F478539

General Info

Members Datasets Scaffolds Average Seq Length
740 293 1480 138

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_070898|Ga0400483_070898_388_852
Length 154
Sequence MSSLSDPTGNGISNATSLSSEADNVNWLVNNFVEQVPGVSEAVVVSSDGLPIAASQGLDRDSVDRFSAVASGLIGLSYGAAGRFGGGAVTEVIVEMEHAFLFVTGISDGSLLAVVADESADIGLVGYEMAVLVDKAGEALTPELRAELQAALPQ

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
56 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
273 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
276 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
281 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
282 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
289 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
290 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
291 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
292 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
293 2990059506 Streptomyces sp. CAP261 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0
Rhizoplane 5.27
Rhizosphere 82.43
Stem 0
Stem Tuber 0
Unclassified 6.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_070898 3300039062 Bacteria 4420
2 Ga0065715_10347406 3300005293 Unclassified 957
3 Ga0070670_100527227 3300005331 Bacteria 1052
4 Ga0070670_101833080 3300005331 Unclassified 558
5 Ga0070682_100445538 3300005337 Bacteria 990
6 Ga0070682_100847086 3300005337 Unclassified 747
7 Ga0070689_100790144 3300005340 Bacteria 834
8 Ga0070687_100679114 3300005343 Bacteria 717
9 Ga0070668_100441662 3300005347 Bacteria 1117
10 Ga0070668_100476806 3300005347 Unclassified 1077
11 Ga0070668_101140132 3300005347 Unclassified 705
12 Ga0070668_101173792 3300005347 Bacteria 695
13 Ga0070675_100104873 3300005354 Bacteria 2385
14 Ga0070671_101105341 3300005355 Bacteria 696
15 Ga0070674_101171852 3300005356 Bacteria 681
16 Ga0070673_100745084 3300005364 Unclassified 902
17 Ga0070713_100094000 3300005436 Bacteria 2584
18 Ga0070713_100525034 3300005436 Bacteria 1119
19 Ga0070710_10006578 3300005437 Bacteria 5588
20 Ga0070705_101204266 3300005440 Bacteria 624
21 Ga0070708_100771362 3300005445 Bacteria 904
22 Ga0070678_100061449 3300005456 Bacteria 2769
23 Ga0070678_100547428 3300005456 Bacteria 1027
24 Ga0070678_100864251 3300005456 Bacteria 825
25 Ga0070678_100947588 3300005456 Unclassified 789
26 Ga0070678_101183506 3300005456 Bacteria 708
27 Ga0070679_101141520 3300005530 Unclassified 724
28 Ga0070684_100437921 3300005535 Bacteria 1207
29 Ga0070672_100077884 3300005543 Bacteria 2652
30 Ga0070672_100316840 3300005543 Bacteria 1325
31 Ga0070672_100844539 3300005543 Bacteria 807
32 Ga0070696_100578435 3300005546 Bacteria 903
33 Ga0070696_100955804 3300005546 Bacteria 713
34 Ga0070693_100585887 3300005547 Bacteria 803
35 Ga0070665_100429488 3300005548 Bacteria 1330
36 Ga0070704_101000214 3300005549 Bacteria 756
37 Ga0070702_100574403 3300005615 Bacteria 841
38 Ga0070702_101239244 3300005615 Bacteria 603
39 Ga0068861_100144373 3300005719 Bacteria 1946
40 Ga0068861_100177583 3300005719 Bacteria 1770
41 Ga0068861_100896152 3300005719 Bacteria 840
42 Ga0068863_100106149 3300005841 Bacteria 2672
43 Ga0068858_100407235 3300005842 Bacteria 1307
44 Ga0068860_100726128 3300005843 Bacteria 1004
45 Ga0081455_10108156 3300005937 Bacteria 2215
46 Ga0081455_10416033 3300005937 Bacteria 928
47 Ga0081455_10434644 3300005937 Bacteria 901
48 Ga0081539_10030945 3300005985 Bacteria 3309
49 Ga0075365_10065937 3300006038 Bacteria 2428
50 Ga0075365_10329836 3300006038 Bacteria 1075
51 Ga0075365_10338314 3300006038 Bacteria 1060
52 Ga0075365_10394832 3300006038 Bacteria 976
53 Ga0075365_10404601 3300006038 Bacteria 963
54 Ga0075365_10652522 3300006038 Bacteria 744
55 Ga0075365_11024953 3300006038 Bacteria 581
56 Ga0075368_10069224 3300006042 Bacteria 1423
57 Ga0075368_10367819 3300006042 Bacteria 628
58 Ga0075363_100193951 3300006048 Bacteria 1159
59 Ga0075363_100299463 3300006048 Bacteria 933
60 Ga0075364_10008974 3300006051 Bacteria 5987
61 Ga0075364_10032317 3300006051 Bacteria 3363
62 Ga0075364_10190900 3300006051 Bacteria 1387
63 Ga0075364_10257350 3300006051 Bacteria 1186
64 Ga0075364_10677977 3300006051 Unclassified 704
65 Ga0075362_10314274 3300006177 Bacteria 779
66 Ga0075367_10078024 3300006178 Bacteria 2000
67 Ga0075367_10229036 3300006178 Bacteria 1164
68 Ga0075367_10329515 3300006178 Unclassified 962
69 Ga0075367_10355877 3300006178 Bacteria 924
70 Ga0075367_10726875 3300006178 Bacteria 632
71 Ga0075366_10725598 3300006195 Bacteria 617
72 Ga0097621_100373654 3300006237 Bacteria 1272
73 Ga0068871_100460263 3300006358 Bacteria 1141
74 Ga0075430_100149449 3300006846 Bacteria 1945
75 Ga0075430_100607389 3300006846 Bacteria 902
76 Ga0075431_101324245 3300006847 Bacteria 681
77 Ga0075434_100321769 3300006871 Bacteria 1567
78 Ga0075429_100649939 3300006880 Bacteria 924
79 Ga0075435_101024150 3300007076 Unclassified 721
80 Ga0111539_10231934 3300009094 Bacteria 2149
81 Ga0111539_11508343 3300009094 Bacteria 780
82 Ga0105245_10045885 3300009098 Bacteria 3904
83 Ga0105245_11661988 3300009098 Bacteria 691
84 Ga0105247_10729041 3300009101 Unclassified 749
85 Ga0114129_10210442 3300009147 Bacteria 2629
86 Ga0114129_10769494 3300009147 Bacteria 1231
87 Ga0114129_11249702 3300009147 Unclassified 923
88 Ga0114129_11306077 3300009147 Bacteria 899
89 Ga0105243_10178525 3300009148 Bacteria 1845
90 Ga0105243_10328764 3300009148 Bacteria 1396
91 Ga0105241_10039406 3300009174 Bacteria 3564
92 Ga0105242_10099286 3300009176 Bacteria 2464
93 Ga0105242_10269641 3300009176 Bacteria 1541
94 Ga0105242_11518197 3300009176 Bacteria 701
95 Ga0105242_11752319 3300009176 Bacteria 658
96 Ga0105248_11282776 3300009177 Unclassified 828
97 Ga0105238_11598544 3300009551 Bacteria 682
98 Ga0105249_10318152 3300009553 Bacteria 1567
99 Ga0105249_12042162 3300009553 Bacteria 646
100 Ga0105030_112858 3300009987 Unclassified 729
101 Ga0105028_120096 3300009993 Bacteria 722
102 Ga0105239_10200717 3300010375 Bacteria 2234
103 Ga0105239_10860386 3300010375 Unclassified 1040
104 Ga0105239_13521519 3300010375 Bacteria 509
105 Ga0105246_10210980 3300011119 Bacteria 1516
106 Ga0105246_10867568 3300011119 Bacteria 807
107 Ga0105246_12297440 3300011119 Bacteria 527
108 Ga0157373_11324250 3300013100 Unclassified 546
109 Ga0157374_10978549 3300013296 Bacteria 865
110 Ga0157378_10176453 3300013297 Bacteria 2007
111 Ga0157378_10439045 3300013297 Bacteria 1293
112 Ga0157378_11738455 3300013297 Bacteria 671
113 Ga0157378_11929878 3300013297 Unclassified 640
114 Ga0163162_10543256 3300013306 Bacteria 1291
115 Ga0163162_11548537 3300013306 Bacteria 756
116 Ga0157372_12324102 3300013307 Bacteria 616
117 Ga0157375_10260855 3300013308 Bacteria 1894
118 Ga0157375_10522420 3300013308 Bacteria 1350
119 Ga0163163_10080544 3300014325 Bacteria 3256
120 Ga0163163_10879446 3300014325 Bacteria 959
121 Ga0157380_10308254 3300014326 Bacteria 1462
