F478542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 292 | 740 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300044673|Ga0453683_0170613|Ga0453683_0170613_72_1100 |
| Length | 336 |
| Sequence | MINLFPRETLAREEWPQADSSRYNRRKKEMTNMXXXTSLVETRSNLPAPNAPRVNIVSAVALLLPLVIGILTTVLTFSPAGAIVLAAQSPKIARQWERAVVLRLGRYIGLRGPGLFWILPFVDTISAWVDQRVITTAFAAEETLTSDTVPVNVDAVLFWMVYDPEKAALEVQNYPQAVSWAAQTALRDIIGRTSLSDLLRGRERIEEELQKLIDERSNPWGVTVQSVEMRDVIIPAALQDAMSREAQAAREKAARVILGQAEVEIAKLFEKAAESYQENPTALHLRAMNMLYEGLKEKGAMMIVPSTAVESMGMGGLLGAAALRQQKLTNFDESPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 205 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 206 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 248 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 249 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 250 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 255 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 258 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 259 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 260 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 261 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 263 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 274 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 278 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 290 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 291 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.35 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 95.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000553 | 3300000532 | Bacteria | 3617 |
| 2 | JGI24748J21848_1000017 | 3300002074 | Bacteria | 133780 |
| 3 | JGI24034J26672_10000017 | 3300002239 | Bacteria | 133784 |
| 4 | JGI24751J29686_10000043 | 3300002459 | Bacteria | 78179 |
| 5 | JGI25406J46586_10000967 | 3300003203 | Bacteria | 13505 |
| 6 | JGI25406J46586_10005110 | 3300003203 | Bacteria | 6085 |
| 7 | JGI25406J46586_10018658 | 3300003203 | Unclassified | 2847 |
| 8 | Ga0065714_10064422 | 3300005288 | Bacteria | 270668 |
| 9 | Ga0065704_10013735 | 3300005289 | Bacteria | 3481 |
| 10 | Ga0065704_10026869 | 3300005289 | Unclassified | 1195 |
| 11 | Ga0065704_10185353 | 3300005289 | Bacteria | 1216 |
| 12 | Ga0065712_10006419 | 3300005290 | Bacteria | 3205 |
| 13 | Ga0065712_10012705 | 3300005290 | Bacteria | 2180 |
| 14 | Ga0065712_10067728 | 3300005290 | Bacteria | 178215 |
| 15 | Ga0065712_10073475 | 3300005290 | Bacteria | 4346 |
| 16 | Ga0065712_10087458 | 3300005290 | Bacteria | 2576 |
| 17 | Ga0065712_10132183 | 3300005290 | Bacteria | 1536 |
| 18 | Ga0065712_10203646 | 3300005290 | Bacteria | 1099 |
| 19 | Ga0065715_10037318 | 3300005293 | Bacteria | 1076 |
| 20 | Ga0065715_10089178 | 3300005293 | Bacteria | 13073 |
| 21 | Ga0065715_10094457 | 3300005293 | Bacteria | 4330 |
| 22 | Ga0065715_10097263 | 3300005293 | Bacteria | 3731 |
| 23 | Ga0065707_10006442 | 3300005295 | Bacteria | 3392 |
| 24 | Ga0065707_10115603 | 3300005295 | Bacteria | 2179 |
| 25 | Ga0065707_10178650 | 3300005295 | Bacteria | 1433 |
| 26 | Ga0065707_10196524 | 3300005295 | Bacteria | 1332 |
| 27 | Ga0065707_10277122 | 3300005295 | Bacteria | 1057 |
| 28 | Ga0070658_10034817 | 3300005327 | Bacteria | 4053 |
| 29 | Ga0070676_10061902 | 3300005328 | Bacteria | 2225 |
| 30 | Ga0070676_10104244 | 3300005328 | Bacteria | 1757 |
| 31 | Ga0070683_100000216 | 3300005329 | Bacteria | 39311 |
| 32 | Ga0070690_100009146 | 3300005330 | Bacteria | 5733 |
| 33 | Ga0070690_100022579 | 3300005330 | Bacteria | 3850 |
| 34 | Ga0070690_100159377 | 3300005330 | Bacteria | 1545 |
| 35 | Ga0070670_100000226 | 3300005331 | Bacteria | 52113 |
| 36 | Ga0070670_100000614 | 3300005331 | Bacteria | 27922 |
| 37 | Ga0070670_100071716 | 3300005331 | Unclassified | 2974 |
| 38 | Ga0070670_100127166 | 3300005331 | Bacteria | 2200 |
| 39 | Ga0070670_100182919 | 3300005331 | Bacteria | 1820 |
| 40 | Ga0070670_100188212 | 3300005331 | Bacteria | 1793 |
| 41 | Ga0068869_100024393 | 3300005334 | Bacteria | 4189 |
| 42 | Ga0068869_100081764 | 3300005334 | Bacteria | 2413 |
| 43 | Ga0068869_100231525 | 3300005334 | Bacteria | 1468 |
| 44 | Ga0068869_100313408 | 3300005334 | Bacteria | 1270 |
| 45 | Ga0070666_10013506 | 3300005335 | Bacteria | 5183 |
| 46 | Ga0070666_10271886 | 3300005335 | Bacteria | 1203 |
| 47 | Ga0070680_100193046 | 3300005336 | Unclassified | 1716 |
| 48 | Ga0070682_100002426 | 3300005337 | Bacteria | 10322 |
| 49 | Ga0070682_100099104 | 3300005337 | Unclassified | 1920 |
| 50 | Ga0068868_100001892 | 3300005338 | Bacteria | 14370 |
| 51 | Ga0068868_100001907 | 3300005338 | Bacteria | 14320 |
| 52 | Ga0068868_100087499 | 3300005338 | Unclassified | 2506 |
| 53 | Ga0068868_100118730 | 3300005338 | Bacteria | 2155 |
| 54 | Ga0070689_100028282 | 3300005340 | Bacteria | 4236 |
| 55 | Ga0070689_100038758 | 3300005340 | Bacteria | 3646 |
| 56 | Ga0070689_100080855 | 3300005340 | Bacteria | 2551 |
| 57 | Ga0070689_100167785 | 3300005340 | Bacteria | 1777 |
| 58 | Ga0070687_100017027 | 3300005343 | Bacteria | 3333 |
| 59 | Ga0070687_100034520 | 3300005343 | Bacteria | 2504 |
| 60 | Ga0070687_100051308 | 3300005343 | Unclassified | 2135 |
| 61 | Ga0070692_10003204 | 3300005345 | Bacteria | 6584 |
| 62 | Ga0070692_10004212 | 3300005345 | Bacteria | 5967 |
| 63 | Ga0070669_100002934 | 3300005353 | Bacteria | 12294 |
| 64 | Ga0070669_100015380 | 3300005353 | Bacteria | 5453 |
| 65 | Ga0070669_100021890 | 3300005353 | Bacteria | 4571 |
| 66 | Ga0070669_100022099 | 3300005353 | Bacteria | 4550 |
| 67 | Ga0070669_100035772 | 3300005353 | Bacteria | 3598 |
| 68 | Ga0070669_100230261 | 3300005353 | Bacteria | 1469 |
| 69 | Ga0070669_100255449 | 3300005353 | Bacteria | 1397 |
| 70 | Ga0070675_100153837 | 3300005354 | Bacteria | 1973 |
| 71 | Ga0070674_100020375 | 3300005356 | Bacteria | 4236 |
| 72 | Ga0070673_100051212 | 3300005364 | Bacteria | 3232 |
| 73 | Ga0070673_100129746 | 3300005364 | Bacteria | 2113 |
| 74 | Ga0070673_100206086 | 3300005364 | Bacteria | 1696 |
| 75 | Ga0070673_100326303 | 3300005364 | Unclassified | 1357 |
| 76 | Ga0070688_100044386 | 3300005365 | Bacteria | 2743 |
| 77 | Ga0070688_100143111 | 3300005365 | Unclassified | 1627 |
| 78 | Ga0070659_100180562 | 3300005366 | Bacteria | 1732 |
| 79 | Ga0070667_100074622 | 3300005367 | Bacteria | 2894 |
| 80 | Ga0070667_100091078 | 3300005367 | Bacteria | 2621 |
| 81 | Ga0070703_10000133 | 3300005406 | Bacteria | 38217 |
| 82 | Ga0070709_10121378 | 3300005434 | Bacteria | 1772 |
| 83 | Ga0070701_10024043 | 3300005438 | Bacteria | 2943 |
| 84 | Ga0070701_10271696 | 3300005438 | Bacteria | 1032 |
| 85 | Ga0070705_100138043 | 3300005440 | Bacteria | 1601 |
| 86 | Ga0070705_100165980 | 3300005440 | Bacteria | 1481 |
| 87 | Ga0070700_100000266 | 3300005441 | Bacteria | 27903 |
| 88 | Ga0070700_100009502 | 3300005441 | Bacteria | 5343 |
| 89 | Ga0070700_100022963 | 3300005441 | Bacteria | 3645 |
| 90 | Ga0070700_100027705 | 3300005441 | Bacteria | 3362 |
| 91 | Ga0070694_100000581 | 3300005444 | Bacteria | 20193 |
| 92 | Ga0070694_100013301 | 3300005444 | Bacteria | 5139 |
| 93 | Ga0070694_100013825 | 3300005444 | Bacteria | 5047 |
| 94 | Ga0070694_100018700 | 3300005444 | Unclassified | 4401 |
| 95 | Ga0070694_100045965 | 3300005444 | Bacteria | 2928 |
| 96 | Ga0070694_100087386 | 3300005444 | Unclassified | 2181 |
| 97 | Ga0070694_100139269 | 3300005444 | Bacteria | 1760 |
| 98 | Ga0070694_100140517 | 3300005444 | Unclassified | 1753 |
| 99 | Ga0070694_100160179 | 3300005444 | Bacteria | 1651 |
| 100 | Ga0070694_100319371 | 3300005444 | Bacteria | 1195 |
| 101 | Ga0070708_100198196 | 3300005445 | Bacteria | 1879 |
| 102 | Ga0070708_100488731 | 3300005445 | Bacteria | 1161 |
| 103 | Ga0070662_100109788 | 3300005457 | Bacteria | 2100 |
| 104 | Ga0070681_10000700 | 3300005458 | Bacteria | 27818 |
| 105 | Ga0070681_10002392 | 3300005458 | Bacteria | 17153 |
| 106 | Ga0070681_10110899 | 3300005458 | Bacteria | 2683 |
| 107 | Ga0068867_100043189 | 3300005459 | Bacteria | 3300 |
| 108 | Ga0068867_100154544 | 3300005459 | Bacteria | 1805 |
| 109 | Ga0068867_100337167 | 3300005459 | Bacteria | 1254 |
| 110 | Ga0070685_10091973 | 3300005466 | Bacteria | 1837 |
| 111 | Ga0070685_10155813 | 3300005466 | Bacteria | 1452 |
| 112 | Ga0070706_100000128 | 3300005467 | Bacteria | 92969 |
| 113 | Ga0070706_100005620 | 3300005467 | Bacteria | 11933 |
| 114 | Ga0070706_100018423 | 3300005467 | Bacteria | 6440 |
| 115 | Ga0070706_100216248 | 3300005467 | Bacteria | 1789 |
| 116 | Ga0070706_100353415 | 3300005467 | Bacteria | 1370 |
| 117 | Ga0070707_100000045 | 3300005468 | Bacteria | 106487 |
| 118 | Ga0070707_100002620 | 3300005468 | Bacteria | 17102 |
| 119 | Ga0070707_100016284 | 3300005468 | Bacteria | 6979 |
| 120 | Ga0070707_100046982 | 3300005468 | Bacteria | 4132 |
| 121 | Ga0070707_100143453 | 3300005468 | Bacteria | 2324 |
| 122 | Ga0070707_100199275 | 3300005468 | Bacteria | 1951 |
| 123 | Ga0070698_100000410 | 3300005471 | Bacteria | 45619 |
| 124 | Ga0070698_100002582 | 3300005471 | Bacteria | 19939 |
| 125 | Ga0070698_100005684 | 3300005471 | Bacteria | 13649 |
| 126 | Ga0070698_100210415 | 3300005471 | Bacteria | 1879 |
| 127 | Ga0070698_100409003 | 3300005471 | Bacteria | 1291 |
| 128 | Ga0070699_100000688 | 3300005518 | Bacteria | 31515 |
| 129 | Ga0070699_100001641 | 3300005518 | Bacteria | 20409 |
| 130 | Ga0070699_100016945 | 3300005518 | Bacteria | 6255 |
| 131 | Ga0070699_100189711 | 3300005518 | Bacteria | 1825 |
| 132 | Ga0070699_100201263 | 3300005518 | Bacteria | 1771 |
| 133 | Ga0070699_100226415 | 3300005518 | Bacteria | 1667 |
| 134 | Ga0070699_100288318 | 3300005518 | Bacteria | 1471 |
| 135 | Ga0070699_100348819 | 3300005518 | Bacteria | 1333 |
| 136 | Ga0070679_100000642 | 3300005530 | Bacteria | 29738 |
| 137 | Ga0070684_100005622 | 3300005535 | Bacteria | 9636 |
| 138 | Ga0070684_100143125 | 3300005535 | Bacteria | 2163 |
| 139 | Ga0070684_100162992 | 3300005535 | Unclassified | 2023 |
| 140 | Ga0070697_100000262 | 3300005536 | Bacteria | 42644 |
| 141 | Ga0070697_100005258 | 3300005536 | Bacteria | 9939 |
| 142 | Ga0070697_100026525 | 3300005536 | Bacteria | 4630 |
| 143 | Ga0070697_100450468 | 3300005536 | Bacteria | 1121 |
| 144 | Ga0068853_100033008 | 3300005539 | Bacteria | 4388 |
| 145 | Ga0070672_100000854 | 3300005543 | Bacteria | 18220 |
| 146 | Ga0070672_100039701 | 3300005543 | Bacteria | 3607 |
| 147 | Ga0070672_100053030 | 3300005543 | Bacteria | 3169 |
| 148 | Ga0070695_100031580 | 3300005545 | Bacteria | 3305 |
| 149 | Ga0070695_100113184 | 3300005545 | Unclassified | 1845 |
| 150 | Ga0070695_100116095 | 3300005545 | Unclassified | 1824 |
| 151 | Ga0070695_100204752 | 3300005545 | Unclassified | 1413 |
| 152 | Ga0070695_100293340 | 3300005545 | Bacteria | 1200 |
| 153 | Ga0070696_100048703 | 3300005546 | Bacteria | 2942 |
| 154 | Ga0070696_100180002 | 3300005546 | Unclassified | 1568 |
| 155 | Ga0070693_100001080 | 3300005547 | Bacteria | 12203 |
| 156 | Ga0070693_100021924 | 3300005547 | Bacteria | 3390 |
| 157 | Ga0070693_100032893 | 3300005547 | Bacteria | 2857 |
| 158 | Ga0070704_100008898 | 3300005549 | Bacteria | 6045 |
| 159 | Ga0070704_100057013 | 3300005549 | Bacteria | 2776 |
| 160 | Ga0070704_100208919 | 3300005549 | Unclassified | 1581 |
| 161 | Ga0070704_100243930 | 3300005549 | Bacteria | 1472 |
| 162 | Ga0070704_100384062 | 3300005549 | Unclassified | 1194 |
| 163 | Ga0070664_100327480 | 3300005564 | Bacteria | 1389 |
| 164 | Ga0068857_100076752 | 3300005577 | Bacteria | 2980 |
| 165 | Ga0068857_100162370 | 3300005577 | Bacteria | 2027 |
| 166 | Ga0068857_100566272 | 3300005577 | Bacteria | 1071 |
| 167 | Ga0068854_100028881 | 3300005578 | Bacteria | 3836 |
| 168 | Ga0068856_100448820 | 3300005614 | Bacteria | 1310 |
| 169 | Ga0070702_100007385 | 3300005615 | Bacteria | 5261 |
| 170 | Ga0070702_100009426 | 3300005615 | Bacteria | 4777 |
| 171 | Ga0070702_100009856 | 3300005615 | Bacteria | 4689 |
| 172 | Ga0070702_100084039 | 3300005615 | Bacteria | 1913 |
| 173 | Ga0068852_100050328 | 3300005616 | Bacteria | 3569 |
| 174 | Ga0068852_100169985 | 3300005616 | Unclassified | 2042 |
| 175 | Ga0068852_100327757 | 3300005616 | Unclassified | 1489 |
| 176 | Ga0068859_100071098 | 3300005617 | Bacteria | 3515 |
| 177 | Ga0068859_100075235 | 3300005617 | Bacteria | 3417 |
| 178 | Ga0068859_100085014 | 3300005617 | Bacteria | 3209 |
| 179 | Ga0068859_100102507 | 3300005617 | Bacteria | 2919 |
| 180 | Ga0068859_100120520 | 3300005617 | Bacteria | 2690 |
