F478542

General Info

Members Datasets Scaffolds Average Seq Length
740 292 740 300

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0170613|Ga0453683_0170613_72_1100
Length 336
Sequence MINLFPRETLAREEWPQADSSRYNRRKKEMTNMXXXTSLVETRSNLPAPNAPRVNIVSAVALLLPLVIGILTTVLTFSPAGAIVLAAQSPKIARQWERAVVLRLGRYIGLRGPGLFWILPFVDTISAWVDQRVITTAFAAEETLTSDTVPVNVDAVLFWMVYDPEKAALEVQNYPQAVSWAAQTALRDIIGRTSLSDLLRGRERIEEELQKLIDERSNPWGVTVQSVEMRDVIIPAALQDAMSREAQAAREKAARVILGQAEVEIAKLFEKAAESYQENPTALHLRAMNMLYEGLKEKGAMMIVPSTAVESMGMGGLLGAAALRQQKLTNFDESPE

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
250 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
254 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
255 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
256 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
257 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
258 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
259 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
260 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
263 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
264 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
268 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
269 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
274 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 2.84
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000553 3300000532 Bacteria 3617
2 JGI24748J21848_1000017 3300002074 Bacteria 133780
3 JGI24034J26672_10000017 3300002239 Bacteria 133784
4 JGI24751J29686_10000043 3300002459 Bacteria 78179
5 JGI25406J46586_10000967 3300003203 Bacteria 13505
6 JGI25406J46586_10005110 3300003203 Bacteria 6085
7 JGI25406J46586_10018658 3300003203 Unclassified 2847
8 Ga0065714_10064422 3300005288 Bacteria 270668
9 Ga0065704_10013735 3300005289 Bacteria 3481
10 Ga0065704_10026869 3300005289 Unclassified 1195
11 Ga0065704_10185353 3300005289 Bacteria 1216
12 Ga0065712_10006419 3300005290 Bacteria 3205
13 Ga0065712_10012705 3300005290 Bacteria 2180
14 Ga0065712_10067728 3300005290 Bacteria 178215
15 Ga0065712_10073475 3300005290 Bacteria 4346
16 Ga0065712_10087458 3300005290 Bacteria 2576
17 Ga0065712_10132183 3300005290 Bacteria 1536
18 Ga0065712_10203646 3300005290 Bacteria 1099
19 Ga0065715_10037318 3300005293 Bacteria 1076
20 Ga0065715_10089178 3300005293 Bacteria 13073
21 Ga0065715_10094457 3300005293 Bacteria 4330
22 Ga0065715_10097263 3300005293 Bacteria 3731
23 Ga0065707_10006442 3300005295 Bacteria 3392
24 Ga0065707_10115603 3300005295 Bacteria 2179
25 Ga0065707_10178650 3300005295 Bacteria 1433
26 Ga0065707_10196524 3300005295 Bacteria 1332
27 Ga0065707_10277122 3300005295 Bacteria 1057
28 Ga0070658_10034817 3300005327 Bacteria 4053
29 Ga0070676_10061902 3300005328 Bacteria 2225
30 Ga0070676_10104244 3300005328 Bacteria 1757
31 Ga0070683_100000216 3300005329 Bacteria 39311
32 Ga0070690_100009146 3300005330 Bacteria 5733
33 Ga0070690_100022579 3300005330 Bacteria 3850
34 Ga0070690_100159377 3300005330 Bacteria 1545
35 Ga0070670_100000226 3300005331 Bacteria 52113
36 Ga0070670_100000614 3300005331 Bacteria 27922
37 Ga0070670_100071716 3300005331 Unclassified 2974
38 Ga0070670_100127166 3300005331 Bacteria 2200
39 Ga0070670_100182919 3300005331 Bacteria 1820
40 Ga0070670_100188212 3300005331 Bacteria 1793
41 Ga0068869_100024393 3300005334 Bacteria 4189
42 Ga0068869_100081764 3300005334 Bacteria 2413
43 Ga0068869_100231525 3300005334 Bacteria 1468
44 Ga0068869_100313408 3300005334 Bacteria 1270
45 Ga0070666_10013506 3300005335 Bacteria 5183
46 Ga0070666_10271886 3300005335 Bacteria 1203
47 Ga0070680_100193046 3300005336 Unclassified 1716
48 Ga0070682_100002426 3300005337 Bacteria 10322
49 Ga0070682_100099104 3300005337 Unclassified 1920
50 Ga0068868_100001892 3300005338 Bacteria 14370
51 Ga0068868_100001907 3300005338 Bacteria 14320
52 Ga0068868_100087499 3300005338 Unclassified 2506
53 Ga0068868_100118730 3300005338 Bacteria 2155
54 Ga0070689_100028282 3300005340 Bacteria 4236
55 Ga0070689_100038758 3300005340 Bacteria 3646
56 Ga0070689_100080855 3300005340 Bacteria 2551
57 Ga0070689_100167785 3300005340 Bacteria 1777
58 Ga0070687_100017027 3300005343 Bacteria 3333
59 Ga0070687_100034520 3300005343 Bacteria 2504
60 Ga0070687_100051308 3300005343 Unclassified 2135
61 Ga0070692_10003204 3300005345 Bacteria 6584
62 Ga0070692_10004212 3300005345 Bacteria 5967
63 Ga0070669_100002934 3300005353 Bacteria 12294
64 Ga0070669_100015380 3300005353 Bacteria 5453
65 Ga0070669_100021890 3300005353 Bacteria 4571
66 Ga0070669_100022099 3300005353 Bacteria 4550
67 Ga0070669_100035772 3300005353 Bacteria 3598
68 Ga0070669_100230261 3300005353 Bacteria 1469
69 Ga0070669_100255449 3300005353 Bacteria 1397
70 Ga0070675_100153837 3300005354 Bacteria 1973
71 Ga0070674_100020375 3300005356 Bacteria 4236
72 Ga0070673_100051212 3300005364 Bacteria 3232
73 Ga0070673_100129746 3300005364 Bacteria 2113
74 Ga0070673_100206086 3300005364 Bacteria 1696
75 Ga0070673_100326303 3300005364 Unclassified 1357
76 Ga0070688_100044386 3300005365 Bacteria 2743
77 Ga0070688_100143111 3300005365 Unclassified 1627
78 Ga0070659_100180562 3300005366 Bacteria 1732
79 Ga0070667_100074622 3300005367 Bacteria 2894
80 Ga0070667_100091078 3300005367 Bacteria 2621
81 Ga0070703_10000133 3300005406 Bacteria 38217
82 Ga0070709_10121378 3300005434 Bacteria 1772
83 Ga0070701_10024043 3300005438 Bacteria 2943
84 Ga0070701_10271696 3300005438 Bacteria 1032
85 Ga0070705_100138043 3300005440 Bacteria 1601
86 Ga0070705_100165980 3300005440 Bacteria 1481
87 Ga0070700_100000266 3300005441 Bacteria 27903
88 Ga0070700_100009502 3300005441 Bacteria 5343
89 Ga0070700_100022963 3300005441 Bacteria 3645
90 Ga0070700_100027705 3300005441 Bacteria 3362
91 Ga0070694_100000581 3300005444 Bacteria 20193
92 Ga0070694_100013301 3300005444 Bacteria 5139
93 Ga0070694_100013825 3300005444 Bacteria 5047
94 Ga0070694_100018700 3300005444 Unclassified 4401
95 Ga0070694_100045965 3300005444 Bacteria 2928
96 Ga0070694_100087386 3300005444 Unclassified 2181
97 Ga0070694_100139269 3300005444 Bacteria 1760
98 Ga0070694_100140517 3300005444 Unclassified 1753
99 Ga0070694_100160179 3300005444 Bacteria 1651
100 Ga0070694_100319371 3300005444 Bacteria 1195
101 Ga0070708_100198196 3300005445 Bacteria 1879
102 Ga0070708_100488731 3300005445 Bacteria 1161
103 Ga0070662_100109788 3300005457 Bacteria 2100
104 Ga0070681_10000700 3300005458 Bacteria 27818
105 Ga0070681_10002392 3300005458 Bacteria 17153
106 Ga0070681_10110899 3300005458 Bacteria 2683
107 Ga0068867_100043189 3300005459 Bacteria 3300
108 Ga0068867_100154544 3300005459 Bacteria 1805
109 Ga0068867_100337167 3300005459 Bacteria 1254
110 Ga0070685_10091973 3300005466 Bacteria 1837
111 Ga0070685_10155813 3300005466 Bacteria 1452
112 Ga0070706_100000128 3300005467 Bacteria 92969
113 Ga0070706_100005620 3300005467 Bacteria 11933
114 Ga0070706_100018423 3300005467 Bacteria 6440
115 Ga0070706_100216248 3300005467 Bacteria 1789
116 Ga0070706_100353415 3300005467 Bacteria 1370
117 Ga0070707_100000045 3300005468 Bacteria 106487
118 Ga0070707_100002620 3300005468 Bacteria 17102
119 Ga0070707_100016284 3300005468 Bacteria 6979
120 Ga0070707_100046982 3300005468 Bacteria 4132
121 Ga0070707_100143453 3300005468 Bacteria 2324
122 Ga0070707_100199275 3300005468 Bacteria 1951
123 Ga0070698_100000410 3300005471 Bacteria 45619
124 Ga0070698_100002582 3300005471 Bacteria 19939
125 Ga0070698_100005684 3300005471 Bacteria 13649
126 Ga0070698_100210415 3300005471 Bacteria 1879
127 Ga0070698_100409003 3300005471 Bacteria 1291
128 Ga0070699_100000688 3300005518 Bacteria 31515
129 Ga0070699_100001641 3300005518 Bacteria 20409
130 Ga0070699_100016945 3300005518 Bacteria 6255
131 Ga0070699_100189711 3300005518 Bacteria 1825
132 Ga0070699_100201263 3300005518 Bacteria 1771
133 Ga0070699_100226415 3300005518 Bacteria 1667
134 Ga0070699_100288318 3300005518 Bacteria 1471
135 Ga0070699_100348819 3300005518 Bacteria 1333
136 Ga0070679_100000642 3300005530 Bacteria 29738
137 Ga0070684_100005622 3300005535 Bacteria 9636
138 Ga0070684_100143125 3300005535 Bacteria 2163
139 Ga0070684_100162992 3300005535 Unclassified 2023
140 Ga0070697_100000262 3300005536 Bacteria 42644
141 Ga0070697_100005258 3300005536 Bacteria 9939
142 Ga0070697_100026525 3300005536 Bacteria 4630
143 Ga0070697_100450468 3300005536 Bacteria 1121
144 Ga0068853_100033008 3300005539 Bacteria 4388
145 Ga0070672_100000854 3300005543 Bacteria 18220
146 Ga0070672_100039701 3300005543 Bacteria 3607
147 Ga0070672_100053030 3300005543 Bacteria 3169
148 Ga0070695_100031580 3300005545 Bacteria 3305
149 Ga0070695_100113184 3300005545 Unclassified 1845
150 Ga0070695_100116095 3300005545 Unclassified 1824
151 Ga0070695_100204752 3300005545 Unclassified 1413
152 Ga0070695_100293340 3300005545 Bacteria 1200
153 Ga0070696_100048703 3300005546 Bacteria 2942
154 Ga0070696_100180002 3300005546 Unclassified 1568
155 Ga0070693_100001080 3300005547 Bacteria 12203
156 Ga0070693_100021924 3300005547 Bacteria 3390
157 Ga0070693_100032893 3300005547 Bacteria 2857
158 Ga0070704_100008898 3300005549 Bacteria 6045
159 Ga0070704_100057013 3300005549 Bacteria 2776
160 Ga0070704_100208919 3300005549 Unclassified 1581
161 Ga0070704_100243930 3300005549 Bacteria 1472
162 Ga0070704_100384062 3300005549 Unclassified 1194
163 Ga0070664_100327480 3300005564 Bacteria 1389
164 Ga0068857_100076752 3300005577 Bacteria 2980
165 Ga0068857_100162370 3300005577 Bacteria 2027
166 Ga0068857_100566272 3300005577 Bacteria 1071
167 Ga0068854_100028881 3300005578 Bacteria 3836
168 Ga0068856_100448820 3300005614 Bacteria 1310
169 Ga0070702_100007385 3300005615 Bacteria 5261
170 Ga0070702_100009426 3300005615 Bacteria 4777
171 Ga0070702_100009856 3300005615 Bacteria 4689
172 Ga0070702_100084039 3300005615 Bacteria 1913
173 Ga0068852_100050328 3300005616 Bacteria 3569
174 Ga0068852_100169985 3300005616 Unclassified 2042
175 Ga0068852_100327757 3300005616 Unclassified 1489
176 Ga0068859_100071098 3300005617 Bacteria 3515
177 Ga0068859_100075235 3300005617 Bacteria 3417
178 Ga0068859_100085014 3300005617 Bacteria 3209
179 Ga0068859_100102507 3300005617 Bacteria 2919
180 Ga0068859_100120520 3300005617 Bacteria 2690
181 Ga0068859_100128539 3300005617 Bacteria 2604
182 Ga0068859_100140386 3300005617 Bacteria 2489