122 Ga0157380_10694227 3300014326 Unclassified 1022
123 Ga0157380_11206079 3300014326 Bacteria 800
124 Ga0157380_11843047 3300014326 Bacteria 665
125 Ga0157377_10408859 3300014745 Bacteria 926
126 Ga0157377_11431775 3300014745 Bacteria 546
127 Ga0157379_10238539 3300014968 Bacteria 1649
128 Ga0157379_11465477 3300014968 Bacteria 663
129 Ga0157376_11595532 3300014969 Bacteria 687
130 Ga0157376_12343488 3300014969 Unclassified 573
131 Ga0163161_10167680 3300017792 Bacteria 1678
132 Ga0213876_10002892 3300021384 Bacteria 9970
133 Ga0207692_10022755 3300025898 Bacteria 2889
134 Ga0207692_10255627 3300025898 Bacteria 1051
135 Ga0207654_10294935 3300025911 Bacteria 1101
136 Ga0207693_10068745 3300025915 Bacteria 2772
137 Ga0207662_10564197 3300025918 Bacteria 789
138 Ga0207681_10172182 3300025923 Bacteria 1642
139 Ga0207681_10576298 3300025923 Bacteria 928
140 Ga0207650_10410042 3300025925 Bacteria 1123
141 Ga0207659_10330426 3300025926 Bacteria 1260
142 Ga0207687_10198593 3300025927 Bacteria 1566
143 Ga0207687_10721128 3300025927 Bacteria 847
144 Ga0207700_10592659 3300025928 Bacteria 986
145 Ga0207686_10119971 3300025934 Bacteria 1788
146 Ga0207686_10594314 3300025934 Bacteria 870
147 Ga0207709_10277930 3300025935 Bacteria 1235
148 Ga0207709_10280519 3300025935 Bacteria 1230
149 Ga0207669_10777685 3300025937 Bacteria 792
150 Ga0207669_11870889 3300025937 Bacteria 513
151 Ga0207665_11164874 3300025939 Bacteria 615
152 Ga0207691_10084745 3300025940 Bacteria 2845
153 Ga0207691_10288254 3300025940 Bacteria 1412
154 Ga0207711_10737571 3300025941 Bacteria 918
155 Ga0207661_11444898 3300025944 Bacteria 631
156 Ga0207651_10732231 3300025960 Unclassified 873
157 Ga0207712_10092521 3300025961 Bacteria 2229
158 Ga0207712_11144257 3300025961 Bacteria 693
159 Ga0207668_10050821 3300025972 Bacteria 2859
160 Ga0207668_10749997 3300025972 Bacteria 861
161 Ga0207668_11049152 3300025972 Bacteria 730
162 Ga0207668_11240841 3300025972 Unclassified 670
163 Ga0207703_10825789 3300026035 Bacteria 886
164 Ga0207678_10642285 3300026067 Bacteria 932
165 Ga0207678_11277482 3300026067 Bacteria 650
166 Ga0207708_10506687 3300026075 Bacteria 1012
167 Ga0207708_11654148 3300026075 Bacteria 562
168 Ga0207648_11062489 3300026089 Bacteria 759
169 Ga0207676_10518631 3300026095 Bacteria 1134
170 Ga0207675_100302728 3300026118 Bacteria 1557
171 Ga0207675_100307656 3300026118 Bacteria 1545
172 Ga0207675_100522210 3300026118 Bacteria 1184
173 Ga0207675_101226546 3300026118 Bacteria 770
174 Ga0207683_10096827 3300026121 Bacteria 2631
175 Ga0207683_10162756 3300026121 Bacteria 2018
176 Ga0207683_10328685 3300026121 Bacteria 1401
177 Ga0207683_10460364 3300026121 Bacteria 1173
178 Ga0207683_10930336 3300026121 Bacteria 807
179 Ga0207698_10936399 3300026142 Bacteria 875
180 Ga0209813_10141382 3300027866 Bacteria 855
181 Ga0209813_10190918 3300027866 Bacteria 754
182 Ga0209813_10208594 3300027866 Bacteria 726
183 Ga0209974_10053671 3300027876 Bacteria 1358
184 Ga0268266_11253292 3300028379 Bacteria 717
185 Ga0268265_10027687 3300028380 Bacteria 4049
186 Ga0268265_11982248 3300028380 Bacteria 589
187 Ga0268264_11019043 3300028381 Bacteria 835
188 Ga0265336_10133424 3300028666 Bacteria 739
189 Ga0307517_10046838 3300028786 Bacteria 4498
190 Ga0265338_10015936 3300028800 Bacteria 8221
191 Ga0265327_10007936 3300031251 Bacteria 8038
192 Ga0265327_10013730 3300031251 Bacteria 5358
193 Ga0265327_10080506 3300031251 Bacteria 1610
194 Ga0265327_10128717 3300031251 Bacteria 1193
195 Ga0307408_100926736 3300031548 Bacteria 799
196 Ga0307508_10031427 3300031616 Bacteria 4798
197 Ga0307508_10165589 3300031616 Bacteria 1814
198 Ga0307508_10383492 3300031616 Bacteria 996
199 Ga0316575_10048373 3300031665 Bacteria 1691
200 Ga0316576_10076359 3300031727 Bacteria 2479
201 Ga0316576_10170245 3300031727 Bacteria 1644
202 Ga0316576_10264720 3300031727 Bacteria 1289
203 Ga0316576_10648999 3300031727 Bacteria 768
204 Ga0316578_10086816 3300031728 Bacteria 1865
205 Ga0316578_10089879 3300031728 Bacteria 1833
206 Ga0307516_10053112 3300031730 Bacteria 3964
207 Ga0307516_10109081 3300031730 Bacteria 2574
208 Ga0307405_10759771 3300031731 Unclassified 808
209 Ga0316577_10291941 3300031733 Bacteria 923
210 Ga0307413_10072580 3300031824 Bacteria 2173
211 Ga0307410_10102100 3300031852 Bacteria 2057
212 Ga0307412_10794241 3300031911 Bacteria 821
213 Ga0307412_11003612 3300031911 Bacteria 738
214 Ga0307412_11603822 3300031911 Unclassified 594
215 Ga0307409_100032897 3300031995 Bacteria 3767
216 Ga0307409_102240344 3300031995 Bacteria 576
217 Ga0307409_102347522 3300031995 Bacteria 562
218 Ga0307409_102571781 3300031995 Bacteria 538
219 Ga0307416_100344301 3300032002 Bacteria 1505
220 Ga0307416_100606555 3300032002 Bacteria 1175
221 Ga0307414_10878173 3300032004 Bacteria 821
222 Ga0307411_11590124 3300032005 Bacteria 603
223 Ga0307415_100433623 3300032126 Bacteria 1131
224 Ga0307415_100761857 3300032126 Bacteria 880
225 Ga0307415_101524643 3300032126 Bacteria 640
226 Ga0307415_102405703 3300032126 Bacteria 518
227 Ga0307507_10579739 3300033179 Bacteria 584
228 Ga0307510_10185132 3300033180 Bacteria 1639
229 Ga0373948_0056806 3300034817 Bacteria 852
230 Ga0373945_0303636 3300035116 Bacteria 684
231 Ga0373955_0089974 3300035172 Bacteria 1748
232 Ga0316574_0001032 3300035398 Bacteria 12623
233 Ga0316574_0161989 3300035398 Unclassified 1440
234 Ga0316574_0206795 3300035398 Bacteria 1260
235 Ga0373931_0008215 3300035691 Bacteria 4945
236 Ga0373931_0227919 3300035691 Bacteria 1125
237 Ga0373931_0805489 3300035691 Bacteria 626
238 Ga0373937_0183996 3300036401 Bacteria 1962
239 Ga0373937_0807976 3300036401 Unclassified 886
240 Ga0373937_0948875 3300036401 Bacteria 809
241 Ga0316582_0134621 3300036647 Bacteria 1662
242 Ga0316584_0003967 3300036712 Bacteria 9733
243 Ga0316584_0025264 3300036712 Bacteria 4355
244 Ga0316584_0247887 3300036712 Bacteria 1302
245 Ga0395905_0120613 3300037471 Bacteria 2465
246 Ga0400485_14901 3300038735 Bacteria 3890
247 Ga0400483_027223 3300039062 Bacteria 80217
248 Ga0400483_076252 3300039062 Bacteria 5181
249 Ga0400483_076253 3300039062 Bacteria 4791
250 Ga0400483_101414 3300039062 Bacteria 5842
251 Ga0400483_122014 3300039062 Bacteria 18056
252 Ga0400483_189648 3300039062 Bacteria 1078
253 Ga0400483_223286 3300039062 Bacteria 31435
254 Ga0400483_257462 3300039062 Bacteria 8613
255 Ga0436365_0345456 3300039437 Bacteria 8513
256 Ga0439461_0047190 3300041410 Bacteria 946
257 Ga0451789_0535420 3300041443 Bacteria 1501
258 Ga0451791_0895493 3300041451 Bacteria 529
259 Ga0451797_1462242 3300041453 Bacteria 724
260 Ga0451802_0139828 3300041460 Bacteria 990
261 Ga0451807_1951674 3300041486 Bacteria 573
262 Ga0451807_2556943 3300041486 Bacteria 515
263 Ga0451833_0602750 3300041491 Bacteria 1304
264 Ga0451837_1635401 3300041494 Bacteria 1089
265 Ga0451841_0650166 3300041498 Bacteria 629