| 181 | Ga0068859_100128539 | 3300005617 | Bacteria | 2604 |
| 182 | Ga0068859_100140386 | 3300005617 | Bacteria | 2489 |
| 183 | Ga0068859_100202480 | 3300005617 | Unclassified | 2070 |
| 184 | Ga0068859_100205531 | 3300005617 | Bacteria | 2054 |
| 185 | Ga0068859_100375959 | 3300005617 | Unclassified | 1516 |
| 186 | Ga0068859_100443248 | 3300005617 | Bacteria | 1395 |
| 187 | Ga0068859_100679578 | 3300005617 | Bacteria | 1121 |
| 188 | Ga0068864_100000081 | 3300005618 | Bacteria | 101891 |
| 189 | Ga0068864_100012529 | 3300005618 | Bacteria | 7013 |
| 190 | Ga0068864_100220174 | 3300005618 | Bacteria | 1751 |
| 191 | Ga0068864_100300617 | 3300005618 | Bacteria | 1502 |
| 192 | Ga0068864_100382643 | 3300005618 | Bacteria | 1334 |
| 193 | Ga0068866_10071659 | 3300005718 | Bacteria | 1833 |
| 194 | Ga0068861_100030563 | 3300005719 | Bacteria | 3949 |
| 195 | Ga0068861_100031410 | 3300005719 | Bacteria | 3902 |
| 196 | Ga0068861_100078407 | 3300005719 | Bacteria | 2579 |
| 197 | Ga0068861_100232388 | 3300005719 | Bacteria | 1564 |
| 198 | Ga0068861_100332668 | 3300005719 | Bacteria | 1326 |
| 199 | Ga0068861_100505894 | 3300005719 | Bacteria | 1093 |
| 200 | Ga0068870_10005619 | 3300005840 | Bacteria | 5483 |
| 201 | Ga0068870_10057937 | 3300005840 | Bacteria | 2073 |
| 202 | Ga0068863_100168189 | 3300005841 | Bacteria | 2102 |
| 203 | Ga0068858_100000146 | 3300005842 | Bacteria | 75219 |
| 204 | Ga0068858_100001392 | 3300005842 | Bacteria | 24887 |
| 205 | Ga0068858_100013704 | 3300005842 | Bacteria | 7652 |
| 206 | Ga0068858_100029807 | 3300005842 | Bacteria | 5069 |
| 207 | Ga0068858_100039499 | 3300005842 | Bacteria | 4375 |
| 208 | Ga0068858_100042638 | 3300005842 | Bacteria | 4207 |
| 209 | Ga0068858_100057128 | 3300005842 | Bacteria | 3607 |
| 210 | Ga0068860_100044253 | 3300005843 | Bacteria | 4243 |
| 211 | Ga0068860_100149380 | 3300005843 | Bacteria | 2249 |
| 212 | Ga0068862_100041424 | 3300005844 | Bacteria | 3918 |
| 213 | Ga0068862_100073871 | 3300005844 | Bacteria | 2947 |
| 214 | Ga0068862_100139540 | 3300005844 | Bacteria | 2150 |
| 215 | Ga0068862_100263520 | 3300005844 | Bacteria | 1574 |
| 216 | Ga0068862_100401725 | 3300005844 | Bacteria | 1282 |
| 217 | Ga0081455_10002675 | 3300005937 | Bacteria | 21053 |
| 218 | Ga0081539_10000033 | 3300005985 | Bacteria | 309306 |
| 219 | Ga0081539_10001050 | 3300005985 | Bacteria | 50568 |
| 220 | Ga0081539_10004757 | 3300005985 | Bacteria | 14656 |
| 221 | Ga0070717_10088136 | 3300006028 | Bacteria | 2615 |
| 222 | Ga0075365_10003010 | 3300006038 | Bacteria | 8536 |
| 223 | Ga0075368_10007558 | 3300006042 | Bacteria | 3836 |
| 224 | Ga0075364_10021014 | 3300006051 | Bacteria | 4111 |
| 225 | Ga0070715_10000024 | 3300006163 | Bacteria | 110647 |
| 226 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 227 | Ga0075367_10015855 | 3300006178 | Bacteria | 4105 |
| 228 | Ga0075366_10005893 | 3300006195 | Bacteria | 6663 |
| 229 | Ga0097621_100028753 | 3300006237 | Bacteria | 4384 |
| 230 | Ga0097621_100140862 | 3300006237 | Bacteria | 2060 |
| 231 | Ga0097621_100179416 | 3300006237 | Bacteria | 1829 |
| 232 | Ga0097621_100306850 | 3300006237 | Unclassified | 1403 |
| 233 | Ga0097621_100375732 | 3300006237 | Bacteria | 1269 |
| 234 | Ga0075370_10013916 | 3300006353 | Bacteria | 4282 |
| 235 | Ga0068871_100005788 | 3300006358 | Bacteria | 8684 |
| 236 | Ga0068871_100015416 | 3300006358 | Bacteria | 5720 |
| 237 | Ga0068871_100071579 | 3300006358 | Bacteria | 2852 |
| 238 | Ga0068871_100291764 | 3300006358 | Unclassified | 1430 |
| 239 | Ga0068871_100360848 | 3300006358 | Unclassified | 1287 |
| 240 | Ga0075428_100059477 | 3300006844 | Bacteria | 4185 |
| 241 | Ga0075430_100065957 | 3300006846 | Bacteria | 3040 |
| 242 | Ga0075431_100048856 | 3300006847 | Bacteria | 4363 |
| 243 | Ga0075431_100345254 | 3300006847 | Bacteria | 1497 |
| 244 | Ga0075433_10071379 | 3300006852 | Bacteria | 3052 |
| 245 | Ga0075433_10090138 | 3300006852 | Bacteria | 2710 |
| 246 | Ga0075433_10137250 | 3300006852 | Unclassified | 2174 |
| 247 | Ga0075433_10210060 | 3300006852 | Unclassified | 1730 |
| 248 | Ga0075434_100040575 | 3300006871 | Bacteria | 4609 |
| 249 | Ga0075434_100058918 | 3300006871 | Bacteria | 3817 |
| 250 | Ga0075434_100074140 | 3300006871 | Unclassified | 3397 |
| 251 | Ga0075434_100148199 | 3300006871 | Unclassified | 2367 |
| 252 | Ga0075434_100236674 | 3300006871 | Unclassified | 1846 |
| 253 | Ga0075434_100518522 | 3300006871 | Bacteria | 1212 |
| 254 | Ga0075429_100014529 | 3300006880 | Bacteria | 6822 |
| 255 | Ga0075429_100018328 | 3300006880 | Bacteria | 6061 |
| 256 | Ga0068865_100089794 | 3300006881 | Unclassified | 2226 |
| 257 | Ga0068865_100096079 | 3300006881 | Bacteria | 2160 |
| 258 | Ga0075436_100000070 | 3300006914 | Bacteria | 62279 |
| 259 | Ga0075436_100019025 | 3300006914 | Bacteria | 4704 |
| 260 | Ga0075436_100035564 | 3300006914 | Bacteria | 3435 |
| 261 | Ga0075436_100061921 | 3300006914 | Bacteria | 2586 |
| 262 | Ga0097620_100071098 | 3300006931 | Bacteria | 3515 |
| 263 | Ga0097620_100075236 | 3300006931 | Bacteria | 3417 |
| 264 | Ga0097620_100085013 | 3300006931 | Bacteria | 3209 |
| 265 | Ga0097620_100102509 | 3300006931 | Bacteria | 2919 |
| 266 | Ga0097620_100120517 | 3300006931 | Bacteria | 2690 |
| 267 | Ga0097620_100128544 | 3300006931 | Bacteria | 2604 |
| 268 | Ga0097620_100140393 | 3300006931 | Bacteria | 2489 |
| 269 | Ga0097620_100202484 | 3300006931 | Unclassified | 2070 |
| 270 | Ga0097620_100205530 | 3300006931 | Bacteria | 2054 |
| 271 | Ga0097620_100375935 | 3300006931 | Unclassified | 1516 |
| 272 | Ga0097620_100443224 | 3300006931 | Bacteria | 1395 |
| 273 | Ga0097620_100679562 | 3300006931 | Bacteria | 1121 |
| 274 | Ga0075435_100004548 | 3300007076 | Bacteria | 9540 |
| 275 | Ga0075435_100006335 | 3300007076 | Bacteria | 8360 |
| 276 | Ga0075435_100011606 | 3300007076 | Bacteria | 6492 |
| 277 | Ga0075435_100021854 | 3300007076 | Bacteria | 4929 |
| 278 | Ga0075435_100043566 | 3300007076 | Bacteria | 3592 |
| 279 | Ga0075435_100080626 | 3300007076 | Bacteria | 2673 |
| 280 | Ga0105240_10233763 | 3300009093 | Bacteria | 2135 |
| 281 | Ga0105240_10782569 | 3300009093 | Bacteria | 1035 |
| 282 | Ga0111539_10000439 | 3300009094 | Bacteria | 52493 |
| 283 | Ga0111539_10075589 | 3300009094 | Unclassified | 3968 |
| 284 | Ga0111539_10208867 | 3300009094 | Bacteria | 2275 |
| 285 | Ga0111539_10291071 | 3300009094 | Bacteria | 1900 |
| 286 | Ga0111539_10341656 | 3300009094 | Bacteria | 1742 |
| 287 | Ga0111539_10405000 | 3300009094 | Bacteria | 1589 |
| 288 | Ga0105245_10000024 | 3300009098 | Bacteria | 178565 |
| 289 | Ga0105245_10001940 | 3300009098 | Bacteria | 18798 |
| 290 | Ga0105245_10016939 | 3300009098 | Bacteria | 6362 |
| 291 | Ga0105245_10018124 | 3300009098 | Bacteria | 6155 |
| 292 | Ga0105245_10068587 | 3300009098 | Bacteria | 3214 |
| 293 | Ga0105245_10092202 | 3300009098 | Bacteria | 2789 |
| 294 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 295 | Ga0105247_10006142 | 3300009101 | Bacteria | 7462 |
| 296 | Ga0105247_10014291 | 3300009101 | Bacteria | 4765 |
| 297 | Ga0105247_10021761 | 3300009101 | Bacteria | 3857 |
| 298 | Ga0105247_10052573 | 3300009101 | Bacteria | 2512 |
| 299 | Ga0114129_10006197 | 3300009147 | Bacteria | 16970 |
| 300 | Ga0114129_10012566 | 3300009147 | Bacteria | 12056 |
| 301 | Ga0114129_10017794 | 3300009147 | Bacteria | 10120 |
| 302 | Ga0114129_10087200 | 3300009147 | Bacteria | 4328 |
| 303 | Ga0114129_10105815 | 3300009147 | Unclassified | 3887 |
| 304 | Ga0114129_10190624 | 3300009147 | Bacteria | 2784 |
| 305 | Ga0114129_10231906 | 3300009147 | Bacteria | 2486 |
| 306 | Ga0114129_10291547 | 3300009147 | Bacteria | 2177 |
| 307 | Ga0114129_10379387 | 3300009147 | Unclassified | 1867 |
| 308 | Ga0114129_10849696 | 3300009147 | Unclassified | 1160 |
| 309 | Ga0114129_10858483 | 3300009147 | Bacteria | 1153 |
| 310 | Ga0105243_10000393 | 3300009148 | Bacteria | 46112 |
| 311 | Ga0105243_10388210 | 3300009148 | Bacteria | 1293 |
| 312 | Ga0105241_10025217 | 3300009174 | Bacteria | 4419 |
| 313 | Ga0105241_10143827 | 3300009174 | Bacteria | 1945 |
| 314 | Ga0105241_10203945 | 3300009174 | Bacteria | 1653 |
| 315 | Ga0105242_10000004 | 3300009176 | Bacteria | 224767 |
| 316 | Ga0105242_10000313 | 3300009176 | Bacteria | 38823 |
| 317 | Ga0105242_10029337 | 3300009176 | Bacteria | 4387 |
| 318 | Ga0105242_10152594 | 3300009176 | Bacteria | 2016 |
| 319 | Ga0105242_10591400 | 3300009176 | Bacteria | 1070 |
| 320 | Ga0105248_10013627 | 3300009177 | Bacteria | 8949 |
| 321 | Ga0105248_10025127 | 3300009177 | Bacteria | 6622 |
| 322 | Ga0105248_10025718 | 3300009177 | Bacteria | 6547 |
| 323 | Ga0105248_10055572 | 3300009177 | Bacteria | 4441 |
| 324 | Ga0105248_10057402 | 3300009177 | Bacteria | 4369 |
| 325 | Ga0105248_10168645 | 3300009177 | Bacteria | 2467 |
| 326 | Ga0105248_10179278 | 3300009177 | Bacteria | 2388 |
| 327 | Ga0105248_10390760 | 3300009177 | Unclassified | 1566 |
| 328 | Ga0105237_10599111 | 3300009545 | Unclassified | 1109 |
| 329 | Ga0105237_10675486 | 3300009545 | Bacteria | 1040 |
| 330 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 331 | Ga0105238_10046310 | 3300009551 | Bacteria | 4390 |
| 332 | Ga0105238_10061191 | 3300009551 | Bacteria | 3768 |
| 333 | Ga0105238_10191998 | 3300009551 | Unclassified | 2018 |
| 334 | Ga0105238_10652419 | 3300009551 | Bacteria | 1062 |
| 335 | Ga0105249_10001872 | 3300009553 | Bacteria | 18236 |
| 336 | Ga0105249_10046821 | 3300009553 | Bacteria | 3937 |
| 337 | Ga0105249_10082427 | 3300009553 | Bacteria | 2993 |
| 338 | Ga0105249_10091747 | 3300009553 | Bacteria | 2843 |
| 339 | Ga0105249_10146986 | 3300009553 | Unclassified | 2265 |
| 340 | Ga0105249_10189909 | 3300009553 | Bacteria | 2004 |
| 341 | Ga0105239_10027696 | 3300010375 | Bacteria | 6235 |
| 342 | Ga0105239_10214226 | 3300010375 | Bacteria | 2159 |
| 343 | Ga0105239_10270584 | 3300010375 | Bacteria | 1911 |
| 344 | Ga0105246_10161518 | 3300011119 | Bacteria | 1707 |
| 345 | Ga0157373_10002636 | 3300013100 | Bacteria | 13607 |
| 346 | Ga0157373_10112158 | 3300013100 | Unclassified | 1917 |
| 347 | Ga0157369_10000654 | 3300013105 | Bacteria | 44821 |
| 348 | Ga0157369_10326614 | 3300013105 | Bacteria | 1594 |
| 349 | Ga0157374_10000022 | 3300013296 | Bacteria | 270307 |
| 350 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 351 | Ga0157378_10000269 | 3300013297 | Bacteria | 50584 |
| 352 | Ga0157378_10000600 | 3300013297 | Bacteria | 33795 |
| 353 | Ga0157378_10005313 | 3300013297 | Bacteria | 11311 |
| 354 | Ga0157378_10036792 | 3300013297 | Bacteria | 4332 |
| 355 | Ga0157378_10204095 | 3300013297 | Bacteria | 1871 |
| 356 | Ga0157378_10454510 | 3300013297 | Archaea | 1272 |
| 357 | Ga0163162_10025254 | 3300013306 | Bacteria | 5871 |
| 358 | Ga0163162_10033650 | 3300013306 | Bacteria | 5094 |
| 359 | Ga0163162_10058127 | 3300013306 | Bacteria | 3895 |
| 360 | Ga0163162_10093107 | 3300013306 | Bacteria | 3098 |
| 361 | Ga0163162_10199599 | 3300013306 | Bacteria | 2129 |
| 362 | Ga0163162_10374911 | 3300013306 | Bacteria | 1556 |
| 363 | Ga0157375_10000002 | 3300013308 | Bacteria | 495826 |
| 364 | Ga0157375_10000008 | 3300013308 | Bacteria | 373560 |
| 365 | Ga0157375_10000106 | 3300013308 | Bacteria | 82080 |
| 366 | Ga0157375_10003437 | 3300013308 | Bacteria | 13728 |
| 367 | Ga0157375_10015052 | 3300013308 | Bacteria | 6918 |
| 368 | Ga0157375_10233935 | 3300013308 | Bacteria | 1996 |
| 369 | Ga0157375_10485381 | 3300013308 | Unclassified | 1400 |
| 370 | Ga0163163_10000103 | 3300014325 | Bacteria | 89756 |
| 371 | Ga0163163_10000961 | 3300014325 | Bacteria | 24490 |
| 372 | Ga0163163_10030602 | 3300014325 | Bacteria | 5188 |
| 373 | Ga0163163_10055419 | 3300014325 | Bacteria | 3918 |
| 374 | Ga0163163_10088802 | 3300014325 | Bacteria | 3102 |
| 375 | Ga0163163_10191202 | 3300014325 | Bacteria | 2095 |
| 376 | Ga0163163_10226335 | 3300014325 | Bacteria | 1919 |
| 377 | Ga0163163_10523908 | 3300014325 | Bacteria | 1248 |
| 378 | Ga0157380_10000324 | 3300014326 | Bacteria | 28884 |
| 379 | Ga0157380_10000682 | 3300014326 | Bacteria | 21066 |
| 380 | Ga0157380_10028508 | 3300014326 | Bacteria | 4257 |
| 381 | Ga0157380_10468781 | 3300014326 | Unclassified | 1214 |
| 382 | Ga0157377_10000009 | 3300014745 | Bacteria | 385287 |
| 383 | Ga0157377_10053196 | 3300014745 | Bacteria | 2288 |
| 384 | Ga0157377_10059760 | 3300014745 | Unclassified | 2174 |
| 385 | Ga0157377_10093745 | 3300014745 | Bacteria | 1778 |