183 Ga0068859_100202480 3300005617 Unclassified 2070
184 Ga0068859_100205531 3300005617 Bacteria 2054
185 Ga0068859_100375959 3300005617 Unclassified 1516
186 Ga0068859_100443248 3300005617 Bacteria 1395
187 Ga0068859_100679578 3300005617 Bacteria 1121
188 Ga0068864_100000081 3300005618 Bacteria 101891
189 Ga0068864_100012529 3300005618 Bacteria 7013
190 Ga0068864_100220174 3300005618 Bacteria 1751
191 Ga0068864_100300617 3300005618 Bacteria 1502
192 Ga0068864_100382643 3300005618 Bacteria 1334
193 Ga0068866_10071659 3300005718 Bacteria 1833
194 Ga0068861_100030563 3300005719 Bacteria 3949
195 Ga0068861_100031410 3300005719 Bacteria 3902
196 Ga0068861_100078407 3300005719 Bacteria 2579
197 Ga0068861_100232388 3300005719 Bacteria 1564
198 Ga0068861_100332668 3300005719 Bacteria 1326
199 Ga0068861_100505894 3300005719 Bacteria 1093
200 Ga0068870_10005619 3300005840 Bacteria 5483
201 Ga0068870_10057937 3300005840 Bacteria 2073
202 Ga0068863_100168189 3300005841 Bacteria 2102
203 Ga0068858_100000146 3300005842 Bacteria 75219
204 Ga0068858_100001392 3300005842 Bacteria 24887
205 Ga0068858_100013704 3300005842 Bacteria 7652
206 Ga0068858_100029807 3300005842 Bacteria 5069
207 Ga0068858_100039499 3300005842 Bacteria 4375
208 Ga0068858_100042638 3300005842 Bacteria 4207
209 Ga0068858_100057128 3300005842 Bacteria 3607
210 Ga0068860_100044253 3300005843 Bacteria 4243
211 Ga0068860_100149380 3300005843 Bacteria 2249
212 Ga0068862_100041424 3300005844 Bacteria 3918
213 Ga0068862_100073871 3300005844 Bacteria 2947
214 Ga0068862_100139540 3300005844 Bacteria 2150
215 Ga0068862_100263520 3300005844 Bacteria 1574
216 Ga0068862_100401725 3300005844 Bacteria 1282
217 Ga0081455_10002675 3300005937 Bacteria 21053
218 Ga0081539_10000033 3300005985 Bacteria 309306
219 Ga0081539_10001050 3300005985 Bacteria 50568
220 Ga0081539_10004757 3300005985 Bacteria 14656
221 Ga0070717_10088136 3300006028 Bacteria 2615
222 Ga0075365_10003010 3300006038 Bacteria 8536
223 Ga0075368_10007558 3300006042 Bacteria 3836
224 Ga0075364_10021014 3300006051 Bacteria 4111
225 Ga0070715_10000024 3300006163 Bacteria 110647
226 Ga0070716_100000001 3300006173 Bacteria 400668
227 Ga0075367_10015855 3300006178 Bacteria 4105
228 Ga0075366_10005893 3300006195 Bacteria 6663
229 Ga0097621_100028753 3300006237 Bacteria 4384
230 Ga0097621_100140862 3300006237 Bacteria 2060
231 Ga0097621_100179416 3300006237 Bacteria 1829
232 Ga0097621_100306850 3300006237 Unclassified 1403
233 Ga0097621_100375732 3300006237 Bacteria 1269
234 Ga0075370_10013916 3300006353 Bacteria 4282
235 Ga0068871_100005788 3300006358 Bacteria 8684
236 Ga0068871_100015416 3300006358 Bacteria 5720
237 Ga0068871_100071579 3300006358 Bacteria 2852
238 Ga0068871_100291764 3300006358 Unclassified 1430
239 Ga0068871_100360848 3300006358 Unclassified 1287
240 Ga0075428_100059477 3300006844 Bacteria 4185
241 Ga0075430_100065957 3300006846 Bacteria 3040
242 Ga0075431_100048856 3300006847 Bacteria 4363
243 Ga0075431_100345254 3300006847 Bacteria 1497
244 Ga0075433_10071379 3300006852 Bacteria 3052
245 Ga0075433_10090138 3300006852 Bacteria 2710
246 Ga0075433_10137250 3300006852 Unclassified 2174
247 Ga0075433_10210060 3300006852 Unclassified 1730
248 Ga0075434_100040575 3300006871 Bacteria 4609
249 Ga0075434_100058918 3300006871 Bacteria 3817
250 Ga0075434_100074140 3300006871 Unclassified 3397
251 Ga0075434_100148199 3300006871 Unclassified 2367
252 Ga0075434_100236674 3300006871 Unclassified 1846
253 Ga0075434_100518522 3300006871 Bacteria 1212
254 Ga0075429_100014529 3300006880 Bacteria 6822
255 Ga0075429_100018328 3300006880 Bacteria 6061
256 Ga0068865_100089794 3300006881 Unclassified 2226
257 Ga0068865_100096079 3300006881 Bacteria 2160
258 Ga0075436_100000070 3300006914 Bacteria 62279
259 Ga0075436_100019025 3300006914 Bacteria 4704
260 Ga0075436_100035564 3300006914 Bacteria 3435
261 Ga0075436_100061921 3300006914 Bacteria 2586
262 Ga0097620_100071098 3300006931 Bacteria 3515
263 Ga0097620_100075236 3300006931 Bacteria 3417
264 Ga0097620_100085013 3300006931 Bacteria 3209
265 Ga0097620_100102509 3300006931 Bacteria 2919
266 Ga0097620_100120517 3300006931 Bacteria 2690
267 Ga0097620_100128544 3300006931 Bacteria 2604
268 Ga0097620_100140393 3300006931 Bacteria 2489
269 Ga0097620_100202484 3300006931 Unclassified 2070
270 Ga0097620_100205530 3300006931 Bacteria 2054
271 Ga0097620_100375935 3300006931 Unclassified 1516
272 Ga0097620_100443224 3300006931 Bacteria 1395
273 Ga0097620_100679562 3300006931 Bacteria 1121
274 Ga0075435_100004548 3300007076 Bacteria 9540
275 Ga0075435_100006335 3300007076 Bacteria 8360
276 Ga0075435_100011606 3300007076 Bacteria 6492
277 Ga0075435_100021854 3300007076 Bacteria 4929
278 Ga0075435_100043566 3300007076 Bacteria 3592
279 Ga0075435_100080626 3300007076 Bacteria 2673
280 Ga0105240_10233763 3300009093 Bacteria 2135
281 Ga0105240_10782569 3300009093 Bacteria 1035
282 Ga0111539_10000439 3300009094 Bacteria 52493
283 Ga0111539_10075589 3300009094 Unclassified 3968
284 Ga0111539_10208867 3300009094 Bacteria 2275
285 Ga0111539_10291071 3300009094 Bacteria 1900
286 Ga0111539_10341656 3300009094 Bacteria 1742
287 Ga0111539_10405000 3300009094 Bacteria 1589
288 Ga0105245_10000024 3300009098 Bacteria 178565
289 Ga0105245_10001940 3300009098 Bacteria 18798
290 Ga0105245_10016939 3300009098 Bacteria 6362
291 Ga0105245_10018124 3300009098 Bacteria 6155
292 Ga0105245_10068587 3300009098 Bacteria 3214
293 Ga0105245_10092202 3300009098 Bacteria 2789
294 Ga0105247_10000004 3300009101 Bacteria 455497
295 Ga0105247_10006142 3300009101 Bacteria 7462
296 Ga0105247_10014291 3300009101 Bacteria 4765
297 Ga0105247_10021761 3300009101 Bacteria 3857
298 Ga0105247_10052573 3300009101 Bacteria 2512
299 Ga0114129_10006197 3300009147 Bacteria 16970
300 Ga0114129_10012566 3300009147 Bacteria 12056
301 Ga0114129_10017794 3300009147 Bacteria 10120
302 Ga0114129_10087200 3300009147 Bacteria 4328
303 Ga0114129_10105815 3300009147 Unclassified 3887
304 Ga0114129_10190624 3300009147 Bacteria 2784
305 Ga0114129_10231906 3300009147 Bacteria 2486
306 Ga0114129_10291547 3300009147 Bacteria 2177
307 Ga0114129_10379387 3300009147 Unclassified 1867
308 Ga0114129_10849696 3300009147 Unclassified 1160
309 Ga0114129_10858483 3300009147 Bacteria 1153
310 Ga0105243_10000393 3300009148 Bacteria 46112
311 Ga0105243_10388210 3300009148 Bacteria 1293
312 Ga0105241_10025217 3300009174 Bacteria 4419
313 Ga0105241_10143827 3300009174 Bacteria 1945
314 Ga0105241_10203945 3300009174 Bacteria 1653
315 Ga0105242_10000004 3300009176 Bacteria 224767
316 Ga0105242_10000313 3300009176 Bacteria 38823
317 Ga0105242_10029337 3300009176 Bacteria 4387
318 Ga0105242_10152594 3300009176 Bacteria 2016
319 Ga0105242_10591400 3300009176 Bacteria 1070
320 Ga0105248_10013627 3300009177 Bacteria 8949
321 Ga0105248_10025127 3300009177 Bacteria 6622
322 Ga0105248_10025718 3300009177 Bacteria 6547
323 Ga0105248_10055572 3300009177 Bacteria 4441
324 Ga0105248_10057402 3300009177 Bacteria 4369
325 Ga0105248_10168645 3300009177 Bacteria 2467
326 Ga0105248_10179278 3300009177 Bacteria 2388
327 Ga0105248_10390760 3300009177 Unclassified 1566
328 Ga0105237_10599111 3300009545 Unclassified 1109
329 Ga0105237_10675486 3300009545 Bacteria 1040
330 Ga0105238_10000001 3300009551 Bacteria 2036163
331 Ga0105238_10046310 3300009551 Bacteria 4390
332 Ga0105238_10061191 3300009551 Bacteria 3768
333 Ga0105238_10191998 3300009551 Unclassified 2018
334 Ga0105238_10652419 3300009551 Bacteria 1062
335 Ga0105249_10001872 3300009553 Bacteria 18236
336 Ga0105249_10046821 3300009553 Bacteria 3937
337 Ga0105249_10082427 3300009553 Bacteria 2993
338 Ga0105249_10091747 3300009553 Bacteria 2843
339 Ga0105249_10146986 3300009553 Unclassified 2265
340 Ga0105249_10189909 3300009553 Bacteria 2004
341 Ga0105239_10027696 3300010375 Bacteria 6235
342 Ga0105239_10214226 3300010375 Bacteria 2159
343 Ga0105239_10270584 3300010375 Bacteria 1911
344 Ga0105246_10161518 3300011119 Bacteria 1707
345 Ga0157373_10002636 3300013100 Bacteria 13607
346 Ga0157373_10112158 3300013100 Unclassified 1917
347 Ga0157369_10000654 3300013105 Bacteria 44821
348 Ga0157369_10326614 3300013105 Bacteria 1594
349 Ga0157374_10000022 3300013296 Bacteria 270307
350 Ga0157378_10000004 3300013297 Bacteria 201051
351 Ga0157378_10000269 3300013297 Bacteria 50584
352 Ga0157378_10000600 3300013297 Bacteria 33795
353 Ga0157378_10005313 3300013297 Bacteria 11311
354 Ga0157378_10036792 3300013297 Bacteria 4332
355 Ga0157378_10204095 3300013297 Bacteria 1871
356 Ga0157378_10454510 3300013297 Archaea 1272
357 Ga0163162_10025254 3300013306 Bacteria 5871
358 Ga0163162_10033650 3300013306 Bacteria 5094
359 Ga0163162_10058127 3300013306 Bacteria 3895
360 Ga0163162_10093107 3300013306 Bacteria 3098
361 Ga0163162_10199599 3300013306 Bacteria 2129
362 Ga0163162_10374911 3300013306 Bacteria 1556
363 Ga0157375_10000002 3300013308 Bacteria 495826
364 Ga0157375_10000008 3300013308 Bacteria 373560
365 Ga0157375_10000106 3300013308 Bacteria 82080
366 Ga0157375_10003437 3300013308 Bacteria 13728
367 Ga0157375_10015052 3300013308 Bacteria 6918
368 Ga0157375_10233935 3300013308 Bacteria 1996
369 Ga0157375_10485381 3300013308 Unclassified 1400
370 Ga0163163_10000103 3300014325 Bacteria 89756
371 Ga0163163_10000961 3300014325 Bacteria 24490
372 Ga0163163_10030602 3300014325 Bacteria 5188
373 Ga0163163_10055419 3300014325 Bacteria 3918
374 Ga0163163_10088802 3300014325 Bacteria 3102
375 Ga0163163_10191202 3300014325 Bacteria 2095
376 Ga0163163_10226335 3300014325 Bacteria 1919
377 Ga0163163_10523908 3300014325 Bacteria 1248
378 Ga0157380_10000324 3300014326 Bacteria 28884
379 Ga0157380_10000682 3300014326 Bacteria 21066
380 Ga0157380_10028508 3300014326 Bacteria 4257
381 Ga0157380_10468781 3300014326 Unclassified 1214
382 Ga0157377_10000009 3300014745 Bacteria 385287
383 Ga0157377_10053196 3300014745 Bacteria 2288
384 Ga0157377_10059760 3300014745 Unclassified 2174
385 Ga0157377_10093745 3300014745 Bacteria 1778
386 Ga0157376_10000020 3300014969 Bacteria 246318
387 Ga0157376_10128811 3300014969 Unclassified 2255
388 Ga0157376_10251197 3300014969 Bacteria 1652
389 Ga0157376_10307896 3300014969 Bacteria 1502
390 Ga0163161_10452017 3300017792 Bacteria 1039
391 Ga0213873_10000857 3300021358 Bacteria 4904
392 Ga0213876_10000173 3300021384 Bacteria 67175
