassified 1320
699 Ga0496107_0051119 3300048910 Bacteria 2980
700 Ga0496107_0118686 3300048910 Unclassified 1948
701 Ga0496107_0136383 3300048910 Bacteria 1813
702 Ga0496108_0017665 3300048911 Bacteria 5837
703 Ga0496108_0888696 3300048911 Bacteria 765
704 Ga0496109_0000524 3300048912 Bacteria 32521
705 Ga0496109_0062942 3300048912 Bacteria 3393
706 Ga0496109_0292638 3300048912 Bacteria 1535
707 Ga0496110_0001679 3300048913 Bacteria 16247
708 Ga0496110_0152029 3300048913 Bacteria 2096
709 Ga0496111_0046363 3300048914 Unclassified 3130
710 Ga0496111_0144538 3300048914 Unclassified 1763
711 Ga0496112_0000645 3300048915 Bacteria 24241
712 Ga0496112_0000753 3300048915 Bacteria 22676
713 Ga0496112_0003806 3300048915 Bacteria 12612
714 Ga0496112_0020118 3300048915 Bacteria 6319
715 Ga0496112_0108004 3300048915 Bacteria 2753
716 Ga0496112_0185071 3300048915 Unclassified 2046
717 Ga0496112_0361511 3300048915 Bacteria 1393
718 Ga0496112_0475784 3300048915 Bacteria 1186
719 Ga0496113_0016848 3300048916 Bacteria 5057
720 Ga0496113_0245314 3300048916 Bacteria 1429
721 Ga0496114_0077357 3300048917 Bacteria 2805
722 Ga0496115_0027517 3300048918 Bacteria 4448
723 Ga0496115_0368790 3300048918 Bacteria 1169
724 Ga0496115_0837118 3300048918 Bacteria 714
725 Ga0501298_011581 3300049521 Bacteria 1534
726 Ga0501083_0037263 3300049744 Bacteria 3313
727 nmdc:mga05p37_519527_c1 3300050507 Bacteria 1362
728 nmdc:mga0n895_12417_c1 3300050512 Bacteria 7640
729 nmdc:mga0n895_5233_c1 3300050512 Bacteria 10810
730 nmdc:mga0n895_7198_c1 3300050512 Bacteria 9526
731 nmdc:mga0rr50_362294_c1 3300050513 Bacteria 1220
732 nmdc:mga0rr50_40379_c1 3300050513 Bacteria 3392
733 nmdc:mga0rr50_563_c1 3300050513 Bacteria 19875
734 nmdc:mga08x19_52431_c1 3300050514 Bacteria 2624
735 nmdc:mga0a205_279_c1 3300050515 Bacteria 37324
736 Ga0495619_0102182 3300053085 Bacteria 1952
737 Ga0495619_0127146 3300053085 Bacteria 1750
738 Ga0495619_0342115 3300053085 Unclassified 1035
739 Ga0501084_0017102 3300054114 Bacteria 6024
740 Ga0501084_0514520 3300054114 Bacteria 1012

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021441 Ga0213871_10010658 Ga0213871_100106582 185
2 3300039438 Ga0436360_1370952 Ga0436360_1370952_1512_2150 185
3 3300039447 Ga0436361_0976825 Ga0436361_0976825_113_751 185
4 3300021361 Ga0213872_10014339 Ga0213872_100143394 186
5 3300035118 Ga0373954_0009994 Ga0373954_0009994_716_1342 186
6 3300035410 Ga0373924_0066136 Ga0373924_0066136_173_799 186
7 3300035724 Ga0373933_0002035 Ga0373933_0002035_7148_7774 186
8 3300036401 Ga0373937_0016558 Ga0373937_0016558_5699_6325 186
9 3300046559 Ga0495667_0042172 Ga0495667_0042172_1196_1822 186
10 3300053085 Ga0495619_0102182 Ga0495619_0102182_1000_1626 186
11 3300025922 Ga0207646_10240092 Ga0207646_102400922 188
12 3300039437 Ga0436365_1781692 Ga0436365_1781692_350_988 188
13 3300039450 Ga0436363_1170876 Ga0436363_1170876_57_695 188
14 3300025986 Ga0207658_10572913 Ga0207658_105729132 189
15 3300005328 Ga0070676_10168073 Ga0070676_101680731 190
16 3300005331 Ga0070670_100017561 Ga0070670_1000175616 190
17 3300005334 Ga0068869_100016098 Ga0068869_1000160981 190
18 3300005336 Ga0070680_100050994 Ga0070680_1000509942 190
19 3300005337 Ga0070682_100241713 Ga0070682_1002417132 190
20 3300005338 Ga0068868_100013694 Ga0068868_1000136946 190
21 3300005338 Ga0068868_100095358 Ga0068868_1000953583 190
22 3300005344 Ga0070661_100025961 Ga0070661_1000259616 190
23 3300005354 Ga0070675_101031738 Ga0070675_1010317381 190
24 3300005364 Ga0070673_100038009 Ga0070673_1000380092 190
25 3300005367 Ga0070667_100558858 Ga0070667_1005588582 190
26 3300005436 Ga0070713_100111385 Ga0070713_1001113852 190
27 3300005440 Ga0070705_100082611 Ga0070705_1000826112 190
28 3300005458 Ga0070681_10000394 Ga0070681_1000039426 190
29 3300005458 Ga0070681_10006170 Ga0070681_1000617010 190
30 3300005459 Ga0068867_100070899 Ga0068867_1000708994 190
31 3300005530 Ga0070679_100003147 Ga0070679_1000031474 190
32 3300005530 Ga0070679_100728138 Ga0070679_1007281382 190
33 3300005535 Ga0070684_100169466 Ga0070684_1001694663 190
34 3300005563 Ga0068855_100000363 Ga0068855_10000036334 190
35 3300005563 Ga0068855_100017122 Ga0068855_1000171222 190
36 3300005563 Ga0068855_100026911 Ga0068855_1000269113 190
37 3300005564 Ga0070664_100002997 Ga0070664_1000029976 190
38 3300005564 Ga0070664_100054826 Ga0070664_1000548264 190
39 3300005577 Ga0068857_100007495 Ga0068857_1000074954 190
40 3300005577 Ga0068857_100083853 Ga0068857_1000838532 190
41 3300005578 Ga0068854_100019906 Ga0068854_1000199066 190
42 3300005578 Ga0068854_100069721 Ga0068854_1000697213 190
43 3300005614 Ga0068856_100000567 Ga0068856_10000056724 190
44 3300005614 Ga0068856_100001253 Ga0068856_10000125320 190
45 3300005614 Ga0068856_100005099 Ga0068856_1000050992 190
46 3300005616 Ga0068852_100149480 Ga0068852_1001494803 190
47 3300005616 Ga0068852_100286745 Ga0068852_1002867453 190
48 3300005616 Ga0068852_100653742 Ga0068852_1006537422 190
49 3300005617 Ga0068859_100005456 Ga0068859_1000054566 190
50 3300005618 Ga0068864_100035678 Ga0068864_1000356785 190
51 3300005718 Ga0068866_10002392 Ga0068866_100023924 190
52 3300005719 Ga0068861_100261058 Ga0068861_1002610583 190
53 3300005841 Ga0068863_100053166 Ga0068863_1000531665 190
54 3300005842 Ga0068858_100047672 Ga0068858_1000476725 190
55 3300005843 Ga0068860_100013919 Ga0068860_1000139191 190
56 3300006028 Ga0070717_10213647 Ga0070717_102136472 190
57 3300006237 Ga0097621_100000085 Ga0097621_10000008533 190
58 3300006237 Ga0097621_100011556 Ga0097621_1000115562 190
59 3300006237 Ga0097621_100107138 Ga0097621_1001071383 190
60 3300006358 Ga0068871_100000849 Ga0068871_1000008493 190
61 3300006358 Ga0068871_100001152 Ga0068871_10000115215 190
62 3300006358 Ga0068871_100050117 Ga0068871_1000501173 190
63 3300006881 Ga0068865_100122818 Ga0068865_1001228182 190
64 3300006931 Ga0097620_100005456 Ga0097620_1000054566 190
65 3300009093 Ga0105240_10015732 Ga0105240_100157326 190
66 3300009093 Ga0105240_10068049 Ga0105240_100680494 190