| 386 | Ga0157376_10000020 | 3300014969 | Bacteria | 246318 |
| 387 | Ga0157376_10128811 | 3300014969 | Unclassified | 2255 |
| 388 | Ga0157376_10251197 | 3300014969 | Bacteria | 1652 |
| 389 | Ga0157376_10307896 | 3300014969 | Bacteria | 1502 |
| 390 | Ga0163161_10452017 | 3300017792 | Bacteria | 1039 |
| 391 | Ga0213873_10000857 | 3300021358 | Bacteria | 4904 |
| 392 | Ga0213876_10000173 | 3300021384 | Bacteria | 67175 |
| 393 | Ga0213876_10129397 | 3300021384 | Unclassified | 1341 |
| 394 | Ga0207672_1000023 | 3300025223 | Bacteria | 19646 |
| 395 | Ga0207697_10003076 | 3300025315 | Bacteria | 8361 |
| 396 | Ga0207697_10018269 | 3300025315 | Bacteria | 2877 |
| 397 | Ga0207653_10013378 | 3300025885 | Bacteria | 2569 |
| 398 | Ga0207682_10012961 | 3300025893 | Bacteria | 3251 |
| 399 | Ga0207642_10218241 | 3300025899 | Bacteria | 1064 |
| 400 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 401 | Ga0207710_10037796 | 3300025900 | Bacteria | 2133 |
| 402 | Ga0207710_10038751 | 3300025900 | Unclassified | 2108 |
| 403 | Ga0207710_10077795 | 3300025900 | Unclassified | 1533 |
| 404 | Ga0207688_10021304 | 3300025901 | Bacteria | 3541 |
| 405 | Ga0207647_10003411 | 3300025904 | Bacteria | 11915 |
| 406 | Ga0207647_10031331 | 3300025904 | Bacteria | 3423 |
| 407 | Ga0207685_10000018 | 3300025905 | Bacteria | 145715 |
| 408 | Ga0207645_10008342 | 3300025907 | Bacteria | 7234 |
| 409 | Ga0207645_10254400 | 3300025907 | Unclassified | 1163 |
| 410 | Ga0207643_10011936 | 3300025908 | Bacteria | 4692 |
| 411 | Ga0207643_10022588 | 3300025908 | Bacteria | 3465 |
| 412 | Ga0207705_10026000 | 3300025909 | Bacteria | 4177 |
| 413 | Ga0207684_10000150 | 3300025910 | Bacteria | 121849 |
| 414 | Ga0207684_10009401 | 3300025910 | Bacteria | 8632 |
| 415 | Ga0207684_10012493 | 3300025910 | Bacteria | 7382 |
| 416 | Ga0207684_10160736 | 3300025910 | Bacteria | 1934 |
| 417 | Ga0207654_10104861 | 3300025911 | Bacteria | 1748 |
| 418 | Ga0207707_10000016 | 3300025912 | Bacteria | 256002 |
| 419 | Ga0207707_10097911 | 3300025912 | Bacteria | 2564 |
| 420 | Ga0207695_10209555 | 3300025913 | Bacteria | 1860 |
| 421 | Ga0207671_10013502 | 3300025914 | Bacteria | 6501 |
| 422 | Ga0207671_10179860 | 3300025914 | Bacteria | 1645 |
| 423 | Ga0207671_10438416 | 3300025914 | Bacteria | 1040 |
| 424 | Ga0207660_10012368 | 3300025917 | Bacteria | 5583 |
| 425 | Ga0207660_10158872 | 3300025917 | Bacteria | 1742 |
| 426 | Ga0207662_10011653 | 3300025918 | Bacteria | 4884 |
| 427 | Ga0207662_10041566 | 3300025918 | Bacteria | 2707 |
| 428 | Ga0207652_10002213 | 3300025921 | Bacteria | 16596 |
| 429 | Ga0207646_10000097 | 3300025922 | Bacteria | 117004 |
| 430 | Ga0207646_10000329 | 3300025922 | Bacteria | 64353 |
| 431 | Ga0207646_10006971 | 3300025922 | Bacteria | 11584 |
| 432 | Ga0207646_10372763 | 3300025922 | Bacteria | 1290 |
| 433 | Ga0207681_10003404 | 3300025923 | Bacteria | 9948 |
| 434 | Ga0207681_10016849 | 3300025923 | Bacteria | 4581 |
| 435 | Ga0207681_10064431 | 3300025923 | Bacteria | 2530 |
| 436 | Ga0207681_10197968 | 3300025923 | Bacteria | 1541 |
| 437 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 438 | Ga0207694_10004103 | 3300025924 | Bacteria | 11452 |
| 439 | Ga0207694_10094624 | 3300025924 | Bacteria | 2361 |
| 440 | Ga0207650_10000011 | 3300025925 | Bacteria | 450115 |
| 441 | Ga0207650_10000218 | 3300025925 | Bacteria | 65326 |
| 442 | Ga0207650_10173687 | 3300025925 | Bacteria | 1714 |
| 443 | Ga0207659_10146619 | 3300025926 | Bacteria | 1838 |
| 444 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 445 | Ga0207687_10010373 | 3300025927 | Bacteria | 6087 |
| 446 | Ga0207687_10021483 | 3300025927 | Bacteria | 4289 |
| 447 | Ga0207687_10134890 | 3300025927 | Bacteria | 1866 |
| 448 | Ga0207644_10000536 | 3300025931 | Bacteria | 24626 |
| 449 | Ga0207644_10056655 | 3300025931 | Bacteria | 2829 |
| 450 | Ga0207644_10193401 | 3300025931 | Unclassified | 1601 |
| 451 | Ga0207706_10053217 | 3300025933 | Bacteria | 3574 |
| 452 | Ga0207686_10000005 | 3300025934 | Bacteria | 260873 |
| 453 | Ga0207686_10000236 | 3300025934 | Bacteria | 42150 |
| 454 | Ga0207686_10000384 | 3300025934 | Bacteria | 30891 |
| 455 | Ga0207686_10072890 | 3300025934 | Bacteria | 2214 |
| 456 | Ga0207709_10000088 | 3300025935 | Bacteria | 152210 |
| 457 | Ga0207709_10000339 | 3300025935 | Bacteria | 48683 |
| 458 | Ga0207709_10002142 | 3300025935 | Bacteria | 12651 |
| 459 | Ga0207709_10104176 | 3300025935 | Bacteria | 1882 |
| 460 | Ga0207670_10001498 | 3300025936 | Bacteria | 12273 |
| 461 | Ga0207670_10031299 | 3300025936 | Unclassified | 3408 |
| 462 | Ga0207670_10166227 | 3300025936 | Unclassified | 1651 |
| 463 | Ga0207670_10193278 | 3300025936 | Unclassified | 1541 |
| 464 | Ga0207670_10226584 | 3300025936 | Bacteria | 1434 |
| 465 | Ga0207669_10106567 | 3300025937 | Bacteria | 1867 |
| 466 | Ga0207704_10216257 | 3300025938 | Unclassified | 1414 |
| 467 | Ga0207704_10268315 | 3300025938 | Bacteria | 1291 |
| 468 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 469 | Ga0207665_10037056 | 3300025939 | Bacteria | 3244 |
| 470 | Ga0207665_10134820 | 3300025939 | Bacteria | 1756 |
| 471 | Ga0207691_10083917 | 3300025940 | Bacteria | 2860 |
| 472 | Ga0207691_10133195 | 3300025940 | Bacteria | 2194 |
| 473 | Ga0207691_10538376 | 3300025940 | Bacteria | 991 |
| 474 | Ga0207711_10010782 | 3300025941 | Bacteria | 7596 |
| 475 | Ga0207711_10012424 | 3300025941 | Bacteria | 7078 |
| 476 | Ga0207711_10013925 | 3300025941 | Bacteria | 6679 |
| 477 | Ga0207711_10030560 | 3300025941 | Bacteria | 4544 |
| 478 | Ga0207711_10222617 | 3300025941 | Bacteria | 1726 |
| 479 | Ga0207711_10330169 | 3300025941 | Unclassified | 1410 |
| 480 | Ga0207689_10006166 | 3300025942 | Bacteria | 10609 |
| 481 | Ga0207689_10030896 | 3300025942 | Bacteria | 4462 |
| 482 | Ga0207689_10220599 | 3300025942 | Bacteria | 1566 |
| 483 | Ga0207689_10316337 | 3300025942 | Bacteria | 1295 |
| 484 | Ga0207661_10000044 | 3300025944 | Bacteria | 115753 |
| 485 | Ga0207661_10062906 | 3300025944 | Unclassified | 3004 |
| 486 | Ga0207679_10053776 | 3300025945 | Bacteria | 2961 |
| 487 | Ga0207679_10108817 | 3300025945 | Bacteria | 2183 |
| 488 | Ga0207651_10008898 | 3300025960 | Bacteria | 5454 |
| 489 | Ga0207651_10012803 | 3300025960 | Bacteria | 4766 |
| 490 | Ga0207651_10141154 | 3300025960 | Bacteria | 1861 |
| 491 | Ga0207651_10573968 | 3300025960 | Unclassified | 983 |
| 492 | Ga0207712_10005230 | 3300025961 | Bacteria | 8207 |
| 493 | Ga0207712_10022873 | 3300025961 | Bacteria | 4121 |
| 494 | Ga0207712_10087624 | 3300025961 | Bacteria | 2284 |
| 495 | Ga0207712_10118554 | 3300025961 | Bacteria | 1998 |
| 496 | Ga0207712_10443598 | 3300025961 | Unclassified | 1099 |
| 497 | Ga0207640_10022961 | 3300025981 | Bacteria | 3743 |
| 498 | Ga0207640_10087055 | 3300025981 | Bacteria | 2152 |
| 499 | Ga0207640_10113430 | 3300025981 | Bacteria | 1926 |
| 500 | Ga0207658_10171437 | 3300025986 | Bacteria | 1788 |
| 501 | Ga0207677_10000005 | 3300026023 | Bacteria | 287656 |
| 502 | Ga0207677_10000009 | 3300026023 | Bacteria | 252751 |
| 503 | Ga0207677_10179503 | 3300026023 | Bacteria | 1664 |
| 504 | Ga0207677_10437819 | 3300026023 | Bacteria | 1117 |
| 505 | Ga0207703_10000687 | 3300026035 | Bacteria | 33444 |
| 506 | Ga0207703_10015342 | 3300026035 | Bacteria | 5976 |
| 507 | Ga0207703_10047035 | 3300026035 | Bacteria | 3477 |
| 508 | Ga0207703_10150310 | 3300026035 | Bacteria | 2030 |
| 509 | Ga0207703_10184085 | 3300026035 | Bacteria | 1845 |
| 510 | Ga0207703_10213589 | 3300026035 | Bacteria | 1721 |
| 511 | Ga0207639_10402506 | 3300026041 | Bacteria | 1233 |
| 512 | Ga0207708_10000725 | 3300026075 | Bacteria | 24762 |
| 513 | Ga0207708_10002201 | 3300026075 | Bacteria | 14398 |
| 514 | Ga0207708_10014124 | 3300026075 | Bacteria | 5969 |
| 515 | Ga0207708_10027465 | 3300026075 | Bacteria | 4309 |
| 516 | Ga0207708_10038347 | 3300026075 | Bacteria | 3650 |
| 517 | Ga0207708_10067037 | 3300026075 | Bacteria | 2745 |
| 518 | Ga0207708_10084351 | 3300026075 | Bacteria | 2443 |
| 519 | Ga0207702_10485759 | 3300026078 | Bacteria | 1202 |
| 520 | Ga0207641_10130711 | 3300026088 | Bacteria | 2254 |
| 521 | Ga0207641_10234867 | 3300026088 | Unclassified | 1706 |
| 522 | Ga0207641_10295768 | 3300026088 | Bacteria | 1528 |
| 523 | Ga0207648_10019253 | 3300026089 | Bacteria | 6162 |
| 524 | Ga0207676_10000020 | 3300026095 | Bacteria | 301541 |
| 525 | Ga0207676_10057318 | 3300026095 | Bacteria | 3067 |
| 526 | Ga0207674_10154972 | 3300026116 | Bacteria | 2246 |
| 527 | Ga0207674_10198755 | 3300026116 | Bacteria | 1954 |
| 528 | Ga0207674_10238543 | 3300026116 | Bacteria | 1765 |
| 529 | Ga0207675_100013881 | 3300026118 | Bacteria | 7510 |
| 530 | Ga0207675_100020577 | 3300026118 | Bacteria | 6150 |
| 531 | Ga0207675_100030317 | 3300026118 | Bacteria | 5037 |
| 532 | Ga0207675_100034479 | 3300026118 | Bacteria | 4719 |
| 533 | Ga0207675_100036361 | 3300026118 | Bacteria | 4594 |
| 534 | Ga0207675_100046067 | 3300026118 | Bacteria | 4074 |
| 535 | Ga0207675_100067025 | 3300026118 | Bacteria | 3355 |
| 536 | Ga0207675_100359766 | 3300026118 | Unclassified | 1428 |
| 537 | Ga0207675_100429340 | 3300026118 | Bacteria | 1306 |
| 538 | Ga0209971_1039665 | 3300027682 | Bacteria | 1133 |
| 539 | Ga0207428_10011558 | 3300027907 | Bacteria | 7796 |
| 540 | Ga0207428_10038151 | 3300027907 | Bacteria | 3907 |
| 541 | Ga0207428_10203960 | 3300027907 | Bacteria | 1487 |
| 542 | Ga0268266_10173918 | 3300028379 | Bacteria | 1956 |
| 543 | Ga0268265_10007639 | 3300028380 | Bacteria | 7295 |
| 544 | Ga0268265_10044289 | 3300028380 | Bacteria | 3313 |
| 545 | Ga0268265_10086271 | 3300028380 | Bacteria | 2494 |
| 546 | Ga0268265_10130266 | 3300028380 | Unclassified | 2089 |
| 547 | Ga0268265_10142348 | 3300028380 | Bacteria | 2009 |
| 548 | Ga0268265_10484949 | 3300028380 | Bacteria | 1162 |
| 549 | Ga0268264_10035201 | 3300028381 | Bacteria | 4122 |
| 550 | Ga0268264_10065450 | 3300028381 | Bacteria | 3062 |
| 551 | Ga0268264_10090411 | 3300028381 | Bacteria | 2638 |
| 552 | Ga0268264_10214828 | 3300028381 | Bacteria | 1768 |
| 553 | Ga0268264_10290402 | 3300028381 | Bacteria | 1535 |
| 554 | Ga0268264_10448590 | 3300028381 | Bacteria | 1249 |
| 555 | Ga0307511_10000562 | 3300030521 | Bacteria | 39912 |
| 556 | Ga0307408_100008073 | 3300031548 | Bacteria | 6958 |
| 557 | Ga0307408_100114484 | 3300031548 | Bacteria | 2078 |
| 558 | Ga0307408_100299274 | 3300031548 | Bacteria | 1347 |
| 559 | Ga0307405_10025242 | 3300031731 | Bacteria | 3408 |
| 560 | Ga0307405_10065247 | 3300031731 | Unclassified | 2317 |
| 561 | Ga0307405_10356561 | 3300031731 | Bacteria | 1130 |
| 562 | Ga0307410_10001655 | 3300031852 | Bacteria | 10250 |
| 563 | Ga0307406_10021804 | 3300031901 | Bacteria | 3794 |
| 564 | Ga0307412_10021597 | 3300031911 | Bacteria | 3935 |
| 565 | Ga0307412_10054547 | 3300031911 | Bacteria | 2654 |
| 566 | Ga0307412_10191984 | 3300031911 | Bacteria | 1545 |
| 567 | Ga0307409_100081046 | 3300031995 | Bacteria | 2622 |
| 568 | Ga0307416_100001814 | 3300032002 | Bacteria | 11867 |
| 569 | Ga0307416_100040486 | 3300032002 | Bacteria | 3621 |
| 570 | Ga0307416_100455655 | 3300032002 | Unclassified | 1333 |
| 571 | Ga0307414_10001545 | 3300032004 | Bacteria | 11955 |
| 572 | Ga0307411_10013888 | 3300032005 | Bacteria | 4463 |
| 573 | Ga0307411_10032000 | 3300032005 | Bacteria | 3245 |
| 574 | Ga0307415_100003242 | 3300032126 | Bacteria | 8257 |
| 575 | Ga0373949_0012780 | 3300035090 | Bacteria | 1859 |
| 576 | Ga0373951_0001232 | 3300035091 | Bacteria | 6770 |
| 577 | Ga0373923_0069407 | 3300035111 | Bacteria | 1511 |
| 578 | Ga0373936_0125026 | 3300035113 | Bacteria | 1102 |
| 579 | Ga0373942_0016088 | 3300035207 | Unclassified | 1831 |
| 580 | Ga0373962_0026915 | 3300035242 | Bacteria | 1553 |
| 581 | Ga0373931_0012931 | 3300035691 | Bacteria | 4054 |
| 582 | Ga0373931_0305206 | 3300035691 | Bacteria | 984 |
| 583 | Ga0373933_0169842 | 3300035724 | Bacteria | 1387 |
| 584 | Ga0373937_0109133 | 3300036401 | Bacteria | 2573 |
| 585 | Ga0373937_0151172 | 3300036401 | Bacteria | 2175 |
| 586 | Ga0373937_0334682 | 3300036401 | Bacteria | 1433 |
| 587 | Ga0395899_0167746 | 3300037312 | Unclassified | 1548 |
| 588 | Ga0395900_0174504 | 3300037418 | Bacteria | 2187 |
| 589 | Ga0395900_0291047 | 3300037418 | Bacteria | 1622 |
| 590 | Ga0395898_0272294 | 3300037466 | Unclassified | 1615 |
| 591 | Ga0436364_0362554 | 3300037853 | Bacteria | 2224 |
| 592 | Ga0436365_0587160 | 3300039437 | Bacteria | 47503 |