393 Ga0213876_10129397 3300021384 Unclassified 1341
394 Ga0207672_1000023 3300025223 Bacteria 19646
395 Ga0207697_10003076 3300025315 Bacteria 8361
396 Ga0207697_10018269 3300025315 Bacteria 2877
397 Ga0207653_10013378 3300025885 Bacteria 2569
398 Ga0207682_10012961 3300025893 Bacteria 3251
399 Ga0207642_10218241 3300025899 Bacteria 1064
400 Ga0207710_10000002 3300025900 Bacteria 1251998
401 Ga0207710_10037796 3300025900 Bacteria 2133
402 Ga0207710_10038751 3300025900 Unclassified 2108
403 Ga0207710_10077795 3300025900 Unclassified 1533
404 Ga0207688_10021304 3300025901 Bacteria 3541
405 Ga0207647_10003411 3300025904 Bacteria 11915
406 Ga0207647_10031331 3300025904 Bacteria 3423
407 Ga0207685_10000018 3300025905 Bacteria 145715
408 Ga0207645_10008342 3300025907 Bacteria 7234
409 Ga0207645_10254400 3300025907 Unclassified 1163
410 Ga0207643_10011936 3300025908 Bacteria 4692
411 Ga0207643_10022588 3300025908 Bacteria 3465
412 Ga0207705_10026000 3300025909 Bacteria 4177
413 Ga0207684_10000150 3300025910 Bacteria 121849
414 Ga0207684_10009401 3300025910 Bacteria 8632
415 Ga0207684_10012493 3300025910 Bacteria 7382
416 Ga0207684_10160736 3300025910 Bacteria 1934
417 Ga0207654_10104861 3300025911 Bacteria 1748
418 Ga0207707_10000016 3300025912 Bacteria 256002
419 Ga0207707_10097911 3300025912 Bacteria 2564
420 Ga0207695_10209555 3300025913 Bacteria 1860
421 Ga0207671_10013502 3300025914 Bacteria 6501
422 Ga0207671_10179860 3300025914 Bacteria 1645
423 Ga0207671_10438416 3300025914 Bacteria 1040
424 Ga0207660_10012368 3300025917 Bacteria 5583
425 Ga0207660_10158872 3300025917 Bacteria 1742
426 Ga0207662_10011653 3300025918 Bacteria 4884
427 Ga0207662_10041566 3300025918 Bacteria 2707
428 Ga0207652_10002213 3300025921 Bacteria 16596
429 Ga0207646_10000097 3300025922 Bacteria 117004
430 Ga0207646_10000329 3300025922 Bacteria 64353
431 Ga0207646_10006971 3300025922 Bacteria 11584
432 Ga0207646_10372763 3300025922 Bacteria 1290
433 Ga0207681_10003404 3300025923 Bacteria 9948
434 Ga0207681_10016849 3300025923 Bacteria 4581
435 Ga0207681_10064431 3300025923 Bacteria 2530
436 Ga0207681_10197968 3300025923 Bacteria 1541
437 Ga0207694_10000001 3300025924 Bacteria 4078485
438 Ga0207694_10004103 3300025924 Bacteria 11452
439 Ga0207694_10094624 3300025924 Bacteria 2361
440 Ga0207650_10000011 3300025925 Bacteria 450115
441 Ga0207650_10000218 3300025925 Bacteria 65326
442 Ga0207650_10173687 3300025925 Bacteria 1714
443 Ga0207659_10146619 3300025926 Bacteria 1838
444 Ga0207687_10000003 3300025927 Bacteria 875159
445 Ga0207687_10010373 3300025927 Bacteria 6087
446 Ga0207687_10021483 3300025927 Bacteria 4289
447 Ga0207687_10134890 3300025927 Bacteria 1866
448 Ga0207644_10000536 3300025931 Bacteria 24626
449 Ga0207644_10056655 3300025931 Bacteria 2829
450 Ga0207644_10193401 3300025931 Unclassified 1601
451 Ga0207706_10053217 3300025933 Bacteria 3574
452 Ga0207686_10000005 3300025934 Bacteria 260873
453 Ga0207686_10000236 3300025934 Bacteria 42150
454 Ga0207686_10000384 3300025934 Bacteria 30891
455 Ga0207686_10072890 3300025934 Bacteria 2214
456 Ga0207709_10000088 3300025935 Bacteria 152210
457 Ga0207709_10000339 3300025935 Bacteria 48683
458 Ga0207709_10002142 3300025935 Bacteria 12651
459 Ga0207709_10104176 3300025935 Bacteria 1882
460 Ga0207670_10001498 3300025936 Bacteria 12273
461 Ga0207670_10031299 3300025936 Unclassified 3408
462 Ga0207670_10166227 3300025936 Unclassified 1651
463 Ga0207670_10193278 3300025936 Unclassified 1541
464 Ga0207670_10226584 3300025936 Bacteria 1434
465 Ga0207669_10106567 3300025937 Bacteria 1867
466 Ga0207704_10216257 3300025938 Unclassified 1414
467 Ga0207704_10268315 3300025938 Bacteria 1291
468 Ga0207665_10000002 3300025939 Bacteria 267895
469 Ga0207665_10037056 3300025939 Bacteria 3244
470 Ga0207665_10134820 3300025939 Bacteria 1756
471 Ga0207691_10083917 3300025940 Bacteria 2860
472 Ga0207691_10133195 3300025940 Bacteria 2194
473 Ga0207691_10538376 3300025940 Bacteria 991
474 Ga0207711_10010782 3300025941 Bacteria 7596
475 Ga0207711_10012424 3300025941 Bacteria 7078
476 Ga0207711_10013925 3300025941 Bacteria 6679
477 Ga0207711_10030560 3300025941 Bacteria 4544
478 Ga0207711_10222617 3300025941 Bacteria 1726
479 Ga0207711_10330169 3300025941 Unclassified 1410
480 Ga0207689_10006166 3300025942 Bacteria 10609
481 Ga0207689_10030896 3300025942 Bacteria 4462
482 Ga0207689_10220599 3300025942 Bacteria 1566
483 Ga0207689_10316337 3300025942 Bacteria 1295
484 Ga0207661_10000044 3300025944 Bacteria 115753
485 Ga0207661_10062906 3300025944 Unclassified 3004
486 Ga0207679_10053776 3300025945 Bacteria 2961
487 Ga0207679_10108817 3300025945 Bacteria 2183
488 Ga0207651_10008898 3300025960 Bacteria 5454
489 Ga0207651_10012803 3300025960 Bacteria 4766
490 Ga0207651_10141154 3300025960 Bacteria 1861
491 Ga0207651_10573968 3300025960 Unclassified 983
492 Ga0207712_10005230 3300025961 Bacteria 8207
493 Ga0207712_10022873 3300025961 Bacteria 4121
494 Ga0207712_10087624 3300025961 Bacteria 2284
495 Ga0207712_10118554 3300025961 Bacteria 1998
496 Ga0207712_10443598 3300025961 Unclassified 1099
497 Ga0207640_10022961 3300025981 Bacteria 3743
498 Ga0207640_10087055 3300025981 Bacteria 2152
499 Ga0207640_10113430 3300025981 Bacteria 1926
500 Ga0207658_10171437 3300025986 Bacteria 1788
501 Ga0207677_10000005 3300026023 Bacteria 287656
502 Ga0207677_10000009 3300026023 Bacteria 252751
503 Ga0207677_10179503 3300026023 Bacteria 1664
504 Ga0207677_10437819 3300026023 Bacteria 1117
505 Ga0207703_10000687 3300026035 Bacteria 33444
506 Ga0207703_10015342 3300026035 Bacteria 5976
507 Ga0207703_10047035 3300026035 Bacteria 3477
508 Ga0207703_10150310 3300026035 Bacteria 2030
509 Ga0207703_10184085 3300026035 Bacteria 1845
510 Ga0207703_10213589 3300026035 Bacteria 1721
511 Ga0207639_10402506 3300026041 Bacteria 1233
512 Ga0207708_10000725 3300026075 Bacteria 24762
513 Ga0207708_10002201 3300026075 Bacteria 14398
514 Ga0207708_10014124 3300026075 Bacteria 5969
515 Ga0207708_10027465 3300026075 Bacteria 4309
516 Ga0207708_10038347 3300026075 Bacteria 3650
517 Ga0207708_10067037 3300026075 Bacteria 2745
518 Ga0207708_10084351 3300026075 Bacteria 2443
519 Ga0207702_10485759 3300026078 Bacteria 1202
520 Ga0207641_10130711 3300026088 Bacteria 2254
521 Ga0207641_10234867 3300026088 Unclassified 1706
522 Ga0207641_10295768 3300026088 Bacteria 1528
523 Ga0207648_10019253 3300026089 Bacteria 6162
524 Ga0207676_10000020 3300026095 Bacteria 301541
525 Ga0207676_10057318 3300026095 Bacteria 3067
526 Ga0207674_10154972 3300026116 Bacteria 2246
527 Ga0207674_10198755 3300026116 Bacteria 1954
528 Ga0207674_10238543 3300026116 Bacteria 1765
529 Ga0207675_100013881 3300026118 Bacteria 7510
530 Ga0207675_100020577 3300026118 Bacteria 6150
531 Ga0207675_100030317 3300026118 Bacteria 5037
532 Ga0207675_100034479 3300026118 Bacteria 4719
533 Ga0207675_100036361 3300026118 Bacteria 4594
534 Ga0207675_100046067 3300026118 Bacteria 4074
535 Ga0207675_100067025 3300026118 Bacteria 3355
536 Ga0207675_100359766 3300026118 Unclassified 1428
537 Ga0207675_100429340 3300026118 Bacteria 1306
538 Ga0209971_1039665 3300027682 Bacteria 1133
539 Ga0207428_10011558 3300027907 Bacteria 7796
540 Ga0207428_10038151 3300027907 Bacteria 3907
541 Ga0207428_10203960 3300027907 Bacteria 1487
542 Ga0268266_10173918 3300028379 Bacteria 1956
543 Ga0268265_10007639 3300028380 Bacteria 7295
544 Ga0268265_10044289 3300028380 Bacteria 3313
545 Ga0268265_10086271 3300028380 Bacteria 2494
546 Ga0268265_10130266 3300028380 Unclassified 2089
547 Ga0268265_10142348 3300028380 Bacteria 2009
548 Ga0268265_10484949 3300028380 Bacteria 1162
549 Ga0268264_10035201 3300028381 Bacteria 4122
550 Ga0268264_10065450 3300028381 Bacteria 3062
551 Ga0268264_10090411 3300028381 Bacteria 2638
552 Ga0268264_10214828 3300028381 Bacteria 1768
553 Ga0268264_10290402 3300028381 Bacteria 1535
554 Ga0268264_10448590 3300028381 Bacteria 1249
555 Ga0307511_10000562 3300030521 Bacteria 39912
556 Ga0307408_100008073 3300031548 Bacteria 6958
557 Ga0307408_100114484 3300031548 Bacteria 2078
558 Ga0307408_100299274 3300031548 Bacteria 1347
559 Ga0307405_10025242 3300031731 Bacteria 3408
560 Ga0307405_10065247 3300031731 Unclassified 2317
561 Ga0307405_10356561 3300031731 Bacteria 1130
562 Ga0307410_10001655 3300031852 Bacteria 10250
563 Ga0307406_10021804 3300031901 Bacteria 3794
564 Ga0307412_10021597 3300031911 Bacteria 3935
565 Ga0307412_10054547 3300031911 Bacteria 2654
566 Ga0307412_10191984 3300031911 Bacteria 1545
567 Ga0307409_100081046 3300031995 Bacteria 2622
568 Ga0307416_100001814 3300032002 Bacteria 11867
569 Ga0307416_100040486 3300032002 Bacteria 3621
570 Ga0307416_100455655 3300032002 Unclassified 1333
571 Ga0307414_10001545 3300032004 Bacteria 11955
572 Ga0307411_10013888 3300032005 Bacteria 4463
573 Ga0307411_10032000 3300032005 Bacteria 3245
574 Ga0307415_100003242 3300032126 Bacteria 8257
575 Ga0373949_0012780 3300035090 Bacteria 1859
576 Ga0373951_0001232 3300035091 Bacteria 6770
577 Ga0373923_0069407 3300035111 Bacteria 1511
578 Ga0373936_0125026 3300035113 Bacteria 1102
579 Ga0373942_0016088 3300035207 Unclassified 1831
580 Ga0373962_0026915 3300035242 Bacteria 1553
581 Ga0373931_0012931 3300035691 Bacteria 4054
582 Ga0373931_0305206 3300035691 Bacteria 984
583 Ga0373933_0169842 3300035724 Bacteria 1387
584 Ga0373937_0109133 3300036401 Bacteria 2573
585 Ga0373937_0151172 3300036401 Bacteria 2175
586 Ga0373937_0334682 3300036401 Bacteria 1433
587 Ga0395899_0167746 3300037312 Unclassified 1548
588 Ga0395900_0174504 3300037418 Bacteria 2187
589 Ga0395900_0291047 3300037418 Bacteria 1622
590 Ga0395898_0272294 3300037466 Unclassified 1615
591 Ga0436364_0362554 3300037853 Bacteria 2224
592 Ga0436365_0587160 3300039437 Bacteria 47503
593 Ga0436362_1025943 3300039453 Bacteria 4917
594 Ga0439445_0034968 3300042004 Bacteria 1318
595 Ga0439448_0005524 3300042005 Bacteria 3606
596 Ga0439450_045394 3300042008 Bacteria 1031
597 Ga0439458_0007665 3300042157 Unclassified 2404
598 Ga0453683_0170613 3300044673 Unclassified 1378
599 Ga0451576_0008797 3300045051 Bacteria 11809
600 Ga0451576_0069143 3300045051 Bacteria 3674
601 Ga0451576_0265948 3300045051 Bacteria 1793
602 Ga0451576_0382857 3300045051 Bacteria 1474
603 Ga0495629_0018566 3300046459 Bacteria 4973
604 Ga0495629_0128150 3300046459 Bacteria 1768
605 Ga0495582_0003606 3300046473 Bacteria 8726