266 Ga0451841_0829097 3300041498 Bacteria 656
267 Ga0451853_3008136 3300041512 Unclassified 568
268 Ga0451853_3483290 3300041512 Bacteria 1424
269 Ga0439431_0094080 3300041997 Bacteria 819
270 Ga0439431_0173568 3300041997 Unclassified 620
271 Ga0439434_0195660 3300042435 Bacteria 680
272 Ga0439434_0329350 3300042435 Unclassified 531
273 Ga0450918_035675 3300042531 Bacteria 885
274 Ga0439440_0075949 3300042993 Bacteria 882
275 Ga0495627_053848 3300046453 Bacteria 1204
276 Ga0495592_0040002 3300046454 Bacteria 3519
277 Ga0495603_0301826 3300046455 Bacteria 920
278 Ga0495603_0865579 3300046455 Bacteria 514
279 Ga0495629_0252354 3300046459 Bacteria 1214
280 Ga0495629_0814772 3300046459 Bacteria 615
281 Ga0495638_0428739 3300046460 Bacteria 680
282 Ga0495641_0076124 3300046461 Bacteria 1504
283 Ga0495641_0180556 3300046461 Unclassified 945
284 Ga0495641_0337338 3300046461 Bacteria 681
285 Ga0495641_0390850 3300046461 Bacteria 631
286 Ga0495641_0454399 3300046461 Bacteria 583
287 Ga0495641_0555845 3300046461 Bacteria 524
288 Ga0495651_0009275 3300046462 Bacteria 7550
289 Ga0495651_0064759 3300046462 Bacteria 2793
290 Ga0495653_0018356 3300046463 Bacteria 5682
291 Ga0495653_0245842 3300046463 Bacteria 1190
292 Ga0495653_0510635 3300046463 Bacteria 748
293 Ga0495662_0132242 3300046476 Bacteria 1227
294 Ga0495594_0127849 3300046499 Bacteria 1438
295 Ga0495594_0836588 3300046499 Bacteria 518
296 Ga0495608_0011546 3300046511 Bacteria 6145
297 Ga0495608_0215939 3300046511 Bacteria 1205
298 Ga0495618_0043582 3300046514 Bacteria 2830
299 Ga0495628_0007427 3300046516 Bacteria 9488
300 Ga0495628_0200213 3300046516 Bacteria 1505
301 Ga0495630_0568594 3300046517 Unclassified 869
302 Ga0495630_0579214 3300046517 Unclassified 860
303 Ga0495630_0808093 3300046517 Bacteria 716
304 Ga0495643_0003841 3300046522 Bacteria 10824
305 Ga0495644_0232908 3300046523 Bacteria 713
306 Ga0495642_0284142 3300046528 Bacteria 724
307 Ga0495652_0021219 3300046529 Bacteria 5774
308 Ga0495652_0527419 3300046529 Bacteria 815
309 Ga0495640_0001549 3300046533 Bacteria 18108
310 Ga0495586_0084056 3300046535 Bacteria 1752
311 Ga0495586_0593714 3300046535 Bacteria 640
312 Ga0495645_0504650 3300046543 Bacteria 756
313 Ga0495622_0088601 3300046557 Bacteria 1422
314 Ga0495667_0058148 3300046559 Bacteria 2540
315 Ga0495667_0275985 3300046559 Bacteria 1067
316 Ga0495667_0526270 3300046559 Bacteria 740
317 Ga0495634_0183181 3300046642 Bacteria 1310
318 Ga0495611_0084399 3300046648 Bacteria 1464
319 Ga0495635_0052229 3300046663 Bacteria 2816
320 Ga0495635_0355198 3300046663 Bacteria 977
321 Ga0495657_0021092 3300046675 Bacteria 4678
322 Ga0495657_0022839 3300046675 Bacteria 4475
323 Ga0495657_0395178 3300046675 Bacteria 814
324 Ga0495657_0568717 3300046675 Bacteria 657
325 Ga0495599_0202272 3300046678 Bacteria 1220
326 Ga0495599_0335678 3300046678 Bacteria 908
327 Ga0495623_0040318 3300046679 Bacteria 2982
328 Ga0495623_0047594 3300046679 Bacteria 2722
329 Ga0495647_0198064 3300046681 Bacteria 880
330 Ga0495658_0044638 3300046683 Bacteria 2484
331 Ga0495658_0191103 3300046683 Bacteria 1273
332 Ga0495658_0288295 3300046683 Bacteria 1037
333 Ga0495658_0409350 3300046683 Bacteria 865
334 Ga0495658_0564159 3300046683 Bacteria 729
335 Ga0495613_0294904 3300046689 Bacteria 1123
336 Ga0495613_0570065 3300046689 Bacteria 756
337 Ga0495613_0744211 3300046689 Bacteria 643
338 Ga0495589_0482712 3300046794 Bacteria 566
339 Ga0495600_0127551 3300046809 Bacteria 1654
340 Ga0495600_0152391 3300046809 Bacteria 1496
341 Ga0495600_0716299 3300046809 Bacteria 601
342 Ga0495604_0002739 3300047317 Bacteria 14139
343 Ga0495604_0048247 3300047317 Bacteria 3313
344 Ga0495636_0027753 3300047318 Bacteria 2306
345 Ga0495674_0686319 3300047319 Bacteria 805
346 Ga0495672_0005262 3300047320 Bacteria 10307
347 Ga0495672_0148464 3300047320 Bacteria 1218
348 Ga0495676_0062246 3300047321 Bacteria 2914
349 Ga0495676_0258166 3300047321 Bacteria 1186
350 Ga0495676_0506287 3300047321 Archaea 792
351 Ga0495680_0016053 3300047322 Bacteria 6440
352 Ga0495680_0022063 3300047322 Bacteria 5317
353 Ga0495680_0213324 3300047322 Bacteria 1381
354 Ga0495687_054210 3300047443 Bacteria 1684
355 Ga0495687_179345 3300047443 Bacteria 693
356 Ga0495675_0057258 3300047444 Bacteria 2471
357 Ga0495675_0137635 3300047444 Bacteria 1515
358 Ga0495679_016168 3300047446 Bacteria 2706
359 Ga0495685_001048 3300047447 Bacteria 8432
360 Ga0495685_018158 3300047447 Bacteria 2412
361 Ga0495673_0231255 3300047469 Bacteria 681
362 Ga0495681_0004904 3300047470 Bacteria 9043
363 Ga0495684_0092775 3300047471 Bacteria 2287
364 Ga0495684_0290828 3300047471 Bacteria 1176
365 Ga0495686_0049809 3300047472 Bacteria 2634
366 Ga0495593_0008434 3300047673 Bacteria 5993
367 Ga0495593_0236215 3300047673 Bacteria 916
368 Ga0495602_0033132 3300048088 Bacteria 4852
369 Ga0495602_0147502 3300048088 Bacteria 1854
370 Ga0495614_0413893 3300048089 Bacteria 635
371 Ga0495615_0266231 3300048090 Bacteria 547
372 Ga0496100_0408023 3300048903 Bacteria 1036
373 Ga0496100_0789728 3300048903 Bacteria 744
374 Ga0496100_0824448 3300048903 Bacteria 727
375 Ga0496101_0009938 3300048904 Bacteria 6270
376 Ga0496101_0274604 3300048904 Bacteria 1316
377 Ga0496101_1360619 3300048904 Bacteria 554
378 Ga0496102_0036149 3300048905 Bacteria 4449
379 Ga0496102_0329857 3300048905 Bacteria 1437
380 Ga0496103_0987171 3300048906 Bacteria 525
381 Ga0496104_0010012 3300048907 Bacteria 8462
382 Ga0496104_0011936 3300048907 Bacteria 7793
383 Ga0496104_0080597 3300048907 Bacteria 3104
384 Ga0496104_0342070 3300048907 Bacteria 1409
385 Ga0496104_1477145 3300048907 Bacteria 583
386 Ga0496105_0034238 3300048908 Bacteria 4176
387 Ga0496105_0047910 3300048908 Bacteria 3527
388 Ga0496105_0321293 3300048908 Bacteria 1240
389 Ga0496106_0087323 3300048909 Bacteria 2403
390 Ga0496107_0204125 3300048910 Bacteria 1469
391 Ga0496108_0419048 3300048911 Bacteria 1169
392 Ga0496108_1401997 3300048911 Bacteria 584
393 Ga0496109_0569282 3300048912 Bacteria 1068
394 Ga0496109_0582132 3300048912 Bacteria 1055
395 Ga0496109_0808722 3300048912 Bacteria 875
396 Ga0496110_1531956 3300048913 Bacteria 576
397 Ga0496111_0336285 3300048914 Unclassified 1118
398 Ga0496111_0433381 3300048914 Bacteria 971
399 Ga0496112_0470500 3300048915 Bacteria 1194
400 Ga0496113_0796305 3300048916 Bacteria 751
401 Ga0496114_0047992 3300048917 Bacteria 3551
402 Ga0496114_0087403 3300048917 Bacteria 2643
403 Ga0496114_1602040 3300048917 Bacteria 539
404 Ga0496115_0000992 3300048918 Bacteria 20551
405 Ga0501031_0016355 3300049568 Bacteria 4817
406 Ga0501031_0073806 3300049568 Unclassified 2221
407 Ga0501031_0183681 3300049568 Bacteria 1366
408 Ga0501031_0281580 3300049568 Bacteria 1078
409 Ga0501031_0427407 3300049568 Bacteria 856
410 Ga0501031_0581499 3300049568 Bacteria 721
411 Ga0501032_0061730 3300049569 Bacteria 2512