| 593 | Ga0436362_1025943 | 3300039453 | Bacteria | 4917 |
| 594 | Ga0439445_0034968 | 3300042004 | Bacteria | 1318 |
| 595 | Ga0439448_0005524 | 3300042005 | Bacteria | 3606 |
| 596 | Ga0439450_045394 | 3300042008 | Bacteria | 1031 |
| 597 | Ga0439458_0007665 | 3300042157 | Unclassified | 2404 |
| 598 | Ga0453683_0170613 | 3300044673 | Unclassified | 1378 |
| 599 | Ga0451576_0008797 | 3300045051 | Bacteria | 11809 |
| 600 | Ga0451576_0069143 | 3300045051 | Bacteria | 3674 |
| 601 | Ga0451576_0265948 | 3300045051 | Bacteria | 1793 |
| 602 | Ga0451576_0382857 | 3300045051 | Bacteria | 1474 |
| 603 | Ga0495629_0018566 | 3300046459 | Bacteria | 4973 |
| 604 | Ga0495629_0128150 | 3300046459 | Bacteria | 1768 |
| 605 | Ga0495582_0003606 | 3300046473 | Bacteria | 8726 |
| 606 | Ga0495667_0232241 | 3300046559 | Bacteria | 1176 |
| 607 | Ga0495613_0043345 | 3300046689 | Bacteria | 3329 |
| 608 | Ga0495600_0205875 | 3300046809 | Bacteria | 1262 |
| 609 | Ga0495581_0005851 | 3300047315 | Bacteria | 7128 |
| 610 | Ga0495674_0299853 | 3300047319 | Bacteria | 1313 |
| 611 | Ga0495679_019559 | 3300047446 | Unclassified | 2376 |
| 612 | Ga0496100_0153326 | 3300048903 | Bacteria | 1646 |
| 613 | Ga0496101_0123474 | 3300048904 | Bacteria | 1960 |
| 614 | Ga0496102_0444951 | 3300048905 | Bacteria | 1216 |
| 615 | Ga0496104_0069827 | 3300048907 | Bacteria | 3339 |
| 616 | Ga0496106_0000607 | 3300048909 | Bacteria | 25590 |
| 617 | Ga0496106_0031023 | 3300048909 | Bacteria | 3984 |
| 618 | Ga0496106_0133634 | 3300048909 | Bacteria | 1947 |
| 619 | Ga0496106_0189738 | 3300048909 | Unclassified | 1634 |
| 620 | Ga0496109_0000379 | 3300048912 | Bacteria | 40412 |
| 621 | Ga0496109_0077347 | 3300048912 | Bacteria | 3062 |
| 622 | Ga0496109_0247044 | 3300048912 | Unclassified | 1680 |
| 623 | Ga0496110_0133830 | 3300048913 | Unclassified | 2240 |
| 624 | Ga0496112_0002397 | 3300048915 | Bacteria | 15076 |
| 625 | Ga0496112_0150211 | 3300048915 | Bacteria | 2297 |
| 626 | Ga0496113_0113177 | 3300048916 | Bacteria | 2115 |
| 627 | Ga0496113_0196106 | 3300048916 | Unclassified | 1604 |
| 628 | Ga0496114_0078765 | 3300048917 | Bacteria | 2781 |
| 629 | Ga0496114_0086560 | 3300048917 | Bacteria | 2656 |
| 630 | Ga0496114_0392614 | 3300048917 | Unclassified | 1229 |
| 631 | Ga0496114_0449181 | 3300048917 | Unclassified | 1142 |
| 632 | Ga0496115_0006199 | 3300048918 | Bacteria | 8746 |
| 633 | Ga0501031_0068793 | 3300049568 | Bacteria | 2306 |
| 634 | Ga0501031_0212539 | 3300049568 | Unclassified | 1260 |
| 635 | Ga0501032_0037590 | 3300049569 | Bacteria | 3300 |
| 636 | Ga0501033_0004970 | 3300049570 | Bacteria | 10574 |
| 637 | Ga0501033_0006587 | 3300049570 | Bacteria | 9083 |
| 638 | Ga0501034_0161990 | 3300049571 | Bacteria | 2207 |
| 639 | Ga0501034_0194760 | 3300049571 | Bacteria | 1987 |
| 640 | Ga0501036_0109479 | 3300049572 | Bacteria | 2334 |
| 641 | Ga0501036_0283907 | 3300049572 | Bacteria | 1385 |
| 642 | Ga0501037_0036695 | 3300049573 | Bacteria | 3611 |
| 643 | Ga0501037_0046187 | 3300049573 | Bacteria | 3194 |
| 644 | Ga0501038_0076145 | 3300049574 | Bacteria | 2834 |
| 645 | Ga0501039_0006443 | 3300049575 | Bacteria | 8920 |
| 646 | Ga0501043_0026346 | 3300049579 | Bacteria | 4562 |
| 647 | Ga0501046_0051751 | 3300049580 | Bacteria | 3239 |
| 648 | Ga0501046_0165512 | 3300049580 | Bacteria | 1661 |
| 649 | Ga0501047_0175594 | 3300049581 | Bacteria | 2009 |
| 650 | Ga0501048_0199436 | 3300049582 | Bacteria | 1418 |
| 651 | Ga0501067_0051153 | 3300049583 | Bacteria | 2291 |
| 652 | Ga0501069_0008951 | 3300049585 | Bacteria | 5281 |
| 653 | Ga0501069_0026950 | 3300049585 | Unclassified | 3148 |
| 654 | Ga0501070_0015013 | 3300049586 | Bacteria | 6516 |
| 655 | Ga0501070_0025561 | 3300049586 | Bacteria | 4952 |
| 656 | Ga0501072_0406876 | 3300049588 | Unclassified | 1079 |
| 657 | Ga0501073_0031581 | 3300049589 | Bacteria | 3778 |
| 658 | Ga0501073_0090490 | 3300049589 | Bacteria | 2126 |
| 659 | Ga0501074_0009531 | 3300049590 | Bacteria | 7053 |
| 660 | Ga0501074_0171707 | 3300049590 | Bacteria | 1547 |
| 661 | Ga0501198_000246 | 3300049649 | Bacteria | 6912 |
| 662 | Ga0501202_000568 | 3300049652 | Bacteria | 5368 |
| 663 | Ga0501209_016372 | 3300049656 | Bacteria | 1672 |
| 664 | Ga0501216_004487 | 3300049660 | Bacteria | 2074 |
| 665 | Ga0501217_004628 | 3300049661 | Bacteria | 2835 |
| 666 | Ga0501223_000583 | 3300049663 | Bacteria | 8819 |
| 667 | Ga0501224_005519 | 3300049664 | Bacteria | 1814 |
| 668 | Ga0501230_001327 | 3300049667 | Bacteria | 2915 |
| 669 | Ga0501235_000868 | 3300049669 | Bacteria | 6192 |
| 670 | Ga0501240_001860 | 3300049673 | Bacteria | 2137 |
| 671 | Ga0501243_000901 | 3300049675 | Bacteria | 4158 |
| 672 | Ga0501257_003649 | 3300049686 | Bacteria | 3321 |
| 673 | Ga0501257_015548 | 3300049686 | Bacteria | 1759 |
| 674 | Ga0501260_001061 | 3300049689 | Bacteria | 2222 |
| 675 | Ga0501221_021799 | 3300049704 | Unclassified | 1264 |
| 676 | Ga0501225_0001270 | 3300049705 | Bacteria | 7826 |
| 677 | Ga0501225_0026006 | 3300049705 | Bacteria | 1610 |
| 678 | Ga0501229_002822 | 3300049706 | Bacteria | 2057 |
| 679 | Ga0501234_000197 | 3300049707 | Bacteria | 8540 |
| 680 | Ga0501245_001676 | 3300049708 | Bacteria | 2896 |
| 681 | Ga0501079_0054424 | 3300049741 | Bacteria | 3086 |
| 682 | Ga0501079_0178769 | 3300049741 | Bacteria | 1655 |
| 683 | Ga0501083_0054781 | 3300049744 | Bacteria | 2675 |
| 684 | Ga0501083_0133765 | 3300049744 | Bacteria | 1625 |
| 685 | Ga0501268_002951 | 3300049765 | Bacteria | 2289 |
| 686 | Ga0501272_003817 | 3300049769 | Bacteria | 1548 |
| 687 | Ga0501273_003885 | 3300049770 | Bacteria | 1614 |
| 688 | Ga0501035_0008860 | 3300049822 | Bacteria | 9362 |
| 689 | Ga0501044_0110996 | 3300049823 | Bacteria | 2750 |
| 690 | Ga0501044_0171962 | 3300049823 | Bacteria | 2137 |
| 691 | Ga0501045_0056428 | 3300049824 | Bacteria | 2872 |
| 692 | Ga0501204_002344 | 3300049850 | Bacteria | 1916 |
| 693 | Ga0501226_000200 | 3300049853 | Bacteria | 9358 |
| 694 | nmdc:mga03683_1363_c1 | 3300050489 | Bacteria | 7245 |
| 695 | nmdc:mga00v17_35644_c1 | 3300050491 | Bacteria | 2963 |
| 696 | nmdc:mga0k408_6811_c1 | 3300050493 | Bacteria | 6092 |
| 697 | nmdc:mga06z11_20504_c1 | 3300050494 | Bacteria | 3056 |
| 698 | nmdc:mga05p37_132122_c1 | 3300050507 | Bacteria | 3063 |
| 699 | nmdc:mga05p37_133827_c1 | 3300050507 | Bacteria | 3041 |
| 700 | nmdc:mga05p37_141780_c1 | 3300050507 | Bacteria | 2944 |
| 701 | nmdc:mga05p37_263431_c1 | 3300050507 | Bacteria | 2062 |
| 702 | nmdc:mga05p37_353826_c1 | 3300050507 | Unclassified | 1728 |
| 703 | nmdc:mga05p37_44985_c1 | 3300050507 | Bacteria | 5431 |
| 704 | nmdc:mga05p37_489328_c1 | 3300050507 | Unclassified | 1415 |
| 705 | nmdc:mga05p37_55119_c1 | 3300050507 | Bacteria | 4891 |
| 706 | nmdc:mga06r32_269026_c1 | 3300050510 | Bacteria | 1692 |
| 707 | nmdc:mga08y16_134014_c1 | 3300050511 | Bacteria | 2575 |
| 708 | nmdc:mga08y16_286353_c1 | 3300050511 | Bacteria | 1699 |
| 709 | nmdc:mga08y16_46923_c1 | 3300050511 | Bacteria | 4522 |
| 710 | nmdc:mga08y16_82902_c1 | 3300050511 | Bacteria | 3343 |
| 711 | nmdc:mga0n895_273186_c1 | 3300050512 | Bacteria | 1714 |
| 712 | nmdc:mga0n895_311849_c1 | 3300050512 | Bacteria | 1594 |
| 713 | nmdc:mga0n895_333894_c1 | 3300050512 | Unclassified | 1536 |
| 714 | nmdc:mga0n895_336234_c1 | 3300050512 | Bacteria | 1530 |
| 715 | nmdc:mga0n895_79914_c1 | 3300050512 | Bacteria | 3257 |
| 716 | nmdc:mga0rr50_118132_c1 | 3300050513 | Unclassified | 2106 |
| 717 | nmdc:mga0rr50_46_c1 | 3300050513 | Bacteria | 74452 |
| 718 | nmdc:mga0rr50_9454_c1 | 3300050513 | Bacteria | 6130 |
| 719 | nmdc:mga0rr50_98742_c1 | 3300050513 | Bacteria | 2289 |
| 720 | nmdc:mga08x19_22608_c1 | 3300050514 | Bacteria | 3895 |
| 721 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 722 | nmdc:mga08x19_44127_c1 | 3300050514 | Bacteria | 2846 |
| 723 | nmdc:mga08x19_91165_c1 | 3300050514 | Bacteria | 2012 |
| 724 | nmdc:mga0a205_119870_c1 | 3300050515 | Bacteria | 2530 |
| 725 | nmdc:mga0a205_15437_c1 | 3300050515 | Bacteria | 7138 |
| 726 | nmdc:mga0a205_164529_c1 | 3300050515 | Bacteria | 2114 |
| 727 | nmdc:mga0a205_242203_c1 | 3300050515 | Unclassified | 1684 |
| 728 | nmdc:mga0a205_50931_c1 | 3300050515 | Bacteria | 3997 |
| 729 | nmdc:mga0a205_60866_c1 | 3300050515 | Bacteria | 3647 |
| 730 | nmdc:mga0a205_85938_c1 | 3300050515 | Bacteria | 3038 |
| 731 | nmdc:mga0a205_92328_c1 | 3300050515 | Bacteria | 2925 |
| 732 | Ga0495619_0050039 | 3300053085 | Bacteria | 2757 |
| 733 | Ga0495619_0105306 | 3300053085 | Bacteria | 1923 |
| 734 | Ga0501084_0010761 | 3300054114 | Bacteria | 7574 |
| 735 | Ga0590071_000062 | 3300059421 | Bacteria | 28725 |
| 736 | Ga0590074_001123 | 3300059423 | Bacteria | 4219 |
| 737 | Ga0590075_000046 | 3300059424 | Bacteria | 32374 |
| 738 | Ga0590077_000653 | 3300059426 | Bacteria | 9225 |
| 739 | Ga0501082_0134821 | 3300060353 | Bacteria | 2142 |
| 740 | Ga0501082_0205484 | 3300060353 | Bacteria | 1713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0444951 | Ga0496102_0444951_395_1171 | 233 |
| 2 | 3300005353 | Ga0070669_100230261 | Ga0070669_1002302612 | 262 |
| 3 | 3300025923 | Ga0207681_10197968 | Ga0207681_101979682 | 262 |
| 4 | 3300045051 | Ga0451576_0382857 | Ga0451576_0382857_340_1266 | 262 |
| 5 | 3300050512 | nmdc:mga0n895_79914_c1 | nmdc:mga0n895_79914_c1_20_946 | 263 |
| 6 | 3300007076 | Ga0075435_100011606 | Ga0075435_1000116065 | 264 |
| 7 | 3300009177 | Ga0105248_10025127 | Ga0105248_100251274 | 264 |
| 8 | 3300009551 | Ga0105238_10652419 | Ga0105238_106524191 | 264 |
| 9 | 3300050513 | nmdc:mga0rr50_9454_c1 | nmdc:mga0rr50_9454_c1_4294_5223 | 264 |
| 10 | 3300005335 | Ga0070666_10271886 | Ga0070666_102718861 | 265 |
| 11 | 3300009098 | Ga0105245_10068587 | Ga0105245_100685874 | 265 |
| 12 | 3300014969 | Ga0157376_10128811 | Ga0157376_101288112 | 265 |
| 13 | 3300025941 | Ga0207711_10222617 | Ga0207711_102226172 | 265 |
| 14 | 3300005328 | Ga0070676_10061902 | Ga0070676_100619023 | 266 |
| 15 | 3300005330 | Ga0070690_100022579 | Ga0070690_1000225792 | 266 |
| 16 | 3300005335 | Ga0070666_10013506 | Ga0070666_100135063 | 266 |
| 17 | 3300005340 | Ga0070689_100028282 | Ga0070689_1000282823 | 266 |
| 18 | 3300005543 | Ga0070672_100039701 | Ga0070672_1000397013 | 266 |
| 19 | 3300005547 | Ga0070693_100032893 | Ga0070693_1000328933 | 266 |
| 20 | 3300005549 | Ga0070704_100208919 | Ga0070704_1002089191 | 266 |
| 21 | 3300005615 | Ga0070702_100009426 | Ga0070702_1000094265 | 266 |
| 22 | 3300005616 | Ga0068852_100050328 | Ga0068852_1000503283 | 266 |
| 23 | 3300005617 | Ga0068859_100128539 | Ga0068859_1001285392 | 266 |
| 24 | 3300005618 | Ga0068864_100012529 | Ga0068864_1000125293 | 266 |
| 25 | 3300005842 | Ga0068858_100039499 | Ga0068858_1000394993 | 266 |
| 26 | 3300005843 | Ga0068860_100044253 | Ga0068860_1000442533 | 266 |
| 27 | 3300006358 | Ga0068871_100291764 | Ga0068871_1002917642 | 266 |
| 28 | 3300006871 | Ga0075434_100040575 | Ga0075434_1000405754 | 266 |
| 29 | 3300006931 | Ga0097620_100128544 | Ga0097620_1001285442 | 266 |
| 30 | 3300007076 | Ga0075435_100004548 | Ga0075435_1000045485 | 266 |
| 31 | 3300025315 | Ga0207697_10018269 | Ga0207697_100182693 | 266 |
| 32 | 3300025893 | Ga0207682_10012961 | Ga0207682_100129613 | 266 |
| 33 | 3300025901 | Ga0207688_10021304 | Ga0207688_100213043 | 266 |
| 34 | 3300025907 | Ga0207645_10008342 | Ga0207645_100083425 | 266 |
| 35 | 3300025918 | Ga0207662_10011653 | Ga0207662_100116533 | 266 |
| 36 | 3300025923 | Ga0207681_10064431 | Ga0207681_100644312 | 266 |
| 37 | 3300025936 | Ga0207670_10031299 | Ga0207670_100312992 | 266 |
| 38 | 3300025936 | Ga0207670_10193278 | Ga0207670_101932782 | 266 |
| 39 | 3300025937 | Ga0207669_10106567 | Ga0207669_101065672 | 266 |
| 40 | 3300025938 | Ga0207704_10216257 | Ga0207704_102162571 | 266 |
| 41 | 3300025940 | Ga0207691_10083917 | Ga0207691_100839172 | 266 |
| 42 | 3300025941 | Ga0207711_10013925 | Ga0207711_100139253 | 266 |
| 43 | 3300025942 | Ga0207689_10030896 | Ga0207689_100308963 | 266 |
| 44 | 3300025944 | Ga0207661_10062906 | Ga0207661_100629063 | 266 |
| 45 | 3300025960 | Ga0207651_10012803 | Ga0207651_100128032 | 266 |
| 46 | 3300025961 | Ga0207712_10118554 | Ga0207712_101185542 | 266 |
| 47 | 3300025981 | Ga0207640_10113430 | Ga0207640_101134302 | 266 |
| 48 | 3300026023 | Ga0207677_10179503 | Ga0207677_101795032 | 266 |
| 49 | 3300026075 | Ga0207708_10014124 | Ga0207708_100141242 | 266 |
| 50 | 3300026089 | Ga0207648_10019253 | Ga0207648_100192533 | 266 |
| 51 | 3300026118 | Ga0207675_100067025 | Ga0207675_1000670252 | 266 |