606 Ga0495667_0232241 3300046559 Bacteria 1176
607 Ga0495613_0043345 3300046689 Bacteria 3329
608 Ga0495600_0205875 3300046809 Bacteria 1262
609 Ga0495581_0005851 3300047315 Bacteria 7128
610 Ga0495674_0299853 3300047319 Bacteria 1313
611 Ga0495679_019559 3300047446 Unclassified 2376
612 Ga0496100_0153326 3300048903 Bacteria 1646
613 Ga0496101_0123474 3300048904 Bacteria 1960
614 Ga0496102_0444951 3300048905 Bacteria 1216
615 Ga0496104_0069827 3300048907 Bacteria 3339
616 Ga0496106_0000607 3300048909 Bacteria 25590
617 Ga0496106_0031023 3300048909 Bacteria 3984
618 Ga0496106_0133634 3300048909 Bacteria 1947
619 Ga0496106_0189738 3300048909 Unclassified 1634
620 Ga0496109_0000379 3300048912 Bacteria 40412
621 Ga0496109_0077347 3300048912 Bacteria 3062
622 Ga0496109_0247044 3300048912 Unclassified 1680
623 Ga0496110_0133830 3300048913 Unclassified 2240
624 Ga0496112_0002397 3300048915 Bacteria 15076
625 Ga0496112_0150211 3300048915 Bacteria 2297
626 Ga0496113_0113177 3300048916 Bacteria 2115
627 Ga0496113_0196106 3300048916 Unclassified 1604
628 Ga0496114_0078765 3300048917 Bacteria 2781
629 Ga0496114_0086560 3300048917 Bacteria 2656
630 Ga0496114_0392614 3300048917 Unclassified 1229
631 Ga0496114_0449181 3300048917 Unclassified 1142
632 Ga0496115_0006199 3300048918 Bacteria 8746
633 Ga0501031_0068793 3300049568 Bacteria 2306
634 Ga0501031_0212539 3300049568 Unclassified 1260
635 Ga0501032_0037590 3300049569 Bacteria 3300
636 Ga0501033_0004970 3300049570 Bacteria 10574
637 Ga0501033_0006587 3300049570 Bacteria 9083
638 Ga0501034_0161990 3300049571 Bacteria 2207
639 Ga0501034_0194760 3300049571 Bacteria 1987
640 Ga0501036_0109479 3300049572 Bacteria 2334
641 Ga0501036_0283907 3300049572 Bacteria 1385
642 Ga0501037_0036695 3300049573 Bacteria 3611
643 Ga0501037_0046187 3300049573 Bacteria 3194
644 Ga0501038_0076145 3300049574 Bacteria 2834
645 Ga0501039_0006443 3300049575 Bacteria 8920
646 Ga0501043_0026346 3300049579 Bacteria 4562
647 Ga0501046_0051751 3300049580 Bacteria 3239
648 Ga0501046_0165512 3300049580 Bacteria 1661
649 Ga0501047_0175594 3300049581 Bacteria 2009
650 Ga0501048_0199436 3300049582 Bacteria 1418
651 Ga0501067_0051153 3300049583 Bacteria 2291
652 Ga0501069_0008951 3300049585 Bacteria 5281
653 Ga0501069_0026950 3300049585 Unclassified 3148
654 Ga0501070_0015013 3300049586 Bacteria 6516
655 Ga0501070_0025561 3300049586 Bacteria 4952
656 Ga0501072_0406876 3300049588 Unclassified 1079
657 Ga0501073_0031581 3300049589 Bacteria 3778
658 Ga0501073_0090490 3300049589 Bacteria 2126
659 Ga0501074_0009531 3300049590 Bacteria 7053
660 Ga0501074_0171707 3300049590 Bacteria 1547
661 Ga0501198_000246 3300049649 Bacteria 6912
662 Ga0501202_000568 3300049652 Bacteria 5368
663 Ga0501209_016372 3300049656 Bacteria 1672
664 Ga0501216_004487 3300049660 Bacteria 2074
665 Ga0501217_004628 3300049661 Bacteria 2835
666 Ga0501223_000583 3300049663 Bacteria 8819
667 Ga0501224_005519 3300049664 Bacteria 1814
668 Ga0501230_001327 3300049667 Bacteria 2915
669 Ga0501235_000868 3300049669 Bacteria 6192
670 Ga0501240_001860 3300049673 Bacteria 2137
671 Ga0501243_000901 3300049675 Bacteria 4158
672 Ga0501257_003649 3300049686 Bacteria 3321
673 Ga0501257_015548 3300049686 Bacteria 1759
674 Ga0501260_001061 3300049689 Bacteria 2222
675 Ga0501221_021799 3300049704 Unclassified 1264
676 Ga0501225_0001270 3300049705 Bacteria 7826
677 Ga0501225_0026006 3300049705 Bacteria 1610
678 Ga0501229_002822 3300049706 Bacteria 2057
679 Ga0501234_000197 3300049707 Bacteria 8540
680 Ga0501245_001676 3300049708 Bacteria 2896
681 Ga0501079_0054424 3300049741 Bacteria 3086
682 Ga0501079_0178769 3300049741 Bacteria 1655
683 Ga0501083_0054781 3300049744 Bacteria 2675
684 Ga0501083_0133765 3300049744 Bacteria 1625
685 Ga0501268_002951 3300049765 Bacteria 2289
686 Ga0501272_003817 3300049769 Bacteria 1548
687 Ga0501273_003885 3300049770 Bacteria 1614
688 Ga0501035_0008860 3300049822 Bacteria 9362
689 Ga0501044_0110996 3300049823 Bacteria 2750
690 Ga0501044_0171962 3300049823 Bacteria 2137
691 Ga0501045_0056428 3300049824 Bacteria 2872
692 Ga0501204_002344 3300049850 Bacteria 1916
693 Ga0501226_000200 3300049853 Bacteria 9358
694 nmdc:mga03683_1363_c1 3300050489 Bacteria 7245
695 nmdc:mga00v17_35644_c1 3300050491 Bacteria 2963
696 nmdc:mga0k408_6811_c1 3300050493 Bacteria 6092
697 nmdc:mga06z11_20504_c1 3300050494 Bacteria 3056
698 nmdc:mga05p37_132122_c1 3300050507 Bacteria 3063
699 nmdc:mga05p37_133827_c1 3300050507 Bacteria 3041
700 nmdc:mga05p37_141780_c1 3300050507 Bacteria 2944
701 nmdc:mga05p37_263431_c1 3300050507 Bacteria 2062
702 nmdc:mga05p37_353826_c1 3300050507 Unclassified 1728
703 nmdc:mga05p37_44985_c1 3300050507 Bacteria 5431
704 nmdc:mga05p37_489328_c1 3300050507 Unclassified 1415
705 nmdc:mga05p37_55119_c1 3300050507 Bacteria 4891
706 nmdc:mga06r32_269026_c1 3300050510 Bacteria 1692
707 nmdc:mga08y16_134014_c1 3300050511 Bacteria 2575
708 nmdc:mga08y16_286353_c1 3300050511 Bacteria 1699
709 nmdc:mga08y16_46923_c1 3300050511 Bacteria 4522
710 nmdc:mga08y16_82902_c1 3300050511 Bacteria 3343
711 nmdc:mga0n895_273186_c1 3300050512 Bacteria 1714
712 nmdc:mga0n895_311849_c1 3300050512 Bacteria 1594
713 nmdc:mga0n895_333894_c1 3300050512 Unclassified 1536
714 nmdc:mga0n895_336234_c1 3300050512 Bacteria 1530
715 nmdc:mga0n895_79914_c1 3300050512 Bacteria 3257
716 nmdc:mga0rr50_118132_c1 3300050513 Unclassified 2106
717 nmdc:mga0rr50_46_c1 3300050513 Bacteria 74452
718 nmdc:mga0rr50_9454_c1 3300050513 Bacteria 6130
719 nmdc:mga0rr50_98742_c1 3300050513 Bacteria 2289
720 nmdc:mga08x19_22608_c1 3300050514 Bacteria 3895
721 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
722 nmdc:mga08x19_44127_c1 3300050514 Bacteria 2846
723 nmdc:mga08x19_91165_c1 3300050514 Bacteria 2012
724 nmdc:mga0a205_119870_c1 3300050515 Bacteria 2530
725 nmdc:mga0a205_15437_c1 3300050515 Bacteria 7138
726 nmdc:mga0a205_164529_c1 3300050515 Bacteria 2114
727 nmdc:mga0a205_242203_c1 3300050515 Unclassified 1684
728 nmdc:mga0a205_50931_c1 3300050515 Bacteria 3997
729 nmdc:mga0a205_60866_c1 3300050515 Bacteria 3647
730 nmdc:mga0a205_85938_c1 3300050515 Bacteria 3038
731 nmdc:mga0a205_92328_c1 3300050515 Bacteria 2925
732 Ga0495619_0050039 3300053085 Bacteria 2757
733 Ga0495619_0105306 3300053085 Bacteria 1923
734 Ga0501084_0010761 3300054114 Bacteria 7574
735 Ga0590071_000062 3300059421 Bacteria 28725
736 Ga0590074_001123 3300059423 Bacteria 4219
737 Ga0590075_000046 3300059424 Bacteria 32374
738 Ga0590077_000653 3300059426 Bacteria 9225
739 Ga0501082_0134821 3300060353 Bacteria 2142
740 Ga0501082_0205484 3300060353 Bacteria 1713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0444951 Ga0496102_0444951_395_1171 233
2 3300005353 Ga0070669_100230261 Ga0070669_1002302612 262
3 3300025923 Ga0207681_10197968 Ga0207681_101979682 262
4 3300045051 Ga0451576_0382857 Ga0451576_0382857_340_1266 262
5 3300050512 nmdc:mga0n895_79914_c1 nmdc:mga0n895_79914_c1_20_946 263
6 3300007076 Ga0075435_100011606 Ga0075435_1000116065 264
7 3300009177 Ga0105248_10025127 Ga0105248_100251274 264
8 3300009551 Ga0105238_10652419 Ga0105238_106524191 264
9 3300050513 nmdc:mga0rr50_9454_c1 nmdc:mga0rr50_9454_c1_4294_5223 264
10 3300005335 Ga0070666_10271886 Ga0070666_102718861 265
11 3300009098 Ga0105245_10068587 Ga0105245_100685874 265
12 3300014969 Ga0157376_10128811 Ga0157376_101288112 265
13 3300025941 Ga0207711_10222617 Ga0207711_102226172 265
14 3300005328 Ga0070676_10061902 Ga0070676_100619023 266
15 3300005330 Ga0070690_100022579 Ga0070690_1000225792 266
16 3300005335 Ga0070666_10013506 Ga0070666_100135063 266
17 3300005340 Ga0070689_100028282 Ga0070689_1000282823 266
18 3300005543 Ga0070672_100039701 Ga0070672_1000397013 266
19 3300005547 Ga0070693_100032893 Ga0070693_1000328933 266
20 3300005549 Ga0070704_100208919 Ga0070704_1002089191 266
21 3300005615 Ga0070702_100009426 Ga0070702_1000094265 266
22 3300005616 Ga0068852_100050328 Ga0068852_1000503283 266
23 3300005617 Ga0068859_100128539 Ga0068859_1001285392 266
24 3300005618 Ga0068864_100012529 Ga0068864_1000125293 266
25 3300005842 Ga0068858_100039499 Ga0068858_1000394993 266
26 3300005843 Ga0068860_100044253 Ga0068860_1000442533 266
27 3300006358 Ga0068871_100291764 Ga0068871_1002917642 266
28 3300006871 Ga0075434_100040575 Ga0075434_1000405754 266
29 3300006931 Ga0097620_100128544 Ga0097620_1001285442 266
30 3300007076 Ga0075435_100004548 Ga0075435_1000045485 266
31 3300025315 Ga0207697_10018269 Ga0207697_100182693 266
32 3300025893 Ga0207682_10012961 Ga0207682_100129613 266
33 3300025901 Ga0207688_10021304 Ga0207688_100213043 266
34 3300025907 Ga0207645_10008342 Ga0207645_100083425 266
35 3300025918 Ga0207662_10011653 Ga0207662_100116533 266
36 3300025923 Ga0207681_10064431 Ga0207681_100644312 266
37 3300025936 Ga0207670_10031299 Ga0207670_100312992 266
38 3300025936 Ga0207670_10193278 Ga0207670_101932782 266
39 3300025937 Ga0207669_10106567 Ga0207669_101065672 266
40 3300025938 Ga0207704_10216257 Ga0207704_102162571 266
41 3300025940 Ga0207691_10083917 Ga0207691_100839172 266
42 3300025941 Ga0207711_10013925 Ga0207711_100139253 266
43 3300025942 Ga0207689_10030896 Ga0207689_100308963 266
44 3300025944 Ga0207661_10062906 Ga0207661_100629063 266
45 3300025960 Ga0207651_10012803 Ga0207651_100128032 266
46 3300025961 Ga0207712_10118554 Ga0207712_101185542 266
47 3300025981 Ga0207640_10113430 Ga0207640_101134302 266
48 3300026023 Ga0207677_10179503 Ga0207677_101795032 266
49 3300026075 Ga0207708_10014124 Ga0207708_100141242 266
50 3300026089 Ga0207648_10019253 Ga0207648_100192533 266
51 3300026118 Ga0207675_100067025 Ga0207675_1000670252 266
52 3300028380 Ga0268265_10044289 Ga0268265_100442893 266
53 3300028381 Ga0268264_10090411 Ga0268264_100904113 266
54 3300048915 Ga0496112_0002397 Ga0496112_0002397_7561_8487 266
55 3300035691 Ga0373931_0305206 Ga0373931_0305206_23_949 267
56 3300048912 Ga0496109_0000379 Ga0496109_0000379_16531_17469 267
57 3300005338 Ga0068868_100118730 Ga0068868_1001187302 268
58 3300005353 Ga0070669_100035772 Ga0070669_1000357723 268
59 3300005356 Ga0070674_100020375 Ga0070674_1000203752 268
60 3300005367 Ga0070667_100091078 Ga0070667_1000910782 268
61 3300005438 Ga0070701_10024043 Ga0070701_100240432 268
62 3300009098 Ga0105245_10092202 Ga0105245_100922022 268
63 3300009174 Ga0105241_10025217 Ga0105241_100252173 268