412 Ga0501032_0157163 3300049569 Bacteria 1493
413 Ga0501032_0230385 3300049569 Unclassified 1205
414 Ga0501032_0280320 3300049569 Bacteria 1079
415 Ga0501033_0046148 3300049570 Bacteria 3240
416 Ga0501033_0400992 3300049570 Bacteria 957
417 Ga0501033_0740614 3300049570 Bacteria 667
418 Ga0501033_0908090 3300049570 Bacteria 592
419 Ga0501034_0000570 3300049571 Bacteria 58453
420 Ga0501034_0015695 3300049571 Bacteria 7780
421 Ga0501034_0026256 3300049571 Bacteria 5932
422 Ga0501034_0065553 3300049571 Bacteria 3645
423 Ga0501034_0098626 3300049571 Bacteria 2917
424 Ga0501034_0193626 3300049571 Bacteria 1994
425 Ga0501034_0313743 3300049571 Bacteria 1502
426 Ga0501034_0535281 3300049571 Bacteria 1082
427 Ga0501034_0798869 3300049571 Bacteria 836
428 Ga0501036_0002556 3300049572 Bacteria 14308
429 Ga0501036_0002702 3300049572 Bacteria 14004
430 Ga0501036_0009930 3300049572 Bacteria 7837
431 Ga0501036_0010212 3300049572 Bacteria 7739
432 Ga0501036_0090468 3300049572 Bacteria 2585
433 Ga0501036_0103767 3300049572 Bacteria 2404
434 Ga0501036_0134495 3300049572 Bacteria 2087
435 Ga0501036_0902318 3300049572 Unclassified 725
436 Ga0501036_1495820 3300049572 Bacteria 546
437 Ga0501037_0063859 3300049573 Bacteria 2684
438 Ga0501037_0115498 3300049573 Bacteria 1932
439 Ga0501037_0137855 3300049573 Bacteria 1747
440 Ga0501037_1004449 3300049573 Unclassified 543
441 Ga0501038_0026699 3300049574 Bacteria 5141
442 Ga0501038_0102367 3300049574 Bacteria 2383
443 Ga0501038_0302731 3300049574 Bacteria 1254
444 Ga0501038_0358679 3300049574 Bacteria 1134
445 Ga0501038_0774949 3300049574 Unclassified 714
446 Ga0501038_0963770 3300049574 Bacteria 627
447 Ga0501038_1357338 3300049574 Bacteria 512
448 Ga0501039_0000690 3300049575 Bacteria 24297
449 Ga0501039_0006870 3300049575 Bacteria 8656
450 Ga0501039_0014959 3300049575 Bacteria 5934
451 Ga0501039_0032863 3300049575 Bacteria 4001
452 Ga0501039_0062428 3300049575 Bacteria 2887
453 Ga0501039_0211757 3300049575 Bacteria 1524
454 Ga0501039_0270310 3300049575 Bacteria 1336
455 Ga0501039_0528165 3300049575 Bacteria 926
456 Ga0501039_1535205 3300049575 Unclassified 512
457 Ga0501040_0001601 3300049576 Bacteria 14426
458 Ga0501040_0004015 3300049576 Bacteria 9561
459 Ga0501040_0005425 3300049576 Bacteria 8250
460 Ga0501040_0047203 3300049576 Bacteria 2941
461 Ga0501040_0069998 3300049576 Bacteria 2420
462 Ga0501040_0113538 3300049576 Bacteria 1895
463 Ga0501040_0123457 3300049576 Bacteria 1818
464 Ga0501040_0366426 3300049576 Unclassified 1033
465 Ga0501040_0551778 3300049576 Bacteria 832
466 Ga0501040_0575144 3300049576 Bacteria 813
467 Ga0501041_0001369 3300049577 Bacteria 13456
468 Ga0501041_0008939 3300049577 Bacteria 5895
469 Ga0501041_0036914 3300049577 Bacteria 2960
470 Ga0501041_0047616 3300049577 Bacteria 2610
471 Ga0501041_0050574 3300049577 Bacteria 2533
472 Ga0501041_0051164 3300049577 Bacteria 2518
473 Ga0501041_0094801 3300049577 Bacteria 1844
474 Ga0501041_0106777 3300049577 Bacteria 1735
475 Ga0501042_0004607 3300049578 Bacteria 8802
476 Ga0501042_0006591 3300049578 Bacteria 7552
477 Ga0501042_0013769 3300049578 Bacteria 5510
478 Ga0501042_0072034 3300049578 Bacteria 2472
479 Ga0501042_0129655 3300049578 Bacteria 1817
480 Ga0501042_0138739 3300049578 Bacteria 1753
481 Ga0501042_0638238 3300049578 Bacteria 774
482 Ga0501042_0708342 3300049578 Bacteria 732
483 Ga0501043_0022701 3300049579 Bacteria 4921
484 Ga0501043_0071190 3300049579 Bacteria 2732
485 Ga0501043_0096429 3300049579 Bacteria 2324
486 Ga0501046_0001376 3300049580 Bacteria 23413
487 Ga0501046_0024043 3300049580 Bacteria 5003
488 Ga0501046_0024895 3300049580 Bacteria 4904
489 Ga0501046_0191491 3300049580 Bacteria 1525
490 Ga0501046_0316790 3300049580 Bacteria 1137
491 Ga0501046_0692671 3300049580 Bacteria 718
492 Ga0501047_0028858 3300049581 Bacteria 5352
493 Ga0501048_0009921 3300049582 Bacteria 7134
494 Ga0501048_0013753 3300049582 Bacteria 6003
495 Ga0501048_0030398 3300049582 Bacteria 3908
496 Ga0501048_0041524 3300049582 Bacteria 3294
497 Ga0501067_0103285 3300049583 Bacteria 1584
498 Ga0501067_0357923 3300049583 Bacteria 814
499 Ga0501068_0006687 3300049584 Bacteria 6369
500 Ga0501068_0048594 3300049584 Bacteria 2562
501 Ga0501068_0085219 3300049584 Bacteria 1944
502 Ga0501068_0119788 3300049584 Bacteria 1640
503 Ga0501068_0163213 3300049584 Bacteria 1404
504 Ga0501068_0548107 3300049584 Bacteria 752
505 Ga0501068_0743338 3300049584 Unclassified 642
506 Ga0501068_1155283 3300049584 Bacteria 512
507 Ga0501069_0011957 3300049585 Bacteria 4606
508 Ga0501069_0061850 3300049585 Bacteria 2091
509 Ga0501069_0236160 3300049585 Unclassified 1065
510 Ga0501070_0057065 3300049586 Bacteria 3236
511 Ga0501070_0140787 3300049586 Bacteria 1992
512 Ga0501070_0155781 3300049586 Bacteria 1884
513 Ga0501070_0301702 3300049586 Bacteria 1305
514 Ga0501070_0405620 3300049586 Bacteria 1102
515 Ga0501070_0649655 3300049586 Bacteria 838
516 Ga0501071_0003674 3300049587 Bacteria 9623
517 Ga0501071_0007173 3300049587 Bacteria 7290
518 Ga0501071_0010752 3300049587 Bacteria 6138
519 Ga0501071_0028753 3300049587 Bacteria 3919
520 Ga0501071_0043245 3300049587 Bacteria 3229
521 Ga0501071_0048882 3300049587 Bacteria 3043
522 Ga0501071_0084694 3300049587 Bacteria 2324
523 Ga0501071_0130004 3300049587 Bacteria 1870
524 Ga0501071_0148244 3300049587 Bacteria 1749
525 Ga0501071_0172788 3300049587 Bacteria 1618
526 Ga0501071_0999335 3300049587 Bacteria 646
527 Ga0501071_1234429 3300049587 Bacteria 577
528 Ga0501072_0004339 3300049588 Bacteria 10766
529 Ga0501072_0006189 3300049588 Bacteria 9115
530 Ga0501072_0008619 3300049588 Bacteria 7740
531 Ga0501072_0008950 3300049588 Bacteria 7612
532 Ga0501072_0015718 3300049588 Bacteria 5801
533 Ga0501072_0024631 3300049588 Bacteria 4684
534 Ga0501072_0075050 3300049588 Bacteria 2674
535 Ga0501072_0086472 3300049588 Bacteria 2488
536 Ga0501072_0117369 3300049588 Bacteria 2120
537 Ga0501072_0142466 3300049588 Bacteria 1911
538 Ga0501072_0156477 3300049588 Bacteria 1817
539 Ga0501072_0446862 3300049588 Bacteria 1024
540 Ga0501072_0804266 3300049588 Bacteria 736
541 Ga0501072_0923382 3300049588 Bacteria 681
542 Ga0501072_1040290 3300049588 Unclassified 638
543 Ga0501073_0013887 3300049589 Bacteria 5855
544 Ga0501073_0920518 3300049589 Bacteria 602
545 Ga0501074_0009316 3300049590 Bacteria 7132
546 Ga0501074_0012090 3300049590 Bacteria 6273
547 Ga0501074_0034293 3300049590 Bacteria 3680
548 Ga0501074_0104696 3300049590 Bacteria 2025
549 Ga0501074_0176388 3300049590 Bacteria 1525
550 Ga0501074_0222454 3300049590 Bacteria 1344
551 Ga0501074_0370326 3300049590 Bacteria 1016
552 Ga0501074_0372409 3300049590 Bacteria 1013
553 Ga0501074_0489885 3300049590 Bacteria 871
554 Ga0501075_0011836 3300049591 Bacteria 6189
555 Ga0501075_0021163 3300049591 Bacteria 4739
556 Ga0501075_0023092 3300049591 Bacteria 4551
557 Ga0501075_0047329 3300049591 Bacteria 3232