67 3300009174 Ga0105241_10088013 Ga0105241_100880131 190
68 3300009176 Ga0105242_10035519 Ga0105242_100355194 190
69 3300009545 Ga0105237_10515262 Ga0105237_105152623 190
70 3300009551 Ga0105238_10001062 Ga0105238_100010628 190
71 3300010375 Ga0105239_10135395 Ga0105239_101353952 190
72 3300010375 Ga0105239_11135423 Ga0105239_111354232 190
73 3300013100 Ga0157373_10183599 Ga0157373_101835993 190
74 3300013102 Ga0157371_10123618 Ga0157371_101236182 190
75 3300013102 Ga0157371_10126323 Ga0157371_101263232 190
76 3300013105 Ga0157369_10000386 Ga0157369_1000038619 190
77 3300013105 Ga0157369_10584251 Ga0157369_105842512 190
78 3300013296 Ga0157374_10000253 Ga0157374_1000025332 190
79 3300013296 Ga0157374_10000453 Ga0157374_1000045319 190
80 3300013296 Ga0157374_10000609 Ga0157374_1000060941 190
81 3300013297 Ga0157378_10000117 Ga0157378_1000011741 190
82 3300013297 Ga0157378_10000321 Ga0157378_1000032110 190
83 3300013297 Ga0157378_10001717 Ga0157378_100017173 190
84 3300013307 Ga0157372_10000500 Ga0157372_1000050024 190
85 3300013307 Ga0157372_10007417 Ga0157372_1000741711 190
86 3300013307 Ga0157372_10008139 Ga0157372_100081398 190
87 3300025899 Ga0207642_10012301 Ga0207642_100123012 190
88 3300025911 Ga0207654_10010110 Ga0207654_100101104 190
89 3300025911 Ga0207654_10101876 Ga0207654_101018763 190
90 3300025912 Ga0207707_10008181 Ga0207707_100081816 190
91 3300025913 Ga0207695_10033887 Ga0207695_100338877 190
92 3300025916 Ga0207663_10708940 Ga0207663_107089401 190
93 3300025917 Ga0207660_10247934 Ga0207660_102479341 190
94 3300025917 Ga0207660_10333057 Ga0207660_103330572 190
95 3300025920 Ga0207649_10171276 Ga0207649_101712762 190
96 3300025921 Ga0207652_10322587 Ga0207652_103225872 190
97 3300025921 Ga0207652_10640248 Ga0207652_106402482 190
98 3300025924 Ga0207694_10000816 Ga0207694_1000081619 190
99 3300025925 Ga0207650_10011352 Ga0207650_100113523 190
100 3300025938 Ga0207704_10110705 Ga0207704_101107053 190
101 3300025942 Ga0207689_10130112 Ga0207689_101301123 190
102 3300025945 Ga0207679_10095908 Ga0207679_100959082 190
103 3300025945 Ga0207679_10343090 Ga0207679_103430902 190
104 3300025949 Ga0207667_10001662 Ga0207667_1000166219 190
105 3300025949 Ga0207667_10009669 Ga0207667_100096696 190
106 3300025960 Ga0207651_10132204 Ga0207651_101322042 190
107 3300025981 Ga0207640_10099957 Ga0207640_100999573 190
108 3300026023 Ga0207677_10051976 Ga0207677_100519763 190
109 3300026035 Ga0207703_10140480 Ga0207703_101404802 190
110 3300026041 Ga0207639_10350976 Ga0207639_103509762 190
111 3300026078 Ga0207702_10000216 Ga0207702_1000021619 190
112 3300026078 Ga0207702_10011343 Ga0207702_100113432 190
113 3300026078 Ga0207702_10105163 Ga0207702_101051632 190
114 3300026088 Ga0207641_10665775 Ga0207641_106657751 190
115 3300026089 Ga0207648_10070581 Ga0207648_100705813 190
116 3300026095 Ga0207676_10024247 Ga0207676_100242473 190
117 3300026116 Ga0207674_10001619 Ga0207674_100016194 190
118 3300026116 Ga0207674_10004568 Ga0207674_1000456813 190
119 3300026118 Ga0207675_100299587 Ga0207675_1002995873 190
120 3300026142 Ga0207698_10039920 Ga0207698_100399204 190
121 3300026142 Ga0207698_10415253 Ga0207698_104152532 190
122 3300028381 Ga0268264_10196641 Ga0268264_101966412 190
123 3300035691 Ga0373931_0046211 Ga0373931_0046211_198_830 190
124 3300048905 Ga0496102_0035418 Ga0496102_0035418_1487_2110 190
125 3300048907 Ga0496104_0032081 Ga0496104_0032081_3060_3683 190
126 3300048908 Ga0496105_0314552 Ga0496105_0314552_287_910 190
127 3300048915 Ga0496112_0000753 Ga0496112_0000753_16496_17119 190
128 3300048915 Ga0496112_0108004 Ga0496112_0108004_353_985 190
129 3300007076 Ga0075435_100327232 Ga0075435_1003272322 191
130 3300025928 Ga0207700_10720186 Ga0207700_107201861 191
131 3300035120 Ga0373957_0235068 Ga0373957_0235068_68_691 191
132 3300035410 Ga0373924_0158515 Ga0373924_0158515_246_890 191
133 3300046472 Ga0495580_0000219 Ga0495580_0000219_42701_43324 191
134 3300046536 Ga0495587_0367202 Ga0495587_0367202_143_766 191
135 3300047319 Ga0495674_0349563 Ga0495674_0349563_155_799 191
136 3300047319 Ga0495674_0548793 Ga0495674_0548793_25_648 191
137 3300048088 Ga0495602_0073160 Ga0495602_0073160_164_787 191
138 3300013104 Ga0157370_10569299 Ga0157370_105692991 192
139 3300035724 Ga0373933_0208370 Ga0373933_0208370_99_743 192
140 3300042876 Ga0451577_0001499 Ga0451577_0001499_26992_27615 192
141 3300044673 Ga0453683_0032487 Ga0453683_0032487_1259_1882 192
142 3300044712 Ga0453684_0000698 Ga0453684_0000698_106063_106686 192
143 3300045051 Ga0451576_0023250 Ga0451576_0023250_2852_3475 192
144 3300005530 Ga0070679_100197934 Ga0070679_1001979341 193
145 3300025921 Ga0207652_11029684 Ga0207652_110296841 193
146 3300041496 Ga0451839_0809308 Ga0451839_0809308_136_717 193
147 3300054114 Ga0501084_0017102 Ga0501084_0017102_2355_2990 193
148 3300044673 Ga0453683_0075125 Ga0453683_0075125_42_665 194
149 3300005334 Ga0068869_100005202 Ga0068869_1000052028 196
150 3300005338 Ga0068868_100021622 Ga0068868_1000216224 196
151 3300005345 Ga0070692_10368934 Ga0070692_103689341 196
152 3300005563 Ga0068855_100140727 Ga0068855_1001407274 196
153 3300005617 Ga0068859_100256708 Ga0068859_1002567082 196
154 3300005841 Ga0068863_100172280 Ga0068863_1001722803 196
155 3300005842 Ga0068858_100001949 Ga0068858_10000194914 196
156 3300005843 Ga0068860_100013886 Ga0068860_1000138864 196
157 3300006237 Ga0097621_100210938 Ga0097621_1002109382 196
158 3300006358 Ga0068871_100270673 Ga0068871_1002706732 196
159 3300006881 Ga0068865_100040872 Ga0068865_1000408723 196
160 3300006931 Ga0097620_100256708 Ga0097620_1002567082 196
161 3300009177 Ga0105248_10165076 Ga0105248_101650763 196
162 3300009545 Ga0105237_10076870 Ga0105237_100768704 196
163 3300009551 Ga0105238_10829387 Ga0105238_108293871 196
164 3300010375 Ga0105239_10010258 Ga0105239_100102586 196
165 3300013296 Ga0157374_10020887 Ga0157374_100208875 196
166 3300013306 Ga0163162_10008600 Ga0163162_100086005 196
167 3300013308 Ga0157375_10315092 Ga0157375_103150922 196
168 3300014968 Ga0157379_10051006 Ga0157379_100510064 196
169 3300014969 Ga0157376_10107726 Ga0157376_101077264 196
170 3300025899 Ga0207642_10065030 Ga0207642_100650303 196
171 3300025904 Ga0207647_10018466 Ga0207647_100184666 196
172 3300025914 Ga0207671_10086349 Ga0207671_100863491 196
173 3300025938 Ga0207704_10077093 Ga0207704_100770933 196
174 3300025942 Ga0207689_10001192 Ga0207689_100011925 196
175 3300026023 Ga0207677_10015908 Ga0207677_100159084 196
176 3300026035 Ga0207703_10050524 Ga0207703_100505244 196
177 3300026075 Ga0207708_10325338 Ga0207708_103253381 196
178 3300026089 Ga0207648_10169567 Ga0207648_101695671 196
179 3300026118 Ga0207675_100408925 Ga0207675_1004089251 196
180 3300028381 Ga0268264_10012944 Ga0268264_100129446 196
181 3300048905 Ga0496102_0245318 Ga0496102_0245318_743_1366 196
182 3300048914 Ga0496111_0144538 Ga0496111_0144538_515_1138 196
183 3300048915 Ga0496112_0003806 Ga0496112_0003806_4224_4847 196
184 3300048918 Ga0496115_0837118 Ga0496115_0837118_59_682 196
185 3300005434 Ga0070709_10000616 Ga0070709_100006164 197
186 3300005436 Ga0070713_100002930 Ga0070713_10000293011 197
187 3300005436 Ga0070713_100029464 Ga0070713_1000294643 197
188 3300005437 Ga0070710_10388694 Ga0070710_103886941 197
189 3300005439 Ga0070711_100008149 Ga0070711_1000081495 197
190 3300006175 Ga0070712_100022710 Ga0070712_1000227104 197
191 3300007076 Ga0075435_100397917 Ga0075435_1003979172 197
192 3300013297 Ga0157378_10076181 Ga0157378_100761811 197
193 3300025898 Ga0207692_10028883 Ga0207692_100288833 197
194 3300025915 Ga0207693_10000076 Ga0207693_1000007612 197
195 3300025915 Ga0207693_10017801 Ga0207693_100178017 197
196 3300025916 Ga0207663_10019551 Ga0207663_100195514 197
197 3300025928 Ga0207700_10059461 Ga0207700_100594611 197
198 3300025939 Ga0207665_10003888 Ga0207665_100038886 197
199 3300044694 Ga0466963_0003785 Ga0466963_0003785_790_1464 197
200 3300044842 Ga0466957_0028175 Ga0466957_0028175_1409_2083 197
201 3300048915 Ga0496112_0185071 Ga0496112_0185071_1432_2025 197
202 3300005367 Ga0070667_100361708 Ga0070667_1003617083 198
203 3300005547 Ga0070693_100336138 Ga0070693_1003361381 198
204 3300005578 Ga0068854_100285975 Ga0068854_1002859752 198
205 3300005615 Ga0070702_100062406 Ga0070702_1000624063 198
206 3300006028 Ga0070717_11220297 Ga0070717_112202971 198
207 3300006237 Ga0097621_100002310 Ga0097621_1000023102 198
208 3300006358 Ga0068871_100002644 Ga0068871_1000026444 198
209 3300009176 Ga0105242_10039415 Ga0105242_100394153 198
210 3300009177 Ga0105248_10088691 Ga0105248_100886913 198
211 3300013297 Ga0157378_10000344 Ga0157378_100003445 198
212 3300025906 Ga0207699_10000566 Ga0207699_1000056616 199
213 3300025938 Ga0207704_10177049 Ga0207704_101770492 199
214 3300025941 Ga0207711_10059374 Ga0207711_100593743 199
215 3300005436 Ga0070713_100244727 Ga0070713_1002447272 200
216 3300025929 Ga0207664_10074274 Ga0207664_100742742 200
217 3300006028 Ga0070717_10005442 Ga0070717_100054424 201
218 3300021441 Ga0213871_10088726 Ga0213871_100887261 201
219 3300036401 Ga0373937_0561488 Ga0373937_0561488_154_786 201
220 3300039438 Ga0436360_0517554 Ga0436360_0517554_76_702 201
221 3300045051 Ga0451576_0170681 Ga0451576_0170681_904_1530 201
222 3300006173 Ga0070716_100263214 Ga0070716_1002632142 203
223 3300025939 Ga0207665_10295494 Ga0207665_102954942 203
224 3300046660 Ga0495625_0000571 Ga0495625_0000571_9648_10298 204
225 3300027695 Ga0209966_1006354 Ga0209966_10063544 205
226 3300000546 LJNas_1001663 LJNas_10016633 206
227 3300005468 Ga0070707_100427786 Ga0070707_1004277862 206
228 3300005518 Ga0070699_100001097 Ga0070699_1000010972 206
229 3300005536 Ga0070697_100232296 Ga0070697_1002322961 206
230 3300025910 Ga0207684_10007499 Ga0207684_100074996 206
231 3300025922 Ga0207646_10001171 Ga0207646_1000117128 206
232 3300025928 Ga0207700_10704173 Ga0207700_107041731 206
233 3300030879 Ga0265765_1003260 Ga0265765_10032601 206
234 3300031090 Ga0265760_10012217 Ga0265760_100122172 206
235 3300002074 JGI24748J21848_1004860 JGI24748J21848_10048603 207
236 3300005329 Ga0070683_100004265 Ga0070683_1000042656 207
237 3300005329 Ga0070683_100105372 Ga0070683_1001053723 207
238 3300005330 Ga0070690_100005060 Ga0070690_1000050603 207
239 3300005331 Ga0070670_100006784 Ga0070670_1000067848 207
240 3300005335 Ga0070666_10040737 Ga0070666_100407374 207
241 3300005336 Ga0070680_100285882 Ga0070680_1002858822 207
242 3300005337 Ga0070682_100008130 Ga0070682_1000081304 207
243 3300005338 Ga0068868_100002026 Ga0068868_1000020268 207
244 3300005338 Ga0068868_100019739 Ga0068868_1000197392 207
245 3300005339 Ga0070660_100006065 Ga0070660_10000606510 207
246 3300005343 Ga0070687_100142822 Ga0070687_1001428222 207
247 3300005344 Ga0070661_100001267 Ga0070661_1000012676 207
248 3300005347 Ga0070668_100005814 Ga0070668_1000058148 207
249 3300005347 Ga0070668_100067915 Ga0070668_1000679151 207
250 3300005355 Ga0070671_100262621 Ga0070671_1002626211 207
251 3300005356 Ga0070674_100006696 Ga0070674_1000066963 207
252 3300005364 Ga0070673_100001501 Ga0070673_1000015013 207
253 3300005366 Ga0070659_100037926 Ga0070659_1000379264 207
254 3300005367 Ga0070667_100560020 Ga0070667_1005600202 207
255 3300005434 Ga0070709_10535131 Ga0070709_105351311 207
256 3300005435 Ga0070714_100016644 Ga0070714_1000166443 207
257 3300005435 Ga0070714_100080762 Ga0070714_1000807624 207
258 3300005435 Ga0070714_100468304 Ga0070714_1004683042 207
259 3300005436 Ga0070713_100005635 Ga0070713_1000056357 207
260 3300005436 Ga0070713_100013379 Ga0070713_1000133792 207
261 3300005439 Ga0070711_100001964 Ga0070711_1000019648 207
262 3300005439 Ga0070711_100166528 Ga0070711_1001665282 207
263 3300005440 Ga0070705_100102487 Ga0070705_1001024872 207
264 3300005445 Ga0070708_100003650 Ga0070708_1000036504 207
265 3300005455 Ga0070663_100002712 Ga0070663_1000027126 207
266 3300005456 Ga0070678_100022680 Ga0070678_1000226804 207
267 3300005457 Ga0070662_100015183 Ga0070662_1000151835 207
268 3300005467 Ga0070706_100001186 Ga0070706_10000118614 207
269 3300005467 Ga0070706_100173048 Ga0070706_1001730484 207
270 3300005468 Ga0070707_100170263 Ga0070707_1001702631 207
271 3300005468 Ga0070707_100202869 Ga0070707_1002028692 207
272 3300005471 Ga0070698_100013035 Ga0070698_10001303510 207
273 3300005536 Ga0070697_100000353 Ga0070697_10000035317 207
274 3300005539 Ga0068853_100094337 Ga0068853_1000943372 207
275 3300005543 Ga0070672_100016320 Ga0070672_1000163205 207
276 3300005544 Ga0070686_100029896 Ga0070686_1000298963 207
277 3300005546 Ga0070696_100021981 Ga0070696_1000219814 207
278 3300005546 Ga0070696_100118457 Ga0070696_1001184573 207
279 3300005546 Ga0070696_100118652 Ga0070696_1001186523 207
280 3300005547 Ga0070693_100328840 Ga0070693_1003288401 207
281 3300005548 Ga0070665_100004403 Ga0070665_1000044034 207
282 3300005548 Ga0070665_100599578 Ga0070665_1005995782 207
283 3300005549 Ga0070704_100617549 Ga0070704_1006175491 207
284 3300005563 Ga0068855_100089317 Ga0068855_1000893173 207
285 3300005563 Ga0068855_100141947 Ga0068855_1001419473 207
286 3300005564 Ga0070664_100051695 Ga0070664_1000516953 207
287 3300005564 Ga0070664_100072469 Ga0070664_1000724692 207
288 3300005577 Ga0068857_100007012 Ga0068857_1000070126 207
289 3300005577 Ga0068857_100030777 Ga0068857_1000307773 207
290 3300005578 Ga0068854_100019834 Ga0068854_1000198344 207
291 3300005578 Ga0068854_100024465 Ga0068854_1000244656 207
292 3300005614 Ga0068856_100019487 Ga0068856_1000194874 207
293 3300005614 Ga0068856_100042725 Ga0068856_1000427254 207
294 3300005616 Ga0068852_100019826 Ga0068852_1000198263 207
295 3300005617 Ga0068859_100002574 Ga0068859_1000025743 207
296 3300005617 Ga0068859_100172492 Ga0068859_1001724922 207
297 3300005618 Ga0068864_100036809 Ga0068864_1000368096 207
298 3300005718 Ga0068866_10002717 Ga0068866_100027175 207
299 3300005834 Ga0068851_10007348 Ga0068851_100073484 207
300 3300005840 Ga0068870_10015186 Ga0068870_100151862 207
301 3300005841 Ga0068863_100330661 Ga0068863_1003306613 207
302 3300005842 Ga0068858_100018785 Ga0068858_1000187854 207
303 3300005842 Ga0068858_100051233 Ga0068858_1000512334 207
304 3300005843 Ga0068860_100338348 Ga0068860_1003383482 207
305 3300005844 Ga0068862_100017838 Ga0068862_1000178387 207
306 3300005844 Ga0068862_100020812 Ga0068862_1000208124 207
307 3300005844 Ga0068862_100076645 Ga0068862_1000766452 207
308 3300006028 Ga0070717_10001372 Ga0070717_100013724 207
309 3300006028 Ga0070717_10023154 Ga0070717_100231545 207
310 3300006028 Ga0070717_10037031 Ga0070717_100370314 207
311 3300006028 Ga0070717_10057743 Ga0070717_100577435 207
312 3300006028 Ga0070717_10282760 Ga0070717_102827603 207
313 3300006163 Ga0070715_10225387 Ga0070715_102253872 207
314 3300006173 Ga0070716_100003475 Ga0070716_1000034755 207
315 3300006173 Ga0070716_100021185 Ga0070716_1000211854 207
316 3300006173 Ga0070716_100114679 Ga0070716_1001146793 207
317 3300006175 Ga0070712_100035393 Ga0070712_1000353934 207
318 3300006237 Ga0097621_100005323 Ga0097621_1000053234 207
319 3300006237 Ga0097621_100009628 Ga0097621_1000096283 207
320 3300006237 Ga0097621_100251479 Ga0097621_1002514792 207
321 3300006358 Ga0068871_100087565 Ga0068871_1000875654 207
322 3300006358 Ga0068871_100107485 Ga0068871_1001074853 207
323 3300006358 Ga0068871_100240643 Ga0068871_1002406432 207
324 3300006881 Ga0068865_100023722 Ga0068865_1000237225 207
325 3300006914 Ga0075436_100002566 Ga0075436_10000256613 207
326 3300006914 Ga0075436_100083301 Ga0075436_1000833013 207
327 3300006931 Ga0097620_100002574 Ga0097620_1000025743 207
328 3300006931 Ga0097620_100172484 Ga0097620_1001724842 207
329 3300007076 Ga0075435_100297163 Ga0075435_1002971632 207
330 3300007265 Ga0099794_10020087 Ga0099794_100200873 207
331 3300009093 Ga0105240_10059592 Ga0105240_100595924 207
332 3300009098 Ga0105245_10092535 Ga0105245_100925354 207
333 3300009098 Ga0105245_10249019 Ga0105245_102490192 207
334 3300009101 Ga0105247_10003382 Ga0105247_100033826 207
335 3300009101 Ga0105247_10007088 Ga0105247_100070886 207
336 3300009101 Ga0105247_10081606 Ga0105247_100816062 207
337 3300009148 Ga0105243_10114212 Ga0105243_101142123 207
338 3300009174 Ga0105241_10016466 Ga0105241_100164662 207
339 3300009174 Ga0105241_10033908 Ga0105241_100339083 207
340 3300009174 Ga0105241_10111525 Ga0105241_101115252 207
341 3300009174 Ga0105241_10196119 Ga0105241_101961191 207
342 3300009176 Ga0105242_10017634 Ga0105242_100176346 207
343 3300009176 Ga0105242_10024113 Ga0105242_100241134 207
344 3300009176 Ga0105242_10430487 Ga0105242_104304872 207
345 3300009177 Ga0105248_10166896 Ga0105248_101668963 207
346 3300009545 Ga0105237_10023675 Ga0105237_100236754 207
347 3300009545 Ga0105237_10261227 Ga0105237_102612273 207
348 3300009551 Ga0105238_10103856 Ga0105238_101038562 207
349 3300009553 Ga0105249_10007882 Ga0105249_100078828 207
350 3300009553 Ga0105249_10042627 Ga0105249_100426273 207
351 3300010375 Ga0105239_10025677 Ga0105239_100256773 207
352 3300010375 Ga0105239_10357982 Ga0105239_103579823 207
353 3300010375 Ga0105239_10681252 Ga0105239_106812522 207
354 3300011119 Ga0105246_10001225 Ga0105246_1000122514 207
355 3300011119 Ga0105246_10014314 Ga0105246_100143143 207
356 3300013100 Ga0157373_10027170 Ga0157373_100271703 207
357 3300013102 Ga0157371_10007268 Ga0157371_100072683 207
358 3300013102 Ga0157371_10008322 Ga0157371_100083224 207
359 3300013105 Ga0157369_10022554 Ga0157369_100225548 207
360 3300013296 Ga0157374_10003439 Ga0157374_100034396 207
361 3300013296 Ga0157374_10381540 Ga0157374_103815402 207
362 3300013296 Ga0157374_10459018 Ga0157374_104590182 207
363 3300013296 Ga0157374_10533625 Ga0157374_105336252 207
364 3300013297 Ga0157378_10121398 Ga0157378_101213982 207
365 3300013306 Ga0163162_10008790 Ga0163162_100087905 207
366 3300013306 Ga0163162_10013645 Ga0163162_100136454 207
367 3300013306 Ga0163162_10068095 Ga0163162_100680952 207
368 3300013306 Ga0163162_10144719 Ga0163162_101447192 207
369 3300013307 Ga0157372_10004725 Ga0157372_1000472514 207
370 3300013307 Ga0157372_10019084 Ga0157372_100190844 207
371 3300013307 Ga0157372_10065584 Ga0157372_100655844 207
372 3300013307 Ga0157372_10154041 Ga0157372_101540413 207
373 3300013308 Ga0157375_10050921 Ga0157375_100509213 207
374 3300013308 Ga0157375_10080633 Ga0157375_100806333 207
375 3300013308 Ga0157375_10646634 Ga0157375_106466342 207
376 3300014325 Ga0163163_10000595 Ga0163163_1000059528 207
377 3300014325 Ga0163163_10008436 Ga0163163_100084365 207
378 3300014325 Ga0163163_10076653 Ga0163163_100766535 207
379 3300014745 Ga0157377_10001292 Ga0157377_100012923 207
380 3300014968 Ga0157379_10003837 Ga0157379_1000383711 207
381 3300014968 Ga0157379_10009864 Ga0157379_100098646 207
382 3300014968 Ga0157379_10206870 Ga0157379_102068703 207
383 3300014969 Ga0157376_10029983 Ga0157376_100299833 207
384 3300014969 Ga0157376_10129367 Ga0157376_101293671 207
385 3300014969 Ga0157376_10687946 Ga0157376_106879462 207
386 3300017792 Ga0163161_10002771 Ga0163161_100027715 207
387 3300022732 Ga0224569_100267 Ga0224569_1002674 207
388 3300024225 Ga0224572_1000996 Ga0224572_10009962 207
389 3300024227 Ga0228598_1000850 Ga0228598_10008502 207
390 3300024227 Ga0228598_1006462 Ga0228598_10064621 207
391 3300025321 Ga0207656_10005405 Ga0207656_100054054 207
392 3300025893 Ga0207682_10167585 Ga0207682_101675852 207
393 3300025900 Ga0207710_10094019 Ga0207710_100940192 207
394 3300025901 Ga0207688_10006690 Ga0207688_100066902 207
395 3300025903 Ga0207680_10002514 Ga0207680_100025144 207
396 3300025904 Ga0207647_10064322 Ga0207647_100643222 207
397 3300025905 Ga0207685_10087108 Ga0207685_100871082 207
398 3300025907 Ga0207645_10000273 Ga0207645_1000027334 207
399 3300025907 Ga0207645_10009069 Ga0207645_100090695 207
400 3300025908 Ga0207643_10006633 Ga0207643_100066336 207
401 3300025910 Ga0207684_10189169 Ga0207684_101891693 207
402 3300025910 Ga0207684_10269505 Ga0207684_102695052 207
403 3300025910 Ga0207684_10279082 Ga0207684_102790822 207
404 3300025911 Ga0207654_10002570 Ga0207654_1000257011 207
405 3300025911 Ga0207654_10013790 Ga0207654_100137904 207
406 3300025911 Ga0207654_10076885 Ga0207654_100768853 207
407 3300025912 Ga0207707_10276716 Ga0207707_102767161 207
408 3300025913 Ga0207695_10004625 Ga0207695_1000462510 207
409 3300025913 Ga0207695_10025559 Ga0207695_100255592 207
410 3300025914 Ga0207671_10029651 Ga0207671_100296514 207
411 3300025914 Ga0207671_10295368 Ga0207671_102953682 207
412 3300025915 Ga0207693_10011894 Ga0207693_100118947 207
413 3300025916 Ga0207663_10083785 Ga0207663_100837853 207
414 3300025916 Ga0207663_10787518 Ga0207663_107875181 207
415 3300025918 Ga0207662_10011456 Ga0207662_100114565 207
416 3300025918 Ga0207662_10152871 Ga0207662_101528712 207
417 3300025919 Ga0207657_10002319 Ga0207657_1000231916 207
418 3300025919 Ga0207657_10010598 Ga0207657_100105986 207
419 3300025920 Ga0207649_10003871 Ga0207649_100038717 207
420 3300025923 Ga0207681_10009802 Ga0207681_100098025 207
421 3300025924 Ga0207694_10048076 Ga0207694_100480762 207
422 3300025924 Ga0207694_10064323 Ga0207694_100643234 207
423 3300025925 Ga0207650_10000036 Ga0207650_1000003645 207
424 3300025925 Ga0207650_10899346 Ga0207650_108993461 207
425 3300025926 Ga0207659_10023383 Ga0207659_100233835 207
426 3300025927 Ga0207687_10011597 Ga0207687_100115973 207
427 3300025927 Ga0207687_10019765 Ga0207687_100197654 207
428 3300025927 Ga0207687_10155287 Ga0207687_101552872 207
429 3300025927 Ga0207687_10542550 Ga0207687_105425502 207
430 3300025928 Ga0207700_10005478 Ga0207700_100054783 207
431 3300025929 Ga0207664_10011150 Ga0207664_100111506 207
432 3300025931 Ga0207644_10022145 Ga0207644_100221453 207
433 3300025932 Ga0207690_10013794 Ga0207690_100137944 207
434 3300025933 Ga0207706_10000165 Ga0207706_1000016561 207
435 3300025933 Ga0207706_10008281 Ga0207706_100082816 207
436 3300025934 Ga0207686_10014823 Ga0207686_100148236 207
437 3300025934 Ga0207686_10197194 Ga0207686_101971942 207
438 3300025935 Ga0207709_10032709 Ga0207709_100327094 207
439 3300025936 Ga0207670_10087390 Ga0207670_100873903 207
440 3300025938 Ga0207704_10022377 Ga0207704_100223774 207
441 3300025939 Ga0207665_10004799 Ga0207665_100047994 207
442 3300025939 Ga0207665_10165295 Ga0207665_101652952 207
443 3300025940 Ga0207691_10012527 Ga0207691_100125275 207
444 3300025941 Ga0207711_10002093 Ga0207711_1000209318 207
445 3300025941 Ga0207711_10012064 Ga0207711_100120644 207
446 3300025941 Ga0207711_10174258 Ga0207711_101742582 207
447 3300025942 Ga0207689_10025271 Ga0207689_100252714 207
448 3300025944 Ga0207661_10518080 Ga0207661_105180801 207
449 3300025945 Ga0207679_10007222 Ga0207679_100072225 207
450 3300025945 Ga0207679_10013609 Ga0207679_100136094 207
451 3300025949 Ga0207667_10002616 Ga0207667_1000261620 207
452 3300025949 Ga0207667_10067545 Ga0207667_100675453 207
453 3300025960 Ga0207651_10005431 Ga0207651_100054315 207
454 3300025972 Ga0207668_10010385 Ga0207668_100103854 207
455 3300025972 Ga0207668_10057446 Ga0207668_100574462 207
456 3300025981 Ga0207640_10014822 Ga0207640_100148222 207
457 3300025981 Ga0207640_10043454 Ga0207640_100434543 207
458 3300025986 Ga0207658_10014425 Ga0207658_100144255 207
459 3300025986 Ga0207658_10120941 Ga0207658_101209413 207
460 3300026023 Ga0207677_10002758 Ga0207677_100027586 207
461 3300026023 Ga0207677_10061860 Ga0207677_100618603 207
462 3300026035 Ga0207703_10158650 Ga0207703_101586503 207
463 3300026035 Ga0207703_10246162 Ga0207703_102461622 207
464 3300026067 Ga0207678_10001477 Ga0207678_100014776 207
465 3300026067 Ga0207678_10006194 Ga0207678_100061945 207
466 3300026078 Ga0207702_10042012 Ga0207702_100420122 207
467 3300026078 Ga0207702_10198529 Ga0207702_101985293 207
468 3300026088 Ga0207641_10000009 Ga0207641_1000000961 207
469 3300026088 Ga0207641_10175245 Ga0207641_101752452 207
470 3300026089 Ga0207648_10000326 Ga0207648_1000032613 207
471 3300026095 Ga0207676_10000092 Ga0207676_100000927 207
472 3300026116 Ga0207674_10000016 Ga0207674_10000016127 207
473 3300026116 Ga0207674_10068835 Ga0207674_100688354 207
474 3300026121 Ga0207683_10000359 Ga0207683_1000035934 207
475 3300026142 Ga0207698_10065753 Ga0207698_100657534 207
476 3300026142 Ga0207698_10424828 Ga0207698_104248282 207
477 3300028379 Ga0268266_10032227 Ga0268266_100322274 207
478 3300028379 Ga0268266_10074112 Ga0268266_100741123 207
479 3300028379 Ga0268266_11056269 Ga0268266_110562691 207
480 3300028380 Ga0268265_10185706 Ga0268265_101857063 207
481 3300028380 Ga0268265_10232062 Ga0268265_102320622 207
482 3300028381 Ga0268264_10018752 Ga0268264_100187522 207
483 3300030760 Ga0265762_1000876 Ga0265762_10008765 207
484 3300031090 Ga0265760_10000115 Ga0265760_1000011515 207
485 3300031712 Ga0265342_10102944 Ga0265342_101029443 207
486 3300035083 Ga0373926_0025305 Ga0373926_0025305_163_786 207
487 3300035112 Ga0373932_0034487 Ga0373932_0034487_346_969 207
488 3300035113 Ga0373936_0014608 Ga0373936_0014608_1877_2500 207
489 3300035170 Ga0373943_0014495 Ga0373943_0014495_1032_1655 207
490 3300035691 Ga0373931_0022342 Ga0373931_0022342_2219_2842 207
491 3300035691 Ga0373931_0030429 Ga0373931_0030429_582_1205 207
492 3300035692 Ga0373935_0011877 Ga0373935_0011877_2383_3006 207
493 3300035692 Ga0373935_0130922 Ga0373935_0130922_187_810 207
494 3300035695 Ga0373927_0042338 Ga0373927_0042338_698_1321 207
495 3300035724 Ga0373933_0170947 Ga0373933_0170947_613_1236 207
496 3300035724 Ga0373933_0180862 Ga0373933_0180862_294_917 207
497 3300035725 Ga0373947_0009012 Ga0373947_0009012_2544_3167 207
498 3300036401 Ga0373937_0163615 Ga0373937_0163615_447_1091 207
499 3300036401 Ga0373937_0440844 Ga0373937_0440844_126_749 207
500 3300036401 Ga0373937_0573281 Ga0373937_0573281_20_664 207
501 3300037068 Ga0373925_0010044 Ga0373925_0010044_4378_5001 207
502 3300037068 Ga0373925_0188415 Ga0373925_0188415_827_1450 207
503 3300039450 Ga0436363_0859318 Ga0436363_0859318_878_1501 207
504 3300042005 Ga0439448_0076326 Ga0439448_0076326_61_684 207
505 3300045051 Ga0451576_0332666 Ga0451576_0332666_21_644 207
506 3300045976 Ga0466967_0009313 Ga0466967_0009313_5549_6223 207
507 3300046472 Ga0495580_0006948 Ga0495580_0006948_2178_2801 207
508 3300046472 Ga0495580_0010147 Ga0495580_0010147_1247_1870 207
509 3300046473 Ga0495582_0003159 Ga0495582_0003159_5931_6554 207
510 3300046531 Ga0495665_0001183 Ga0495665_0001183_3954_4577 207
511 3300046663 Ga0495635_0220685 Ga0495635_0220685_581_1204 207
512 3300046679 Ga0495623_0097929 Ga0495623_0097929_661_1284 207
513 3300046683 Ga0495658_0052261 Ga0495658_0052261_1246_1869 207
514 3300046684 Ga0495669_0080479 Ga0495669_0080479_797_1420 207
515 3300047471 Ga0495684_0407606 Ga0495684_0407606_112_735 207
516 3300048088 Ga0495602_0152229 Ga0495602_0152229_1147_1770 207
517 3300048903 Ga0496100_0091545 Ga0496100_0091545_459_1082 207
518 3300048903 Ga0496100_0097159 Ga0496100_0097159_91_714 207
519 3300048903 Ga0496100_0128813 Ga0496100_0128813_528_1151 207
520 3300048904 Ga0496101_0038318 Ga0496101_0038318_1268_1891 207
521 3300048904 Ga0496101_0468688 Ga0496101_0468688_279_902 207
522 3300048905 Ga0496102_0004659 Ga0496102_0004659_6103_6726 207
523 3300048905 Ga0496102_0034222 Ga0496102_0034222_1604_2227 207
524 3300048905 Ga0496102_0404013 Ga0496102_0404013_469_1092 207
525 3300048906 Ga0496103_0000974 Ga0496103_0000974_303_926 207
526 3300048906 Ga0496103_0068110 Ga0496103_0068110_1163_1786 207
527 3300048907 Ga0496104_0039109 Ga0496104_0039109_40_663 207
528 3300048907 Ga0496104_0083008 Ga0496104_0083008_2345_2968 207
529 3300048907 Ga0496104_0179604 Ga0496104_0179604_396_1019 207
530 3300048907 Ga0496104_0190016 Ga0496104_0190016_762_1385 207
531 3300048907 Ga0496104_1087585 Ga0496104_1087585_21_656 207
532 3300048908 Ga0496105_0337293 Ga0496105_0337293_165_788 207
533 3300048908 Ga0496105_0608680 Ga0496105_0608680_88_711 207
534 3300048909 Ga0496106_0266486 Ga0496106_0266486_703_1326 207
535 3300048909 Ga0496106_0286723 Ga0496106_0286723_325_948 207
536 3300048910 Ga0496107_0051119 Ga0496107_0051119_91_714 207
537 3300048910 Ga0496107_0136383 Ga0496107_0136383_39_662 207
538 3300048911 Ga0496108_0017665 Ga0496108_0017665_381_1004 207
539 3300048911 Ga0496108_0888696 Ga0496108_0888696_81_704 207
540 3300048912 Ga0496109_0000524 Ga0496109_0000524_8142_8765 207
541 3300048912 Ga0496109_0062942 Ga0496109_0062942_2740_3363 207
542 3300048913 Ga0496110_0001679 Ga0496110_0001679_12371_12994 207
543 3300048914 Ga0496111_0046363 Ga0496111_0046363_2398_3021 207
544 3300048915 Ga0496112_0000645 Ga0496112_0000645_14256_14879 207
545 3300048915 Ga0496112_0020118 Ga0496112_0020118_2244_2879 207
546 3300048915 Ga0496112_0475784 Ga0496112_0475784_348_971 207
547 3300048916 Ga0496113_0016848 Ga0496113_0016848_996_1619 207
548 3300048917 Ga0496114_0077357 Ga0496114_0077357_325_948 207
549 3300048918 Ga0496115_0027517 Ga0496115_0027517_2110_2733 207
550 3300050513 nmdc:mga0rr50_362294_c1 nmdc:mga0rr50_362294_c1_98_721 207
551 3300050514 nmdc:mga08x19_52431_c1 nmdc:mga08x19_52431_c1_196_819 207
552 3300053085 Ga0495619_0127146 Ga0495619_0127146_222_845 207
553 2162886012 MBSR1b_contig_2357773 MBSR1b_0144.00000530 208
554 2162886012 MBSR1b_contig_4104914 MBSR1b_0130.00002630 208
555 3300005293 Ga0065715_10011916 Ga0065715_100119164 208
556 3300005327 Ga0070658_10252225 Ga0070658_102522253 208
557 3300005329 Ga0070683_100171020 Ga0070683_1001710202 208
558 3300005331 Ga0070670_100194738 Ga0070670_1001947382 208
559 3300005337 Ga0070682_100052488 Ga0070682_1000524882 208
560 3300005338 Ga0068868_100295824 Ga0068868_1002958241 208
561 3300005339 Ga0070660_100060293 Ga0070660_1000602935 208
562 3300005344 Ga0070661_100167188 Ga0070661_1001671881 208
563 3300005354 Ga0070675_100739173 Ga0070675_1007391732 208
564 3300005355 Ga0070671_100824051 Ga0070671_1008240511 208
565 3300005434 Ga0070709_10076720 Ga0070709_100767202 208
566 3300005434 Ga0070709_10079037 Ga0070709_100790373 208
567 3300005434 Ga0070709_10204821 Ga0070709_102048212 208
568 3300005435 Ga0070714_100182619 Ga0070714_1001826192 208
569 3300005435 Ga0070714_100447572 Ga0070714_1004475722 208
570 3300005436 Ga0070713_100027072 Ga0070713_1000270723 208
571 3300005437 Ga0070710_10150299 Ga0070710_101502992 208
572 3300005439 Ga0070711_100022258 Ga0070711_1000222582 208
573 3300005439 Ga0070711_100028655 Ga0070711_1000286555 208
574 3300005445 Ga0070708_100002464 Ga0070708_1000024643 208
575 3300005445 Ga0070708_100007742 Ga0070708_1000077427 208
576 3300005445 Ga0070708_100078771 Ga0070708_1000787714 208
577 3300005445 Ga0070708_100285794 Ga0070708_1002857942 208
578 3300005445 Ga0070708_100628969 Ga0070708_1006289692 208
579 3300005445 Ga0070708_100706516 Ga0070708_1007065161 208
580 3300005457 Ga0070662_100165504 Ga0070662_1001655042 208
581 3300005458 Ga0070681_10212150 Ga0070681_102121501 208
582 3300005467 Ga0070706_100001941 Ga0070706_10000194115 208
583 3300005467 Ga0070706_100044540 Ga0070706_1000445401 208
584 3300005467 Ga0070706_100469537 Ga0070706_1004695372 208
585 3300005468 Ga0070707_100001843 Ga0070707_1000018437 208
586 3300005468 Ga0070707_100196285 Ga0070707_1001962852 208
587 3300005468 Ga0070707_100234615 Ga0070707_1002346153 208
588 3300005468 Ga0070707_100895892 Ga0070707_1008958921 208
589 3300005471 Ga0070698_100000758 Ga0070698_10000075835 208
590 3300005471 Ga0070698_100019235 Ga0070698_1000192355 208
591 3300005518 Ga0070699_100012112 Ga0070699_1000121123 208
592 3300005518 Ga0070699_100183301 Ga0070699_1001833012 208
593 3300005518 Ga0070699_100184504 Ga0070699_1001845043 208
594 3300005530 Ga0070679_100169328 Ga0070679_1001693281 208
595 3300005536 Ga0070697_100000107 Ga0070697_10000010724 208
596 3300005536 Ga0070697_100011022 Ga0070697_1000110227 208
597 3300005536 Ga0070697_100021934 Ga0070697_1000219342 208
598 3300005536 Ga0070697_100041359 Ga0070697_1000413594 208
599 3300005536 Ga0070697_100195106 Ga0070697_1001951061 208
600 3300005536 Ga0070697_100478484 Ga0070697_1004784842 208
601 3300005545 Ga0070695_100030579 Ga0070695_1000305795 208
602 3300005546 Ga0070696_100270059 Ga0070696_1002700592 208
603 3300005549 Ga0070704_100223129 Ga0070704_1002231292 208
604 3300005563 Ga0068855_100797148 Ga0068855_1007971482 208
605 3300005564 Ga0070664_100017999 Ga0070664_1000179994 208
606 3300005577 Ga0068857_100256982 Ga0068857_1002569822 208
607 3300005578 Ga0068854_100125325 Ga0068854_1001253253 208
608 3300005614 Ga0068856_100014173 Ga0068856_1000141736 208
609 3300005614 Ga0068856_100187811 Ga0068856_1001878113 208
610 3300006028 Ga0070717_10032222 Ga0070717_100322225 208
611 3300006163 Ga0070715_10097254 Ga0070715_100972542 208
612 3300006175 Ga0070712_100007843 Ga0070712_1000078438 208
613 3300006237 Ga0097621_100053550 Ga0097621_1000535503 208
614 3300006237 Ga0097621_100326432 Ga0097621_1003264322 208
615 3300006852 Ga0075433_10000310 Ga0075433_100003107 208
616 3300006871 Ga0075434_100001515 Ga0075434_1000015154 208
617 3300006871 Ga0075434_100003635 Ga0075434_1000036357 208
618 3300006871 Ga0075434_100008451 Ga0075434_1000084515 208
619 3300007076 Ga0075435_100000683 Ga0075435_10000068313 208
620 3300007076 Ga0075435_100116142 Ga0075435_1001161422 208
621 3300007788 Ga0099795_10050590 Ga0099795_100505901 208
622 3300009093 Ga0105240_10187516 Ga0105240_101875162 208
623 3300009147 Ga0114129_10066372 Ga0114129_100663723 208
624 3300009147 Ga0114129_10368271 Ga0114129_103682712 208
625 3300009174 Ga0105241_10005955 Ga0105241_100059556 208
626 3300009177 Ga0105248_10695516 Ga0105248_106955161 208
627 3300009545 Ga0105237_10066134 Ga0105237_100661344 208
628 3300009545 Ga0105237_10141864 Ga0105237_101418644 208
629 3300009545 Ga0105237_11095164 Ga0105237_110951641 208
630 3300010159 Ga0099796_10074838 Ga0099796_100748382 208
631 3300013100 Ga0157373_10003701 Ga0157373_1000370110 208
632 3300013104 Ga0157370_10032415 Ga0157370_100324155 208
633 3300013104 Ga0157370_10251075 Ga0157370_102510753 208
634 3300013105 Ga0157369_10574698 Ga0157369_105746981 208
635 3300013296 Ga0157374_10252326 Ga0157374_102523262 208
636 3300013306 Ga0163162_10357365 Ga0163162_103573653 208
637 3300013306 Ga0163162_10500805 Ga0163162_105008051 208
638 3300013307 Ga0157372_10035970 Ga0157372_100359705 208
639 3300014325 Ga0163163_10271446 Ga0163163_102714463 208
640 3300014497 Ga0182008_10016296 Ga0182008_100162964 208
641 3300014497 Ga0182008_10057313 Ga0182008_100573132 208
642 3300014968 Ga0157379_10066713 Ga0157379_100667133 208
643 3300014969 Ga0157376_10018804 Ga0157376_100188046 208
644 3300014969 Ga0157376_10789075 Ga0157376_107890752 208
645 3300015262 Ga0182007_10003470 Ga0182007_100034709 208
646 3300015262 Ga0182007_10027429 Ga0182007_100274292 208
647 3300015265 Ga0182005_1009874 Ga0182005_10098742 208
648 3300024227 Ga0228598_1000385 Ga0228598_10003853 208
649 3300025321 Ga0207656_10211470 Ga0207656_102114701 208
650 3300025898 Ga0207692_10457656 Ga0207692_104576561 208
651 3300025906 Ga0207699_10003269 Ga0207699_100032694 208
652 3300025910 Ga0207684_10004278 Ga0207684_100042783 208
653 3300025910 Ga0207684_10148053 Ga0207684_101480532 208
654 3300025911 Ga0207654_10011434 Ga0207654_100114343 208
655 3300025912 Ga0207707_10771385 Ga0207707_107713851 208
656 3300025914 Ga0207671_10091035 Ga0207671_100910353 208
657 3300025915 Ga0207693_10007915 Ga0207693_100079156 208
658 3300025915 Ga0207693_10042918 Ga0207693_100429183 208
659 3300025916 Ga0207663_10019378 Ga0207663_100193784 208
660 3300025916 Ga0207663_10020169 Ga0207663_100201696 208
661 3300025916 Ga0207663_10120176 Ga0207663_101201762 208
662 3300025916 Ga0207663_10337230 Ga0207663_103372302 208
663 3300025919 Ga0207657_10000628 Ga0207657_100006283 208
664 3300025922 Ga0207646_10003289 Ga0207646_1000328915 208
665 3300025922 Ga0207646_10488242 Ga0207646_104882422 208
666 3300025924 Ga0207694_10190336 Ga0207694_101903362 208
667 3300025925 Ga0207650_10239834 Ga0207650_102398342 208
668 3300025928 Ga0207700_10022498 Ga0207700_100224983 208
669 3300025929 Ga0207664_10975218 Ga0207664_109752181 208
670 3300025933 Ga0207706_10010021 Ga0207706_100100216 208
671 3300025939 Ga0207665_10000574 Ga0207665_1000057418 208
672 3300025939 Ga0207665_10228603 Ga0207665_102286032 208
673 3300025945 Ga0207679_10210098 Ga0207679_102100983 208
674 3300025949 Ga0207667_10242463 Ga0207667_102424631 208
675 3300025949 Ga0207667_11337504 Ga0207667_113375041 208
676 3300025981 Ga0207640_10113094 Ga0207640_101130943 208
677 3300026023 Ga0207677_10406042 Ga0207677_104060421 208
678 3300026041 Ga0207639_10299361 Ga0207639_102993612 208
679 3300026078 Ga0207702_10031251 Ga0207702_100312515 208
680 3300026078 Ga0207702_10267601 Ga0207702_102676011 208
681 3300026088 Ga0207641_10080966 Ga0207641_100809663 208
682 3300026116 Ga0207674_10141993 Ga0207674_101419933 208
683 3300028017 Ga0265356_1003425 Ga0265356_10034252 208
684 3300028558 Ga0265326_10049232 Ga0265326_100492322 208
685 3300028800 Ga0265338_10048803 Ga0265338_100488034 208
686 3300028800 Ga0265338_10297899 Ga0265338_102978991 208
687 3300030760 Ga0265762_1002847 Ga0265762_10028473 208
688 3300031235 Ga0265330_10019280 Ga0265330_100192802 208
689 3300031249 Ga0265339_10034914 Ga0265339_100349141 208
690 3300031344 Ga0265316_10009500 Ga0265316_100095003 208
691 3300031344 Ga0265316_10079402 Ga0265316_100794023 208
692 3300031711 Ga0265314_10068053 Ga0265314_100680534 208
693 3300032002 Ga0307416_100040214 Ga0307416_1000402144 208
694 3300035172 Ga0373955_0118165 Ga0373955_0118165_706_1341 208
695 3300035691 Ga0373931_0295883 Ga0373931_0295883_21_650 208
696 3300035695 Ga0373927_0058548 Ga0373927_0058548_927_1556 208
697 3300035725 Ga0373947_0106009 Ga0373947_0106009_352_978 208
698 3300036401 Ga0373937_0077543 Ga0373937_0077543_1589_2224 208
699 3300037068 Ga0373925_0122239 Ga0373925_0122239_920_1549 208
700 3300037471 Ga0395905_0274320 Ga0395905_0274320_58_690 208
701 3300037471 Ga0395905_0315721 Ga0395905_0315721_488_1126 208
702 3300038443 Ga0395901_0316397 Ga0395901_0316397_583_1227 208
703 3300039453 Ga0436362_0529442 Ga0436362_0529442_273_908 208
704 3300044694 Ga0466963_0457517 Ga0466963_0457517_130_789 208
705 3300045051 Ga0451576_0022087 Ga0451576_0022087_1811_2443 208
706 3300045976 Ga0466967_0077881 Ga0466967_0077881_441_1079 208
707 3300046457 Ga0495590_0123319 Ga0495590_0123319_182_814 208
708 3300046472 Ga0495580_0000204 Ga0495580_0000204_20063_20689 208
709 3300046472 Ga0495580_0001024 Ga0495580_0001024_12562_13188 208
710 3300046472 Ga0495580_0029342 Ga0495580_0029342_1310_1936 208
711 3300046472 Ga0495580_0049396 Ga0495580_0049396_1960_2595 208
712 3300046472 Ga0495580_0072278 Ga0495580_0072278_430_1059 208
713 3300046499 Ga0495594_0069803 Ga0495594_0069803_1205_1831 208
714 3300046663 Ga0495635_0180255 Ga0495635_0180255_538_1173 208
715 3300046674 Ga0495588_0166416 Ga0495588_0166416_354_980 208
716 3300047315 Ga0495581_0086874 Ga0495581_0086874_1000_1635 208
717 3300047318 Ga0495636_0239861 Ga0495636_0239861_53_679 208
718 3300047471 Ga0495684_0339936 Ga0495684_0339936_92_727 208
719 3300048903 Ga0496100_0065436 Ga0496100_0065436_1431_2057 208
720 3300048904 Ga0496101_0268269 Ga0496101_0268269_63_689 208
721 3300048905 Ga0496102_0041429 Ga0496102_0041429_2408_3034 208
722 3300048905 Ga0496102_0110529 Ga0496102_0110529_834_1460 208
723 3300048905 Ga0496102_0765306 Ga0496102_0765306_181_810 208
724 3300048910 Ga0496107_0118686 Ga0496107_0118686_59_685 208
725 3300048912 Ga0496109_0292638 Ga0496109_0292638_301_927 208
726 3300048913 Ga0496110_0152029 Ga0496110_0152029_589_1215 208
727 3300048915 Ga0496112_0361511 Ga0496112_0361511_74_703 208
728 3300048916 Ga0496113_0245314 Ga0496113_0245314_406_1032 208
729 3300048918 Ga0496115_0368790 Ga0496115_0368790_338_967 208
730 3300049521 Ga0501298_011581 Ga0501298_011581_881_1513 208
731 3300049744 Ga0501083_0037263 Ga0501083_0037263_855_1481 208
732 3300050507 nmdc:mga05p37_519527_c1 nmdc:mga05p37_519527_c1_622_1257 208
733 3300050512 nmdc:mga0n895_12417_c1 nmdc:mga0n895_12417_c1_1179_1805 208
734 3300050512 nmdc:mga0n895_5233_c1 nmdc:mga0n895_5233_c1_2890_3516 208
735 3300050512 nmdc:mga0n895_7198_c1 nmdc:mga0n895_7198_c1_3949_4575 208
736 3300050513 nmdc:mga0rr50_40379_c1 nmdc:mga0rr50_40379_c1_637_1263 208
737 3300050513 nmdc:mga0rr50_563_c1 nmdc:mga0rr50_563_c1_8658_9284 208
738 3300050515 nmdc:mga0a205_279_c1 nmdc:mga0a205_279_c1_34173_34799 208
739 3300053085 Ga0495619_0342115 Ga0495619_0342115_322_957 208
740 3300054114 Ga0501084_0514520 Ga0501084_0514520_226_852 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

38

173

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8giw-assembly2.cif.gz_D c143k variant of citrate synthase (cita) in mycobacterium tuberculosis 0.3979 35 167
8gmi-assembly4.cif.gz_H citrate synthase (cita) in mycobacterium tuberculosis modified by ebselen at c143 residue 0.3674 44 167
8s9d-assembly1.cif.gz_A-2 c143s variant of citrate synthase (cita) in mycobacterium tuberculosis 0.3516 21 167
8gm9-assembly2.cif.gz_C structure of citrate synthase(cita) in mycobacterium tuberculosis 0.3486 29 167
8glb-assembly2.cif.gz_B selenomethionine derivatized citrate synthase (cita) in mycobacterium tuberculosis with pyruvate 0.3348 21 167
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8143 36 163 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8017 36 163 1.10.1760.20
af_P9WN27_598_833_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.4803 19 84 3.30.460.10
af_Q9NAG1_1_333_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3487 2 122 1.20.1070.10
af_J3QNS5_224_388_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3459 25 168 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7C3MN71-F1-model_v4 DedA family protein 0.9459 1 178 GO:0005886
AF-A0A698C407-F1-model_v4 deleted 0.9401 3 163
AF-A0A431JC60-F1-model_v4 deleted 0.9315 2 156
AF-A0A7C3MN71-F1-model_v4 DedA family protein 0.9308 1 178 GO:0005886
AF-A0A847PBR6-F1-model_v4 DedA family protein 0.9283 5 169 GO:0005886

Feature Viewer

pLDDT pTM Quality
81.46 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map