64 3300009176 Ga0105242_10029337 Ga0105242_100293372 268
65 3300009177 Ga0105248_10013627 Ga0105248_100136273 268
66 3300010375 Ga0105239_10214226 Ga0105239_102142262 268
67 3300013297 Ga0157378_10204095 Ga0157378_102040952 268
68 3300013306 Ga0163162_10374911 Ga0163162_103749112 268
69 3300025931 Ga0207644_10193401 Ga0207644_101934012 268
70 3300028380 Ga0268265_10484949 Ga0268265_104849491 268
71 3300035242 Ga0373962_0026915 Ga0373962_0026915_245_1192 268
72 3300035691 Ga0373931_0012931 Ga0373931_0012931_364_1311 268
73 3300042008 Ga0439450_045394 Ga0439450_045394_12_833 268
74 3300048916 Ga0496113_0196106 Ga0496113_0196106_135_1082 268
75 3300026088 Ga0207641_10295768 Ga0207641_102957682 269
76 3300050512 nmdc:mga0n895_336234_c1 nmdc:mga0n895_336234_c1_696_1514 269
77 3300007076 Ga0075435_100021854 Ga0075435_1000218544 270
78 3300009553 Ga0105249_10189909 Ga0105249_101899092 270
79 3300017792 Ga0163161_10452017 Ga0163161_104520171 270
80 3300045051 Ga0451576_0265948 Ga0451576_0265948_603_1454 271
81 3300005290 Ga0065712_10087458 Ga0065712_100874582 272
82 3300035724 Ga0373933_0169842 Ga0373933_0169842_165_1097 273
83 3300046459 Ga0495629_0128150 Ga0495629_0128150_199_1131 273
84 3300006881 Ga0068865_100096079 Ga0068865_1000960792 274
85 3300009147 Ga0114129_10291547 Ga0114129_102915472 274
86 3300009147 Ga0114129_10858483 Ga0114129_108584832 274
87 3300025940 Ga0207691_10538376 Ga0207691_105383761 274
88 3300046459 Ga0495629_0018566 Ga0495629_0018566_3330_4256 274
89 3300046473 Ga0495582_0003606 Ga0495582_0003606_2785_3711 274
90 3300047315 Ga0495581_0005851 Ga0495581_0005851_244_1170 274
91 3300050507 nmdc:mga05p37_263431_c1 nmdc:mga05p37_263431_c1_772_1626 274
92 3300050513 nmdc:mga0rr50_98742_c1 nmdc:mga0rr50_98742_c1_1424_2278 274
93 3300050515 nmdc:mga0a205_92328_c1 nmdc:mga0a205_92328_c1_761_1615 274
94 3300009174 Ga0105241_10203945 Ga0105241_102039452 275
95 3300009553 Ga0105249_10082427 Ga0105249_100824273 275
96 3300037418 Ga0395900_0291047 Ga0395900_0291047_485_1357 275
97 3300050513 nmdc:mga0rr50_118132_c1 nmdc:mga0rr50_118132_c1_63_935 275
98 3300050515 nmdc:mga0a205_15437_c1 nmdc:mga0a205_15437_c1_644_1516 275
99 3300009176 Ga0105242_10591400 Ga0105242_105914001 276
100 3300025924 Ga0207694_10094624 Ga0207694_100946244 276
101 3300046689 Ga0495613_0043345 Ga0495613_0043345_95_946 276
102 3300048917 Ga0496114_0449181 Ga0496114_0449181_295_1125 276
103 3300048903 Ga0496100_0153326 Ga0496100_0153326_278_1231 277
104 3300048904 Ga0496101_0123474 Ga0496101_0123474_641_1594 277
105 3300048917 Ga0496114_0078765 Ga0496114_0078765_1332_2285 277
106 3300048918 Ga0496115_0006199 Ga0496115_0006199_270_1223 277
107 3300005458 Ga0070681_10110899 Ga0070681_101108994 279
108 3300009147 Ga0114129_10849696 Ga0114129_108496961 279
109 3300013105 Ga0157369_10326614 Ga0157369_103266142 279
110 3300003203 JGI25406J46586_10005110 JGI25406J46586_100051103 280
111 3300005330 Ga0070690_100159377 Ga0070690_1001593772 280
112 3300005985 Ga0081539_10000033 Ga0081539_10000033189 280
113 3300006038 Ga0075365_10003010 Ga0075365_100030108 280
114 3300006042 Ga0075368_10007558 Ga0075368_100075583 280
115 3300006051 Ga0075364_10021014 Ga0075364_100210144 280
116 3300006178 Ga0075367_10015855 Ga0075367_100158554 280
117 3300006353 Ga0075370_10013916 Ga0075370_100139163 280
118 3300005290 Ga0065712_10132183 Ga0065712_101321831 281
119 3300005331 Ga0070670_100188212 Ga0070670_1001882121 281
120 3300005334 Ga0068869_100231525 Ga0068869_1002315251 281
121 3300005844 Ga0068862_100073871 Ga0068862_1000738713 281
122 3300009545 Ga0105237_10675486 Ga0105237_106754861 281
123 3300048912 Ga0496109_0077347 Ga0496109_0077347_697_1629 281
124 3300050491 nmdc:mga00v17_35644_c1 nmdc:mga00v17_35644_c1_696_1637 281
125 3300009093 Ga0105240_10233763 Ga0105240_102337632 282
126 3300009101 Ga0105247_10014291 Ga0105247_100142914 282
127 3300048915 Ga0496112_0150211 Ga0496112_0150211_1203_2051 282
128 3300006358 Ga0068871_100360848 Ga0068871_1003608482 283
129 3300009147 Ga0114129_10006197 Ga0114129_100061978 283
130 3300036401 Ga0373937_0151172 Ga0373937_0151172_1283_2164 283
131 3300049686 Ga0501257_015548 Ga0501257_015548_24_902 283
132 3300049704 Ga0501221_021799 Ga0501221_021799_187_1065 283
133 3300049770 Ga0501273_003885 Ga0501273_003885_316_1194 283
134 3300050507 nmdc:mga05p37_55119_c1 nmdc:mga05p37_55119_c1_1525_2376 283
135 3300059421 Ga0590071_000062 Ga0590071_000062_11589_12458 283
136 3300059423 Ga0590074_001123 Ga0590074_001123_2345_3214 283
137 3300059424 Ga0590075_000046 Ga0590075_000046_23381_24250 283
138 3300059426 Ga0590077_000653 Ga0590077_000653_3305_4174 283
139 3300009101 Ga0105247_10052573 Ga0105247_100525731 284
140 3300014326 Ga0157380_10468781 Ga0157380_104687812 284
141 3300014745 Ga0157377_10093745 Ga0157377_100937453 284
142 3300025938 Ga0207704_10268315 Ga0207704_102683152 284
143 3300049649 Ga0501198_000246 Ga0501198_000246_3705_4583 284
144 3300049652 Ga0501202_000568 Ga0501202_000568_2093_2971 284
145 3300049656 Ga0501209_016372 Ga0501209_016372_439_1317 284
146 3300049660 Ga0501216_004487 Ga0501216_004487_21_899 284
147 3300049661 Ga0501217_004628 Ga0501217_004628_1654_2532 284
148 3300049663 Ga0501223_000583 Ga0501223_000583_749_1627 284
149 3300049664 Ga0501224_005519 Ga0501224_005519_165_1043 284
150 3300049667 Ga0501230_001327 Ga0501230_001327_856_1734 284
151 3300049669 Ga0501235_000868 Ga0501235_000868_999_1877 284
152 3300049673 Ga0501240_001860 Ga0501240_001860_783_1661 284
153 3300049675 Ga0501243_000901 Ga0501243_000901_2162_3040 284
154 3300049686 Ga0501257_003649 Ga0501257_003649_2289_3167 284
155 3300049689 Ga0501260_001061 Ga0501260_001061_860_1738 284
156 3300049705 Ga0501225_0001270 Ga0501225_0001270_6154_7032 284
157 3300049706 Ga0501229_002822 Ga0501229_002822_930_1808 284
158 3300049707 Ga0501234_000197 Ga0501234_000197_2555_3433 284
159 3300049708 Ga0501245_001676 Ga0501245_001676_984_1862 284
160 3300049765 Ga0501268_002951 Ga0501268_002951_336_1214 284
161 3300049769 Ga0501272_003817 Ga0501272_003817_393_1271 284
162 3300049850 Ga0501204_002344 Ga0501204_002344_441_1319 284
163 3300049853 Ga0501226_000200 Ga0501226_000200_2454_3332 284
164 3300050493 nmdc:mga0k408_6811_c1 nmdc:mga0k408_6811_c1_3332_4216 284
165 3300005340 Ga0070689_100080855 Ga0070689_1000808555 286
166 3300005466 Ga0070685_10155813 Ga0070685_101558131 286
167 3300009094 Ga0111539_10341656 Ga0111539_103416563 286
168 3300009098 Ga0105245_10016939 Ga0105245_100169397 286
169 3300009101 Ga0105247_10021761 Ga0105247_100217611 286
170 3300009148 Ga0105243_10388210 Ga0105243_103882102 286
171 3300009176 Ga0105242_10152594 Ga0105242_101525942 286
172 3300009177 Ga0105248_10057402 Ga0105248_100574025 286
173 3300009553 Ga0105249_10146986 Ga0105249_101469863 286
174 3300010375 Ga0105239_10270584 Ga0105239_102705842 286
175 3300011119 Ga0105246_10161518 Ga0105246_101615182 286
176 3300013297 Ga0157378_10005313 Ga0157378_100053134 286
177 3300013306 Ga0163162_10199599 Ga0163162_101995993 286
178 3300013308 Ga0157375_10233935 Ga0157375_102339351 286
179 3300014326 Ga0157380_10000682 Ga0157380_1000068212 286
180 3300014969 Ga0157376_10251197 Ga0157376_102511971 286
181 3300025931 Ga0207644_10056655 Ga0207644_100566552 286
182 3300025936 Ga0207670_10166227 Ga0207670_101662272 286
183 3300025960 Ga0207651_10141154 Ga0207651_101411544 286
184 3300036401 Ga0373937_0109133 Ga0373937_0109133_191_1051 286
185 3300037853 Ga0436364_0362554 Ga0436364_0362554_611_1564 286
186 3300050511 nmdc:mga08y16_46923_c1 nmdc:mga08y16_46923_c1_3393_4262 286
187 3300014325 Ga0163163_10000103 Ga0163163_1000010323 287
188 3300026035 Ga0207703_10150310 Ga0207703_101503102 287
189 3300045051 Ga0451576_0069143 Ga0451576_0069143_1397_2278 287
190 3300048913 Ga0496110_0133830 Ga0496110_0133830_730_1611 287
191 3300048917 Ga0496114_0392614 Ga0496114_0392614_34_915 287
192 3300005985 Ga0081539_10004757 Ga0081539_1000475710 288
193 3300014325 Ga0163163_10226335 Ga0163163_102263352 288
194 3300026116 Ga0207674_10198755 Ga0207674_101987552 288
195 3300042005 Ga0439448_0005524 Ga0439448_0005524_2140_3033 288
196 3300042157 Ga0439458_0007665 Ga0439458_0007665_944_1837 288
197 3300048916 Ga0496113_0113177 Ga0496113_0113177_734_1621 288
198 3300050489 nmdc:mga03683_1363_c1 nmdc:mga03683_1363_c1_538_1422 288
199 3300050494 nmdc:mga06z11_20504_c1 nmdc:mga06z11_20504_c1_681_1565 288
200 3300050510 nmdc:mga06r32_269026_c1 nmdc:mga06r32_269026_c1_771_1655 288
201 3300005549 Ga0070704_100384062 Ga0070704_1003840622 289
202 3300005577 Ga0068857_100162370 Ga0068857_1001623702 289
203 3300005840 Ga0068870_10057937 Ga0068870_100579373 289
204 3300014745 Ga0157377_10059760 Ga0157377_100597603 289
205 3300037312 Ga0395899_0167746 Ga0395899_0167746_57_926 289
206 3300037418 Ga0395900_0174504 Ga0395900_0174504_119_988 289
207 3300037466 Ga0395898_0272294 Ga0395898_0272294_203_1072 289
208 3300048907 Ga0496104_0069827 Ga0496104_0069827_137_1009 289
209 3300048909 Ga0496106_0189738 Ga0496106_0189738_232_1104 289
210 3300049568 Ga0501031_0212539 Ga0501031_0212539_138_1034 289
211 3300049570 Ga0501033_0004970 Ga0501033_0004970_8248_9144 289
212 3300049571 Ga0501034_0161990 Ga0501034_0161990_33_929 289
213 3300049572 Ga0501036_0109479 Ga0501036_0109479_646_1542 289
214 3300049573 Ga0501037_0046187 Ga0501037_0046187_2168_3064 289
215 3300049574 Ga0501038_0076145 Ga0501038_0076145_1323_2219 289
216 3300049579 Ga0501043_0026346 Ga0501043_0026346_136_1032 289
217 3300049580 Ga0501046_0165512 Ga0501046_0165512_206_1102 289
218 3300049581 Ga0501047_0175594 Ga0501047_0175594_221_1117 289
219 3300049582 Ga0501048_0199436 Ga0501048_0199436_40_936 289
220 3300049583 Ga0501067_0051153 Ga0501067_0051153_1240_2136 289
221 3300049585 Ga0501069_0008951 Ga0501069_0008951_1607_2503 289
222 3300049586 Ga0501070_0025561 Ga0501070_0025561_3911_4807 289
223 3300049588 Ga0501072_0406876 Ga0501072_0406876_54_950 289
224 3300049589 Ga0501073_0031581 Ga0501073_0031581_118_1014 289
225 3300049590 Ga0501074_0009531 Ga0501074_0009531_191_1087 289
226 3300049741 Ga0501079_0054424 Ga0501079_0054424_625_1521 289
227 3300049744 Ga0501083_0054781 Ga0501083_0054781_1588_2484 289
228 3300049822 Ga0501035_0008860 Ga0501035_0008860_8234_9130 289
229 3300049823 Ga0501044_0110996 Ga0501044_0110996_1829_2725 289