| 52 | 3300028380 | Ga0268265_10044289 | Ga0268265_100442893 | 266 |
| 53 | 3300028381 | Ga0268264_10090411 | Ga0268264_100904113 | 266 |
| 54 | 3300048915 | Ga0496112_0002397 | Ga0496112_0002397_7561_8487 | 266 |
| 55 | 3300035691 | Ga0373931_0305206 | Ga0373931_0305206_23_949 | 267 |
| 56 | 3300048912 | Ga0496109_0000379 | Ga0496109_0000379_16531_17469 | 267 |
| 57 | 3300005338 | Ga0068868_100118730 | Ga0068868_1001187302 | 268 |
| 58 | 3300005353 | Ga0070669_100035772 | Ga0070669_1000357723 | 268 |
| 59 | 3300005356 | Ga0070674_100020375 | Ga0070674_1000203752 | 268 |
| 60 | 3300005367 | Ga0070667_100091078 | Ga0070667_1000910782 | 268 |
| 61 | 3300005438 | Ga0070701_10024043 | Ga0070701_100240432 | 268 |
| 62 | 3300009098 | Ga0105245_10092202 | Ga0105245_100922022 | 268 |
| 63 | 3300009174 | Ga0105241_10025217 | Ga0105241_100252173 | 268 |
| 64 | 3300009176 | Ga0105242_10029337 | Ga0105242_100293372 | 268 |
| 65 | 3300009177 | Ga0105248_10013627 | Ga0105248_100136273 | 268 |
| 66 | 3300010375 | Ga0105239_10214226 | Ga0105239_102142262 | 268 |
| 67 | 3300013297 | Ga0157378_10204095 | Ga0157378_102040952 | 268 |
| 68 | 3300013306 | Ga0163162_10374911 | Ga0163162_103749112 | 268 |
| 69 | 3300025931 | Ga0207644_10193401 | Ga0207644_101934012 | 268 |
| 70 | 3300028380 | Ga0268265_10484949 | Ga0268265_104849491 | 268 |
| 71 | 3300035242 | Ga0373962_0026915 | Ga0373962_0026915_245_1192 | 268 |
| 72 | 3300035691 | Ga0373931_0012931 | Ga0373931_0012931_364_1311 | 268 |
| 73 | 3300042008 | Ga0439450_045394 | Ga0439450_045394_12_833 | 268 |
| 74 | 3300048916 | Ga0496113_0196106 | Ga0496113_0196106_135_1082 | 268 |
| 75 | 3300026088 | Ga0207641_10295768 | Ga0207641_102957682 | 269 |
| 76 | 3300050512 | nmdc:mga0n895_336234_c1 | nmdc:mga0n895_336234_c1_696_1514 | 269 |
| 77 | 3300007076 | Ga0075435_100021854 | Ga0075435_1000218544 | 270 |
| 78 | 3300009553 | Ga0105249_10189909 | Ga0105249_101899092 | 270 |
| 79 | 3300017792 | Ga0163161_10452017 | Ga0163161_104520171 | 270 |
| 80 | 3300045051 | Ga0451576_0265948 | Ga0451576_0265948_603_1454 | 271 |
| 81 | 3300005290 | Ga0065712_10087458 | Ga0065712_100874582 | 272 |
| 82 | 3300035724 | Ga0373933_0169842 | Ga0373933_0169842_165_1097 | 273 |
| 83 | 3300046459 | Ga0495629_0128150 | Ga0495629_0128150_199_1131 | 273 |
| 84 | 3300006881 | Ga0068865_100096079 | Ga0068865_1000960792 | 274 |
| 85 | 3300009147 | Ga0114129_10291547 | Ga0114129_102915472 | 274 |
| 86 | 3300009147 | Ga0114129_10858483 | Ga0114129_108584832 | 274 |
| 87 | 3300025940 | Ga0207691_10538376 | Ga0207691_105383761 | 274 |
| 88 | 3300046459 | Ga0495629_0018566 | Ga0495629_0018566_3330_4256 | 274 |
| 89 | 3300046473 | Ga0495582_0003606 | Ga0495582_0003606_2785_3711 | 274 |
| 90 | 3300047315 | Ga0495581_0005851 | Ga0495581_0005851_244_1170 | 274 |
| 91 | 3300050507 | nmdc:mga05p37_263431_c1 | nmdc:mga05p37_263431_c1_772_1626 | 274 |
| 92 | 3300050513 | nmdc:mga0rr50_98742_c1 | nmdc:mga0rr50_98742_c1_1424_2278 | 274 |
| 93 | 3300050515 | nmdc:mga0a205_92328_c1 | nmdc:mga0a205_92328_c1_761_1615 | 274 |
| 94 | 3300009174 | Ga0105241_10203945 | Ga0105241_102039452 | 275 |
| 95 | 3300009553 | Ga0105249_10082427 | Ga0105249_100824273 | 275 |
| 96 | 3300037418 | Ga0395900_0291047 | Ga0395900_0291047_485_1357 | 275 |
| 97 | 3300050513 | nmdc:mga0rr50_118132_c1 | nmdc:mga0rr50_118132_c1_63_935 | 275 |
| 98 | 3300050515 | nmdc:mga0a205_15437_c1 | nmdc:mga0a205_15437_c1_644_1516 | 275 |
| 99 | 3300009176 | Ga0105242_10591400 | Ga0105242_105914001 | 276 |
| 100 | 3300025924 | Ga0207694_10094624 | Ga0207694_100946244 | 276 |
| 101 | 3300046689 | Ga0495613_0043345 | Ga0495613_0043345_95_946 | 276 |
| 102 | 3300048917 | Ga0496114_0449181 | Ga0496114_0449181_295_1125 | 276 |
| 103 | 3300048903 | Ga0496100_0153326 | Ga0496100_0153326_278_1231 | 277 |
| 104 | 3300048904 | Ga0496101_0123474 | Ga0496101_0123474_641_1594 | 277 |
| 105 | 3300048917 | Ga0496114_0078765 | Ga0496114_0078765_1332_2285 | 277 |
| 106 | 3300048918 | Ga0496115_0006199 | Ga0496115_0006199_270_1223 | 277 |
| 107 | 3300005458 | Ga0070681_10110899 | Ga0070681_101108994 | 279 |
| 108 | 3300009147 | Ga0114129_10849696 | Ga0114129_108496961 | 279 |
| 109 | 3300013105 | Ga0157369_10326614 | Ga0157369_103266142 | 279 |
| 110 | 3300003203 | JGI25406J46586_10005110 | JGI25406J46586_100051103 | 280 |
| 111 | 3300005330 | Ga0070690_100159377 | Ga0070690_1001593772 | 280 |
| 112 | 3300005985 | Ga0081539_10000033 | Ga0081539_10000033189 | 280 |
| 113 | 3300006038 | Ga0075365_10003010 | Ga0075365_100030108 | 280 |
| 114 | 3300006042 | Ga0075368_10007558 | Ga0075368_100075583 | 280 |
| 115 | 3300006051 | Ga0075364_10021014 | Ga0075364_100210144 | 280 |
| 116 | 3300006178 | Ga0075367_10015855 | Ga0075367_100158554 | 280 |
| 117 | 3300006353 | Ga0075370_10013916 | Ga0075370_100139163 | 280 |
| 118 | 3300005290 | Ga0065712_10132183 | Ga0065712_101321831 | 281 |
| 119 | 3300005331 | Ga0070670_100188212 | Ga0070670_1001882121 | 281 |
| 120 | 3300005334 | Ga0068869_100231525 | Ga0068869_1002315251 | 281 |
| 121 | 3300005844 | Ga0068862_100073871 | Ga0068862_1000738713 | 281 |
| 122 | 3300009545 | Ga0105237_10675486 | Ga0105237_106754861 | 281 |
| 123 | 3300048912 | Ga0496109_0077347 | Ga0496109_0077347_697_1629 | 281 |
| 124 | 3300050491 | nmdc:mga00v17_35644_c1 | nmdc:mga00v17_35644_c1_696_1637 | 281 |
| 125 | 3300009093 | Ga0105240_10233763 | Ga0105240_102337632 | 282 |
| 126 | 3300009101 | Ga0105247_10014291 | Ga0105247_100142914 | 282 |
| 127 | 3300048915 | Ga0496112_0150211 | Ga0496112_0150211_1203_2051 | 282 |
| 128 | 3300006358 | Ga0068871_100360848 | Ga0068871_1003608482 | 283 |
| 129 | 3300009147 | Ga0114129_10006197 | Ga0114129_100061978 | 283 |
| 130 | 3300036401 | Ga0373937_0151172 | Ga0373937_0151172_1283_2164 | 283 |
| 131 | 3300049686 | Ga0501257_015548 | Ga0501257_015548_24_902 | 283 |
| 132 | 3300049704 | Ga0501221_021799 | Ga0501221_021799_187_1065 | 283 |
| 133 | 3300049770 | Ga0501273_003885 | Ga0501273_003885_316_1194 | 283 |
| 134 | 3300050507 | nmdc:mga05p37_55119_c1 | nmdc:mga05p37_55119_c1_1525_2376 | 283 |
| 135 | 3300059421 | Ga0590071_000062 | Ga0590071_000062_11589_12458 | 283 |
| 136 | 3300059423 | Ga0590074_001123 | Ga0590074_001123_2345_3214 | 283 |
| 137 | 3300059424 | Ga0590075_000046 | Ga0590075_000046_23381_24250 | 283 |
| 138 | 3300059426 | Ga0590077_000653 | Ga0590077_000653_3305_4174 | 283 |
| 139 | 3300009101 | Ga0105247_10052573 | Ga0105247_100525731 | 284 |
| 140 | 3300014326 | Ga0157380_10468781 | Ga0157380_104687812 | 284 |
| 141 | 3300014745 | Ga0157377_10093745 | Ga0157377_100937453 | 284 |
| 142 | 3300025938 | Ga0207704_10268315 | Ga0207704_102683152 | 284 |
| 143 | 3300049649 | Ga0501198_000246 | Ga0501198_000246_3705_4583 | 284 |
| 144 | 3300049652 | Ga0501202_000568 | Ga0501202_000568_2093_2971 | 284 |
| 145 | 3300049656 | Ga0501209_016372 | Ga0501209_016372_439_1317 | 284 |
| 146 | 3300049660 | Ga0501216_004487 | Ga0501216_004487_21_899 | 284 |
| 147 | 3300049661 | Ga0501217_004628 | Ga0501217_004628_1654_2532 | 284 |
| 148 | 3300049663 | Ga0501223_000583 | Ga0501223_000583_749_1627 | 284 |
| 149 | 3300049664 | Ga0501224_005519 | Ga0501224_005519_165_1043 | 284 |
| 150 | 3300049667 | Ga0501230_001327 | Ga0501230_001327_856_1734 | 284 |
| 151 | 3300049669 | Ga0501235_000868 | Ga0501235_000868_999_1877 | 284 |
| 152 | 3300049673 | Ga0501240_001860 | Ga0501240_001860_783_1661 | 284 |
| 153 | 3300049675 | Ga0501243_000901 | Ga0501243_000901_2162_3040 | 284 |
| 154 | 3300049686 | Ga0501257_003649 | Ga0501257_003649_2289_3167 | 284 |
| 155 | 3300049689 | Ga0501260_001061 | Ga0501260_001061_860_1738 | 284 |
| 156 | 3300049705 | Ga0501225_0001270 | Ga0501225_0001270_6154_7032 | 284 |
| 157 | 3300049706 | Ga0501229_002822 | Ga0501229_002822_930_1808 | 284 |
| 158 | 3300049707 | Ga0501234_000197 | Ga0501234_000197_2555_3433 | 284 |
| 159 | 3300049708 | Ga0501245_001676 | Ga0501245_001676_984_1862 | 284 |
| 160 | 3300049765 | Ga0501268_002951 | Ga0501268_002951_336_1214 | 284 |
| 161 | 3300049769 | Ga0501272_003817 | Ga0501272_003817_393_1271 | 284 |
| 162 | 3300049850 | Ga0501204_002344 | Ga0501204_002344_441_1319 | 284 |
| 163 | 3300049853 | Ga0501226_000200 | Ga0501226_000200_2454_3332 | 284 |
| 164 | 3300050493 | nmdc:mga0k408_6811_c1 | nmdc:mga0k408_6811_c1_3332_4216 | 284 |
| 165 | 3300005340 | Ga0070689_100080855 | Ga0070689_1000808555 | 286 |
| 166 | 3300005466 | Ga0070685_10155813 | Ga0070685_101558131 | 286 |
| 167 | 3300009094 | Ga0111539_10341656 | Ga0111539_103416563 | 286 |
| 168 | 3300009098 | Ga0105245_10016939 | Ga0105245_100169397 | 286 |
| 169 | 3300009101 | Ga0105247_10021761 | Ga0105247_100217611 | 286 |
| 170 | 3300009148 | Ga0105243_10388210 | Ga0105243_103882102 | 286 |
| 171 | 3300009176 | Ga0105242_10152594 | Ga0105242_101525942 | 286 |
| 172 | 3300009177 | Ga0105248_10057402 | Ga0105248_100574025 | 286 |
| 173 | 3300009553 | Ga0105249_10146986 | Ga0105249_101469863 | 286 |
| 174 | 3300010375 | Ga0105239_10270584 | Ga0105239_102705842 | 286 |
| 175 | 3300011119 | Ga0105246_10161518 | Ga0105246_101615182 | 286 |
| 176 | 3300013297 | Ga0157378_10005313 | Ga0157378_100053134 | 286 |
| 177 | 3300013306 | Ga0163162_10199599 | Ga0163162_101995993 | 286 |
| 178 | 3300013308 | Ga0157375_10233935 | Ga0157375_102339351 | 286 |
| 179 | 3300014326 | Ga0157380_10000682 | Ga0157380_1000068212 | 286 |
| 180 | 3300014969 | Ga0157376_10251197 | Ga0157376_102511971 | 286 |
| 181 | 3300025931 | Ga0207644_10056655 | Ga0207644_100566552 | 286 |
| 182 | 3300025936 | Ga0207670_10166227 | Ga0207670_101662272 | 286 |
| 183 | 3300025960 | Ga0207651_10141154 | Ga0207651_101411544 | 286 |
| 184 | 3300036401 | Ga0373937_0109133 | Ga0373937_0109133_191_1051 | 286 |
| 185 | 3300037853 | Ga0436364_0362554 | Ga0436364_0362554_611_1564 | 286 |
| 186 | 3300050511 | nmdc:mga08y16_46923_c1 | nmdc:mga08y16_46923_c1_3393_4262 | 286 |
| 187 | 3300014325 | Ga0163163_10000103 | Ga0163163_1000010323 | 287 |
| 188 | 3300026035 | Ga0207703_10150310 | Ga0207703_101503102 | 287 |
| 189 | 3300045051 | Ga0451576_0069143 | Ga0451576_0069143_1397_2278 | 287 |
| 190 | 3300048913 | Ga0496110_0133830 | Ga0496110_0133830_730_1611 | 287 |
| 191 | 3300048917 | Ga0496114_0392614 | Ga0496114_0392614_34_915 | 287 |
| 192 | 3300005985 | Ga0081539_10004757 | Ga0081539_1000475710 | 288 |
| 193 | 3300014325 | Ga0163163_10226335 | Ga0163163_102263352 | 288 |
| 194 | 3300026116 | Ga0207674_10198755 | Ga0207674_101987552 | 288 |
| 195 | 3300042005 | Ga0439448_0005524 | Ga0439448_0005524_2140_3033 | 288 |
| 196 | 3300042157 | Ga0439458_0007665 | Ga0439458_0007665_944_1837 | 288 |
| 197 | 3300048916 | Ga0496113_0113177 | Ga0496113_0113177_734_1621 | 288 |
| 198 | 3300050489 | nmdc:mga03683_1363_c1 | nmdc:mga03683_1363_c1_538_1422 | 288 |
| 199 | 3300050494 | nmdc:mga06z11_20504_c1 | nmdc:mga06z11_20504_c1_681_1565 | 288 |
| 200 | 3300050510 | nmdc:mga06r32_269026_c1 | nmdc:mga06r32_269026_c1_771_1655 | 288 |
| 201 | 3300005549 | Ga0070704_100384062 | Ga0070704_1003840622 | 289 |
| 202 | 3300005577 | Ga0068857_100162370 | Ga0068857_1001623702 | 289 |
| 203 | 3300005840 | Ga0068870_10057937 | Ga0068870_100579373 | 289 |
| 204 | 3300014745 | Ga0157377_10059760 | Ga0157377_100597603 | 289 |
| 205 | 3300037312 | Ga0395899_0167746 | Ga0395899_0167746_57_926 | 289 |
| 206 | 3300037418 | Ga0395900_0174504 | Ga0395900_0174504_119_988 | 289 |
| 207 | 3300037466 | Ga0395898_0272294 | Ga0395898_0272294_203_1072 | 289 |
| 208 | 3300048907 | Ga0496104_0069827 | Ga0496104_0069827_137_1009 | 289 |
| 209 | 3300048909 | Ga0496106_0189738 | Ga0496106_0189738_232_1104 | 289 |
| 210 | 3300049568 | Ga0501031_0212539 | Ga0501031_0212539_138_1034 | 289 |
| 211 | 3300049570 | Ga0501033_0004970 | Ga0501033_0004970_8248_9144 | 289 |
| 212 | 3300049571 | Ga0501034_0161990 | Ga0501034_0161990_33_929 | 289 |
| 213 | 3300049572 | Ga0501036_0109479 | Ga0501036_0109479_646_1542 | 289 |
| 214 | 3300049573 | Ga0501037_0046187 | Ga0501037_0046187_2168_3064 | 289 |
| 215 | 3300049574 | Ga0501038_0076145 | Ga0501038_0076145_1323_2219 | 289 |
| 216 | 3300049579 | Ga0501043_0026346 | Ga0501043_0026346_136_1032 | 289 |
| 217 | 3300049580 | Ga0501046_0165512 | Ga0501046_0165512_206_1102 | 289 |
| 218 | 3300049581 | Ga0501047_0175594 | Ga0501047_0175594_221_1117 | 289 |
| 219 | 3300049582 | Ga0501048_0199436 | Ga0501048_0199436_40_936 | 289 |
| 220 | 3300049583 | Ga0501067_0051153 | Ga0501067_0051153_1240_2136 | 289 |
| 221 | 3300049585 | Ga0501069_0008951 | Ga0501069_0008951_1607_2503 | 289 |