558 Ga0501075_0077028 3300049591 Bacteria 2523
559 Ga0501075_0078996 3300049591 Bacteria 2490
560 Ga0501075_0134879 3300049591 Bacteria 1881
561 Ga0501075_0156201 3300049591 Bacteria 1739
562 Ga0501075_0161849 3300049591 Bacteria 1707
563 Ga0501075_0168256 3300049591 Bacteria 1672
564 Ga0501075_0430535 3300049591 Bacteria 1006
565 Ga0501075_0867590 3300049591 Bacteria 686
566 Ga0501076_0004054 3300049592 Bacteria 10356
567 Ga0501076_0006049 3300049592 Bacteria 8754
568 Ga0501076_0010222 3300049592 Bacteria 6955
569 Ga0501076_0011417 3300049592 Bacteria 6615
570 Ga0501076_0032725 3300049592 Bacteria 4059
571 Ga0501076_0036845 3300049592 Bacteria 3834
572 Ga0501076_0064673 3300049592 Bacteria 2916
573 Ga0501076_0184050 3300049592 Bacteria 1703
574 Ga0501076_0192769 3300049592 Bacteria 1663
575 Ga0501076_0287603 3300049592 Unclassified 1347
576 Ga0501076_0383027 3300049592 Bacteria 1156
577 Ga0501076_0414992 3300049592 Bacteria 1107
578 Ga0501076_0722879 3300049592 Bacteria 822
579 Ga0501077_0001526 3300049593 Bacteria 13956
580 Ga0501077_0016021 3300049593 Bacteria 4722
581 Ga0501077_0058658 3300049593 Bacteria 2443
582 Ga0501077_0070556 3300049593 Bacteria 2214
583 Ga0501077_0070995 3300049593 Bacteria 2207
584 Ga0501077_0085885 3300049593 Bacteria 1995
585 Ga0501077_0107351 3300049593 Bacteria 1769
586 Ga0501077_0182309 3300049593 Bacteria 1334
587 Ga0501077_0219917 3300049593 Bacteria 1207
588 Ga0501079_0002334 3300049741 Bacteria 13757
589 Ga0501079_0006783 3300049741 Bacteria 8615
590 Ga0501079_0011085 3300049741 Bacteria 6875
591 Ga0501079_0051493 3300049741 Bacteria 3179
592 Ga0501079_0057630 3300049741 Bacteria 2998
593 Ga0501079_0141375 3300049741 Bacteria 1875
594 Ga0501079_0153164 3300049741 Bacteria 1797
595 Ga0501079_0230208 3300049741 Bacteria 1448
596 Ga0501079_0376088 3300049741 Bacteria 1114
597 Ga0501079_0425112 3300049741 Bacteria 1043
598 Ga0501080_0004741 3300049742 Bacteria 12124
599 Ga0501080_0012395 3300049742 Bacteria 7817
600 Ga0501080_0028501 3300049742 Bacteria 5196
601 Ga0501080_0187489 3300049742 Bacteria 1902
602 Ga0501080_0199210 3300049742 Bacteria 1839
603 Ga0501080_0891763 3300049742 Bacteria 776
604 Ga0501081_0000702 3300049743 Bacteria 19369
605 Ga0501081_0005627 3300049743 Bacteria 8099
606 Ga0501081_0009944 3300049743 Bacteria 6199
607 Ga0501081_0015059 3300049743 Bacteria 5103
608 Ga0501081_0030099 3300049743 Bacteria 3673
609 Ga0501081_0068527 3300049743 Bacteria 2470
610 Ga0501081_0086006 3300049743 Bacteria 2207
611 Ga0501081_0228520 3300049743 Bacteria 1354
612 Ga0501081_0245223 3300049743 Bacteria 1307
613 Ga0501081_0301216 3300049743 Bacteria 1176
614 Ga0501081_0527893 3300049743 Bacteria 881
615 Ga0501081_0911999 3300049743 Bacteria 663
616 Ga0501083_0012150 3300049744 Bacteria 6028
617 Ga0501083_0081167 3300049744 Bacteria 2150
618 Ga0501083_0149430 3300049744 Bacteria 1530
619 Ga0501035_0003872 3300049822 Bacteria 14282
620 Ga0501035_0046652 3300049822 Bacteria 3897
621 Ga0501044_0084927 3300049823 Bacteria 3199
622 Ga0501044_0278462 3300049823 Bacteria 1607
623 Ga0501044_0759767 3300049823 Bacteria 851
624 Ga0501044_1073637 3300049823 Bacteria 675
625 Ga0501045_0003901 3300049824 Bacteria 10267
626 Ga0501045_0004200 3300049824 Bacteria 9944
627 Ga0501045_0005551 3300049824 Bacteria 8724
628 Ga0501045_0010341 3300049824 Bacteria 6535
629 Ga0501045_0088541 3300049824 Bacteria 2287
630 Ga0501045_0092989 3300049824 Bacteria 2230
631 Ga0501045_0259070 3300049824 Bacteria 1294
632 Ga0501045_0567843 3300049824 Unclassified 841
633 Ga0501045_0879463 3300049824 Bacteria 658
634 Ga0501045_0951626 3300049824 Bacteria 630
635 Ga0501045_0971352 3300049824 Bacteria 623
636 nmdc:mga03683_280742_c1 3300050489 Bacteria 778
637 nmdc:mga03n38_338483_c1 3300050490 Bacteria 816
638 nmdc:mga03n38_469375_c1 3300050490 Unclassified 702
639 nmdc:mga03n38_54923_c1 3300050490 Bacteria 1792
640 nmdc:mga00v17_153179_c1 3300050491 Bacteria 1481
641 nmdc:mga00v17_318119_c1 3300050491 Bacteria 1011
642 nmdc:mga00v17_3280_c1 3300050491 Bacteria 8339
643 nmdc:mga00v17_583170_c1 3300050491 Bacteria 722
644 nmdc:mga00v17_90230_c1 3300050491 Bacteria 1924
645 nmdc:mga0yw44_228418_c1 3300050492 Bacteria 1235
646 nmdc:mga0yw44_42798_c1 3300050492 Bacteria 2702
647 nmdc:mga0yw44_62615_c1 3300050492 Bacteria 2285
648 nmdc:mga0yw44_65244_c1 3300050492 Bacteria 2243
649 nmdc:mga0yw44_702040_c1 3300050492 Bacteria 687
650 nmdc:mga06z11_312063_c1 3300050494 Bacteria 937
651 nmdc:mga06z11_3801_c1 3300050494 Bacteria 5879
652 nmdc:mga06z11_51551_c1 3300050494 Bacteria 2107
653 nmdc:mga06z11_53742_c1 3300050494 Bacteria 2073
654 nmdc:mga04h51_165261_c1 3300050495 Bacteria 854
655 nmdc:mga04h51_258143_c1 3300050495 Bacteria 700
656 nmdc:mga04h51_329238_c1 3300050495 Bacteria 628
657 nmdc:mga05p37_1335043_c1 3300050507 Bacteria 728
658 nmdc:mga05p37_821865_c1 3300050507 Bacteria 1013
659 nmdc:mga05p37_880453_c1 3300050507 Bacteria 968
660 nmdc:mga09592_1045264_c1 3300050508 Bacteria 681
661 nmdc:mga09592_426853_c1 3300050508 Bacteria 1144
662 nmdc:mga09592_909113_c1 3300050508 Bacteria 739
663 nmdc:mga0qj67_179264_c1 3300050509 Bacteria 1721
664 nmdc:mga08y16_1293604_c1 3300050511 Bacteria 696
665 nmdc:mga0n895_473951_c1 3300050512 Bacteria 1263
666 nmdc:mga0rr50_499622_c1 3300050513 Bacteria 1034
667 Ga0495601_0074672 3300053077 Bacteria 2169
668 Ga0495601_0189397 3300053077 Bacteria 1345
669 Ga0495612_0199875 3300053078 Bacteria 882
670 Ga0495612_0231789 3300053078 Bacteria 819
671 Ga0495612_0459321 3300053078 Bacteria 582
672 Ga0500635_0077839 3300053080 Bacteria 1186
673 Ga0495655_0007225 3300053083 Bacteria 2056
674 Ga0495655_0072683 3300053083 Bacteria 965
675 Ga0495595_0003693 3300053084 Bacteria 6088
676 Ga0495595_0284152 3300053084 Unclassified 831
677 Ga0495595_0705410 3300053084 Bacteria 517
678 Ga0495619_0047297 3300053085 Bacteria 2832
679 Ga0495619_0079511 3300053085 Bacteria 2206
680 Ga0495619_0251134 3300053085 Bacteria 1225
681 Ga0495619_0315015 3300053085 Bacteria 1083
682 Ga0495619_0967219 3300053085 Bacteria 570
683 Ga0500646_0149339 3300053090 Bacteria 773
684 Ga0500566_0076821 3300053094 Bacteria 1866
685 Ga0500660_022531 3300053100 Bacteria 3342
686 Ga0500553_176646 3300053101 Bacteria 774
687 Ga0500569_008855 3300053109 Bacteria 2317
688 Ga0500593_194193 3300053117 Bacteria 740
689 Ga0500614_119960 3300053123 Bacteria 773
690 Ga0500568_0000389 3300053139 Bacteria 33456
691 Ga0500573_0141891 3300053140 Bacteria 1322
692 Ga0500577_0122415 3300053142 Bacteria 1084
693 Ga0500579_115325 3300053143 Bacteria 1330
694 Ga0500600_0045429 3300053149 Bacteria 2513
695 Ga0500603_193238 3300053150 Bacteria 644
696 Ga0500616_0191240 3300053153 Bacteria 913
697 Ga0500616_0191886 3300053153 Bacteria 911
698 Ga0500634_0260735 3300053161 Bacteria 713
699 Ga0501084_0000577 3300054114 Bacteria 28039