230 3300060353 Ga0501082_0205484 Ga0501082_0205484_620_1516 289
231 3300005345 Ga0070692_10003204 Ga0070692_100032046 290
232 3300005365 Ga0070688_100143111 Ga0070688_1001431112 290
233 3300005617 Ga0068859_100202480 Ga0068859_1002024801 290
234 3300006931 Ga0097620_100202484 Ga0097620_1002024841 290
235 3300025939 Ga0207665_10037056 Ga0207665_100370564 290
236 3300005289 Ga0065704_10026869 Ga0065704_100268691 292
237 3300006237 Ga0097621_100179416 Ga0097621_1001794162 292
238 3300009545 Ga0105237_10599111 Ga0105237_105991111 292
239 3300009551 Ga0105238_10046310 Ga0105238_100463105 292
240 3300009551 Ga0105238_10061191 Ga0105238_100611913 292
241 3300009551 Ga0105238_10191998 Ga0105238_101919983 292
242 3300013100 Ga0157373_10112158 Ga0157373_101121582 292
243 3300013297 Ga0157378_10454510 Ga0157378_104545102 292
244 3300014325 Ga0163163_10000961 Ga0163163_1000096123 292
245 3300035091 Ga0373951_0001232 Ga0373951_0001232_244_1122 292
246 3300048909 Ga0496106_0031023 Ga0496106_0031023_472_1350 292
247 3300049568 Ga0501031_0068793 Ga0501031_0068793_549_1457 292
248 3300049569 Ga0501032_0037590 Ga0501032_0037590_1630_2538 292
249 3300049570 Ga0501033_0006587 Ga0501033_0006587_2692_3600 292
250 3300049571 Ga0501034_0194760 Ga0501034_0194760_265_1173 292
251 3300049573 Ga0501037_0036695 Ga0501037_0036695_644_1552 292
252 3300049575 Ga0501039_0006443 Ga0501039_0006443_643_1551 292
253 3300049580 Ga0501046_0051751 Ga0501046_0051751_606_1514 292
254 3300049585 Ga0501069_0026950 Ga0501069_0026950_1599_2507 292
255 3300049586 Ga0501070_0015013 Ga0501070_0015013_754_1662 292
256 3300049589 Ga0501073_0090490 Ga0501073_0090490_684_1592 292
257 3300049590 Ga0501074_0171707 Ga0501074_0171707_79_987 292
258 3300049741 Ga0501079_0178769 Ga0501079_0178769_483_1391 292
259 3300049744 Ga0501083_0133765 Ga0501083_0133765_514_1422 292
260 3300049823 Ga0501044_0171962 Ga0501044_0171962_345_1253 292
261 3300049824 Ga0501045_0056428 Ga0501045_0056428_1842_2750 292
262 3300050515 nmdc:mga0a205_60866_c1 nmdc:mga0a205_60866_c1_1177_2055 292
263 3300060353 Ga0501082_0134821 Ga0501082_0134821_959_1867 292
264 3300005444 Ga0070694_100140517 Ga0070694_1001405171 293
265 3300005545 Ga0070695_100116095 Ga0070695_1001160952 293
266 3300005719 Ga0068861_100232388 Ga0068861_1002323882 293
267 3300006914 Ga0075436_100061921 Ga0075436_1000619213 293
268 3300050514 nmdc:mga08x19_22608_c1 nmdc:mga08x19_22608_c1_2844_3794 293
269 3300014325 Ga0163163_10030602 Ga0163163_100306027 294
270 3300014325 Ga0163163_10055419 Ga0163163_100554192 294
271 3300014969 Ga0157376_10307896 Ga0157376_103078962 294
272 3300050515 nmdc:mga0a205_85938_c1 nmdc:mga0a205_85938_c1_255_1139 294
273 3300005338 Ga0068868_100001907 Ga0068868_1000019076 295
274 3300013308 Ga0157375_10015052 Ga0157375_100150524 295
275 3300026023 Ga0207677_10000005 Ga0207677_10000005112 295
276 3300027682 Ga0209971_1039665 Ga0209971_10396651 295
277 3300031548 Ga0307408_100299274 Ga0307408_1002992742 295
278 3300032002 Ga0307416_100040486 Ga0307416_1000404865 295
279 3300005290 Ga0065712_10203646 Ga0065712_102036461 296
280 3300005353 Ga0070669_100015380 Ga0070669_1000153803 296
281 3300005364 Ga0070673_100051212 Ga0070673_1000512122 296
282 3300005518 Ga0070699_100189711 Ga0070699_1001897111 296
283 3300005543 Ga0070672_100000854 Ga0070672_1000008543 296
284 3300005616 Ga0068852_100169985 Ga0068852_1001699853 296
285 3300005618 Ga0068864_100000081 Ga0068864_10000008188 296
286 3300005842 Ga0068858_100001392 Ga0068858_10000139217 296
287 3300006852 Ga0075433_10210060 Ga0075433_102100602 296
288 3300006871 Ga0075434_100236674 Ga0075434_1002366744 296
289 3300009093 Ga0105240_10782569 Ga0105240_107825691 296
290 3300009098 Ga0105245_10018124 Ga0105245_100181245 296
291 3300009147 Ga0114129_10017794 Ga0114129_100177945 296
292 3300009177 Ga0105248_10168645 Ga0105248_101686452 296
293 3300013308 Ga0157375_10000002 Ga0157375_10000002267 296
294 3300025923 Ga0207681_10016849 Ga0207681_100168493 296
295 3300025927 Ga0207687_10010373 Ga0207687_100103733 296
296 3300025936 Ga0207670_10001498 Ga0207670_100014986 296
297 3300025960 Ga0207651_10008898 Ga0207651_100088983 296
298 3300026095 Ga0207676_10000020 Ga0207676_1000002088 296
299 3300050507 nmdc:mga05p37_132122_c1 nmdc:mga05p37_132122_c1_1102_2040 296
300 3300050512 nmdc:mga0n895_333894_c1 nmdc:mga0n895_333894_c1_548_1486 296
301 3300050515 nmdc:mga0a205_119870_c1 nmdc:mga0a205_119870_c1_1036_1974 296
302 3300054114 Ga0501084_0010761 Ga0501084_0010761_1216_2133 296
303 3300005536 Ga0070697_100000262 Ga0070697_10000026227 297
304 3300005546 Ga0070696_100180002 Ga0070696_1001800022 297
305 3300009147 Ga0114129_10012566 Ga0114129_100125662 297
306 3300009147 Ga0114129_10087200 Ga0114129_100872003 297
307 3300050507 nmdc:mga05p37_133827_c1 nmdc:mga05p37_133827_c1_115_1038 297
308 3300050507 nmdc:mga05p37_44985_c1 nmdc:mga05p37_44985_c1_4096_5028 297
309 3300003203 JGI25406J46586_10000967 JGI25406J46586_1000096714 298
310 3300005290 Ga0065712_10073475 Ga0065712_100734755 298
311 3300005366 Ga0070659_100180562 Ga0070659_1001805623 298
312 3300005438 Ga0070701_10271696 Ga0070701_102716961 298
313 3300005518 Ga0070699_100001641 Ga0070699_10000164113 298
314 3300005618 Ga0068864_100300617 Ga0068864_1003006172 298
315 3300005843 Ga0068860_100149380 Ga0068860_1001493802 298
316 3300005985 Ga0081539_10001050 Ga0081539_1000105023 298
317 3300006914 Ga0075436_100019025 Ga0075436_1000190252 298
318 3300006914 Ga0075436_100035564 Ga0075436_1000355644 298
319 3300007076 Ga0075435_100043566 Ga0075435_1000435664 298
320 3300007076 Ga0075435_100080626 Ga0075435_1000806265 298
321 3300009094 Ga0111539_10291071 Ga0111539_102910713 298
322 3300025914 Ga0207671_10179860 Ga0207671_101798602 298
323 3300025936 Ga0207670_10226584 Ga0207670_102265843 298
324 3300028381 Ga0268264_10214828 Ga0268264_102148282 298
325 3300050514 nmdc:mga08x19_44127_c1 nmdc:mga08x19_44127_c1_331_1269 298
326 3300050514 nmdc:mga08x19_91165_c1 nmdc:mga08x19_91165_c1_268_1200 298
327 3300005330 Ga0070690_100009146 Ga0070690_1000091467 299
328 3300005345 Ga0070692_10004212 Ga0070692_100042123 299
329 3300005444 Ga0070694_100045965 Ga0070694_1000459652 299
330 3300005617 Ga0068859_100120520 Ga0068859_1001205203 299
331 3300005719 Ga0068861_100332668 Ga0068861_1003326682 299
332 3300006844 Ga0075428_100059477 Ga0075428_1000594775 299
333 3300006852 Ga0075433_10137250 Ga0075433_101372503 299
334 3300006931 Ga0097620_100120517 Ga0097620_1001205173 299
335 3300013306 Ga0163162_10025254 Ga0163162_100252545 299
336 3300025961 Ga0207712_10443598 Ga0207712_104435982 299
337 3300026075 Ga0207708_10038347 Ga0207708_100383473 299
338 3300049572 Ga0501036_0283907 Ga0501036_0283907_327_1250 299
339 3300050512 nmdc:mga0n895_273186_c1 nmdc:mga0n895_273186_c1_378_1301 299
340 3300050515 nmdc:mga0a205_50931_c1 nmdc:mga0a205_50931_c1_181_1116 299
341 3300005288 Ga0065714_10064422 Ga0065714_1006442283 300
342 3300005290 Ga0065712_10067728 Ga0065712_1006772882 300
343 3300005293 Ga0065715_10089178 Ga0065715_100891788 300
344 3300005468 Ga0070707_100000045 Ga0070707_10000004521 300
345 3300005468 Ga0070707_100046982 Ga0070707_1000469824 300
346 3300005844 Ga0068862_100401725 Ga0068862_1004017252 300
347 3300006871 Ga0075434_100074140 Ga0075434_1000741402 300
348 3300009148 Ga0105243_10000393 Ga0105243_1000039310 300
349 3300009176 Ga0105242_10000313 Ga0105242_100003138 300
350 3300009177 Ga0105248_10390760 Ga0105248_103907602 300
351 3300013297 Ga0157378_10000004 Ga0157378_1000000411 300
352 3300013308 Ga0157375_10003437 Ga0157375_1000343712 300
353 3300025922 Ga0207646_10000097 Ga0207646_1000009761 300
354 3300025934 Ga0207686_10000384 Ga0207686_1000038417 300
355 3300025935 Ga0207709_10000339 Ga0207709_1000033926 300
356 3300025941 Ga0207711_10330169 Ga0207711_103301692 300
357 3300026116 Ga0207674_10238543 Ga0207674_102385433 300
358 3300031548 Ga0307408_100114484 Ga0307408_1001144843 300
359 3300031731 Ga0307405_10065247 Ga0307405_100652472 300
360 3300031911 Ga0307412_10191984 Ga0307412_101919842 300
361 3300032005 Ga0307411_10032000 Ga0307411_100320004 300
362 3300048909 Ga0496106_0000607 Ga0496106_0000607_22652_23587 300
363 3300050507 nmdc:mga05p37_489328_c1 nmdc:mga05p37_489328_c1_192_1115 300
364 3300050512 nmdc:mga0n895_311849_c1 nmdc:mga0n895_311849_c1_470_1405 300
365 3300050515 nmdc:mga0a205_242203_c1 nmdc:mga0a205_242203_c1_112_1035 300
366 3300005293 Ga0065715_10094457 Ga0065715_100944573 301
367 3300005293 Ga0065715_10097263 Ga0065715_100972633 301
368 3300005364 Ga0070673_100326303 Ga0070673_1003263032 301
369 3300005458 Ga0070681_10002392 Ga0070681_100023923 301
370 3300005459 Ga0068867_100154544 Ga0068867_1001545443 301
371 3300005549 Ga0070704_100243930 Ga0070704_1002439302 301
372 3300005617 Ga0068859_100085014 Ga0068859_1000850143 301
373 3300006846 Ga0075430_100065957 Ga0075430_1000659573 301
374 3300006847 Ga0075431_100048856 Ga0075431_1000488563 301
375 3300006852 Ga0075433_10090138 Ga0075433_100901383 301
376 3300006880 Ga0075429_100018328 Ga0075429_1000183283 301
377 3300006931 Ga0097620_100085013 Ga0097620_1000850133 301
378 3300025912 Ga0207707_10097911 Ga0207707_100979112 301
379 3300025914 Ga0207671_10438416 Ga0207671_104384161 301
380 3300025960 Ga0207651_10573968 Ga0207651_105739681 301
381 3300026035 Ga0207703_10213589 Ga0207703_102135893 301
382 3300035090 Ga0373949_0012780 Ga0373949_0012780_854_1783 301
383 3300035113 Ga0373936_0125026 Ga0373936_0125026_36_968 301
384 3300035207 Ga0373942_0016088 Ga0373942_0016088_434_1363 301
385 3300050507 nmdc:mga05p37_141780_c1 nmdc:mga05p37_141780_c1_1079_2008 301
386 3300053085 Ga0495619_0105306 Ga0495619_0105306_347_1279 301
387 3300002074 JGI24748J21848_1000017 JGI24748J21848_100001793 302
388 3300002239 JGI24034J26672_10000017 JGI24034J26672_1000001719 302
389 3300005295 Ga0065707_10178650 Ga0065707_101786501 302
390 3300005353 Ga0070669_100021890 Ga0070669_1000218903 302
391 3300005459 Ga0068867_100337167 Ga0068867_1003371671 302
392 3300005471 Ga0070698_100000410 Ga0070698_10000041023 302
393 3300005545 Ga0070695_100113184 Ga0070695_1001131842 302
394 3300005842 Ga0068858_100000146 Ga0068858_10000014615 302
395 3300006871 Ga0075434_100518522 Ga0075434_1005185221 302
396 3300009094 Ga0111539_10000439 Ga0111539_1000043911 302
397 3300009101 Ga0105247_10000004 Ga0105247_1000000433 302
398 3300009101 Ga0105247_10006142 Ga0105247_100061428 302
399 3300009177 Ga0105248_10025718 Ga0105248_100257183 302
400 3300009553 Ga0105249_10001872 Ga0105249_100018725 302
401 3300013306 Ga0163162_10093107 Ga0163162_100931073 302
402 3300014325 Ga0163163_10523908 Ga0163163_105239082 302
403 3300014326 Ga0157380_10028508 Ga0157380_100285084 302
404 3300025223 Ga0207672_1000023 Ga0207672_100002310 302
405 3300025900 Ga0207710_10000002 Ga0207710_10000002980 302
406 3300025900 Ga0207710_10037796 Ga0207710_100377963 302
407 3300025913 Ga0207695_10209555 Ga0207695_102095552 302
408 3300025923 Ga0207681_10003404 Ga0207681_100034046 302
409 3300025931 Ga0207644_10000536 Ga0207644_1000053614 302
410 3300025934 Ga0207686_10000236 Ga0207686_1000023620 302
411 3300025945 Ga0207679_10053776 Ga0207679_100537763 302
412 3300025961 Ga0207712_10022873 Ga0207712_100228735 302
413 3300026035 Ga0207703_10000687 Ga0207703_1000068718 302
414 3300026041 Ga0207639_10402506 Ga0207639_104025062 302
415 3300026075 Ga0207708_10067037 Ga0207708_100670375 302
416 3300026118 Ga0207675_100359766 Ga0207675_1003597662 302
417 3300027907 Ga0207428_10011558 Ga0207428_100115585 302
418 3300028380 Ga0268265_10007639 Ga0268265_100076395 302
419 3300031548 Ga0307408_100008073 Ga0307408_1000080736 302
420 3300031731 Ga0307405_10025242 Ga0307405_100252422 302
421 3300031852 Ga0307410_10001655 Ga0307410_100016558 302
422 3300031901 Ga0307406_10021804 Ga0307406_100218044 302
423 3300031911 Ga0307412_10021597 Ga0307412_100215974 302
424 3300031995 Ga0307409_100081046 Ga0307409_1000810463 302
425 3300032002 Ga0307416_100001814 Ga0307416_1000018149 302
426 3300032004 Ga0307414_10001545 Ga0307414_100015455 302
427 3300032005 Ga0307411_10013888 Ga0307411_100138883 302
428 3300032126 Ga0307415_100003242 Ga0307415_1000032424 302
429 3300005327 Ga0070658_10034817 Ga0070658_100348174 303
430 3300005329 Ga0070683_100000216 Ga0070683_10000021618 303
431 3300005331 Ga0070670_100000226 Ga0070670_10000022626 303
432 3300005331 Ga0070670_100182919 Ga0070670_1001829193 303
433 3300005338 Ga0068868_100001892 Ga0068868_1000018926 303
434 3300005343 Ga0070687_100017027 Ga0070687_1000170273 303
435 3300005406 Ga0070703_10000133 Ga0070703_1000013339 303
436 3300005441 Ga0070700_100009502 Ga0070700_1000095024 303
437 3300005444 Ga0070694_100000581 Ga0070694_10000058118 303
438 3300005535 Ga0070684_100005622 Ga0070684_1000056221 303
439 3300005535 Ga0070684_100162992 Ga0070684_1001629921 303
440 3300005578 Ga0068854_100028881 Ga0068854_1000288815 303
441 3300006195 Ga0075366_10005893 Ga0075366_100058932 303
442 3300009094 Ga0111539_10405000 Ga0111539_104050002 303
443 3300009098 Ga0105245_10001940 Ga0105245_1000194014 303
444 3300009147 Ga0114129_10190624 Ga0114129_101906243 303
445 3300009174 Ga0105241_10143827 Ga0105241_101438273 303
446 3300009177 Ga0105248_10055572 Ga0105248_100555726 303
447 3300009177 Ga0105248_10179278 Ga0105248_101792783 303
448 3300009551 Ga0105238_10000001 Ga0105238_10000001881 303
449 3300013100 Ga0157373_10002636 Ga0157373_100026369 303
450 3300013105 Ga0157369_10000654 Ga0157369_1000065423 303
451 3300013296 Ga0157374_10000022 Ga0157374_1000002218 303
452 3300013297 Ga0157378_10000269 Ga0157378_1000026949 303
453 3300013297 Ga0157378_10000600 Ga0157378_100006005 303
454 3300013306 Ga0163162_10033650 Ga0163162_100336505 303
455 3300013306 Ga0163162_10058127 Ga0163162_100581273 303
456 3300013308 Ga0157375_10000008 Ga0157375_1000000895 303
457 3300013308 Ga0157375_10000106 Ga0157375_1000010655 303
458 3300014745 Ga0157377_10000009 Ga0157377_100000096 303
459 3300014969 Ga0157376_10000020 Ga0157376_10000020137 303
460 3300021358 Ga0213873_10000857 Ga0213873_100008573 303
461 3300021384 Ga0213876_10000173 Ga0213876_1000017333 303
462 3300021384 Ga0213876_10129397 Ga0213876_101293972 303
463 3300025909 Ga0207705_10026000 Ga0207705_100260003 303
464 3300025924 Ga0207694_10000001 Ga0207694_100000011921 303
465 3300025925 Ga0207650_10000218 Ga0207650_100002185 303
466 3300025944 Ga0207661_10000044 Ga0207661_1000004413 303
467 3300025981 Ga0207640_10022961 Ga0207640_100229612 303
468 3300026023 Ga0207677_10000009 Ga0207677_1000000982 303
469 3300026118 Ga0207675_100429340 Ga0207675_1004293402 303
470 3300030521 Ga0307511_10000562 Ga0307511_1000056230 303
471 3300031731 Ga0307405_10356561 Ga0307405_103565611 303
472 3300032002 Ga0307416_100455655 Ga0307416_1004556552 303
473 3300039437 Ga0436365_0587160 Ga0436365_0587160_15422_16354 303
474 3300039453 Ga0436362_1025943 Ga0436362_1025943_2215_3147 303
475 3300042004 Ga0439445_0034968 Ga0439445_0034968_180_1121 303
476 3300047446 Ga0495679_019559 Ga0495679_019559_738_1673 303
477 3300048909 Ga0496106_0133634 Ga0496106_0133634_215_1126 303
478 3300048917 Ga0496114_0086560 Ga0496114_0086560_1299_2294 303
479 3300049705 Ga0501225_0026006 Ga0501225_0026006_654_1595 303
480 3300050511 nmdc:mga08y16_286353_c1 nmdc:mga08y16_286353_c1_592_1503 303
481 3300005289 Ga0065704_10185353 Ga0065704_101853532 304
482 3300005295 Ga0065707_10115603 Ga0065707_101156032 304
483 3300005444 Ga0070694_100013825 Ga0070694_1000138253 304
484 3300005617 Ga0068859_100071098 Ga0068859_1000710983 304
485 3300005844 Ga0068862_100139540 Ga0068862_1001395402 304
486 3300006880 Ga0075429_100014529 Ga0075429_1000145293 304
487 3300006931 Ga0097620_100071098 Ga0097620_1000710981 304
488 3300009094 Ga0111539_10208867 Ga0111539_102088672 304
489 3300009098 Ga0105245_10000024 Ga0105245_10000024110 304
490 3300009147 Ga0114129_10105815 Ga0114129_101058153 304
491 3300025927 Ga0207687_10000003 Ga0207687_10000003110 304
492 3300027907 Ga0207428_10038151 Ga0207428_100381514 304
493 3300028380 Ga0268265_10142348 Ga0268265_101423482 304
494 3300035111 Ga0373923_0069407 Ga0373923_0069407_94_1035 304
495 3300036401 Ga0373937_0334682 Ga0373937_0334682_462_1403 304
496 3300044673 Ga0453683_0170613 Ga0453683_0170613_72_1100 304
497 3300046559 Ga0495667_0232241 Ga0495667_0232241_176_1117 304
498 3300050507 nmdc:mga05p37_353826_c1 nmdc:mga05p37_353826_c1_590_1537 304
499 3300050511 nmdc:mga08y16_82902_c1 nmdc:mga08y16_82902_c1_1047_2042 304
500 3300053085 Ga0495619_0050039 Ga0495619_0050039_397_1338 304
501 3300005295 Ga0065707_10277122 Ga0065707_102771221 305
502 3300005334 Ga0068869_100081764 Ga0068869_1000817642 305
503 3300005467 Ga0070706_100353415 Ga0070706_1003534152 305
504 3300005577 Ga0068857_100076752 Ga0068857_1000767523 305
505 3300006028 Ga0070717_10088136 Ga0070717_100881361 305
506 3300009176 Ga0105242_10000004 Ga0105242_10000004112 305
507 3300025934 Ga0207686_10000005 Ga0207686_10000005125 305
508 3300025935 Ga0207709_10000088 Ga0207709_10000088115 305
509 3300026116 Ga0207674_10154972 Ga0207674_101549722 305
510 3300005445 Ga0070708_100198196 Ga0070708_1001981961 306
511 3300005937 Ga0081455_10002675 Ga0081455_100026755 306
512 3300013308 Ga0157375_10485381 Ga0157375_104853812 306
513 3300014325 Ga0163163_10088802 Ga0163163_100888024 306
514 3300005295 Ga0065707_10196524 Ga0065707_101965242 307
515 3300005336 Ga0070680_100193046 Ga0070680_1001930462 307
516 3300005353 Ga0070669_100255449 Ga0070669_1002554492 307
517 3300005518 Ga0070699_100226415 Ga0070699_1002264152 307
518 3300005840 Ga0068870_10005619 Ga0068870_100056196 307
519 3300010375 Ga0105239_10027696 Ga0105239_100276962 307
520 3300025908 Ga0207643_10022588 Ga0207643_100225883 307
521 3300025911 Ga0207654_10104861 Ga0207654_101048612 307
522 3300025917 Ga0207660_10158872 Ga0207660_101588722 307
523 3300025922 Ga0207646_10372763 Ga0207646_103727632 307
524 3300025925 Ga0207650_10173687 Ga0207650_101736873 307
525 3300025939 Ga0207665_10134820 Ga0207665_101348202 307
526 3300028380 Ga0268265_10130266 Ga0268265_101302663 307
527 3300031911 Ga0307412_10054547 Ga0307412_100545473 307
528 3300002459 JGI24751J29686_10000043 JGI24751J29686_1000004367 308
529 3300003203 JGI25406J46586_10018658 JGI25406J46586_100186582 308
530 3300005290 Ga0065712_10012705 Ga0065712_100127052 308
531 3300005293 Ga0065715_10037318 Ga0065715_100373182 308
532 3300005295 Ga0065707_10006442 Ga0065707_100064422 308
533 3300005331 Ga0070670_100000614 Ga0070670_10000061423 308
534 3300005334 Ga0068869_100024393 Ga0068869_1000243933 308
535 3300005337 Ga0070682_100002426 Ga0070682_1000024264 308
536 3300005338 Ga0068868_100087499 Ga0068868_1000874993 308
537 3300005340 Ga0070689_100038758 Ga0070689_1000387585 308
538 3300005340 Ga0070689_100167785 Ga0070689_1001677852 308
539 3300005343 Ga0070687_100034520 Ga0070687_1000345202 308
540 3300005343 Ga0070687_100051308 Ga0070687_1000513083 308
541 3300005353 Ga0070669_100022099 Ga0070669_1000220995 308
542 3300005354 Ga0070675_100153837 Ga0070675_1001538372 308
543 3300005364 Ga0070673_100206086 Ga0070673_1002060861 308
544 3300005365 Ga0070688_100044386 Ga0070688_1000443861 308
545 3300005367 Ga0070667_100074622 Ga0070667_1000746224 308
546 3300005440 Ga0070705_100138043 Ga0070705_1001380431 308
547 3300005440 Ga0070705_100165980 Ga0070705_1001659802 308
548 3300005444 Ga0070694_100013301 Ga0070694_1000133016 308
549 3300005444 Ga0070694_100018700 Ga0070694_1000187002 308
550 3300005444 Ga0070694_100319371 Ga0070694_1003193711 308
551 3300005445 Ga0070708_100488731 Ga0070708_1004887311 308
552 3300005459 Ga0068867_100043189 Ga0068867_1000431892 308
553 3300005466 Ga0070685_10091973 Ga0070685_100919732 308
554 3300005467 Ga0070706_100005620 Ga0070706_1000056204 308
555 3300005468 Ga0070707_100002620 Ga0070707_10000262012 308
556 3300005468 Ga0070707_100016284 Ga0070707_1000162844 308
557 3300005468 Ga0070707_100143453 Ga0070707_1001434533 308
558 3300005471 Ga0070698_100409003 Ga0070698_1004090032 308
559 3300005518 Ga0070699_100201263 Ga0070699_1002012631 308
560 3300005518 Ga0070699_100288318 Ga0070699_1002883181 308
561 3300005535 Ga0070684_100143125 Ga0070684_1001431252 308
562 3300005536 Ga0070697_100026525 Ga0070697_1000265254 308
563 3300005543 Ga0070672_100053030 Ga0070672_1000530303 308
564 3300005545 Ga0070695_100031580 Ga0070695_1000315804 308
565 3300005545 Ga0070695_100293340 Ga0070695_1002933401 308
566 3300005547 Ga0070693_100001080 Ga0070693_1000010806 308
567 3300005549 Ga0070704_100008898 Ga0070704_1000088983 308
568 3300005549 Ga0070704_100057013 Ga0070704_1000570131 308
569 3300005564 Ga0070664_100327480 Ga0070664_1003274801 308