| 222 | 3300049586 | Ga0501070_0025561 | Ga0501070_0025561_3911_4807 | 289 |
| 223 | 3300049588 | Ga0501072_0406876 | Ga0501072_0406876_54_950 | 289 |
| 224 | 3300049589 | Ga0501073_0031581 | Ga0501073_0031581_118_1014 | 289 |
| 225 | 3300049590 | Ga0501074_0009531 | Ga0501074_0009531_191_1087 | 289 |
| 226 | 3300049741 | Ga0501079_0054424 | Ga0501079_0054424_625_1521 | 289 |
| 227 | 3300049744 | Ga0501083_0054781 | Ga0501083_0054781_1588_2484 | 289 |
| 228 | 3300049822 | Ga0501035_0008860 | Ga0501035_0008860_8234_9130 | 289 |
| 229 | 3300049823 | Ga0501044_0110996 | Ga0501044_0110996_1829_2725 | 289 |
| 230 | 3300060353 | Ga0501082_0205484 | Ga0501082_0205484_620_1516 | 289 |
| 231 | 3300005345 | Ga0070692_10003204 | Ga0070692_100032046 | 290 |
| 232 | 3300005365 | Ga0070688_100143111 | Ga0070688_1001431112 | 290 |
| 233 | 3300005617 | Ga0068859_100202480 | Ga0068859_1002024801 | 290 |
| 234 | 3300006931 | Ga0097620_100202484 | Ga0097620_1002024841 | 290 |
| 235 | 3300025939 | Ga0207665_10037056 | Ga0207665_100370564 | 290 |
| 236 | 3300005289 | Ga0065704_10026869 | Ga0065704_100268691 | 292 |
| 237 | 3300006237 | Ga0097621_100179416 | Ga0097621_1001794162 | 292 |
| 238 | 3300009545 | Ga0105237_10599111 | Ga0105237_105991111 | 292 |
| 239 | 3300009551 | Ga0105238_10046310 | Ga0105238_100463105 | 292 |
| 240 | 3300009551 | Ga0105238_10061191 | Ga0105238_100611913 | 292 |
| 241 | 3300009551 | Ga0105238_10191998 | Ga0105238_101919983 | 292 |
| 242 | 3300013100 | Ga0157373_10112158 | Ga0157373_101121582 | 292 |
| 243 | 3300013297 | Ga0157378_10454510 | Ga0157378_104545102 | 292 |
| 244 | 3300014325 | Ga0163163_10000961 | Ga0163163_1000096123 | 292 |
| 245 | 3300035091 | Ga0373951_0001232 | Ga0373951_0001232_244_1122 | 292 |
| 246 | 3300048909 | Ga0496106_0031023 | Ga0496106_0031023_472_1350 | 292 |
| 247 | 3300049568 | Ga0501031_0068793 | Ga0501031_0068793_549_1457 | 292 |
| 248 | 3300049569 | Ga0501032_0037590 | Ga0501032_0037590_1630_2538 | 292 |
| 249 | 3300049570 | Ga0501033_0006587 | Ga0501033_0006587_2692_3600 | 292 |
| 250 | 3300049571 | Ga0501034_0194760 | Ga0501034_0194760_265_1173 | 292 |
| 251 | 3300049573 | Ga0501037_0036695 | Ga0501037_0036695_644_1552 | 292 |
| 252 | 3300049575 | Ga0501039_0006443 | Ga0501039_0006443_643_1551 | 292 |
| 253 | 3300049580 | Ga0501046_0051751 | Ga0501046_0051751_606_1514 | 292 |
| 254 | 3300049585 | Ga0501069_0026950 | Ga0501069_0026950_1599_2507 | 292 |
| 255 | 3300049586 | Ga0501070_0015013 | Ga0501070_0015013_754_1662 | 292 |
| 256 | 3300049589 | Ga0501073_0090490 | Ga0501073_0090490_684_1592 | 292 |
| 257 | 3300049590 | Ga0501074_0171707 | Ga0501074_0171707_79_987 | 292 |
| 258 | 3300049741 | Ga0501079_0178769 | Ga0501079_0178769_483_1391 | 292 |
| 259 | 3300049744 | Ga0501083_0133765 | Ga0501083_0133765_514_1422 | 292 |
| 260 | 3300049823 | Ga0501044_0171962 | Ga0501044_0171962_345_1253 | 292 |
| 261 | 3300049824 | Ga0501045_0056428 | Ga0501045_0056428_1842_2750 | 292 |
| 262 | 3300050515 | nmdc:mga0a205_60866_c1 | nmdc:mga0a205_60866_c1_1177_2055 | 292 |
| 263 | 3300060353 | Ga0501082_0134821 | Ga0501082_0134821_959_1867 | 292 |
| 264 | 3300005444 | Ga0070694_100140517 | Ga0070694_1001405171 | 293 |
| 265 | 3300005545 | Ga0070695_100116095 | Ga0070695_1001160952 | 293 |
| 266 | 3300005719 | Ga0068861_100232388 | Ga0068861_1002323882 | 293 |
| 267 | 3300006914 | Ga0075436_100061921 | Ga0075436_1000619213 | 293 |
| 268 | 3300050514 | nmdc:mga08x19_22608_c1 | nmdc:mga08x19_22608_c1_2844_3794 | 293 |
| 269 | 3300014325 | Ga0163163_10030602 | Ga0163163_100306027 | 294 |
| 270 | 3300014325 | Ga0163163_10055419 | Ga0163163_100554192 | 294 |
| 271 | 3300014969 | Ga0157376_10307896 | Ga0157376_103078962 | 294 |
| 272 | 3300050515 | nmdc:mga0a205_85938_c1 | nmdc:mga0a205_85938_c1_255_1139 | 294 |
| 273 | 3300005338 | Ga0068868_100001907 | Ga0068868_1000019076 | 295 |
| 274 | 3300013308 | Ga0157375_10015052 | Ga0157375_100150524 | 295 |
| 275 | 3300026023 | Ga0207677_10000005 | Ga0207677_10000005112 | 295 |
| 276 | 3300027682 | Ga0209971_1039665 | Ga0209971_10396651 | 295 |
| 277 | 3300031548 | Ga0307408_100299274 | Ga0307408_1002992742 | 295 |
| 278 | 3300032002 | Ga0307416_100040486 | Ga0307416_1000404865 | 295 |
| 279 | 3300005290 | Ga0065712_10203646 | Ga0065712_102036461 | 296 |
| 280 | 3300005353 | Ga0070669_100015380 | Ga0070669_1000153803 | 296 |
| 281 | 3300005364 | Ga0070673_100051212 | Ga0070673_1000512122 | 296 |
| 282 | 3300005518 | Ga0070699_100189711 | Ga0070699_1001897111 | 296 |
| 283 | 3300005543 | Ga0070672_100000854 | Ga0070672_1000008543 | 296 |
| 284 | 3300005616 | Ga0068852_100169985 | Ga0068852_1001699853 | 296 |
| 285 | 3300005618 | Ga0068864_100000081 | Ga0068864_10000008188 | 296 |
| 286 | 3300005842 | Ga0068858_100001392 | Ga0068858_10000139217 | 296 |
| 287 | 3300006852 | Ga0075433_10210060 | Ga0075433_102100602 | 296 |
| 288 | 3300006871 | Ga0075434_100236674 | Ga0075434_1002366744 | 296 |
| 289 | 3300009093 | Ga0105240_10782569 | Ga0105240_107825691 | 296 |
| 290 | 3300009098 | Ga0105245_10018124 | Ga0105245_100181245 | 296 |
| 291 | 3300009147 | Ga0114129_10017794 | Ga0114129_100177945 | 296 |
| 292 | 3300009177 | Ga0105248_10168645 | Ga0105248_101686452 | 296 |
| 293 | 3300013308 | Ga0157375_10000002 | Ga0157375_10000002267 | 296 |
| 294 | 3300025923 | Ga0207681_10016849 | Ga0207681_100168493 | 296 |
| 295 | 3300025927 | Ga0207687_10010373 | Ga0207687_100103733 | 296 |
| 296 | 3300025936 | Ga0207670_10001498 | Ga0207670_100014986 | 296 |
| 297 | 3300025960 | Ga0207651_10008898 | Ga0207651_100088983 | 296 |
| 298 | 3300026095 | Ga0207676_10000020 | Ga0207676_1000002088 | 296 |
| 299 | 3300050507 | nmdc:mga05p37_132122_c1 | nmdc:mga05p37_132122_c1_1102_2040 | 296 |
| 300 | 3300050512 | nmdc:mga0n895_333894_c1 | nmdc:mga0n895_333894_c1_548_1486 | 296 |
| 301 | 3300050515 | nmdc:mga0a205_119870_c1 | nmdc:mga0a205_119870_c1_1036_1974 | 296 |
| 302 | 3300054114 | Ga0501084_0010761 | Ga0501084_0010761_1216_2133 | 296 |
| 303 | 3300005536 | Ga0070697_100000262 | Ga0070697_10000026227 | 297 |
| 304 | 3300005546 | Ga0070696_100180002 | Ga0070696_1001800022 | 297 |
| 305 | 3300009147 | Ga0114129_10012566 | Ga0114129_100125662 | 297 |
| 306 | 3300009147 | Ga0114129_10087200 | Ga0114129_100872003 | 297 |
| 307 | 3300050507 | nmdc:mga05p37_133827_c1 | nmdc:mga05p37_133827_c1_115_1038 | 297 |
| 308 | 3300050507 | nmdc:mga05p37_44985_c1 | nmdc:mga05p37_44985_c1_4096_5028 | 297 |
| 309 | 3300003203 | JGI25406J46586_10000967 | JGI25406J46586_1000096714 | 298 |
| 310 | 3300005290 | Ga0065712_10073475 | Ga0065712_100734755 | 298 |
| 311 | 3300005366 | Ga0070659_100180562 | Ga0070659_1001805623 | 298 |
| 312 | 3300005438 | Ga0070701_10271696 | Ga0070701_102716961 | 298 |
| 313 | 3300005518 | Ga0070699_100001641 | Ga0070699_10000164113 | 298 |
| 314 | 3300005618 | Ga0068864_100300617 | Ga0068864_1003006172 | 298 |
| 315 | 3300005843 | Ga0068860_100149380 | Ga0068860_1001493802 | 298 |
| 316 | 3300005985 | Ga0081539_10001050 | Ga0081539_1000105023 | 298 |
| 317 | 3300006914 | Ga0075436_100019025 | Ga0075436_1000190252 | 298 |
| 318 | 3300006914 | Ga0075436_100035564 | Ga0075436_1000355644 | 298 |
| 319 | 3300007076 | Ga0075435_100043566 | Ga0075435_1000435664 | 298 |
| 320 | 3300007076 | Ga0075435_100080626 | Ga0075435_1000806265 | 298 |
| 321 | 3300009094 | Ga0111539_10291071 | Ga0111539_102910713 | 298 |
| 322 | 3300025914 | Ga0207671_10179860 | Ga0207671_101798602 | 298 |
| 323 | 3300025936 | Ga0207670_10226584 | Ga0207670_102265843 | 298 |
| 324 | 3300028381 | Ga0268264_10214828 | Ga0268264_102148282 | 298 |
| 325 | 3300050514 | nmdc:mga08x19_44127_c1 | nmdc:mga08x19_44127_c1_331_1269 | 298 |
| 326 | 3300050514 | nmdc:mga08x19_91165_c1 | nmdc:mga08x19_91165_c1_268_1200 | 298 |
| 327 | 3300005330 | Ga0070690_100009146 | Ga0070690_1000091467 | 299 |
| 328 | 3300005345 | Ga0070692_10004212 | Ga0070692_100042123 | 299 |
| 329 | 3300005444 | Ga0070694_100045965 | Ga0070694_1000459652 | 299 |
| 330 | 3300005617 | Ga0068859_100120520 | Ga0068859_1001205203 | 299 |
| 331 | 3300005719 | Ga0068861_100332668 | Ga0068861_1003326682 | 299 |
| 332 | 3300006844 | Ga0075428_100059477 | Ga0075428_1000594775 | 299 |
| 333 | 3300006852 | Ga0075433_10137250 | Ga0075433_101372503 | 299 |
| 334 | 3300006931 | Ga0097620_100120517 | Ga0097620_1001205173 | 299 |
| 335 | 3300013306 | Ga0163162_10025254 | Ga0163162_100252545 | 299 |
| 336 | 3300025961 | Ga0207712_10443598 | Ga0207712_104435982 | 299 |
| 337 | 3300026075 | Ga0207708_10038347 | Ga0207708_100383473 | 299 |
| 338 | 3300049572 | Ga0501036_0283907 | Ga0501036_0283907_327_1250 | 299 |
| 339 | 3300050512 | nmdc:mga0n895_273186_c1 | nmdc:mga0n895_273186_c1_378_1301 | 299 |
| 340 | 3300050515 | nmdc:mga0a205_50931_c1 | nmdc:mga0a205_50931_c1_181_1116 | 299 |
| 341 | 3300005288 | Ga0065714_10064422 | Ga0065714_1006442283 | 300 |
| 342 | 3300005290 | Ga0065712_10067728 | Ga0065712_1006772882 | 300 |
| 343 | 3300005293 | Ga0065715_10089178 | Ga0065715_100891788 | 300 |
| 344 | 3300005468 | Ga0070707_100000045 | Ga0070707_10000004521 | 300 |
| 345 | 3300005468 | Ga0070707_100046982 | Ga0070707_1000469824 | 300 |
| 346 | 3300005844 | Ga0068862_100401725 | Ga0068862_1004017252 | 300 |
| 347 | 3300006871 | Ga0075434_100074140 | Ga0075434_1000741402 | 300 |
| 348 | 3300009148 | Ga0105243_10000393 | Ga0105243_1000039310 | 300 |
| 349 | 3300009176 | Ga0105242_10000313 | Ga0105242_100003138 | 300 |
| 350 | 3300009177 | Ga0105248_10390760 | Ga0105248_103907602 | 300 |
| 351 | 3300013297 | Ga0157378_10000004 | Ga0157378_1000000411 | 300 |
| 352 | 3300013308 | Ga0157375_10003437 | Ga0157375_1000343712 | 300 |
| 353 | 3300025922 | Ga0207646_10000097 | Ga0207646_1000009761 | 300 |
| 354 | 3300025934 | Ga0207686_10000384 | Ga0207686_1000038417 | 300 |
| 355 | 3300025935 | Ga0207709_10000339 | Ga0207709_1000033926 | 300 |
| 356 | 3300025941 | Ga0207711_10330169 | Ga0207711_103301692 | 300 |
| 357 | 3300026116 | Ga0207674_10238543 | Ga0207674_102385433 | 300 |
| 358 | 3300031548 | Ga0307408_100114484 | Ga0307408_1001144843 | 300 |
| 359 | 3300031731 | Ga0307405_10065247 | Ga0307405_100652472 | 300 |
| 360 | 3300031911 | Ga0307412_10191984 | Ga0307412_101919842 | 300 |
| 361 | 3300032005 | Ga0307411_10032000 | Ga0307411_100320004 | 300 |
| 362 | 3300048909 | Ga0496106_0000607 | Ga0496106_0000607_22652_23587 | 300 |
| 363 | 3300050507 | nmdc:mga05p37_489328_c1 | nmdc:mga05p37_489328_c1_192_1115 | 300 |
| 364 | 3300050512 | nmdc:mga0n895_311849_c1 | nmdc:mga0n895_311849_c1_470_1405 | 300 |
| 365 | 3300050515 | nmdc:mga0a205_242203_c1 | nmdc:mga0a205_242203_c1_112_1035 | 300 |
| 366 | 3300005293 | Ga0065715_10094457 | Ga0065715_100944573 | 301 |
| 367 | 3300005293 | Ga0065715_10097263 | Ga0065715_100972633 | 301 |
| 368 | 3300005364 | Ga0070673_100326303 | Ga0070673_1003263032 | 301 |
| 369 | 3300005458 | Ga0070681_10002392 | Ga0070681_100023923 | 301 |
| 370 | 3300005459 | Ga0068867_100154544 | Ga0068867_1001545443 | 301 |
| 371 | 3300005549 | Ga0070704_100243930 | Ga0070704_1002439302 | 301 |
| 372 | 3300005617 | Ga0068859_100085014 | Ga0068859_1000850143 | 301 |
| 373 | 3300006846 | Ga0075430_100065957 | Ga0075430_1000659573 | 301 |
| 374 | 3300006847 | Ga0075431_100048856 | Ga0075431_1000488563 | 301 |
| 375 | 3300006852 | Ga0075433_10090138 | Ga0075433_100901383 | 301 |
| 376 | 3300006880 | Ga0075429_100018328 | Ga0075429_1000183283 | 301 |
| 377 | 3300006931 | Ga0097620_100085013 | Ga0097620_1000850133 | 301 |
| 378 | 3300025912 | Ga0207707_10097911 | Ga0207707_100979112 | 301 |
| 379 | 3300025914 | Ga0207671_10438416 | Ga0207671_104384161 | 301 |
| 380 | 3300025960 | Ga0207651_10573968 | Ga0207651_105739681 | 301 |
| 381 | 3300026035 | Ga0207703_10213589 | Ga0207703_102135893 | 301 |
| 382 | 3300035090 | Ga0373949_0012780 | Ga0373949_0012780_854_1783 | 301 |
| 383 | 3300035113 | Ga0373936_0125026 | Ga0373936_0125026_36_968 | 301 |
| 384 | 3300035207 | Ga0373942_0016088 | Ga0373942_0016088_434_1363 | 301 |
| 385 | 3300050507 | nmdc:mga05p37_141780_c1 | nmdc:mga05p37_141780_c1_1079_2008 | 301 |
| 386 | 3300053085 | Ga0495619_0105306 | Ga0495619_0105306_347_1279 | 301 |
| 387 | 3300002074 | JGI24748J21848_1000017 | JGI24748J21848_100001793 | 302 |
| 388 | 3300002239 | JGI24034J26672_10000017 | JGI24034J26672_1000001719 | 302 |
| 389 | 3300005295 | Ga0065707_10178650 | Ga0065707_101786501 | 302 |
| 390 | 3300005353 | Ga0070669_100021890 | Ga0070669_1000218903 | 302 |
| 391 | 3300005459 | Ga0068867_100337167 | Ga0068867_1003371671 | 302 |