700 Ga0501084_0000970 3300054114 Bacteria 22234
701 Ga0501084_0029885 3300054114 Bacteria 4558
702 Ga0501084_0047742 3300054114 Bacteria 3586
703 Ga0501084_0119169 3300054114 Bacteria 2218
704 Ga0501084_0223357 3300054114 Bacteria 1589
705 Ga0501084_0263111 3300054114 Bacteria 1456
706 Ga0501084_0428978 3300054114 Bacteria 1118
707 Ga0501084_0445752 3300054114 Unclassified 1094
708 Ga0501084_0517297 3300054114 Bacteria 1009
709 Ga0501084_1113113 3300054114 Unclassified 663
710 Ga0501082_0012107 3300060353 Bacteria 7411
711 Ga0501082_0043410 3300060353 Bacteria 3877
712 Ga0501082_0066585 3300060353 Bacteria 3102
713 Ga0501082_0078206 3300060353 Bacteria 2853
714 Ga0501082_0085285 3300060353 Unclassified 2724
715 Ga0501082_0086198 3300060353 Bacteria 2708
716 Ga0501082_0105787 3300060353 Bacteria 2434
717 Ga0501082_0357651 3300060353 Bacteria 1273
718 Ga0501082_0425013 3300060353 Bacteria 1160
719 Ga0501082_0723354 3300060353 Bacteria 871
720 Ga0501082_0737354 3300060353 Bacteria 862
721 Ga0501082_0893859 3300060353 Bacteria 777
722 Ga0501082_1046946 3300060353 Bacteria 713
723 Ga0501082_1476016 3300060353 Bacteria 594
724 Ga0530510_0004811 3300061734 Bacteria 9344
725 Ga0530510_0016132 3300061734 Bacteria 5282
726 Ga0530510_0019264 3300061734 Bacteria 4843
727 Ga0530510_0049683 3300061734 Bacteria 3030
728 Ga0530510_0060708 3300061734 Bacteria 2736
729 Ga0530510_0078925 3300061734 Bacteria 2394
730 Ga0530510_0211077 3300061734 Bacteria 1442
731 Ga0530510_0452797 3300061734 Unclassified 970
732 Ga0530510_0575201 3300061734 Bacteria 856
733 Ga0530510_0711617 3300061734 Bacteria 765
734 Ga0530510_0722161 3300061734 Bacteria 759
735 2585318355 2582581314 Bacteria 11452267
736 2616699841 2616644814 Bacteria 11555299
737 2954007593 2954002825 Bacteria 9173742
738 2954382579 2954380949 Bacteria 10050426
739 2954696555 2954691527 Bacteria 10720516
740 2990065682 2990059506 Bacteria 9321252
741 Ga0400483_070898
742 Ga0065715_10347406
743 Ga0070670_100527227
744 Ga0070670_101833080
745 Ga0070682_100445538
746 Ga0070682_100847086
747 Ga0070689_100790144
748 Ga0070687_100679114
749 Ga0070668_100441662
750 Ga0070668_100476806
751 Ga0070668_101140132
752 Ga0070668_101173792
753 Ga0070675_100104873
754 Ga0070671_101105341
755 Ga0070674_101171852
756 Ga0070673_100745084
757 Ga0070713_100094000
758 Ga0070713_100525034
759 Ga0070710_10006578
760 Ga0070705_101204266
761 Ga0070708_100771362
762 Ga0070678_100061449
763 Ga0070678_100547428
764 Ga0070678_100864251
765 Ga0070678_100947588
766 Ga0070678_101183506
767 Ga0070679_101141520
768 Ga0070684_100437921
769 Ga0070672_100077884
770 Ga0070672_100316840
771 Ga0070672_100844539
772 Ga0070696_100578435
773 Ga0070696_100955804
774 Ga0070693_100585887
775 Ga0070665_100429488
776 Ga0070704_101000214
777 Ga0070702_100574403
778 Ga0070702_101239244
779 Ga0068861_100144373
780 Ga0068861_100177583
781 Ga0068861_100896152
782 Ga0068863_100106149
783 Ga0068858_100407235
784 Ga0068860_100726128
785 Ga0081455_10108156
786 Ga0081455_10416033
787 Ga0081455_10434644
788 Ga0081539_10030945
789 Ga0075365_10065937
790 Ga0075365_10329836
791 Ga0075365_10338314
792 Ga0075365_10394832
793 Ga0075365_10404601
794 Ga0075365_10652522
795 Ga0075365_11024953
796 Ga0075368_10069224
797 Ga0075368_10367819
798 Ga0075363_100193951
799 Ga0075363_100299463
800 Ga0075364_10008974
801 Ga0075364_10032317
802 Ga0075364_10190900
803 Ga0075364_10257350
804 Ga0075364_10677977
805 Ga0075362_10314274
806 Ga0075367_10078024
807 Ga0075367_10229036
808 Ga0075367_10329515
809 Ga0075367_10355877
810 Ga0075367_10726875
811 Ga0075366_10725598
812 Ga0097621_100373654
813 Ga0068871_100460263
814 Ga0075430_100149449
815 Ga0075430_100607389
816 Ga0075431_101324245
817 Ga0075434_100321769
818 Ga0075429_100649939
819 Ga0075435_101024150
820 Ga0111539_10231934
821 Ga0111539_11508343
822 Ga0105245_10045885
823 Ga0105245_11661988
824 Ga0105247_10729041
825 Ga0114129_10210442
826 Ga0114129_10769494
827 Ga0114129_11249702
828 Ga0114129_11306077
829 Ga0105243_10178525
830 Ga0105243_10328764
831 Ga0105241_10039406
832 Ga0105242_10099286
833 Ga0105242_10269641
834 Ga0105242_11518197
835 Ga0105242_11752319
836 Ga0105248_11282776
837 Ga0105238_11598544
838 Ga0105249_10318152
839 Ga0105249_12042162
840 Ga0105030_112858
841 Ga0105028_120096
842 Ga0105239_10200717
843 Ga0105239_10860386
844 Ga0105239_13521519
845 Ga0105246_10210980
846 Ga0105246_10867568
847 Ga0105246_12297440
848 Ga0157373_11324250
849 Ga0157374_10978549
850 Ga0157378_10176453
851 Ga0157378_10439045
852 Ga0157378_11738455
853 Ga0157378_11929878
854 Ga0163162_10543256
855 Ga0163162_11548537
856 Ga0157372_12324102
857 Ga0157375_10260855
858 Ga0157375_10522420
859 Ga0163163_10080544
860 Ga0163163_10879446
861 Ga0157380_10308254
862 Ga0157380_10694227
863 Ga0157380_11206079
864 Ga0157380_11843047
865 Ga0157377_10408859
866 Ga0157377_11431775
867 Ga0157379_10238539
868 Ga0157379_11465477
869 Ga0157376_11595532
870 Ga0157376_12343488
871 Ga0163161_10167680
872 Ga0213876_10002892
873 Ga0207692_10022755
874 Ga0207692_10255627
875 Ga0207654_10294935
876 Ga0207693_10068745
877 Ga0207662_10564197
878 Ga0207681_10172182
879 Ga0207681_10576298
880 Ga0207650_10410042
881 Ga0207659_10330426
882 Ga0207687_10198593
883 Ga0207687_10721128
884 Ga0207700_10592659
885 Ga0207686_10119971
886 Ga0207686_10594314
887 Ga0207709_10277930
888 Ga0207709_10280519
889 Ga0207669_10777685
890 Ga0207669_11870889
891 Ga0207665_11164874
892 Ga0207691_10084745
893 Ga0207691_10288254
894 Ga0207711_10737571
895 Ga0207661_11444898
896 Ga0207651_10732231
897 Ga0207712_10092521
898 Ga0207712_11144257
899 Ga0207668_10050821
900 Ga0207668_10749997
901 Ga0207668_11049152
902 Ga0207668_11240841
903 Ga0207703_10825789
904 Ga0207678_10642285
905 Ga0207678_11277482
906 Ga0207708_10506687
907 Ga0207708_11654148
908 Ga0207648_11062489
909 Ga0207676_10518631
910 Ga0207675_100302728
911 Ga0207675_100307656
912 Ga0207675_100522210
913 Ga0207675_101226546
914 Ga0207683_10096827
915 Ga0207683_10162756
916 Ga0207683_10328685
917 Ga0207683_10460364
918 Ga0207683_10930336
919 Ga0207698_10936399
920 Ga0209813_10141382
921 Ga0209813_10190918
922 Ga0209813_10208594
923 Ga0209974_10053671
924 Ga0268266_11253292
925 Ga0268265_10027687
926 Ga0268265_11982248
927 Ga0268264_11019043
928 Ga0265336_10133424
929 Ga0307517_10046838
930 Ga0265338_10015936
931 Ga0265327_10007936
932 Ga0265327_10013730
933 Ga0265327_10080506
934 Ga0265327_10128717
935 Ga0307408_100926736
936 Ga0307508_10031427
937 Ga0307508_10165589
938 Ga0307508_10383492
939 Ga0316575_10048373
940 Ga0316576_10076359
941 Ga0316576_10170245
942 Ga0316576_10264720
943 Ga0316576_10648999
944 Ga0316578_10086816
945 Ga0316578_10089879
946 Ga0307516_10053112
947 Ga0307516_10109081
948 Ga0307405_10759771
949 Ga0316577_10291941
950 Ga0307413_10072580
951 Ga0307410_10102100
952 Ga0307412_10794241
953 Ga0307412_11003612
954 Ga0307412_11603822
955 Ga0307409_100032897
956 Ga0307409_102240344
957 Ga0307409_102347522
958 Ga0307409_102571781
959 Ga0307416_100344301
960 Ga0307416_100606555
961 Ga0307414_10878173
962 Ga0307411_11590124
963 Ga0307415_100433623
964 Ga0307415_100761857
965 Ga0307415_101524643
966 Ga0307415_102405703
967 Ga0307507_10579739
968 Ga0307510_10185132
969 Ga0373948_0056806
970 Ga0373945_0303636
971 Ga0373955_0089974
972 Ga0316574_0001032
973 Ga0316574_0161989
974 Ga0316574_0206795
975 Ga0373931_0008215
976 Ga0373931_0227919
977 Ga0373931_0805489
978 Ga0373937_0183996
979 Ga0373937_0807976
980 Ga0373937_0948875
981 Ga0316582_0134621
982 Ga0316584_0003967
983 Ga0316584_0025264
984 Ga0316584_0247887
985 Ga0395905_0120613
986 Ga0400485_14901
987 Ga0400483_027223
988 Ga0400483_076252
989 Ga0400483_076253
990 Ga0400483_101414
991 Ga0400483_122014
992 Ga0400483_189648
993 Ga0400483_223286
994 Ga0400483_257462
995 Ga0436365_0345456
996 Ga0439461_0047190
997 Ga0451789_0535420
998 Ga0451791_0895493
999 Ga0451797_1462242
1000 Ga0451802_0139828
1001 Ga0451807_1951674
1002 Ga0451807_2556943
1003 Ga0451833_0602750
1004 Ga0451837_1635401
1005 Ga0451841_0650166
1006 Ga0451841_0829097
1007 Ga0451853_3008136
1008 Ga0451853_3483290
1009 Ga0439431_0094080
1010 Ga0439431_0173568
1011 Ga0439434_0195660
1012 Ga0439434_0329350
1013 Ga0450918_035675
1014 Ga0439440_0075949
1015 Ga0495627_053848
1016 Ga0495592_0040002
1017 Ga0495603_0301826
1018 Ga0495603_0865579
1019 Ga0495629_0252354
1020 Ga0495629_0814772
1021 Ga0495638_0428739
1022 Ga0495641_0076124
1023 Ga0495641_0180556
1024 Ga0495641_0337338
1025 Ga0495641_0390850
1026 Ga0495641_0454399
1027 Ga0495641_0555845
1028 Ga0495651_0009275
1029 Ga0495651_0064759
1030 Ga0495653_0018356
1031 Ga0495653_0245842
1032 Ga0495653_0510635
1033 Ga0495662_0132242
1034 Ga0495594_0127849
1035 Ga0495594_0836588
1036 Ga0495608_0011546
1037 Ga0495608_0215939
1038 Ga0495618_0043582
1039 Ga0495628_0007427
1040 Ga0495628_0200213
1041 Ga0495630_0568594
1042 Ga0495630_0579214
1043 Ga0495630_0808093
1044 Ga0495643_0003841
1045 Ga0495644_0232908
1046 Ga0495642_0284142
1047 Ga0495652_0021219
1048 Ga0495652_0527419
1049 Ga0495640_0001549
1050 Ga0495586_0084056
1051 Ga0495586_0593714
1052 Ga0495645_0504650
1053 Ga0495622_0088601
1054 Ga0495667_0058148
1055 Ga0495667_0275985
1056 Ga0495667_0526270
1057 Ga0495634_0183181
1058 Ga0495611_0084399
1059 Ga0495635_0052229
1060 Ga0495635_0355198
1061 Ga0495657_0021092
1062 Ga0495657_0022839
1063 Ga0495657_0395178
1064 Ga0495657_0568717
1065 Ga0495599_0202272
1066 Ga0495599_0335678
1067 Ga0495623_0040318
1068 Ga0495623_0047594
1069 Ga0495647_0198064
1070 Ga0495658_0044638
1071 Ga0495658_0191103
1072 Ga0495658_0288295
1073 Ga0495658_0409350
1074 Ga0495658_0564159
1075 Ga0495613_0294904
1076 Ga0495613_0570065
1077 Ga0495613_0744211
1078 Ga0495589_0482712
1079 Ga0495600_0127551
1080 Ga0495600_0152391
1081 Ga0495600_0716299
1082 Ga0495604_0002739
1083 Ga0495604_0048247
1084 Ga0495636_0027753
1085 Ga0495674_0686319
1086 Ga0495672_0005262
1087 Ga0495672_0148464
1088 Ga0495676_0062246
1089 Ga0495676_0258166
1090 Ga0495676_0506287
1091 Ga0495680_0016053
1092 Ga0495680_0022063
1093 Ga0495680_0213324
1094 Ga0495687_054210
1095 Ga0495687_179345
1096 Ga0495675_0057258
1097 Ga0495675_0137635
1098 Ga0495679_016168
1099 Ga0495685_001048
1100 Ga0495685_018158
1101 Ga0495673_0231255
1102 Ga0495681_0004904
1103 Ga0495684_0092775
1104 Ga0495684_0290828
1105 Ga0495686_0049809
1106 Ga0495593_0008434
1107 Ga0495593_0236215
1108 Ga0495602_0033132
1109 Ga0495602_0147502
1110 Ga0495614_0413893
1111 Ga0495615_0266231
1112 Ga0496100_0408023
1113 Ga0496100_0789728
1114 Ga0496100_0824448
1115 Ga0496101_0009938
1116 Ga0496101_0274604
1117 Ga0496101_1360619
1118 Ga0496102_0036149
1119 Ga0496102_0329857
1120 Ga0496103_0987171
1121 Ga0496104_0010012
1122 Ga0496104_0011936
1123 Ga0496104_0080597
1124 Ga0496104_0342070
1125 Ga0496104_1477145
1126 Ga0496105_0034238
1127 Ga0496105_0047910
1128 Ga0496105_0321293
1129 Ga0496106_0087323
1130 Ga0496107_0204125
1131 Ga0496108_0419048
1132 Ga0496108_1401997
1133 Ga0496109_0569282
1134 Ga0496109_0582132
1135 Ga0496109_0808722
1136 Ga0496110_1531956
1137 Ga0496111_0336285
1138 Ga0496111_0433381
1139 Ga0496112_0470500
1140 Ga0496113_0796305
1141 Ga0496114_0047992
1142 Ga0496114_0087403
1143 Ga0496114_1602040
1144 Ga0496115_0000992
1145 Ga0501031_0016355
1146 Ga0501031_0073806
1147 Ga0501031_0183681
1148 Ga0501031_0281580
1149 Ga0501031_0427407
1150 Ga0501031_0581499
1151 Ga0501032_0061730
1152 Ga0501032_0157163
1153 Ga0501032_0230385
1154 Ga0501032_0280320
1155 Ga0501033_0046148
1156 Ga0501033_0400992
1157 Ga0501033_0740614
1158 Ga0501033_0908090
1159 Ga0501034_0000570
1160 Ga0501034_0015695
1161 Ga0501034_0026256
1162 Ga0501034_0065553
1163 Ga0501034_0098626
1164 Ga0501034_0193626
1165 Ga0501034_0313743
1166 Ga0501034_0535281
1167 Ga0501034_0798869
1168 Ga0501036_0002556
1169 Ga0501036_0002702
1170 Ga0501036_0009930
1171 Ga0501036_0010212
1172 Ga0501036_0090468
1173 Ga0501036_0103767
1174 Ga0501036_0134495
1175 Ga0501036_0902318
1176 Ga0501036_1495820
1177 Ga0501037_0063859
1178 Ga0501037_0115498
1179 Ga0501037_0137855
1180 Ga0501037_1004449
1181 Ga0501038_0026699
1182 Ga0501038_0102367
1183 Ga0501038_0302731
1184 Ga0501038_0358679
1185 Ga0501038_0774949
1186 Ga0501038_0963770
1187 Ga0501038_1357338
1188 Ga0501039_0000690
1189 Ga0501039_0006870
1190 Ga0501039_0014959
1191 Ga0501039_0032863
1192 Ga0501039_0062428
1193 Ga0501039_0211757
1194 Ga0501039_0270310
1195 Ga0501039_0528165
1196 Ga0501039_1535205
1197 Ga0501040_0001601
1198 Ga0501040_0004015
1199 Ga0501040_0005425
1200 Ga0501040_0047203
1201 Ga0501040_0069998
1202 Ga0501040_0113538
1203 Ga0501040_0123457
1204 Ga0501040_0366426
1205 Ga0501040_0551778
1206 Ga0501040_0575144
1207 Ga0501041_0001369
1208 Ga0501041_0008939
1209 Ga0501041_0036914
1210 Ga0501041_0047616
1211 Ga0501041_0050574
1212 Ga0501041_0051164
1213 Ga0501041_0094801
1214 Ga0501041_0106777
1215 Ga0501042_0004607
1216 Ga0501042_0006591
1217 Ga0501042_0013769
1218 Ga0501042_0072034
1219 Ga0501042_0129655
1220 Ga0501042_0138739
1221 Ga0501042_0638238
1222 Ga0501042_0708342
1223 Ga0501043_0022701
1224 Ga0501043_0071190
1225 Ga0501043_0096429
1226 Ga0501046_0001376
1227 Ga0501046_0024043
1228 Ga0501046_0024895
1229 Ga0501046_0191491
1230 Ga0501046_0316790
1231 Ga0501046_0692671
1232 Ga0501047_0028858
1233 Ga0501048_0009921
1234 Ga0501048_0013753
1235 Ga0501048_0030398
1236 Ga0501048_0041524
1237 Ga0501067_0103285
1238 Ga0501067_0357923
1239 Ga0501068_0006687
1240 Ga0501068_0048594
1241 Ga0501068_0085219
1242 Ga0501068_0119788
1243 Ga0501068_0163213
1244 Ga0501068_0548107
1245 Ga0501068_0743338
1246 Ga0501068_1155283
1247 Ga0501069_0011957
1248 Ga0501069_0061850
1249 Ga0501069_0236160
1250 Ga0501070_0057065
1251 Ga0501070_0140787
1252 Ga0501070_0155781
1253 Ga0501070_0301702
1254 Ga0501070_0405620
1255 Ga0501070_0649655
1256 Ga0501071_0003674
1257 Ga0501071_0007173
1258 Ga0501071_0010752
1259 Ga0501071_0028753
1260 Ga0501071_0043245
1261 Ga0501071_0048882
1262 Ga0501071_0084694
1263 Ga0501071_0130004
1264 Ga0501071_0148244
1265 Ga0501071_0172788
1266 Ga0501071_0999335
1267 Ga0501071_1234429
1268 Ga0501072_0004339
1269 Ga0501072_0006189
1270 Ga0501072_0008619
1271 Ga0501072_0008950
1272 Ga0501072_0015718
1273 Ga0501072_0024631
1274 Ga0501072_0075050
1275 Ga0501072_0086472
1276 Ga0501072_0117369
1277 Ga0501072_0142466
1278 Ga0501072_0156477
1279 Ga0501072_0446862
1280 Ga0501072_0804266
1281 Ga0501072_0923382
1282 Ga0501072_1040290
1283 Ga0501073_0013887
1284 Ga0501073_0920518
1285 Ga0501074_0009316
1286 Ga0501074_0012090
1287 Ga0501074_0034293
1288 Ga0501074_0104696
1289 Ga0501074_0176388
1290 Ga0501074_0222454
1291 Ga0501074_0370326
1292 Ga0501074_0372409
1293 Ga0501074_0489885
1294 Ga0501075_0011836
1295 Ga0501075_0021163
1296 Ga0501075_0023092
1297 Ga0501075_0047329
1298 Ga0501075_0077028
1299 Ga0501075_0078996
1300 Ga0501075_0134879
1301 Ga0501075_0156201
1302 Ga0501075_0161849
1303 Ga0501075_0168256
1304 Ga0501075_0430535
1305 Ga0501075_0867590
1306 Ga0501076_0004054
1307 Ga0501076_0006049
1308 Ga0501076_0010222
1309 Ga0501076_0011417
1310 Ga0501076_0032725
1311 Ga0501076_0036845
1312 Ga0501076_0064673
1313 Ga0501076_0184050
1314 Ga0501076_0192769
1315 Ga0501076_0287603
1316 Ga0501076_0383027
1317 Ga0501076_0414992
1318 Ga0501076_0722879
1319 Ga0501077_0001526
1320 Ga0501077_0016021
1321 Ga0501077_0058658
1322 Ga0501077_0070556
1323 Ga0501077_0070995
1324 Ga0501077_0085885
1325 Ga0501077_0107351
1326 Ga0501077_0182309
1327 Ga0501077_0219917
1328 Ga0501079_0002334
1329 Ga0501079_0006783
1330 Ga0501079_0011085
1331 Ga0501079_0051493
1332 Ga0501079_0057630
1333 Ga0501079_0141375
1334 Ga0501079_0153164
1335 Ga0501079_0230208
1336 Ga0501079_0376088
1337 Ga0501079_0425112
1338 Ga0501080_0004741
1339 Ga0501080_0012395
1340 Ga0501080_0028501
1341 Ga0501080_0187489
1342 Ga0501080_0199210
1343 Ga0501080_0891763
1344 Ga0501081_0000702
1345 Ga0501081_0005627
1346 Ga0501081_0009944
1347 Ga0501081_0015059
1348 Ga0501081_0030099
1349 Ga0501081_0068527
1350 Ga0501081_0086006
1351 Ga0501081_0228520
1352 Ga0501081_0245223
1353 Ga0501081_0301216
1354 Ga0501081_0527893
1355 Ga0501081_0911999
1356 Ga0501083_0012150
1357 Ga0501083_0081167
1358 Ga0501083_0149430
1359 Ga0501035_0003872
1360 Ga0501035_0046652
1361 Ga0501044_0084927
1362 Ga0501044_0278462
1363 Ga0501044_0759767
1364 Ga0501044_1073637
1365 Ga0501045_0003901
1366 Ga0501045_0004200
1367 Ga0501045_0005551
1368 Ga0501045_0010341
1369 Ga0501045_0088541
1370 Ga0501045_0092989
1371 Ga0501045_0259070
1372 Ga0501045_0567843
1373 Ga0501045_0879463
1374 Ga0501045_0951626
1375 Ga0501045_0971352
1376 nmdc:mga03683_280742_c1
1377 nmdc:mga03n38_338483_c1
1378 nmdc:mga03n38_469375_c1
1379 nmdc:mga03n38_54923_c1
1380 nmdc:mga00v17_153179_c1
1381 nmdc:mga00v17_318119_c1
1382 nmdc:mga00v17_3280_c1
1383 nmdc:mga00v17_583170_c1
1384 nmdc:mga00v17_90230_c1
1385 nmdc:mga0yw44_228418_c1
1386 nmdc:mga0yw44_42798_c1
1387 nmdc:mga0yw44_62615_c1
1388 nmdc:mga0yw44_65244_c1
1389 nmdc:mga0yw44_702040_c1
1390 nmdc:mga06z11_312063_c1
1391 nmdc:mga06z11_3801_c1
1392 nmdc:mga06z11_51551_c1
1393 nmdc:mga06z11_53742_c1
1394 nmdc:mga04h51_165261_c1
1395 nmdc:mga04h51_258143_c1
1396 nmdc:mga04h51_329238_c1
1397 nmdc:mga05p37_1335043_c1
1398 nmdc:mga05p37_821865_c1
1399 nmdc:mga05p37_880453_c1
1400 nmdc:mga09592_1045264_c1
1401 nmdc:mga09592_426853_c1
1402 nmdc:mga09592_909113_c1
1403 nmdc:mga0qj67_179264_c1
1404 nmdc:mga08y16_1293604_c1
1405 nmdc:mga0n895_473951_c1
1406 nmdc:mga0rr50_499622_c1
1407 Ga0495601_0074672
1408 Ga0495601_0189397
1409 Ga0495612_0199875
1410 Ga0495612_0231789
1411 Ga0495612_0459321
1412 Ga0500635_0077839
1413 Ga0495655_0007225
1414 Ga0495655_0072683
1415 Ga0495595_0003693
1416 Ga0495595_0284152
1417 Ga0495595_0705410
1418 Ga0495619_0047297
1419 Ga0495619_0079511
1420 Ga0495619_0251134
1421 Ga0495619_0315015
1422 Ga0495619_0967219
1423 Ga0500646_0149339
1424 Ga0500566_0076821
1425 Ga0500660_022531
1426 Ga0500553_176646
1427 Ga0500569_008855
1428 Ga0500593_194193
1429 Ga0500614_119960
1430 Ga0500568_0000389
1431 Ga0500573_0141891
1432 Ga0500577_0122415
1433 Ga0500579_115325
1434 Ga0500600_0045429
1435 Ga0500603_193238
1436 Ga0500616_0191240
1437 Ga0500616_0191886
1438 Ga0500634_0260735
1439 Ga0501084_0000577
1440 Ga0501084_0000970
1441 Ga0501084_0029885
1442 Ga0501084_0047742
1443 Ga0501084_0119169
1444 Ga0501084_0223357
1445 Ga0501084_0263111
1446 Ga0501084_0428978
1447 Ga0501084_0445752
1448 Ga0501084_0517297
1449 Ga0501084_1113113
1450 Ga0501082_0012107
1451 Ga0501082_0043410
1452 Ga0501082_0066585
1453 Ga0501082_0078206
1454 Ga0501082_0085285
1455 Ga0501082_0086198
1456 Ga0501082_0105787
1457 Ga0501082_0357651
1458 Ga0501082_0425013
1459 Ga0501082_0723354
1460 Ga0501082_0737354
1461 Ga0501082_0893859
1462 Ga0501082_1046946
1463 Ga0501082_1476016
1464 Ga0530510_0004811
1465 Ga0530510_0016132
1466 Ga0530510_0019264
1467 Ga0530510_0049683
1468 Ga0530510_0060708
1469 Ga0530510_0078925
1470 Ga0530510_0211077
1471 Ga0530510_0452797
1472 Ga0530510_0575201
1473 Ga0530510_0711617
1474 Ga0530510_0722161
1475 2585318355
1476 2616699841
1477 2954007593
1478 2954382579
1479 2954696555
1480 2990065682

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03259

Robl_LC7

Roadblock/LC7 domain

25

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kye-assembly2.cif.gz_C crystal structure of roadblock/lc7 domain from streptomyces avermitilis 0.9333 13 109
7f8m-assembly3.cif.gz_F roadblock from thorarchaeota smtz1-45 0.904 9 111
7yh1-assembly2.cif.gz_C roadblock from candidatus prometheoarchaeum syntrophicum strain mk-d1 0.8971 9 107
3t1r-assembly2.cif.gz_C mglb with tetrameric arrangement 0.8836 1 110
1j3w-assembly1.cif.gz_B structure of gliding protein-mglb from thermus thermophilus hb8 0.8568 1 110
ID Description Score Start End Superfamily
af_O50393_7_130_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.9501 11 109 3.30.450.30
af_Q58736_1_114_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.9146 11 111 3.30.450.30
3kyeD00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8897 11 111 3.30.450.30
3t1rC00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8836 1 110 3.30.450.30
af_Q54DY3_5_86_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8342 23 85 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A2G6DT07-F1-model_v4 Dynein regulation protein LC7 0.9671 7 121
AF-A0A1Q9P609-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.953 5 110 GO:0005085
GO:0032008
GO:0060090
AF-A0A7X6D3J9-F1-model_v4 Roadblock/LC7 domain-containing protein 0.9526 4 122
AF-A0A662HNR7-F1-model_v4 Roadblock/LAMTOR2 domain-containing protein 0.9517 6 113
AF-G0FLQ2-F1-model_v4 deleted 0.9502 8 111

Map