570 3300005615 Ga0070702_100009856 Ga0070702_1000098562 308
571 3300005616 Ga0068852_100327757 Ga0068852_1003277572 308
572 3300005617 Ga0068859_100075235 Ga0068859_1000752352 308
573 3300005617 Ga0068859_100140386 Ga0068859_1001403863 308
574 3300005617 Ga0068859_100205531 Ga0068859_1002055313 308
575 3300005617 Ga0068859_100443248 Ga0068859_1004432481 308
576 3300005718 Ga0068866_10071659 Ga0068866_100716593 308
577 3300005719 Ga0068861_100078407 Ga0068861_1000784073 308
578 3300005842 Ga0068858_100042638 Ga0068858_1000426383 308
579 3300005844 Ga0068862_100041424 Ga0068862_1000414243 308
580 3300006237 Ga0097621_100028753 Ga0097621_1000287534 308
581 3300006358 Ga0068871_100071579 Ga0068871_1000715792 308
582 3300006881 Ga0068865_100089794 Ga0068865_1000897942 308
583 3300006931 Ga0097620_100075236 Ga0097620_1000752365 308
584 3300006931 Ga0097620_100140393 Ga0097620_1001403933 308
585 3300006931 Ga0097620_100205530 Ga0097620_1002055303 308
586 3300006931 Ga0097620_100443224 Ga0097620_1004432241 308
587 3300009147 Ga0114129_10379387 Ga0114129_103793872 308
588 3300009553 Ga0105249_10046821 Ga0105249_100468214 308
589 3300013297 Ga0157378_10036792 Ga0157378_100367923 308
590 3300014325 Ga0163163_10191202 Ga0163163_101912022 308
591 3300014745 Ga0157377_10053196 Ga0157377_100531962 308
592 3300025315 Ga0207697_10003076 Ga0207697_100030769 308
593 3300025885 Ga0207653_10013378 Ga0207653_100133782 308
594 3300025899 Ga0207642_10218241 Ga0207642_102182411 308
595 3300025904 Ga0207647_10031331 Ga0207647_100313312 308
596 3300025907 Ga0207645_10254400 Ga0207645_102544002 308
597 3300025908 Ga0207643_10011936 Ga0207643_100119362 308
598 3300025910 Ga0207684_10009401 Ga0207684_100094017 308
599 3300025914 Ga0207671_10013502 Ga0207671_100135027 308
600 3300025918 Ga0207662_10041566 Ga0207662_100415663 308
601 3300025922 Ga0207646_10000329 Ga0207646_1000032937 308
602 3300025922 Ga0207646_10006971 Ga0207646_100069712 308
603 3300025924 Ga0207694_10004103 Ga0207694_100041039 308
604 3300025925 Ga0207650_10000011 Ga0207650_10000011190 308
605 3300025926 Ga0207659_10146619 Ga0207659_101466193 308
606 3300025927 Ga0207687_10021483 Ga0207687_100214835 308
607 3300025927 Ga0207687_10134890 Ga0207687_101348902 308
608 3300025934 Ga0207686_10072890 Ga0207686_100728903 308
609 3300025935 Ga0207709_10104176 Ga0207709_101041762 308
610 3300025940 Ga0207691_10133195 Ga0207691_101331953 308
611 3300025942 Ga0207689_10006166 Ga0207689_100061665 308
612 3300025942 Ga0207689_10220599 Ga0207689_102205991 308
613 3300025942 Ga0207689_10316337 Ga0207689_103163372 308
614 3300025945 Ga0207679_10108817 Ga0207679_101088172 308
615 3300025961 Ga0207712_10005230 Ga0207712_100052304 308
616 3300025961 Ga0207712_10087624 Ga0207712_100876242 308
617 3300025981 Ga0207640_10087055 Ga0207640_100870553 308
618 3300025986 Ga0207658_10171437 Ga0207658_101714372 308
619 3300026023 Ga0207677_10437819 Ga0207677_104378191 308
620 3300026035 Ga0207703_10184085 Ga0207703_101840852 308
621 3300026075 Ga0207708_10084351 Ga0207708_100843512 308
622 3300026118 Ga0207675_100030317 Ga0207675_1000303174 308
623 3300026118 Ga0207675_100034479 Ga0207675_1000344792 308
624 3300026118 Ga0207675_100036361 Ga0207675_1000363615 308
625 3300027907 Ga0207428_10203960 Ga0207428_102039602 308
626 3300028380 Ga0268265_10086271 Ga0268265_100862712 308
627 3300028381 Ga0268264_10065450 Ga0268264_100654503 308
628 3300028381 Ga0268264_10290402 Ga0268264_102904023 308
629 3300045051 Ga0451576_0008797 Ga0451576_0008797_1322_2263 308
630 3300050515 nmdc:mga0a205_164529_c1 nmdc:mga0a205_164529_c1_371_1312 308
631 3300005289 Ga0065704_10013735 Ga0065704_100137351 309
632 3300005290 Ga0065712_10006419 Ga0065712_100064193 309
633 3300005328 Ga0070676_10104244 Ga0070676_101042442 309
634 3300005331 Ga0070670_100071716 Ga0070670_1000717162 309
635 3300005353 Ga0070669_100002934 Ga0070669_10000293412 309
636 3300005364 Ga0070673_100129746 Ga0070673_1001297462 309
637 3300005434 Ga0070709_10121378 Ga0070709_101213782 309
638 3300005441 Ga0070700_100022963 Ga0070700_1000229632 309
639 3300005441 Ga0070700_100027705 Ga0070700_1000277053 309
640 3300005444 Ga0070694_100139269 Ga0070694_1001392692 309
641 3300005457 Ga0070662_100109788 Ga0070662_1001097883 309
642 3300005467 Ga0070706_100018423 Ga0070706_1000184235 309
643 3300005468 Ga0070707_100199275 Ga0070707_1001992752 309
644 3300005471 Ga0070698_100002582 Ga0070698_10000258220 309
645 3300005518 Ga0070699_100000688 Ga0070699_1000006887 309
646 3300005536 Ga0070697_100005258 Ga0070697_1000052585 309
647 3300005617 Ga0068859_100102507 Ga0068859_1001025072 309
648 3300005618 Ga0068864_100220174 Ga0068864_1002201742 309
649 3300005719 Ga0068861_100031410 Ga0068861_1000314102 309
650 3300005842 Ga0068858_100029807 Ga0068858_1000298073 309
651 3300005842 Ga0068858_100057128 Ga0068858_1000571283 309
652 3300005844 Ga0068862_100263520 Ga0068862_1002635202 309
653 3300006163 Ga0070715_10000024 Ga0070715_1000002473 309
654 3300006173 Ga0070716_100000001 Ga0070716_100000001321 309
655 3300006237 Ga0097621_100375732 Ga0097621_1003757322 309
656 3300006358 Ga0068871_100015416 Ga0068871_1000154162 309
657 3300006847 Ga0075431_100345254 Ga0075431_1003452542 309
658 3300006914 Ga0075436_100000070 Ga0075436_10000007042 309
659 3300006931 Ga0097620_100102509 Ga0097620_1001025092 309
660 3300007076 Ga0075435_100006335 Ga0075435_1000063359 309
661 3300009094 Ga0111539_10075589 Ga0111539_100755892 309
662 3300009147 Ga0114129_10231906 Ga0114129_102319062 309
663 3300009553 Ga0105249_10091747 Ga0105249_100917473 309
664 3300014326 Ga0157380_10000324 Ga0157380_1000032425 309
665 3300025905 Ga0207685_10000018 Ga0207685_1000001869 309
666 3300025910 Ga0207684_10012493 Ga0207684_100124936 309
667 3300025933 Ga0207706_10053217 Ga0207706_100532173 309
668 3300025939 Ga0207665_10000002 Ga0207665_10000002193 309
669 3300025941 Ga0207711_10030560 Ga0207711_100305606 309
670 3300026035 Ga0207703_10047035 Ga0207703_100470353 309
671 3300026075 Ga0207708_10002201 Ga0207708_100022017 309
672 3300026075 Ga0207708_10027465 Ga0207708_100274652 309
673 3300026118 Ga0207675_100020577 Ga0207675_1000205777 309
674 3300026118 Ga0207675_100046067 Ga0207675_1000460675 309
675 3300028379 Ga0268266_10173918 Ga0268266_101739182 309
676 3300028381 Ga0268264_10448590 Ga0268264_104485901 309
677 3300046809 Ga0495600_0205875 Ga0495600_0205875_40_972 309
678 3300047319 Ga0495674_0299853 Ga0495674_0299853_307_1239 309
679 3300050511 nmdc:mga08y16_134014_c1 nmdc:mga08y16_134014_c1_1342_2319 309
680 3300050513 nmdc:mga0rr50_46_c1 nmdc:mga0rr50_46_c1_22610_23545 309
681 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_257758_258693 309
682 3300000532 CNAas_1000553 CNAas_10005532 310
683 3300005331 Ga0070670_100127166 Ga0070670_1001271662 310
684 3300005334 Ga0068869_100313408 Ga0068869_1003134082 310
685 3300005337 Ga0070682_100099104 Ga0070682_1000991042 310
686 3300005441 Ga0070700_100000266 Ga0070700_1000002669 310
687 3300005444 Ga0070694_100087386 Ga0070694_1000873863 310
688 3300005444 Ga0070694_100160179 Ga0070694_1001601792 310
689 3300005458 Ga0070681_10000700 Ga0070681_100007004 310
690 3300005467 Ga0070706_100000128 Ga0070706_10000012827 310
691 3300005467 Ga0070706_100216248 Ga0070706_1002162482 310
692 3300005471 Ga0070698_100005684 Ga0070698_1000056848 310
693 3300005471 Ga0070698_100210415 Ga0070698_1002104153 310
694 3300005518 Ga0070699_100016945 Ga0070699_1000169455 310
695 3300005518 Ga0070699_100348819 Ga0070699_1003488192 310
696 3300005530 Ga0070679_100000642 Ga0070679_1000006424 310
697 3300005536 Ga0070697_100450468 Ga0070697_1004504682 310
698 3300005539 Ga0068853_100033008 Ga0068853_1000330085 310
699 3300005545 Ga0070695_100204752 Ga0070695_1002047522 310
700 3300005546 Ga0070696_100048703 Ga0070696_1000487033 310
701 3300005547 Ga0070693_100021924 Ga0070693_1000219243 310
702 3300005577 Ga0068857_100566272 Ga0068857_1005662722 310
703 3300005614 Ga0068856_100448820 Ga0068856_1004488202 310
704 3300005615 Ga0070702_100007385 Ga0070702_1000073856 310
705 3300005615 Ga0070702_100084039 Ga0070702_1000840393 310
706 3300005617 Ga0068859_100375959 Ga0068859_1003759592 310
707 3300005617 Ga0068859_100679578 Ga0068859_1006795782 310
708 3300005618 Ga0068864_100382643 Ga0068864_1003826432 310
709 3300005719 Ga0068861_100030563 Ga0068861_1000305633 310
710 3300005719 Ga0068861_100505894 Ga0068861_1005058941 310
711 3300005841 Ga0068863_100168189 Ga0068863_1001681893 310
712 3300005842 Ga0068858_100013704 Ga0068858_1000137049 310
713 3300006237 Ga0097621_100140862 Ga0097621_1001408622 310
714 3300006237 Ga0097621_100306850 Ga0097621_1003068502 310
715 3300006358 Ga0068871_100005788 Ga0068871_1000057882 310
716 3300006852 Ga0075433_10071379 Ga0075433_100713792 310
717 3300006871 Ga0075434_100058918 Ga0075434_1000589183 310
718 3300006871 Ga0075434_100148199 Ga0075434_1001481993 310
719 3300006931 Ga0097620_100375935 Ga0097620_1003759352 310
720 3300006931 Ga0097620_100679562 Ga0097620_1006795622 310
721 3300025900 Ga0207710_10038751 Ga0207710_100387512 310
722 3300025900 Ga0207710_10077795 Ga0207710_100777952 310
723 3300025904 Ga0207647_10003411 Ga0207647_100034113 310
724 3300025910 Ga0207684_10000150 Ga0207684_1000015027 310
725 3300025910 Ga0207684_10160736 Ga0207684_101607363 310
726 3300025912 Ga0207707_10000016 Ga0207707_1000001661 310
727 3300025917 Ga0207660_10012368 Ga0207660_100123683 310
728 3300025921 Ga0207652_10002213 Ga0207652_100022134 310
729 3300025935 Ga0207709_10002142 Ga0207709_100021429 310
730 3300025941 Ga0207711_10010782 Ga0207711_100107825 310
731 3300025941 Ga0207711_10012424 Ga0207711_100124247 310
732 3300026035 Ga0207703_10015342 Ga0207703_100153423 310
733 3300026075 Ga0207708_10000725 Ga0207708_100007258 310
734 3300026078 Ga0207702_10485759 Ga0207702_104857591 310
735 3300026088 Ga0207641_10130711 Ga0207641_101307112 310
736 3300026088 Ga0207641_10234867 Ga0207641_102348672 310
737 3300026095 Ga0207676_10057318 Ga0207676_100573183 310
738 3300026118 Ga0207675_100013881 Ga0207675_1000138813 310
739 3300028381 Ga0268264_10035201 Ga0268264_100352011 310
740 3300048912 Ga0496109_0247044 Ga0496109_0247044_241_1176 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

91

267

0.97

Feature Viewer

pLDDT pTM Quality
73.57 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map