| 392 | 3300005471 | Ga0070698_100000410 | Ga0070698_10000041023 | 302 |
| 393 | 3300005545 | Ga0070695_100113184 | Ga0070695_1001131842 | 302 |
| 394 | 3300005842 | Ga0068858_100000146 | Ga0068858_10000014615 | 302 |
| 395 | 3300006871 | Ga0075434_100518522 | Ga0075434_1005185221 | 302 |
| 396 | 3300009094 | Ga0111539_10000439 | Ga0111539_1000043911 | 302 |
| 397 | 3300009101 | Ga0105247_10000004 | Ga0105247_1000000433 | 302 |
| 398 | 3300009101 | Ga0105247_10006142 | Ga0105247_100061428 | 302 |
| 399 | 3300009177 | Ga0105248_10025718 | Ga0105248_100257183 | 302 |
| 400 | 3300009553 | Ga0105249_10001872 | Ga0105249_100018725 | 302 |
| 401 | 3300013306 | Ga0163162_10093107 | Ga0163162_100931073 | 302 |
| 402 | 3300014325 | Ga0163163_10523908 | Ga0163163_105239082 | 302 |
| 403 | 3300014326 | Ga0157380_10028508 | Ga0157380_100285084 | 302 |
| 404 | 3300025223 | Ga0207672_1000023 | Ga0207672_100002310 | 302 |
| 405 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002980 | 302 |
| 406 | 3300025900 | Ga0207710_10037796 | Ga0207710_100377963 | 302 |
| 407 | 3300025913 | Ga0207695_10209555 | Ga0207695_102095552 | 302 |
| 408 | 3300025923 | Ga0207681_10003404 | Ga0207681_100034046 | 302 |
| 409 | 3300025931 | Ga0207644_10000536 | Ga0207644_1000053614 | 302 |
| 410 | 3300025934 | Ga0207686_10000236 | Ga0207686_1000023620 | 302 |
| 411 | 3300025945 | Ga0207679_10053776 | Ga0207679_100537763 | 302 |
| 412 | 3300025961 | Ga0207712_10022873 | Ga0207712_100228735 | 302 |
| 413 | 3300026035 | Ga0207703_10000687 | Ga0207703_1000068718 | 302 |
| 414 | 3300026041 | Ga0207639_10402506 | Ga0207639_104025062 | 302 |
| 415 | 3300026075 | Ga0207708_10067037 | Ga0207708_100670375 | 302 |
| 416 | 3300026118 | Ga0207675_100359766 | Ga0207675_1003597662 | 302 |
| 417 | 3300027907 | Ga0207428_10011558 | Ga0207428_100115585 | 302 |
| 418 | 3300028380 | Ga0268265_10007639 | Ga0268265_100076395 | 302 |
| 419 | 3300031548 | Ga0307408_100008073 | Ga0307408_1000080736 | 302 |
| 420 | 3300031731 | Ga0307405_10025242 | Ga0307405_100252422 | 302 |
| 421 | 3300031852 | Ga0307410_10001655 | Ga0307410_100016558 | 302 |
| 422 | 3300031901 | Ga0307406_10021804 | Ga0307406_100218044 | 302 |
| 423 | 3300031911 | Ga0307412_10021597 | Ga0307412_100215974 | 302 |
| 424 | 3300031995 | Ga0307409_100081046 | Ga0307409_1000810463 | 302 |
| 425 | 3300032002 | Ga0307416_100001814 | Ga0307416_1000018149 | 302 |
| 426 | 3300032004 | Ga0307414_10001545 | Ga0307414_100015455 | 302 |
| 427 | 3300032005 | Ga0307411_10013888 | Ga0307411_100138883 | 302 |
| 428 | 3300032126 | Ga0307415_100003242 | Ga0307415_1000032424 | 302 |
| 429 | 3300005327 | Ga0070658_10034817 | Ga0070658_100348174 | 303 |
| 430 | 3300005329 | Ga0070683_100000216 | Ga0070683_10000021618 | 303 |
| 431 | 3300005331 | Ga0070670_100000226 | Ga0070670_10000022626 | 303 |
| 432 | 3300005331 | Ga0070670_100182919 | Ga0070670_1001829193 | 303 |
| 433 | 3300005338 | Ga0068868_100001892 | Ga0068868_1000018926 | 303 |
| 434 | 3300005343 | Ga0070687_100017027 | Ga0070687_1000170273 | 303 |
| 435 | 3300005406 | Ga0070703_10000133 | Ga0070703_1000013339 | 303 |
| 436 | 3300005441 | Ga0070700_100009502 | Ga0070700_1000095024 | 303 |
| 437 | 3300005444 | Ga0070694_100000581 | Ga0070694_10000058118 | 303 |
| 438 | 3300005535 | Ga0070684_100005622 | Ga0070684_1000056221 | 303 |
| 439 | 3300005535 | Ga0070684_100162992 | Ga0070684_1001629921 | 303 |
| 440 | 3300005578 | Ga0068854_100028881 | Ga0068854_1000288815 | 303 |
| 441 | 3300006195 | Ga0075366_10005893 | Ga0075366_100058932 | 303 |
| 442 | 3300009094 | Ga0111539_10405000 | Ga0111539_104050002 | 303 |
| 443 | 3300009098 | Ga0105245_10001940 | Ga0105245_1000194014 | 303 |
| 444 | 3300009147 | Ga0114129_10190624 | Ga0114129_101906243 | 303 |
| 445 | 3300009174 | Ga0105241_10143827 | Ga0105241_101438273 | 303 |
| 446 | 3300009177 | Ga0105248_10055572 | Ga0105248_100555726 | 303 |
| 447 | 3300009177 | Ga0105248_10179278 | Ga0105248_101792783 | 303 |
| 448 | 3300009551 | Ga0105238_10000001 | Ga0105238_10000001881 | 303 |
| 449 | 3300013100 | Ga0157373_10002636 | Ga0157373_100026369 | 303 |
| 450 | 3300013105 | Ga0157369_10000654 | Ga0157369_1000065423 | 303 |
| 451 | 3300013296 | Ga0157374_10000022 | Ga0157374_1000002218 | 303 |
| 452 | 3300013297 | Ga0157378_10000269 | Ga0157378_1000026949 | 303 |
| 453 | 3300013297 | Ga0157378_10000600 | Ga0157378_100006005 | 303 |
| 454 | 3300013306 | Ga0163162_10033650 | Ga0163162_100336505 | 303 |
| 455 | 3300013306 | Ga0163162_10058127 | Ga0163162_100581273 | 303 |
| 456 | 3300013308 | Ga0157375_10000008 | Ga0157375_1000000895 | 303 |
| 457 | 3300013308 | Ga0157375_10000106 | Ga0157375_1000010655 | 303 |
| 458 | 3300014745 | Ga0157377_10000009 | Ga0157377_100000096 | 303 |
| 459 | 3300014969 | Ga0157376_10000020 | Ga0157376_10000020137 | 303 |
| 460 | 3300021358 | Ga0213873_10000857 | Ga0213873_100008573 | 303 |
| 461 | 3300021384 | Ga0213876_10000173 | Ga0213876_1000017333 | 303 |
| 462 | 3300021384 | Ga0213876_10129397 | Ga0213876_101293972 | 303 |
| 463 | 3300025909 | Ga0207705_10026000 | Ga0207705_100260003 | 303 |
| 464 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000011921 | 303 |
| 465 | 3300025925 | Ga0207650_10000218 | Ga0207650_100002185 | 303 |
| 466 | 3300025944 | Ga0207661_10000044 | Ga0207661_1000004413 | 303 |
| 467 | 3300025981 | Ga0207640_10022961 | Ga0207640_100229612 | 303 |
| 468 | 3300026023 | Ga0207677_10000009 | Ga0207677_1000000982 | 303 |
| 469 | 3300026118 | Ga0207675_100429340 | Ga0207675_1004293402 | 303 |
| 470 | 3300030521 | Ga0307511_10000562 | Ga0307511_1000056230 | 303 |
| 471 | 3300031731 | Ga0307405_10356561 | Ga0307405_103565611 | 303 |
| 472 | 3300032002 | Ga0307416_100455655 | Ga0307416_1004556552 | 303 |
| 473 | 3300039437 | Ga0436365_0587160 | Ga0436365_0587160_15422_16354 | 303 |
| 474 | 3300039453 | Ga0436362_1025943 | Ga0436362_1025943_2215_3147 | 303 |
| 475 | 3300042004 | Ga0439445_0034968 | Ga0439445_0034968_180_1121 | 303 |
| 476 | 3300047446 | Ga0495679_019559 | Ga0495679_019559_738_1673 | 303 |
| 477 | 3300048909 | Ga0496106_0133634 | Ga0496106_0133634_215_1126 | 303 |
| 478 | 3300048917 | Ga0496114_0086560 | Ga0496114_0086560_1299_2294 | 303 |
| 479 | 3300049705 | Ga0501225_0026006 | Ga0501225_0026006_654_1595 | 303 |
| 480 | 3300050511 | nmdc:mga08y16_286353_c1 | nmdc:mga08y16_286353_c1_592_1503 | 303 |
| 481 | 3300005289 | Ga0065704_10185353 | Ga0065704_101853532 | 304 |
| 482 | 3300005295 | Ga0065707_10115603 | Ga0065707_101156032 | 304 |
| 483 | 3300005444 | Ga0070694_100013825 | Ga0070694_1000138253 | 304 |
| 484 | 3300005617 | Ga0068859_100071098 | Ga0068859_1000710983 | 304 |
| 485 | 3300005844 | Ga0068862_100139540 | Ga0068862_1001395402 | 304 |
| 486 | 3300006880 | Ga0075429_100014529 | Ga0075429_1000145293 | 304 |
| 487 | 3300006931 | Ga0097620_100071098 | Ga0097620_1000710981 | 304 |
| 488 | 3300009094 | Ga0111539_10208867 | Ga0111539_102088672 | 304 |
| 489 | 3300009098 | Ga0105245_10000024 | Ga0105245_10000024110 | 304 |
| 490 | 3300009147 | Ga0114129_10105815 | Ga0114129_101058153 | 304 |
| 491 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003110 | 304 |
| 492 | 3300027907 | Ga0207428_10038151 | Ga0207428_100381514 | 304 |
| 493 | 3300028380 | Ga0268265_10142348 | Ga0268265_101423482 | 304 |
| 494 | 3300035111 | Ga0373923_0069407 | Ga0373923_0069407_94_1035 | 304 |
| 495 | 3300036401 | Ga0373937_0334682 | Ga0373937_0334682_462_1403 | 304 |
| 496 | 3300044673 | Ga0453683_0170613 | Ga0453683_0170613_72_1100 | 304 |
| 497 | 3300046559 | Ga0495667_0232241 | Ga0495667_0232241_176_1117 | 304 |
| 498 | 3300050507 | nmdc:mga05p37_353826_c1 | nmdc:mga05p37_353826_c1_590_1537 | 304 |
| 499 | 3300050511 | nmdc:mga08y16_82902_c1 | nmdc:mga08y16_82902_c1_1047_2042 | 304 |
| 500 | 3300053085 | Ga0495619_0050039 | Ga0495619_0050039_397_1338 | 304 |
| 501 | 3300005295 | Ga0065707_10277122 | Ga0065707_102771221 | 305 |
| 502 | 3300005334 | Ga0068869_100081764 | Ga0068869_1000817642 | 305 |
| 503 | 3300005467 | Ga0070706_100353415 | Ga0070706_1003534152 | 305 |
| 504 | 3300005577 | Ga0068857_100076752 | Ga0068857_1000767523 | 305 |
| 505 | 3300006028 | Ga0070717_10088136 | Ga0070717_100881361 | 305 |
| 506 | 3300009176 | Ga0105242_10000004 | Ga0105242_10000004112 | 305 |
| 507 | 3300025934 | Ga0207686_10000005 | Ga0207686_10000005125 | 305 |
| 508 | 3300025935 | Ga0207709_10000088 | Ga0207709_10000088115 | 305 |
| 509 | 3300026116 | Ga0207674_10154972 | Ga0207674_101549722 | 305 |
| 510 | 3300005445 | Ga0070708_100198196 | Ga0070708_1001981961 | 306 |
| 511 | 3300005937 | Ga0081455_10002675 | Ga0081455_100026755 | 306 |
| 512 | 3300013308 | Ga0157375_10485381 | Ga0157375_104853812 | 306 |
| 513 | 3300014325 | Ga0163163_10088802 | Ga0163163_100888024 | 306 |
| 514 | 3300005295 | Ga0065707_10196524 | Ga0065707_101965242 | 307 |
| 515 | 3300005336 | Ga0070680_100193046 | Ga0070680_1001930462 | 307 |
| 516 | 3300005353 | Ga0070669_100255449 | Ga0070669_1002554492 | 307 |
| 517 | 3300005518 | Ga0070699_100226415 | Ga0070699_1002264152 | 307 |
| 518 | 3300005840 | Ga0068870_10005619 | Ga0068870_100056196 | 307 |
| 519 | 3300010375 | Ga0105239_10027696 | Ga0105239_100276962 | 307 |
| 520 | 3300025908 | Ga0207643_10022588 | Ga0207643_100225883 | 307 |
| 521 | 3300025911 | Ga0207654_10104861 | Ga0207654_101048612 | 307 |
| 522 | 3300025917 | Ga0207660_10158872 | Ga0207660_101588722 | 307 |
| 523 | 3300025922 | Ga0207646_10372763 | Ga0207646_103727632 | 307 |
| 524 | 3300025925 | Ga0207650_10173687 | Ga0207650_101736873 | 307 |
| 525 | 3300025939 | Ga0207665_10134820 | Ga0207665_101348202 | 307 |
| 526 | 3300028380 | Ga0268265_10130266 | Ga0268265_101302663 | 307 |
| 527 | 3300031911 | Ga0307412_10054547 | Ga0307412_100545473 | 307 |
| 528 | 3300002459 | JGI24751J29686_10000043 | JGI24751J29686_1000004367 | 308 |
| 529 | 3300003203 | JGI25406J46586_10018658 | JGI25406J46586_100186582 | 308 |
| 530 | 3300005290 | Ga0065712_10012705 | Ga0065712_100127052 | 308 |
| 531 | 3300005293 | Ga0065715_10037318 | Ga0065715_100373182 | 308 |
| 532 | 3300005295 | Ga0065707_10006442 | Ga0065707_100064422 | 308 |
| 533 | 3300005331 | Ga0070670_100000614 | Ga0070670_10000061423 | 308 |
| 534 | 3300005334 | Ga0068869_100024393 | Ga0068869_1000243933 | 308 |
| 535 | 3300005337 | Ga0070682_100002426 | Ga0070682_1000024264 | 308 |
| 536 | 3300005338 | Ga0068868_100087499 | Ga0068868_1000874993 | 308 |
| 537 | 3300005340 | Ga0070689_100038758 | Ga0070689_1000387585 | 308 |
| 538 | 3300005340 | Ga0070689_100167785 | Ga0070689_1001677852 | 308 |
| 539 | 3300005343 | Ga0070687_100034520 | Ga0070687_1000345202 | 308 |
| 540 | 3300005343 | Ga0070687_100051308 | Ga0070687_1000513083 | 308 |
| 541 | 3300005353 | Ga0070669_100022099 | Ga0070669_1000220995 | 308 |
| 542 | 3300005354 | Ga0070675_100153837 | Ga0070675_1001538372 | 308 |
| 543 | 3300005364 | Ga0070673_100206086 | Ga0070673_1002060861 | 308 |
| 544 | 3300005365 | Ga0070688_100044386 | Ga0070688_1000443861 | 308 |
| 545 | 3300005367 | Ga0070667_100074622 | Ga0070667_1000746224 | 308 |
| 546 | 3300005440 | Ga0070705_100138043 | Ga0070705_1001380431 | 308 |
| 547 | 3300005440 | Ga0070705_100165980 | Ga0070705_1001659802 | 308 |
| 548 | 3300005444 | Ga0070694_100013301 | Ga0070694_1000133016 | 308 |
| 549 | 3300005444 | Ga0070694_100018700 | Ga0070694_1000187002 | 308 |
| 550 | 3300005444 | Ga0070694_100319371 | Ga0070694_1003193711 | 308 |
| 551 | 3300005445 | Ga0070708_100488731 | Ga0070708_1004887311 | 308 |
| 552 | 3300005459 | Ga0068867_100043189 | Ga0068867_1000431892 | 308 |
| 553 | 3300005466 | Ga0070685_10091973 | Ga0070685_100919732 | 308 |
| 554 | 3300005467 | Ga0070706_100005620 | Ga0070706_1000056204 | 308 |
| 555 | 3300005468 | Ga0070707_100002620 | Ga0070707_10000262012 | 308 |
| 556 | 3300005468 | Ga0070707_100016284 | Ga0070707_1000162844 | 308 |
| 557 | 3300005468 | Ga0070707_100143453 | Ga0070707_1001434533 | 308 |
| 558 | 3300005471 | Ga0070698_100409003 | Ga0070698_1004090032 | 308 |
| 559 | 3300005518 | Ga0070699_100201263 | Ga0070699_1002012631 | 308 |
| 560 | 3300005518 | Ga0070699_100288318 | Ga0070699_1002883181 | 308 |
| 561 | 3300005535 | Ga0070684_100143125 | Ga0070684_1001431252 | 308 |
| 562 | 3300005536 | Ga0070697_100026525 | Ga0070697_1000265254 | 308 |
| 563 | 3300005543 | Ga0070672_100053030 | Ga0070672_1000530303 | 308 |
| 564 | 3300005545 | Ga0070695_100031580 | Ga0070695_1000315804 | 308 |
| 565 | 3300005545 | Ga0070695_100293340 | Ga0070695_1002933401 | 308 |
| 566 | 3300005547 | Ga0070693_100001080 | Ga0070693_1000010806 | 308 |
| 567 | 3300005549 | Ga0070704_100008898 | Ga0070704_1000088983 | 308 |
| 568 | 3300005549 | Ga0070704_100057013 | Ga0070704_1000570131 | 308 |
| 569 | 3300005564 | Ga0070664_100327480 | Ga0070664_1003274801 | 308 |
| 570 | 3300005615 | Ga0070702_100009856 | Ga0070702_1000098562 | 308 |
| 571 | 3300005616 | Ga0068852_100327757 | Ga0068852_1003277572 | 308 |
| 572 | 3300005617 | Ga0068859_100075235 | Ga0068859_1000752352 | 308 |
| 573 | 3300005617 | Ga0068859_100140386 | Ga0068859_1001403863 | 308 |
| 574 | 3300005617 | Ga0068859_100205531 | Ga0068859_1002055313 | 308 |
| 575 | 3300005617 | Ga0068859_100443248 | Ga0068859_1004432481 | 308 |
| 576 | 3300005718 | Ga0068866_10071659 | Ga0068866_100716593 | 308 |
| 577 | 3300005719 | Ga0068861_100078407 | Ga0068861_1000784073 | 308 |
| 578 | 3300005842 | Ga0068858_100042638 | Ga0068858_1000426383 | 308 |
| 579 | 3300005844 | Ga0068862_100041424 | Ga0068862_1000414243 | 308 |
| 580 | 3300006237 | Ga0097621_100028753 | Ga0097621_1000287534 | 308 |
| 581 | 3300006358 | Ga0068871_100071579 | Ga0068871_1000715792 | 308 |
| 582 | 3300006881 | Ga0068865_100089794 | Ga0068865_1000897942 | 308 |
| 583 | 3300006931 | Ga0097620_100075236 | Ga0097620_1000752365 | 308 |
| 584 | 3300006931 | Ga0097620_100140393 | Ga0097620_1001403933 | 308 |
| 585 | 3300006931 | Ga0097620_100205530 | Ga0097620_1002055303 | 308 |
| 586 | 3300006931 | Ga0097620_100443224 | Ga0097620_1004432241 | 308 |
| 587 | 3300009147 | Ga0114129_10379387 | Ga0114129_103793872 | 308 |
| 588 | 3300009553 | Ga0105249_10046821 | Ga0105249_100468214 | 308 |
| 589 | 3300013297 | Ga0157378_10036792 | Ga0157378_100367923 | 308 |
| 590 | 3300014325 | Ga0163163_10191202 | Ga0163163_101912022 | 308 |
| 591 | 3300014745 | Ga0157377_10053196 | Ga0157377_100531962 | 308 |
| 592 | 3300025315 | Ga0207697_10003076 | Ga0207697_100030769 | 308 |
| 593 | 3300025885 | Ga0207653_10013378 | Ga0207653_100133782 | 308 |
| 594 | 3300025899 | Ga0207642_10218241 | Ga0207642_102182411 | 308 |
| 595 | 3300025904 | Ga0207647_10031331 | Ga0207647_100313312 | 308 |
| 596 | 3300025907 | Ga0207645_10254400 | Ga0207645_102544002 | 308 |
| 597 | 3300025908 | Ga0207643_10011936 | Ga0207643_100119362 | 308 |
| 598 | 3300025910 | Ga0207684_10009401 | Ga0207684_100094017 | 308 |
| 599 | 3300025914 | Ga0207671_10013502 | Ga0207671_100135027 | 308 |
| 600 | 3300025918 | Ga0207662_10041566 | Ga0207662_100415663 | 308 |
| 601 | 3300025922 | Ga0207646_10000329 | Ga0207646_1000032937 | 308 |
| 602 | 3300025922 | Ga0207646_10006971 | Ga0207646_100069712 | 308 |
| 603 | 3300025924 | Ga0207694_10004103 | Ga0207694_100041039 | 308 |
| 604 | 3300025925 | Ga0207650_10000011 | Ga0207650_10000011190 | 308 |
| 605 | 3300025926 | Ga0207659_10146619 | Ga0207659_101466193 | 308 |
| 606 | 3300025927 | Ga0207687_10021483 | Ga0207687_100214835 | 308 |
| 607 | 3300025927 | Ga0207687_10134890 | Ga0207687_101348902 | 308 |
| 608 | 3300025934 | Ga0207686_10072890 | Ga0207686_100728903 | 308 |
| 609 | 3300025935 | Ga0207709_10104176 | Ga0207709_101041762 | 308 |
| 610 | 3300025940 | Ga0207691_10133195 | Ga0207691_101331953 | 308 |
| 611 | 3300025942 | Ga0207689_10006166 | Ga0207689_100061665 | 308 |
| 612 | 3300025942 | Ga0207689_10220599 | Ga0207689_102205991 | 308 |
| 613 | 3300025942 | Ga0207689_10316337 | Ga0207689_103163372 | 308 |
| 614 | 3300025945 | Ga0207679_10108817 | Ga0207679_101088172 | 308 |
| 615 | 3300025961 | Ga0207712_10005230 | Ga0207712_100052304 | 308 |
| 616 | 3300025961 | Ga0207712_10087624 | Ga0207712_100876242 | 308 |
| 617 | 3300025981 | Ga0207640_10087055 | Ga0207640_100870553 | 308 |
| 618 | 3300025986 | Ga0207658_10171437 | Ga0207658_101714372 | 308 |
| 619 | 3300026023 | Ga0207677_10437819 | Ga0207677_104378191 | 308 |
| 620 | 3300026035 | Ga0207703_10184085 | Ga0207703_101840852 | 308 |
| 621 | 3300026075 | Ga0207708_10084351 | Ga0207708_100843512 | 308 |
| 622 | 3300026118 | Ga0207675_100030317 | Ga0207675_1000303174 | 308 |
| 623 | 3300026118 | Ga0207675_100034479 | Ga0207675_1000344792 | 308 |
| 624 | 3300026118 | Ga0207675_100036361 | Ga0207675_1000363615 | 308 |
| 625 | 3300027907 | Ga0207428_10203960 | Ga0207428_102039602 | 308 |
| 626 | 3300028380 | Ga0268265_10086271 | Ga0268265_100862712 | 308 |
| 627 | 3300028381 | Ga0268264_10065450 | Ga0268264_100654503 | 308 |
| 628 | 3300028381 | Ga0268264_10290402 | Ga0268264_102904023 | 308 |
| 629 | 3300045051 | Ga0451576_0008797 | Ga0451576_0008797_1322_2263 | 308 |
| 630 | 3300050515 | nmdc:mga0a205_164529_c1 | nmdc:mga0a205_164529_c1_371_1312 | 308 |
| 631 | 3300005289 | Ga0065704_10013735 | Ga0065704_100137351 | 309 |
| 632 | 3300005290 | Ga0065712_10006419 | Ga0065712_100064193 | 309 |
| 633 | 3300005328 | Ga0070676_10104244 | Ga0070676_101042442 | 309 |
| 634 | 3300005331 | Ga0070670_100071716 | Ga0070670_1000717162 | 309 |
| 635 | 3300005353 | Ga0070669_100002934 | Ga0070669_10000293412 | 309 |
| 636 | 3300005364 | Ga0070673_100129746 | Ga0070673_1001297462 | 309 |
| 637 | 3300005434 | Ga0070709_10121378 | Ga0070709_101213782 | 309 |
| 638 | 3300005441 | Ga0070700_100022963 | Ga0070700_1000229632 | 309 |
| 639 | 3300005441 | Ga0070700_100027705 | Ga0070700_1000277053 | 309 |
| 640 | 3300005444 | Ga0070694_100139269 | Ga0070694_1001392692 | 309 |
| 641 | 3300005457 | Ga0070662_100109788 | Ga0070662_1001097883 | 309 |
| 642 | 3300005467 | Ga0070706_100018423 | Ga0070706_1000184235 | 309 |
| 643 | 3300005468 | Ga0070707_100199275 | Ga0070707_1001992752 | 309 |
| 644 | 3300005471 | Ga0070698_100002582 | Ga0070698_10000258220 | 309 |
| 645 | 3300005518 | Ga0070699_100000688 | Ga0070699_1000006887 | 309 |
| 646 | 3300005536 | Ga0070697_100005258 | Ga0070697_1000052585 | 309 |
| 647 | 3300005617 | Ga0068859_100102507 | Ga0068859_1001025072 | 309 |
| 648 | 3300005618 | Ga0068864_100220174 | Ga0068864_1002201742 | 309 |
| 649 | 3300005719 | Ga0068861_100031410 | Ga0068861_1000314102 | 309 |
| 650 | 3300005842 | Ga0068858_100029807 | Ga0068858_1000298073 | 309 |
| 651 | 3300005842 | Ga0068858_100057128 | Ga0068858_1000571283 | 309 |
| 652 | 3300005844 | Ga0068862_100263520 | Ga0068862_1002635202 | 309 |
| 653 | 3300006163 | Ga0070715_10000024 | Ga0070715_1000002473 | 309 |
| 654 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001321 | 309 |
| 655 | 3300006237 | Ga0097621_100375732 | Ga0097621_1003757322 | 309 |
| 656 | 3300006358 | Ga0068871_100015416 | Ga0068871_1000154162 | 309 |
| 657 | 3300006847 | Ga0075431_100345254 | Ga0075431_1003452542 | 309 |
| 658 | 3300006914 | Ga0075436_100000070 | Ga0075436_10000007042 | 309 |
| 659 | 3300006931 | Ga0097620_100102509 | Ga0097620_1001025092 | 309 |
| 660 | 3300007076 | Ga0075435_100006335 | Ga0075435_1000063359 | 309 |
| 661 | 3300009094 | Ga0111539_10075589 | Ga0111539_100755892 | 309 |
| 662 | 3300009147 | Ga0114129_10231906 | Ga0114129_102319062 | 309 |
| 663 | 3300009553 | Ga0105249_10091747 | Ga0105249_100917473 | 309 |
| 664 | 3300014326 | Ga0157380_10000324 | Ga0157380_1000032425 | 309 |
| 665 | 3300025905 | Ga0207685_10000018 | Ga0207685_1000001869 | 309 |
| 666 | 3300025910 | Ga0207684_10012493 | Ga0207684_100124936 | 309 |
| 667 | 3300025933 | Ga0207706_10053217 | Ga0207706_100532173 | 309 |
| 668 | 3300025939 | Ga0207665_10000002 | Ga0207665_10000002193 | 309 |
| 669 | 3300025941 | Ga0207711_10030560 | Ga0207711_100305606 | 309 |
| 670 | 3300026035 | Ga0207703_10047035 | Ga0207703_100470353 | 309 |
| 671 | 3300026075 | Ga0207708_10002201 | Ga0207708_100022017 | 309 |
| 672 | 3300026075 | Ga0207708_10027465 | Ga0207708_100274652 | 309 |
| 673 | 3300026118 | Ga0207675_100020577 | Ga0207675_1000205777 | 309 |
| 674 | 3300026118 | Ga0207675_100046067 | Ga0207675_1000460675 | 309 |
| 675 | 3300028379 | Ga0268266_10173918 | Ga0268266_101739182 | 309 |
| 676 | 3300028381 | Ga0268264_10448590 | Ga0268264_104485901 | 309 |
| 677 | 3300046809 | Ga0495600_0205875 | Ga0495600_0205875_40_972 | 309 |
| 678 | 3300047319 | Ga0495674_0299853 | Ga0495674_0299853_307_1239 | 309 |
| 679 | 3300050511 | nmdc:mga08y16_134014_c1 | nmdc:mga08y16_134014_c1_1342_2319 | 309 |
| 680 | 3300050513 | nmdc:mga0rr50_46_c1 | nmdc:mga0rr50_46_c1_22610_23545 | 309 |
| 681 | 3300050514 | nmdc:mga08x19_3_c1 | nmdc:mga08x19_3_c1_257758_258693 | 309 |
| 682 | 3300000532 | CNAas_1000553 | CNAas_10005532 | 310 |
| 683 | 3300005331 | Ga0070670_100127166 | Ga0070670_1001271662 | 310 |
| 684 | 3300005334 | Ga0068869_100313408 | Ga0068869_1003134082 | 310 |
| 685 | 3300005337 | Ga0070682_100099104 | Ga0070682_1000991042 | 310 |
| 686 | 3300005441 | Ga0070700_100000266 | Ga0070700_1000002669 | 310 |
| 687 | 3300005444 | Ga0070694_100087386 | Ga0070694_1000873863 | 310 |
| 688 | 3300005444 | Ga0070694_100160179 | Ga0070694_1001601792 | 310 |
| 689 | 3300005458 | Ga0070681_10000700 | Ga0070681_100007004 | 310 |
| 690 | 3300005467 | Ga0070706_100000128 | Ga0070706_10000012827 | 310 |
| 691 | 3300005467 | Ga0070706_100216248 | Ga0070706_1002162482 | 310 |
| 692 | 3300005471 | Ga0070698_100005684 | Ga0070698_1000056848 | 310 |
| 693 | 3300005471 | Ga0070698_100210415 | Ga0070698_1002104153 | 310 |
| 694 | 3300005518 | Ga0070699_100016945 | Ga0070699_1000169455 | 310 |
| 695 | 3300005518 | Ga0070699_100348819 | Ga0070699_1003488192 | 310 |
| 696 | 3300005530 | Ga0070679_100000642 | Ga0070679_1000006424 | 310 |
| 697 | 3300005536 | Ga0070697_100450468 | Ga0070697_1004504682 | 310 |
| 698 | 3300005539 | Ga0068853_100033008 | Ga0068853_1000330085 | 310 |
| 699 | 3300005545 | Ga0070695_100204752 | Ga0070695_1002047522 | 310 |
| 700 | 3300005546 | Ga0070696_100048703 | Ga0070696_1000487033 | 310 |
| 701 | 3300005547 | Ga0070693_100021924 | Ga0070693_1000219243 | 310 |
| 702 | 3300005577 | Ga0068857_100566272 | Ga0068857_1005662722 | 310 |
| 703 | 3300005614 | Ga0068856_100448820 | Ga0068856_1004488202 | 310 |
| 704 | 3300005615 | Ga0070702_100007385 | Ga0070702_1000073856 | 310 |
| 705 | 3300005615 | Ga0070702_100084039 | Ga0070702_1000840393 | 310 |
| 706 | 3300005617 | Ga0068859_100375959 | Ga0068859_1003759592 | 310 |
| 707 | 3300005617 | Ga0068859_100679578 | Ga0068859_1006795782 | 310 |
| 708 | 3300005618 | Ga0068864_100382643 | Ga0068864_1003826432 | 310 |
| 709 | 3300005719 | Ga0068861_100030563 | Ga0068861_1000305633 | 310 |
| 710 | 3300005719 | Ga0068861_100505894 | Ga0068861_1005058941 | 310 |
| 711 | 3300005841 | Ga0068863_100168189 | Ga0068863_1001681893 | 310 |
| 712 | 3300005842 | Ga0068858_100013704 | Ga0068858_1000137049 | 310 |
| 713 | 3300006237 | Ga0097621_100140862 | Ga0097621_1001408622 | 310 |
| 714 | 3300006237 | Ga0097621_100306850 | Ga0097621_1003068502 | 310 |
| 715 | 3300006358 | Ga0068871_100005788 | Ga0068871_1000057882 | 310 |
| 716 | 3300006852 | Ga0075433_10071379 | Ga0075433_100713792 | 310 |
| 717 | 3300006871 | Ga0075434_100058918 | Ga0075434_1000589183 | 310 |
| 718 | 3300006871 | Ga0075434_100148199 | Ga0075434_1001481993 | 310 |
| 719 | 3300006931 | Ga0097620_100375935 | Ga0097620_1003759352 | 310 |
| 720 | 3300006931 | Ga0097620_100679562 | Ga0097620_1006795622 | 310 |
| 721 | 3300025900 | Ga0207710_10038751 | Ga0207710_100387512 | 310 |
| 722 | 3300025900 | Ga0207710_10077795 | Ga0207710_100777952 | 310 |
| 723 | 3300025904 | Ga0207647_10003411 | Ga0207647_100034113 | 310 |
| 724 | 3300025910 | Ga0207684_10000150 | Ga0207684_1000015027 | 310 |
| 725 | 3300025910 | Ga0207684_10160736 | Ga0207684_101607363 | 310 |
| 726 | 3300025912 | Ga0207707_10000016 | Ga0207707_1000001661 | 310 |
| 727 | 3300025917 | Ga0207660_10012368 | Ga0207660_100123683 | 310 |
| 728 | 3300025921 | Ga0207652_10002213 | Ga0207652_100022134 | 310 |
| 729 | 3300025935 | Ga0207709_10002142 | Ga0207709_100021429 | 310 |
| 730 | 3300025941 | Ga0207711_10010782 | Ga0207711_100107825 | 310 |
| 731 | 3300025941 | Ga0207711_10012424 | Ga0207711_100124247 | 310 |
| 732 | 3300026035 | Ga0207703_10015342 | Ga0207703_100153423 | 310 |
| 733 | 3300026075 | Ga0207708_10000725 | Ga0207708_100007258 | 310 |
| 734 | 3300026078 | Ga0207702_10485759 | Ga0207702_104857591 | 310 |
| 735 | 3300026088 | Ga0207641_10130711 | Ga0207641_101307112 | 310 |
| 736 | 3300026088 | Ga0207641_10234867 | Ga0207641_102348672 | 310 |
| 737 | 3300026095 | Ga0207676_10057318 | Ga0207676_100573183 | 310 |
| 738 | 3300026118 | Ga0207675_100013881 | Ga0207675_1000138813 | 310 |
| 739 | 3300028381 | Ga0268264_10035201 | Ga0268264_100352011 | 310 |
| 740 | 3300048912 | Ga0496109_0247044 | Ga0496109_0247044_241_1176 | 310 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar