F478539
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 293 | 1480 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_070898|Ga0400483_070898_388_852 |
| Length | 154 |
| Sequence | MSSLSDPTGNGISNATSLSSEADNVNWLVNNFVEQVPGVSEAVVVSSDGLPIAASQGLDRDSVDRFSAVASGLIGLSYGAAGRFGGGAVTEVIVEMEHAFLFVTGISDGSLLAVVADESADIGLVGYEMAVLVDKAGEALTPELRAELQAALPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 56 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 110 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 125 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 126 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 127 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 130 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 133 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 138 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 144 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 145 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 148 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 149 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 150 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 151 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 267 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 271 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 272 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 273 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 274 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 275 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 276 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 277 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 278 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 279 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 281 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 282 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 288 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 289 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 290 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 291 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 292 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 293 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.65 |
| Nodule | 0 |
| Rhizoplane | 5.27 |
| Rhizosphere | 82.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400483_070898 | 3300039062 | Bacteria | 4420 |
| 2 | Ga0065715_10347406 | 3300005293 | Unclassified | 957 |
| 3 | Ga0070670_100527227 | 3300005331 | Bacteria | 1052 |
| 4 | Ga0070670_101833080 | 3300005331 | Unclassified | 558 |
| 5 | Ga0070682_100445538 | 3300005337 | Bacteria | 990 |
| 6 | Ga0070682_100847086 | 3300005337 | Unclassified | 747 |
| 7 | Ga0070689_100790144 | 3300005340 | Bacteria | 834 |
| 8 | Ga0070687_100679114 | 3300005343 | Bacteria | 717 |
| 9 | Ga0070668_100441662 | 3300005347 | Bacteria | 1117 |
| 10 | Ga0070668_100476806 | 3300005347 | Unclassified | 1077 |
| 11 | Ga0070668_101140132 | 3300005347 | Unclassified | 705 |
| 12 | Ga0070668_101173792 | 3300005347 | Bacteria | 695 |
| 13 | Ga0070675_100104873 | 3300005354 | Bacteria | 2385 |
| 14 | Ga0070671_101105341 | 3300005355 | Bacteria | 696 |
| 15 | Ga0070674_101171852 | 3300005356 | Bacteria | 681 |
| 16 | Ga0070673_100745084 | 3300005364 | Unclassified | 902 |
| 17 | Ga0070713_100094000 | 3300005436 | Bacteria | 2584 |
| 18 | Ga0070713_100525034 | 3300005436 | Bacteria | 1119 |
| 19 | Ga0070710_10006578 | 3300005437 | Bacteria | 5588 |
| 20 | Ga0070705_101204266 | 3300005440 | Bacteria | 624 |
| 21 | Ga0070708_100771362 | 3300005445 | Bacteria | 904 |
| 22 | Ga0070678_100061449 | 3300005456 | Bacteria | 2769 |
| 23 | Ga0070678_100547428 | 3300005456 | Bacteria | 1027 |
| 24 | Ga0070678_100864251 | 3300005456 | Bacteria | 825 |
| 25 | Ga0070678_100947588 | 3300005456 | Unclassified | 789 |
| 26 | Ga0070678_101183506 | 3300005456 | Bacteria | 708 |
| 27 | Ga0070679_101141520 | 3300005530 | Unclassified | 724 |
| 28 | Ga0070684_100437921 | 3300005535 | Bacteria | 1207 |
| 29 | Ga0070672_100077884 | 3300005543 | Bacteria | 2652 |
| 30 | Ga0070672_100316840 | 3300005543 | Bacteria | 1325 |
| 31 | Ga0070672_100844539 | 3300005543 | Bacteria | 807 |
| 32 | Ga0070696_100578435 | 3300005546 | Bacteria | 903 |
| 33 | Ga0070696_100955804 | 3300005546 | Bacteria | 713 |
| 34 | Ga0070693_100585887 | 3300005547 | Bacteria | 803 |
| 35 | Ga0070665_100429488 | 3300005548 | Bacteria | 1330 |
| 36 | Ga0070704_101000214 | 3300005549 | Bacteria | 756 |
| 37 | Ga0070702_100574403 | 3300005615 | Bacteria | 841 |
| 38 | Ga0070702_101239244 | 3300005615 | Bacteria | 603 |
| 39 | Ga0068861_100144373 | 3300005719 | Bacteria | 1946 |
| 40 | Ga0068861_100177583 | 3300005719 | Bacteria | 1770 |
| 41 | Ga0068861_100896152 | 3300005719 | Bacteria | 840 |
| 42 | Ga0068863_100106149 | 3300005841 | Bacteria | 2672 |
| 43 | Ga0068858_100407235 | 3300005842 | Bacteria | 1307 |
| 44 | Ga0068860_100726128 | 3300005843 | Bacteria | 1004 |
| 45 | Ga0081455_10108156 | 3300005937 | Bacteria | 2215 |
| 46 | Ga0081455_10416033 | 3300005937 | Bacteria | 928 |
| 47 | Ga0081455_10434644 | 3300005937 | Bacteria | 901 |
| 48 | Ga0081539_10030945 | 3300005985 | Bacteria | 3309 |
| 49 | Ga0075365_10065937 | 3300006038 | Bacteria | 2428 |
| 50 | Ga0075365_10329836 | 3300006038 | Bacteria | 1075 |
| 51 | Ga0075365_10338314 | 3300006038 | Bacteria | 1060 |
| 52 | Ga0075365_10394832 | 3300006038 | Bacteria | 976 |
| 53 | Ga0075365_10404601 | 3300006038 | Bacteria | 963 |
| 54 | Ga0075365_10652522 | 3300006038 | Bacteria | 744 |
| 55 | Ga0075365_11024953 | 3300006038 | Bacteria | 581 |
| 56 | Ga0075368_10069224 | 3300006042 | Bacteria | 1423 |
| 57 | Ga0075368_10367819 | 3300006042 | Bacteria | 628 |
| 58 | Ga0075363_100193951 | 3300006048 | Bacteria | 1159 |
| 59 | Ga0075363_100299463 | 3300006048 | Bacteria | 933 |
| 60 | Ga0075364_10008974 | 3300006051 | Bacteria | 5987 |
| 61 | Ga0075364_10032317 | 3300006051 | Bacteria | 3363 |
| 62 | Ga0075364_10190900 | 3300006051 | Bacteria | 1387 |
| 63 | Ga0075364_10257350 | 3300006051 | Bacteria | 1186 |
| 64 | Ga0075364_10677977 | 3300006051 | Unclassified | 704 |
| 65 | Ga0075362_10314274 | 3300006177 | Bacteria | 779 |
| 66 | Ga0075367_10078024 | 3300006178 | Bacteria | 2000 |
| 67 | Ga0075367_10229036 | 3300006178 | Bacteria | 1164 |
| 68 | Ga0075367_10329515 | 3300006178 | Unclassified | 962 |
| 69 | Ga0075367_10355877 | 3300006178 | Bacteria | 924 |
| 70 | Ga0075367_10726875 | 3300006178 | Bacteria | 632 |
| 71 | Ga0075366_10725598 | 3300006195 | Bacteria | 617 |
| 72 | Ga0097621_100373654 | 3300006237 | Bacteria | 1272 |
| 73 | Ga0068871_100460263 | 3300006358 | Bacteria | 1141 |
| 74 | Ga0075430_100149449 | 3300006846 | Bacteria | 1945 |
| 75 | Ga0075430_100607389 | 3300006846 | Bacteria | 902 |
| 76 | Ga0075431_101324245 | 3300006847 | Bacteria | 681 |
| 77 | Ga0075434_100321769 | 3300006871 | Bacteria | 1567 |
| 78 | Ga0075429_100649939 | 3300006880 | Bacteria | 924 |
| 79 | Ga0075435_101024150 | 3300007076 | Unclassified | 721 |
| 80 | Ga0111539_10231934 | 3300009094 | Bacteria | 2149 |
| 81 | Ga0111539_11508343 | 3300009094 | Bacteria | 780 |
| 82 | Ga0105245_10045885 | 3300009098 | Bacteria | 3904 |
| 83 | Ga0105245_11661988 | 3300009098 | Bacteria | 691 |
| 84 | Ga0105247_10729041 | 3300009101 | Unclassified | 749 |
| 85 | Ga0114129_10210442 | 3300009147 | Bacteria | 2629 |
| 86 | Ga0114129_10769494 | 3300009147 | Bacteria | 1231 |
| 87 | Ga0114129_11249702 | 3300009147 | Unclassified | 923 |
| 88 | Ga0114129_11306077 | 3300009147 | Bacteria | 899 |
| 89 | Ga0105243_10178525 | 3300009148 | Bacteria | 1845 |
| 90 | Ga0105243_10328764 | 3300009148 | Bacteria | 1396 |
| 91 | Ga0105241_10039406 | 3300009174 | Bacteria | 3564 |
| 92 | Ga0105242_10099286 | 3300009176 | Bacteria | 2464 |
| 93 | Ga0105242_10269641 | 3300009176 | Bacteria | 1541 |
| 94 | Ga0105242_11518197 | 3300009176 | Bacteria | 701 |
| 95 | Ga0105242_11752319 | 3300009176 | Bacteria | 658 |
| 96 | Ga0105248_11282776 | 3300009177 | Unclassified | 828 |
| 97 | Ga0105238_11598544 | 3300009551 | Bacteria | 682 |
| 98 | Ga0105249_10318152 | 3300009553 | Bacteria | 1567 |
| 99 | Ga0105249_12042162 | 3300009553 | Bacteria | 646 |
| 100 | Ga0105030_112858 | 3300009987 | Unclassified | 729 |
| 101 | Ga0105028_120096 | 3300009993 | Bacteria | 722 |
| 102 | Ga0105239_10200717 | 3300010375 | Bacteria | 2234 |
| 103 | Ga0105239_10860386 | 3300010375 | Unclassified | 1040 |
| 104 | Ga0105239_13521519 | 3300010375 | Bacteria | 509 |
| 105 | Ga0105246_10210980 | 3300011119 | Bacteria | 1516 |
| 106 | Ga0105246_10867568 | 3300011119 | Bacteria | 807 |
| 107 | Ga0105246_12297440 | 3300011119 | Bacteria | 527 |
| 108 | Ga0157373_11324250 | 3300013100 | Unclassified | 546 |
| 109 | Ga0157374_10978549 | 3300013296 | Bacteria | 865 |
| 110 | Ga0157378_10176453 | 3300013297 | Bacteria | 2007 |
| 111 | Ga0157378_10439045 | 3300013297 | Bacteria | 1293 |
| 112 | Ga0157378_11738455 | 3300013297 | Bacteria | 671 |
| 113 | Ga0157378_11929878 | 3300013297 | Unclassified | 640 |
| 114 | Ga0163162_10543256 | 3300013306 | Bacteria | 1291 |
| 115 | Ga0163162_11548537 | 3300013306 | Bacteria | 756 |
| 116 | Ga0157372_12324102 | 3300013307 | Bacteria | 616 |
| 117 | Ga0157375_10260855 | 3300013308 | Bacteria | 1894 |
| 118 | Ga0157375_10522420 | 3300013308 | Bacteria | 1350 |
| 119 | Ga0163163_10080544 | 3300014325 | Bacteria | 3256 |
| 120 | Ga0163163_10879446 | 3300014325 | Bacteria | 959 |
| 121 | Ga0157380_10308254 | 3300014326 | Bacteria | 1462 |
| 122 | Ga0157380_10694227 | 3300014326 | Unclassified | 1022 |
| 123 | Ga0157380_11206079 | 3300014326 | Bacteria | 800 |
| 124 | Ga0157380_11843047 | 3300014326 | Bacteria | 665 |
| 125 | Ga0157377_10408859 | 3300014745 | Bacteria | 926 |
| 126 | Ga0157377_11431775 | 3300014745 | Bacteria | 546 |
| 127 | Ga0157379_10238539 | 3300014968 | Bacteria | 1649 |
| 128 | Ga0157379_11465477 | 3300014968 | Bacteria | 663 |
| 129 | Ga0157376_11595532 | 3300014969 | Bacteria | 687 |
| 130 | Ga0157376_12343488 | 3300014969 | Unclassified | 573 |
| 131 | Ga0163161_10167680 | 3300017792 | Bacteria | 1678 |
| 132 | Ga0213876_10002892 | 3300021384 | Bacteria | 9970 |
| 133 | Ga0207692_10022755 | 3300025898 | Bacteria | 2889 |
| 134 | Ga0207692_10255627 | 3300025898 | Bacteria | 1051 |
| 135 | Ga0207654_10294935 | 3300025911 | Bacteria | 1101 |
| 136 | Ga0207693_10068745 | 3300025915 | Bacteria | 2772 |
| 137 | Ga0207662_10564197 | 3300025918 | Bacteria | 789 |
| 138 | Ga0207681_10172182 | 3300025923 | Bacteria | 1642 |
| 139 | Ga0207681_10576298 | 3300025923 | Bacteria | 928 |
| 140 | Ga0207650_10410042 | 3300025925 | Bacteria | 1123 |
| 141 | Ga0207659_10330426 | 3300025926 | Bacteria | 1260 |
| 142 | Ga0207687_10198593 | 3300025927 | Bacteria | 1566 |
| 143 | Ga0207687_10721128 | 3300025927 | Bacteria | 847 |
| 144 | Ga0207700_10592659 | 3300025928 | Bacteria | 986 |
| 145 | Ga0207686_10119971 | 3300025934 | Bacteria | 1788 |
| 146 | Ga0207686_10594314 | 3300025934 | Bacteria | 870 |
| 147 | Ga0207709_10277930 | 3300025935 | Bacteria | 1235 |
| 148 | Ga0207709_10280519 | 3300025935 | Bacteria | 1230 |
| 149 | Ga0207669_10777685 | 3300025937 | Bacteria | 792 |
| 150 | Ga0207669_11870889 | 3300025937 | Bacteria | 513 |
| 151 | Ga0207665_11164874 | 3300025939 | Bacteria | 615 |
| 152 | Ga0207691_10084745 | 3300025940 | Bacteria | 2845 |
| 153 | Ga0207691_10288254 | 3300025940 | Bacteria | 1412 |
| 154 | Ga0207711_10737571 | 3300025941 | Bacteria | 918 |
| 155 | Ga0207661_11444898 | 3300025944 | Bacteria | 631 |
| 156 | Ga0207651_10732231 | 3300025960 | Unclassified | 873 |
| 157 | Ga0207712_10092521 | 3300025961 | Bacteria | 2229 |
| 158 | Ga0207712_11144257 | 3300025961 | Bacteria | 693 |
| 159 | Ga0207668_10050821 | 3300025972 | Bacteria | 2859 |
| 160 | Ga0207668_10749997 | 3300025972 | Bacteria | 861 |
| 161 | Ga0207668_11049152 | 3300025972 | Bacteria | 730 |
| 162 | Ga0207668_11240841 | 3300025972 | Unclassified | 670 |
| 163 | Ga0207703_10825789 | 3300026035 | Bacteria | 886 |
| 164 | Ga0207678_10642285 | 3300026067 | Bacteria | 932 |
| 165 | Ga0207678_11277482 | 3300026067 | Bacteria | 650 |
| 166 | Ga0207708_10506687 | 3300026075 | Bacteria | 1012 |
| 167 | Ga0207708_11654148 | 3300026075 | Bacteria | 562 |
| 168 | Ga0207648_11062489 | 3300026089 | Bacteria | 759 |
| 169 | Ga0207676_10518631 | 3300026095 | Bacteria | 1134 |
| 170 | Ga0207675_100302728 | 3300026118 | Bacteria | 1557 |
| 171 | Ga0207675_100307656 | 3300026118 | Bacteria | 1545 |
| 172 | Ga0207675_100522210 | 3300026118 | Bacteria | 1184 |
| 173 | Ga0207675_101226546 | 3300026118 | Bacteria | 770 |
| 174 | Ga0207683_10096827 | 3300026121 | Bacteria | 2631 |
| 175 | Ga0207683_10162756 | 3300026121 | Bacteria | 2018 |
| 176 | Ga0207683_10328685 | 3300026121 | Bacteria | 1401 |
| 177 | Ga0207683_10460364 | 3300026121 | Bacteria | 1173 |
| 178 | Ga0207683_10930336 | 3300026121 | Bacteria | 807 |
| 179 | Ga0207698_10936399 | 3300026142 | Bacteria | 875 |
| 180 | Ga0209813_10141382 | 3300027866 | Bacteria | 855 |
| 181 | Ga0209813_10190918 | 3300027866 | Bacteria | 754 |
| 182 | Ga0209813_10208594 | 3300027866 | Bacteria | 726 |
| 183 | Ga0209974_10053671 | 3300027876 | Bacteria | 1358 |
| 184 | Ga0268266_11253292 | 3300028379 | Bacteria | 717 |
| 185 | Ga0268265_10027687 | 3300028380 | Bacteria | 4049 |
| 186 | Ga0268265_11982248 | 3300028380 | Bacteria | 589 |
| 187 | Ga0268264_11019043 | 3300028381 | Bacteria | 835 |
| 188 | Ga0265336_10133424 | 3300028666 | Bacteria | 739 |
| 189 | Ga0307517_10046838 | 3300028786 | Bacteria | 4498 |
| 190 | Ga0265338_10015936 | 3300028800 | Bacteria | 8221 |
| 191 | Ga0265327_10007936 | 3300031251 | Bacteria | 8038 |
| 192 | Ga0265327_10013730 | 3300031251 | Bacteria | 5358 |
| 193 | Ga0265327_10080506 | 3300031251 | Bacteria | 1610 |
| 194 | Ga0265327_10128717 | 3300031251 | Bacteria | 1193 |
| 195 | Ga0307408_100926736 | 3300031548 | Bacteria | 799 |
| 196 | Ga0307508_10031427 | 3300031616 | Bacteria | 4798 |
| 197 | Ga0307508_10165589 | 3300031616 | Bacteria | 1814 |
| 198 | Ga0307508_10383492 | 3300031616 | Bacteria | 996 |
| 199 | Ga0316575_10048373 | 3300031665 | Bacteria | 1691 |
| 200 | Ga0316576_10076359 | 3300031727 | Bacteria | 2479 |
| 201 | Ga0316576_10170245 | 3300031727 | Bacteria | 1644 |
| 202 | Ga0316576_10264720 | 3300031727 | Bacteria | 1289 |
| 203 | Ga0316576_10648999 | 3300031727 | Bacteria | 768 |
| 204 | Ga0316578_10086816 | 3300031728 | Bacteria | 1865 |
| 205 | Ga0316578_10089879 | 3300031728 | Bacteria | 1833 |
| 206 | Ga0307516_10053112 | 3300031730 | Bacteria | 3964 |
| 207 | Ga0307516_10109081 | 3300031730 | Bacteria | 2574 |
| 208 | Ga0307405_10759771 | 3300031731 | Unclassified | 808 |
| 209 | Ga0316577_10291941 | 3300031733 | Bacteria | 923 |
| 210 | Ga0307413_10072580 | 3300031824 | Bacteria | 2173 |
| 211 | Ga0307410_10102100 | 3300031852 | Bacteria | 2057 |
| 212 | Ga0307412_10794241 | 3300031911 | Bacteria | 821 |
| 213 | Ga0307412_11003612 | 3300031911 | Bacteria | 738 |
| 214 | Ga0307412_11603822 | 3300031911 | Unclassified | 594 |
| 215 | Ga0307409_100032897 | 3300031995 | Bacteria | 3767 |
| 216 | Ga0307409_102240344 | 3300031995 | Bacteria | 576 |
| 217 | Ga0307409_102347522 | 3300031995 | Bacteria | 562 |
| 218 | Ga0307409_102571781 | 3300031995 | Bacteria | 538 |
| 219 | Ga0307416_100344301 | 3300032002 | Bacteria | 1505 |
| 220 | Ga0307416_100606555 | 3300032002 | Bacteria | 1175 |
| 221 | Ga0307414_10878173 | 3300032004 | Bacteria | 821 |
| 222 | Ga0307411_11590124 | 3300032005 | Bacteria | 603 |
| 223 | Ga0307415_100433623 | 3300032126 | Bacteria | 1131 |
| 224 | Ga0307415_100761857 | 3300032126 | Bacteria | 880 |
| 225 | Ga0307415_101524643 | 3300032126 | Bacteria | 640 |
| 226 | Ga0307415_102405703 | 3300032126 | Bacteria | 518 |
| 227 | Ga0307507_10579739 | 3300033179 | Bacteria | 584 |
| 228 | Ga0307510_10185132 | 3300033180 | Bacteria | 1639 |
| 229 | Ga0373948_0056806 | 3300034817 | Bacteria | 852 |
| 230 | Ga0373945_0303636 | 3300035116 | Bacteria | 684 |
| 231 | Ga0373955_0089974 | 3300035172 | Bacteria | 1748 |
| 232 | Ga0316574_0001032 | 3300035398 | Bacteria | 12623 |
| 233 | Ga0316574_0161989 | 3300035398 | Unclassified | 1440 |
| 234 | Ga0316574_0206795 | 3300035398 | Bacteria | 1260 |
| 235 | Ga0373931_0008215 | 3300035691 | Bacteria | 4945 |
| 236 | Ga0373931_0227919 | 3300035691 | Bacteria | 1125 |
| 237 | Ga0373931_0805489 | 3300035691 | Bacteria | 626 |
| 238 | Ga0373937_0183996 | 3300036401 | Bacteria | 1962 |
| 239 | Ga0373937_0807976 | 3300036401 | Unclassified | 886 |
| 240 | Ga0373937_0948875 | 3300036401 | Bacteria | 809 |
| 241 | Ga0316582_0134621 | 3300036647 | Bacteria | 1662 |
| 242 | Ga0316584_0003967 | 3300036712 | Bacteria | 9733 |
| 243 | Ga0316584_0025264 | 3300036712 | Bacteria | 4355 |
| 244 | Ga0316584_0247887 | 3300036712 | Bacteria | 1302 |
| 245 | Ga0395905_0120613 | 3300037471 | Bacteria | 2465 |
| 246 | Ga0400485_14901 | 3300038735 | Bacteria | 3890 |
| 247 | Ga0400483_027223 | 3300039062 | Bacteria | 80217 |
| 248 | Ga0400483_076252 | 3300039062 | Bacteria | 5181 |
| 249 | Ga0400483_076253 | 3300039062 | Bacteria | 4791 |
| 250 | Ga0400483_101414 | 3300039062 | Bacteria | 5842 |
| 251 | Ga0400483_122014 | 3300039062 | Bacteria | 18056 |
| 252 | Ga0400483_189648 | 3300039062 | Bacteria | 1078 |
| 253 | Ga0400483_223286 | 3300039062 | Bacteria | 31435 |
| 254 | Ga0400483_257462 | 3300039062 | Bacteria | 8613 |
| 255 | Ga0436365_0345456 | 3300039437 | Bacteria | 8513 |
| 256 | Ga0439461_0047190 | 3300041410 | Bacteria | 946 |
| 257 | Ga0451789_0535420 | 3300041443 | Bacteria | 1501 |
| 258 | Ga0451791_0895493 | 3300041451 | Bacteria | 529 |
| 259 | Ga0451797_1462242 | 3300041453 | Bacteria | 724 |
| 260 | Ga0451802_0139828 | 3300041460 | Bacteria | 990 |
| 261 | Ga0451807_1951674 | 3300041486 | Bacteria | 573 |
| 262 | Ga0451807_2556943 | 3300041486 | Bacteria | 515 |
| 263 | Ga0451833_0602750 | 3300041491 | Bacteria | 1304 |
| 264 | Ga0451837_1635401 | 3300041494 | Bacteria | 1089 |
| 265 | Ga0451841_0650166 | 3300041498 | Bacteria | 629 |
| 266 | Ga0451841_0829097 | 3300041498 | Bacteria | 656 |
| 267 | Ga0451853_3008136 | 3300041512 | Unclassified | 568 |
| 268 | Ga0451853_3483290 | 3300041512 | Bacteria | 1424 |
| 269 | Ga0439431_0094080 | 3300041997 | Bacteria | 819 |
| 270 | Ga0439431_0173568 | 3300041997 | Unclassified | 620 |
| 271 | Ga0439434_0195660 | 3300042435 | Bacteria | 680 |
| 272 | Ga0439434_0329350 | 3300042435 | Unclassified | 531 |
| 273 | Ga0450918_035675 | 3300042531 | Bacteria | 885 |
| 274 | Ga0439440_0075949 | 3300042993 | Bacteria | 882 |
| 275 | Ga0495627_053848 | 3300046453 | Bacteria | 1204 |
| 276 | Ga0495592_0040002 | 3300046454 | Bacteria | 3519 |
| 277 | Ga0495603_0301826 | 3300046455 | Bacteria | 920 |
| 278 | Ga0495603_0865579 | 3300046455 | Bacteria | 514 |
| 279 | Ga0495629_0252354 | 3300046459 | Bacteria | 1214 |
| 280 | Ga0495629_0814772 | 3300046459 | Bacteria | 615 |
| 281 | Ga0495638_0428739 | 3300046460 | Bacteria | 680 |
| 282 | Ga0495641_0076124 | 3300046461 | Bacteria | 1504 |
| 283 | Ga0495641_0180556 | 3300046461 | Unclassified | 945 |
| 284 | Ga0495641_0337338 | 3300046461 | Bacteria | 681 |
| 285 | Ga0495641_0390850 | 3300046461 | Bacteria | 631 |
| 286 | Ga0495641_0454399 | 3300046461 | Bacteria | 583 |
| 287 | Ga0495641_0555845 | 3300046461 | Bacteria | 524 |
| 288 | Ga0495651_0009275 | 3300046462 | Bacteria | 7550 |
| 289 | Ga0495651_0064759 | 3300046462 | Bacteria | 2793 |
| 290 | Ga0495653_0018356 | 3300046463 | Bacteria | 5682 |
| 291 | Ga0495653_0245842 | 3300046463 | Bacteria | 1190 |
| 292 | Ga0495653_0510635 | 3300046463 | Bacteria | 748 |
| 293 | Ga0495662_0132242 | 3300046476 | Bacteria | 1227 |
| 294 | Ga0495594_0127849 | 3300046499 | Bacteria | 1438 |
| 295 | Ga0495594_0836588 | 3300046499 | Bacteria | 518 |
| 296 | Ga0495608_0011546 | 3300046511 | Bacteria | 6145 |
| 297 | Ga0495608_0215939 | 3300046511 | Bacteria | 1205 |
| 298 | Ga0495618_0043582 | 3300046514 | Bacteria | 2830 |
| 299 | Ga0495628_0007427 | 3300046516 | Bacteria | 9488 |
| 300 | Ga0495628_0200213 | 3300046516 | Bacteria | 1505 |
| 301 | Ga0495630_0568594 | 3300046517 | Unclassified | 869 |
| 302 | Ga0495630_0579214 | 3300046517 | Unclassified | 860 |
| 303 | Ga0495630_0808093 | 3300046517 | Bacteria | 716 |
| 304 | Ga0495643_0003841 | 3300046522 | Bacteria | 10824 |
| 305 | Ga0495644_0232908 | 3300046523 | Bacteria | 713 |
| 306 | Ga0495642_0284142 | 3300046528 | Bacteria | 724 |
| 307 | Ga0495652_0021219 | 3300046529 | Bacteria | 5774 |
| 308 | Ga0495652_0527419 | 3300046529 | Bacteria | 815 |
| 309 | Ga0495640_0001549 | 3300046533 | Bacteria | 18108 |
| 310 | Ga0495586_0084056 | 3300046535 | Bacteria | 1752 |
| 311 | Ga0495586_0593714 | 3300046535 | Bacteria | 640 |
| 312 | Ga0495645_0504650 | 3300046543 | Bacteria | 756 |
| 313 | Ga0495622_0088601 | 3300046557 | Bacteria | 1422 |
| 314 | Ga0495667_0058148 | 3300046559 | Bacteria | 2540 |
| 315 | Ga0495667_0275985 | 3300046559 | Bacteria | 1067 |
| 316 | Ga0495667_0526270 | 3300046559 | Bacteria | 740 |
| 317 | Ga0495634_0183181 | 3300046642 | Bacteria | 1310 |
| 318 | Ga0495611_0084399 | 3300046648 | Bacteria | 1464 |
| 319 | Ga0495635_0052229 | 3300046663 | Bacteria | 2816 |
| 320 | Ga0495635_0355198 | 3300046663 | Bacteria | 977 |
| 321 | Ga0495657_0021092 | 3300046675 | Bacteria | 4678 |
| 322 | Ga0495657_0022839 | 3300046675 | Bacteria | 4475 |
| 323 | Ga0495657_0395178 | 3300046675 | Bacteria | 814 |
| 324 | Ga0495657_0568717 | 3300046675 | Bacteria | 657 |
| 325 | Ga0495599_0202272 | 3300046678 | Bacteria | 1220 |
| 326 | Ga0495599_0335678 | 3300046678 | Bacteria | 908 |
| 327 | Ga0495623_0040318 | 3300046679 | Bacteria | 2982 |
| 328 | Ga0495623_0047594 | 3300046679 | Bacteria | 2722 |
| 329 | Ga0495647_0198064 | 3300046681 | Bacteria | 880 |
| 330 | Ga0495658_0044638 | 3300046683 | Bacteria | 2484 |
| 331 | Ga0495658_0191103 | 3300046683 | Bacteria | 1273 |
| 332 | Ga0495658_0288295 | 3300046683 | Bacteria | 1037 |
| 333 | Ga0495658_0409350 | 3300046683 | Bacteria | 865 |
| 334 | Ga0495658_0564159 | 3300046683 | Bacteria | 729 |
| 335 | Ga0495613_0294904 | 3300046689 | Bacteria | 1123 |
| 336 | Ga0495613_0570065 | 3300046689 | Bacteria | 756 |
| 337 | Ga0495613_0744211 | 3300046689 | Bacteria | 643 |
| 338 | Ga0495589_0482712 | 3300046794 | Bacteria | 566 |
| 339 | Ga0495600_0127551 | 3300046809 | Bacteria | 1654 |
| 340 | Ga0495600_0152391 | 3300046809 | Bacteria | 1496 |
| 341 | Ga0495600_0716299 | 3300046809 | Bacteria | 601 |
| 342 | Ga0495604_0002739 | 3300047317 | Bacteria | 14139 |
| 343 | Ga0495604_0048247 | 3300047317 | Bacteria | 3313 |
| 344 | Ga0495636_0027753 | 3300047318 | Bacteria | 2306 |
| 345 | Ga0495674_0686319 | 3300047319 | Bacteria | 805 |
| 346 | Ga0495672_0005262 | 3300047320 | Bacteria | 10307 |
| 347 | Ga0495672_0148464 | 3300047320 | Bacteria | 1218 |
| 348 | Ga0495676_0062246 | 3300047321 | Bacteria | 2914 |
| 349 | Ga0495676_0258166 | 3300047321 | Bacteria | 1186 |
| 350 | Ga0495676_0506287 | 3300047321 | Archaea | 792 |
| 351 | Ga0495680_0016053 | 3300047322 | Bacteria | 6440 |
| 352 | Ga0495680_0022063 | 3300047322 | Bacteria | 5317 |
| 353 | Ga0495680_0213324 | 3300047322 | Bacteria | 1381 |
| 354 | Ga0495687_054210 | 3300047443 | Bacteria | 1684 |
| 355 | Ga0495687_179345 | 3300047443 | Bacteria | 693 |
| 356 | Ga0495675_0057258 | 3300047444 | Bacteria | 2471 |
| 357 | Ga0495675_0137635 | 3300047444 | Bacteria | 1515 |
| 358 | Ga0495679_016168 | 3300047446 | Bacteria | 2706 |
| 359 | Ga0495685_001048 | 3300047447 | Bacteria | 8432 |
| 360 | Ga0495685_018158 | 3300047447 | Bacteria | 2412 |
| 361 | Ga0495673_0231255 | 3300047469 | Bacteria | 681 |
| 362 | Ga0495681_0004904 | 3300047470 | Bacteria | 9043 |
| 363 | Ga0495684_0092775 | 3300047471 | Bacteria | 2287 |
| 364 | Ga0495684_0290828 | 3300047471 | Bacteria | 1176 |
| 365 | Ga0495686_0049809 | 3300047472 | Bacteria | 2634 |
| 366 | Ga0495593_0008434 | 3300047673 | Bacteria | 5993 |
| 367 | Ga0495593_0236215 | 3300047673 | Bacteria | 916 |
| 368 | Ga0495602_0033132 | 3300048088 | Bacteria | 4852 |
| 369 | Ga0495602_0147502 | 3300048088 | Bacteria | 1854 |
| 370 | Ga0495614_0413893 | 3300048089 | Bacteria | 635 |
| 371 | Ga0495615_0266231 | 3300048090 | Bacteria | 547 |
| 372 | Ga0496100_0408023 | 3300048903 | Bacteria | 1036 |
| 373 | Ga0496100_0789728 | 3300048903 | Bacteria | 744 |
| 374 | Ga0496100_0824448 | 3300048903 | Bacteria | 727 |
| 375 | Ga0496101_0009938 | 3300048904 | Bacteria | 6270 |
| 376 | Ga0496101_0274604 | 3300048904 | Bacteria | 1316 |
| 377 | Ga0496101_1360619 | 3300048904 | Bacteria | 554 |
| 378 | Ga0496102_0036149 | 3300048905 | Bacteria | 4449 |
| 379 | Ga0496102_0329857 | 3300048905 | Bacteria | 1437 |
| 380 | Ga0496103_0987171 | 3300048906 | Bacteria | 525 |
| 381 | Ga0496104_0010012 | 3300048907 | Bacteria | 8462 |
| 382 | Ga0496104_0011936 | 3300048907 | Bacteria | 7793 |
| 383 | Ga0496104_0080597 | 3300048907 | Bacteria | 3104 |
| 384 | Ga0496104_0342070 | 3300048907 | Bacteria | 1409 |
| 385 | Ga0496104_1477145 | 3300048907 | Bacteria | 583 |
| 386 | Ga0496105_0034238 | 3300048908 | Bacteria | 4176 |
| 387 | Ga0496105_0047910 | 3300048908 | Bacteria | 3527 |
| 388 | Ga0496105_0321293 | 3300048908 | Bacteria | 1240 |
| 389 | Ga0496106_0087323 | 3300048909 | Bacteria | 2403 |
| 390 | Ga0496107_0204125 | 3300048910 | Bacteria | 1469 |
| 391 | Ga0496108_0419048 | 3300048911 | Bacteria | 1169 |
| 392 | Ga0496108_1401997 | 3300048911 | Bacteria | 584 |
| 393 | Ga0496109_0569282 | 3300048912 | Bacteria | 1068 |
| 394 | Ga0496109_0582132 | 3300048912 | Bacteria | 1055 |
| 395 | Ga0496109_0808722 | 3300048912 | Bacteria | 875 |
| 396 | Ga0496110_1531956 | 3300048913 | Bacteria | 576 |
| 397 | Ga0496111_0336285 | 3300048914 | Unclassified | 1118 |
| 398 | Ga0496111_0433381 | 3300048914 | Bacteria | 971 |
| 399 | Ga0496112_0470500 | 3300048915 | Bacteria | 1194 |
| 400 | Ga0496113_0796305 | 3300048916 | Bacteria | 751 |
| 401 | Ga0496114_0047992 | 3300048917 | Bacteria | 3551 |
| 402 | Ga0496114_0087403 | 3300048917 | Bacteria | 2643 |
| 403 | Ga0496114_1602040 | 3300048917 | Bacteria | 539 |
| 404 | Ga0496115_0000992 | 3300048918 | Bacteria | 20551 |
| 405 | Ga0501031_0016355 | 3300049568 | Bacteria | 4817 |
| 406 | Ga0501031_0073806 | 3300049568 | Unclassified | 2221 |
| 407 | Ga0501031_0183681 | 3300049568 | Bacteria | 1366 |
| 408 | Ga0501031_0281580 | 3300049568 | Bacteria | 1078 |
| 409 | Ga0501031_0427407 | 3300049568 | Bacteria | 856 |
| 410 | Ga0501031_0581499 | 3300049568 | Bacteria | 721 |
| 411 | Ga0501032_0061730 | 3300049569 | Bacteria | 2512 |
| 412 | Ga0501032_0157163 | 3300049569 | Bacteria | 1493 |
| 413 | Ga0501032_0230385 | 3300049569 | Unclassified | 1205 |
| 414 | Ga0501032_0280320 | 3300049569 | Bacteria | 1079 |
| 415 | Ga0501033_0046148 | 3300049570 | Bacteria | 3240 |
| 416 | Ga0501033_0400992 | 3300049570 | Bacteria | 957 |
| 417 | Ga0501033_0740614 | 3300049570 | Bacteria | 667 |
| 418 | Ga0501033_0908090 | 3300049570 | Bacteria | 592 |
| 419 | Ga0501034_0000570 | 3300049571 | Bacteria | 58453 |
| 420 | Ga0501034_0015695 | 3300049571 | Bacteria | 7780 |
| 421 | Ga0501034_0026256 | 3300049571 | Bacteria | 5932 |
| 422 | Ga0501034_0065553 | 3300049571 | Bacteria | 3645 |
| 423 | Ga0501034_0098626 | 3300049571 | Bacteria | 2917 |
| 424 | Ga0501034_0193626 | 3300049571 | Bacteria | 1994 |
| 425 | Ga0501034_0313743 | 3300049571 | Bacteria | 1502 |
| 426 | Ga0501034_0535281 | 3300049571 | Bacteria | 1082 |
| 427 | Ga0501034_0798869 | 3300049571 | Bacteria | 836 |
| 428 | Ga0501036_0002556 | 3300049572 | Bacteria | 14308 |
| 429 | Ga0501036_0002702 | 3300049572 | Bacteria | 14004 |
| 430 | Ga0501036_0009930 | 3300049572 | Bacteria | 7837 |
| 431 | Ga0501036_0010212 | 3300049572 | Bacteria | 7739 |
| 432 | Ga0501036_0090468 | 3300049572 | Bacteria | 2585 |
| 433 | Ga0501036_0103767 | 3300049572 | Bacteria | 2404 |
| 434 | Ga0501036_0134495 | 3300049572 | Bacteria | 2087 |
| 435 | Ga0501036_0902318 | 3300049572 | Unclassified | 725 |
| 436 | Ga0501036_1495820 | 3300049572 | Bacteria | 546 |
| 437 | Ga0501037_0063859 | 3300049573 | Bacteria | 2684 |
| 438 | Ga0501037_0115498 | 3300049573 | Bacteria | 1932 |
| 439 | Ga0501037_0137855 | 3300049573 | Bacteria | 1747 |
| 440 | Ga0501037_1004449 | 3300049573 | Unclassified | 543 |
| 441 | Ga0501038_0026699 | 3300049574 | Bacteria | 5141 |
| 442 | Ga0501038_0102367 | 3300049574 | Bacteria | 2383 |
| 443 | Ga0501038_0302731 | 3300049574 | Bacteria | 1254 |
| 444 | Ga0501038_0358679 | 3300049574 | Bacteria | 1134 |
| 445 | Ga0501038_0774949 | 3300049574 | Unclassified | 714 |
| 446 | Ga0501038_0963770 | 3300049574 | Bacteria | 627 |
| 447 | Ga0501038_1357338 | 3300049574 | Bacteria | 512 |
| 448 | Ga0501039_0000690 | 3300049575 | Bacteria | 24297 |
| 449 | Ga0501039_0006870 | 3300049575 | Bacteria | 8656 |
| 450 | Ga0501039_0014959 | 3300049575 | Bacteria | 5934 |
| 451 | Ga0501039_0032863 | 3300049575 | Bacteria | 4001 |
| 452 | Ga0501039_0062428 | 3300049575 | Bacteria | 2887 |
| 453 | Ga0501039_0211757 | 3300049575 | Bacteria | 1524 |
| 454 | Ga0501039_0270310 | 3300049575 | Bacteria | 1336 |
| 455 | Ga0501039_0528165 | 3300049575 | Bacteria | 926 |
| 456 | Ga0501039_1535205 | 3300049575 | Unclassified | 512 |
| 457 | Ga0501040_0001601 | 3300049576 | Bacteria | 14426 |
| 458 | Ga0501040_0004015 | 3300049576 | Bacteria | 9561 |
| 459 | Ga0501040_0005425 | 3300049576 | Bacteria | 8250 |
| 460 | Ga0501040_0047203 | 3300049576 | Bacteria | 2941 |
| 461 | Ga0501040_0069998 | 3300049576 | Bacteria | 2420 |
| 462 | Ga0501040_0113538 | 3300049576 | Bacteria | 1895 |
| 463 | Ga0501040_0123457 | 3300049576 | Bacteria | 1818 |
| 464 | Ga0501040_0366426 | 3300049576 | Unclassified | 1033 |
| 465 | Ga0501040_0551778 | 3300049576 | Bacteria | 832 |
| 466 | Ga0501040_0575144 | 3300049576 | Bacteria | 813 |
| 467 | Ga0501041_0001369 | 3300049577 | Bacteria | 13456 |
| 468 | Ga0501041_0008939 | 3300049577 | Bacteria | 5895 |
| 469 | Ga0501041_0036914 | 3300049577 | Bacteria | 2960 |
| 470 | Ga0501041_0047616 | 3300049577 | Bacteria | 2610 |
| 471 | Ga0501041_0050574 | 3300049577 | Bacteria | 2533 |
| 472 | Ga0501041_0051164 | 3300049577 | Bacteria | 2518 |
| 473 | Ga0501041_0094801 | 3300049577 | Bacteria | 1844 |
| 474 | Ga0501041_0106777 | 3300049577 | Bacteria | 1735 |
| 475 | Ga0501042_0004607 | 3300049578 | Bacteria | 8802 |
| 476 | Ga0501042_0006591 | 3300049578 | Bacteria | 7552 |
| 477 | Ga0501042_0013769 | 3300049578 | Bacteria | 5510 |
| 478 | Ga0501042_0072034 | 3300049578 | Bacteria | 2472 |
| 479 | Ga0501042_0129655 | 3300049578 | Bacteria | 1817 |
| 480 | Ga0501042_0138739 | 3300049578 | Bacteria | 1753 |
| 481 | Ga0501042_0638238 | 3300049578 | Bacteria | 774 |
| 482 | Ga0501042_0708342 | 3300049578 | Bacteria | 732 |
| 483 | Ga0501043_0022701 | 3300049579 | Bacteria | 4921 |
| 484 | Ga0501043_0071190 | 3300049579 | Bacteria | 2732 |
| 485 | Ga0501043_0096429 | 3300049579 | Bacteria | 2324 |
| 486 | Ga0501046_0001376 | 3300049580 | Bacteria | 23413 |
| 487 | Ga0501046_0024043 | 3300049580 | Bacteria | 5003 |
| 488 | Ga0501046_0024895 | 3300049580 | Bacteria | 4904 |
| 489 | Ga0501046_0191491 | 3300049580 | Bacteria | 1525 |
| 490 | Ga0501046_0316790 | 3300049580 | Bacteria | 1137 |
| 491 | Ga0501046_0692671 | 3300049580 | Bacteria | 718 |
| 492 | Ga0501047_0028858 | 3300049581 | Bacteria | 5352 |
| 493 | Ga0501048_0009921 | 3300049582 | Bacteria | 7134 |
| 494 | Ga0501048_0013753 | 3300049582 | Bacteria | 6003 |
| 495 | Ga0501048_0030398 | 3300049582 | Bacteria | 3908 |
| 496 | Ga0501048_0041524 | 3300049582 | Bacteria | 3294 |
| 497 | Ga0501067_0103285 | 3300049583 | Bacteria | 1584 |
| 498 | Ga0501067_0357923 | 3300049583 | Bacteria | 814 |
| 499 | Ga0501068_0006687 | 3300049584 | Bacteria | 6369 |
| 500 | Ga0501068_0048594 | 3300049584 | Bacteria | 2562 |
| 501 | Ga0501068_0085219 | 3300049584 | Bacteria | 1944 |
| 502 | Ga0501068_0119788 | 3300049584 | Bacteria | 1640 |
| 503 | Ga0501068_0163213 | 3300049584 | Bacteria | 1404 |
| 504 | Ga0501068_0548107 | 3300049584 | Bacteria | 752 |
| 505 | Ga0501068_0743338 | 3300049584 | Unclassified | 642 |
| 506 | Ga0501068_1155283 | 3300049584 | Bacteria | 512 |
| 507 | Ga0501069_0011957 | 3300049585 | Bacteria | 4606 |
| 508 | Ga0501069_0061850 | 3300049585 | Bacteria | 2091 |
| 509 | Ga0501069_0236160 | 3300049585 | Unclassified | 1065 |
| 510 | Ga0501070_0057065 | 3300049586 | Bacteria | 3236 |
| 511 | Ga0501070_0140787 | 3300049586 | Bacteria | 1992 |
| 512 | Ga0501070_0155781 | 3300049586 | Bacteria | 1884 |
| 513 | Ga0501070_0301702 | 3300049586 | Bacteria | 1305 |
| 514 | Ga0501070_0405620 | 3300049586 | Bacteria | 1102 |
| 515 | Ga0501070_0649655 | 3300049586 | Bacteria | 838 |
| 516 | Ga0501071_0003674 | 3300049587 | Bacteria | 9623 |
| 517 | Ga0501071_0007173 | 3300049587 | Bacteria | 7290 |
| 518 | Ga0501071_0010752 | 3300049587 | Bacteria | 6138 |
| 519 | Ga0501071_0028753 | 3300049587 | Bacteria | 3919 |
| 520 | Ga0501071_0043245 | 3300049587 | Bacteria | 3229 |
| 521 | Ga0501071_0048882 | 3300049587 | Bacteria | 3043 |
| 522 | Ga0501071_0084694 | 3300049587 | Bacteria | 2324 |
| 523 | Ga0501071_0130004 | 3300049587 | Bacteria | 1870 |
| 524 | Ga0501071_0148244 | 3300049587 | Bacteria | 1749 |
| 525 | Ga0501071_0172788 | 3300049587 | Bacteria | 1618 |
| 526 | Ga0501071_0999335 | 3300049587 | Bacteria | 646 |
| 527 | Ga0501071_1234429 | 3300049587 | Bacteria | 577 |
| 528 | Ga0501072_0004339 | 3300049588 | Bacteria | 10766 |
| 529 | Ga0501072_0006189 | 3300049588 | Bacteria | 9115 |
| 530 | Ga0501072_0008619 | 3300049588 | Bacteria | 7740 |
| 531 | Ga0501072_0008950 | 3300049588 | Bacteria | 7612 |
| 532 | Ga0501072_0015718 | 3300049588 | Bacteria | 5801 |
| 533 | Ga0501072_0024631 | 3300049588 | Bacteria | 4684 |
| 534 | Ga0501072_0075050 | 3300049588 | Bacteria | 2674 |
| 535 | Ga0501072_0086472 | 3300049588 | Bacteria | 2488 |
| 536 | Ga0501072_0117369 | 3300049588 | Bacteria | 2120 |
| 537 | Ga0501072_0142466 | 3300049588 | Bacteria | 1911 |
| 538 | Ga0501072_0156477 | 3300049588 | Bacteria | 1817 |
| 539 | Ga0501072_0446862 | 3300049588 | Bacteria | 1024 |
| 540 | Ga0501072_0804266 | 3300049588 | Bacteria | 736 |
| 541 | Ga0501072_0923382 | 3300049588 | Bacteria | 681 |
| 542 | Ga0501072_1040290 | 3300049588 | Unclassified | 638 |
| 543 | Ga0501073_0013887 | 3300049589 | Bacteria | 5855 |
| 544 | Ga0501073_0920518 | 3300049589 | Bacteria | 602 |
| 545 | Ga0501074_0009316 | 3300049590 | Bacteria | 7132 |
| 546 | Ga0501074_0012090 | 3300049590 | Bacteria | 6273 |
| 547 | Ga0501074_0034293 | 3300049590 | Bacteria | 3680 |
| 548 | Ga0501074_0104696 | 3300049590 | Bacteria | 2025 |
| 549 | Ga0501074_0176388 | 3300049590 | Bacteria | 1525 |
| 550 | Ga0501074_0222454 | 3300049590 | Bacteria | 1344 |
| 551 | Ga0501074_0370326 | 3300049590 | Bacteria | 1016 |
| 552 | Ga0501074_0372409 | 3300049590 | Bacteria | 1013 |
| 553 | Ga0501074_0489885 | 3300049590 | Bacteria | 871 |
| 554 | Ga0501075_0011836 | 3300049591 | Bacteria | 6189 |
| 555 | Ga0501075_0021163 | 3300049591 | Bacteria | 4739 |
| 556 | Ga0501075_0023092 | 3300049591 | Bacteria | 4551 |
| 557 | Ga0501075_0047329 | 3300049591 | Bacteria | 3232 |
| 558 | Ga0501075_0077028 | 3300049591 | Bacteria | 2523 |
| 559 | Ga0501075_0078996 | 3300049591 | Bacteria | 2490 |
| 560 | Ga0501075_0134879 | 3300049591 | Bacteria | 1881 |
| 561 | Ga0501075_0156201 | 3300049591 | Bacteria | 1739 |
| 562 | Ga0501075_0161849 | 3300049591 | Bacteria | 1707 |
| 563 | Ga0501075_0168256 | 3300049591 | Bacteria | 1672 |
| 564 | Ga0501075_0430535 | 3300049591 | Bacteria | 1006 |
| 565 | Ga0501075_0867590 | 3300049591 | Bacteria | 686 |
| 566 | Ga0501076_0004054 | 3300049592 | Bacteria | 10356 |
| 567 | Ga0501076_0006049 | 3300049592 | Bacteria | 8754 |
| 568 | Ga0501076_0010222 | 3300049592 | Bacteria | 6955 |
| 569 | Ga0501076_0011417 | 3300049592 | Bacteria | 6615 |
| 570 | Ga0501076_0032725 | 3300049592 | Bacteria | 4059 |
| 571 | Ga0501076_0036845 | 3300049592 | Bacteria | 3834 |
| 572 | Ga0501076_0064673 | 3300049592 | Bacteria | 2916 |
| 573 | Ga0501076_0184050 | 3300049592 | Bacteria | 1703 |
| 574 | Ga0501076_0192769 | 3300049592 | Bacteria | 1663 |
| 575 | Ga0501076_0287603 | 3300049592 | Unclassified | 1347 |
| 576 | Ga0501076_0383027 | 3300049592 | Bacteria | 1156 |
| 577 | Ga0501076_0414992 | 3300049592 | Bacteria | 1107 |
| 578 | Ga0501076_0722879 | 3300049592 | Bacteria | 822 |
| 579 | Ga0501077_0001526 | 3300049593 | Bacteria | 13956 |
| 580 | Ga0501077_0016021 | 3300049593 | Bacteria | 4722 |
| 581 | Ga0501077_0058658 | 3300049593 | Bacteria | 2443 |
| 582 | Ga0501077_0070556 | 3300049593 | Bacteria | 2214 |
| 583 | Ga0501077_0070995 | 3300049593 | Bacteria | 2207 |
| 584 | Ga0501077_0085885 | 3300049593 | Bacteria | 1995 |
| 585 | Ga0501077_0107351 | 3300049593 | Bacteria | 1769 |
| 586 | Ga0501077_0182309 | 3300049593 | Bacteria | 1334 |
| 587 | Ga0501077_0219917 | 3300049593 | Bacteria | 1207 |
| 588 | Ga0501079_0002334 | 3300049741 | Bacteria | 13757 |
| 589 | Ga0501079_0006783 | 3300049741 | Bacteria | 8615 |
| 590 | Ga0501079_0011085 | 3300049741 | Bacteria | 6875 |
| 591 | Ga0501079_0051493 | 3300049741 | Bacteria | 3179 |
| 592 | Ga0501079_0057630 | 3300049741 | Bacteria | 2998 |
| 593 | Ga0501079_0141375 | 3300049741 | Bacteria | 1875 |
| 594 | Ga0501079_0153164 | 3300049741 | Bacteria | 1797 |
| 595 | Ga0501079_0230208 | 3300049741 | Bacteria | 1448 |
| 596 | Ga0501079_0376088 | 3300049741 | Bacteria | 1114 |
| 597 | Ga0501079_0425112 | 3300049741 | Bacteria | 1043 |
| 598 | Ga0501080_0004741 | 3300049742 | Bacteria | 12124 |
| 599 | Ga0501080_0012395 | 3300049742 | Bacteria | 7817 |
| 600 | Ga0501080_0028501 | 3300049742 | Bacteria | 5196 |
| 601 | Ga0501080_0187489 | 3300049742 | Bacteria | 1902 |
| 602 | Ga0501080_0199210 | 3300049742 | Bacteria | 1839 |
| 603 | Ga0501080_0891763 | 3300049742 | Bacteria | 776 |
| 604 | Ga0501081_0000702 | 3300049743 | Bacteria | 19369 |
| 605 | Ga0501081_0005627 | 3300049743 | Bacteria | 8099 |
| 606 | Ga0501081_0009944 | 3300049743 | Bacteria | 6199 |
| 607 | Ga0501081_0015059 | 3300049743 | Bacteria | 5103 |
| 608 | Ga0501081_0030099 | 3300049743 | Bacteria | 3673 |
| 609 | Ga0501081_0068527 | 3300049743 | Bacteria | 2470 |
| 610 | Ga0501081_0086006 | 3300049743 | Bacteria | 2207 |
| 611 | Ga0501081_0228520 | 3300049743 | Bacteria | 1354 |
| 612 | Ga0501081_0245223 | 3300049743 | Bacteria | 1307 |
| 613 | Ga0501081_0301216 | 3300049743 | Bacteria | 1176 |
| 614 | Ga0501081_0527893 | 3300049743 | Bacteria | 881 |
| 615 | Ga0501081_0911999 | 3300049743 | Bacteria | 663 |
| 616 | Ga0501083_0012150 | 3300049744 | Bacteria | 6028 |
| 617 | Ga0501083_0081167 | 3300049744 | Bacteria | 2150 |
| 618 | Ga0501083_0149430 | 3300049744 | Bacteria | 1530 |
| 619 | Ga0501035_0003872 | 3300049822 | Bacteria | 14282 |
| 620 | Ga0501035_0046652 | 3300049822 | Bacteria | 3897 |
| 621 | Ga0501044_0084927 | 3300049823 | Bacteria | 3199 |
| 622 | Ga0501044_0278462 | 3300049823 | Bacteria | 1607 |
| 623 | Ga0501044_0759767 | 3300049823 | Bacteria | 851 |
| 624 | Ga0501044_1073637 | 3300049823 | Bacteria | 675 |
| 625 | Ga0501045_0003901 | 3300049824 | Bacteria | 10267 |
| 626 | Ga0501045_0004200 | 3300049824 | Bacteria | 9944 |
| 627 | Ga0501045_0005551 | 3300049824 | Bacteria | 8724 |
| 628 | Ga0501045_0010341 | 3300049824 | Bacteria | 6535 |
| 629 | Ga0501045_0088541 | 3300049824 | Bacteria | 2287 |
| 630 | Ga0501045_0092989 | 3300049824 | Bacteria | 2230 |
| 631 | Ga0501045_0259070 | 3300049824 | Bacteria | 1294 |
| 632 | Ga0501045_0567843 | 3300049824 | Unclassified | 841 |
| 633 | Ga0501045_0879463 | 3300049824 | Bacteria | 658 |
| 634 | Ga0501045_0951626 | 3300049824 | Bacteria | 630 |
| 635 | Ga0501045_0971352 | 3300049824 | Bacteria | 623 |
| 636 | nmdc:mga03683_280742_c1 | 3300050489 | Bacteria | 778 |
| 637 | nmdc:mga03n38_338483_c1 | 3300050490 | Bacteria | 816 |
| 638 | nmdc:mga03n38_469375_c1 | 3300050490 | Unclassified | 702 |
| 639 | nmdc:mga03n38_54923_c1 | 3300050490 | Bacteria | 1792 |
| 640 | nmdc:mga00v17_153179_c1 | 3300050491 | Bacteria | 1481 |
| 641 | nmdc:mga00v17_318119_c1 | 3300050491 | Bacteria | 1011 |
| 642 | nmdc:mga00v17_3280_c1 | 3300050491 | Bacteria | 8339 |
| 643 | nmdc:mga00v17_583170_c1 | 3300050491 | Bacteria | 722 |
| 644 | nmdc:mga00v17_90230_c1 | 3300050491 | Bacteria | 1924 |
| 645 | nmdc:mga0yw44_228418_c1 | 3300050492 | Bacteria | 1235 |
| 646 | nmdc:mga0yw44_42798_c1 | 3300050492 | Bacteria | 2702 |
| 647 | nmdc:mga0yw44_62615_c1 | 3300050492 | Bacteria | 2285 |
| 648 | nmdc:mga0yw44_65244_c1 | 3300050492 | Bacteria | 2243 |
| 649 | nmdc:mga0yw44_702040_c1 | 3300050492 | Bacteria | 687 |
| 650 | nmdc:mga06z11_312063_c1 | 3300050494 | Bacteria | 937 |
| 651 | nmdc:mga06z11_3801_c1 | 3300050494 | Bacteria | 5879 |
| 652 | nmdc:mga06z11_51551_c1 | 3300050494 | Bacteria | 2107 |
| 653 | nmdc:mga06z11_53742_c1 | 3300050494 | Bacteria | 2073 |
| 654 | nmdc:mga04h51_165261_c1 | 3300050495 | Bacteria | 854 |
| 655 | nmdc:mga04h51_258143_c1 | 3300050495 | Bacteria | 700 |
| 656 | nmdc:mga04h51_329238_c1 | 3300050495 | Bacteria | 628 |
| 657 | nmdc:mga05p37_1335043_c1 | 3300050507 | Bacteria | 728 |
| 658 | nmdc:mga05p37_821865_c1 | 3300050507 | Bacteria | 1013 |
| 659 | nmdc:mga05p37_880453_c1 | 3300050507 | Bacteria | 968 |
| 660 | nmdc:mga09592_1045264_c1 | 3300050508 | Bacteria | 681 |
| 661 | nmdc:mga09592_426853_c1 | 3300050508 | Bacteria | 1144 |
| 662 | nmdc:mga09592_909113_c1 | 3300050508 | Bacteria | 739 |
| 663 | nmdc:mga0qj67_179264_c1 | 3300050509 | Bacteria | 1721 |
| 664 | nmdc:mga08y16_1293604_c1 | 3300050511 | Bacteria | 696 |
| 665 | nmdc:mga0n895_473951_c1 | 3300050512 | Bacteria | 1263 |
| 666 | nmdc:mga0rr50_499622_c1 | 3300050513 | Bacteria | 1034 |
| 667 | Ga0495601_0074672 | 3300053077 | Bacteria | 2169 |
| 668 | Ga0495601_0189397 | 3300053077 | Bacteria | 1345 |
| 669 | Ga0495612_0199875 | 3300053078 | Bacteria | 882 |
| 670 | Ga0495612_0231789 | 3300053078 | Bacteria | 819 |
| 671 | Ga0495612_0459321 | 3300053078 | Bacteria | 582 |
| 672 | Ga0500635_0077839 | 3300053080 | Bacteria | 1186 |
| 673 | Ga0495655_0007225 | 3300053083 | Bacteria | 2056 |
| 674 | Ga0495655_0072683 | 3300053083 | Bacteria | 965 |
| 675 | Ga0495595_0003693 | 3300053084 | Bacteria | 6088 |
| 676 | Ga0495595_0284152 | 3300053084 | Unclassified | 831 |
| 677 | Ga0495595_0705410 | 3300053084 | Bacteria | 517 |
| 678 | Ga0495619_0047297 | 3300053085 | Bacteria | 2832 |
| 679 | Ga0495619_0079511 | 3300053085 | Bacteria | 2206 |
| 680 | Ga0495619_0251134 | 3300053085 | Bacteria | 1225 |
| 681 | Ga0495619_0315015 | 3300053085 | Bacteria | 1083 |
| 682 | Ga0495619_0967219 | 3300053085 | Bacteria | 570 |
| 683 | Ga0500646_0149339 | 3300053090 | Bacteria | 773 |
| 684 | Ga0500566_0076821 | 3300053094 | Bacteria | 1866 |
| 685 | Ga0500660_022531 | 3300053100 | Bacteria | 3342 |
| 686 | Ga0500553_176646 | 3300053101 | Bacteria | 774 |
| 687 | Ga0500569_008855 | 3300053109 | Bacteria | 2317 |
| 688 | Ga0500593_194193 | 3300053117 | Bacteria | 740 |
| 689 | Ga0500614_119960 | 3300053123 | Bacteria | 773 |
| 690 | Ga0500568_0000389 | 3300053139 | Bacteria | 33456 |
| 691 | Ga0500573_0141891 | 3300053140 | Bacteria | 1322 |
| 692 | Ga0500577_0122415 | 3300053142 | Bacteria | 1084 |
| 693 | Ga0500579_115325 | 3300053143 | Bacteria | 1330 |
| 694 | Ga0500600_0045429 | 3300053149 | Bacteria | 2513 |
| 695 | Ga0500603_193238 | 3300053150 | Bacteria | 644 |
| 696 | Ga0500616_0191240 | 3300053153 | Bacteria | 913 |
| 697 | Ga0500616_0191886 | 3300053153 | Bacteria | 911 |
| 698 | Ga0500634_0260735 | 3300053161 | Bacteria | 713 |
| 699 | Ga0501084_0000577 | 3300054114 | Bacteria | 28039 |
| 700 | Ga0501084_0000970 | 3300054114 | Bacteria | 22234 |
| 701 | Ga0501084_0029885 | 3300054114 | Bacteria | 4558 |
| 702 | Ga0501084_0047742 | 3300054114 | Bacteria | 3586 |
| 703 | Ga0501084_0119169 | 3300054114 | Bacteria | 2218 |
| 704 | Ga0501084_0223357 | 3300054114 | Bacteria | 1589 |
| 705 | Ga0501084_0263111 | 3300054114 | Bacteria | 1456 |
| 706 | Ga0501084_0428978 | 3300054114 | Bacteria | 1118 |
| 707 | Ga0501084_0445752 | 3300054114 | Unclassified | 1094 |
| 708 | Ga0501084_0517297 | 3300054114 | Bacteria | 1009 |
| 709 | Ga0501084_1113113 | 3300054114 | Unclassified | 663 |
| 710 | Ga0501082_0012107 | 3300060353 | Bacteria | 7411 |
| 711 | Ga0501082_0043410 | 3300060353 | Bacteria | 3877 |
| 712 | Ga0501082_0066585 | 3300060353 | Bacteria | 3102 |
| 713 | Ga0501082_0078206 | 3300060353 | Bacteria | 2853 |
| 714 | Ga0501082_0085285 | 3300060353 | Unclassified | 2724 |
| 715 | Ga0501082_0086198 | 3300060353 | Bacteria | 2708 |
| 716 | Ga0501082_0105787 | 3300060353 | Bacteria | 2434 |
| 717 | Ga0501082_0357651 | 3300060353 | Bacteria | 1273 |
| 718 | Ga0501082_0425013 | 3300060353 | Bacteria | 1160 |
| 719 | Ga0501082_0723354 | 3300060353 | Bacteria | 871 |
| 720 | Ga0501082_0737354 | 3300060353 | Bacteria | 862 |
| 721 | Ga0501082_0893859 | 3300060353 | Bacteria | 777 |
| 722 | Ga0501082_1046946 | 3300060353 | Bacteria | 713 |
| 723 | Ga0501082_1476016 | 3300060353 | Bacteria | 594 |
| 724 | Ga0530510_0004811 | 3300061734 | Bacteria | 9344 |
| 725 | Ga0530510_0016132 | 3300061734 | Bacteria | 5282 |
| 726 | Ga0530510_0019264 | 3300061734 | Bacteria | 4843 |
| 727 | Ga0530510_0049683 | 3300061734 | Bacteria | 3030 |
| 728 | Ga0530510_0060708 | 3300061734 | Bacteria | 2736 |
| 729 | Ga0530510_0078925 | 3300061734 | Bacteria | 2394 |
| 730 | Ga0530510_0211077 | 3300061734 | Bacteria | 1442 |
| 731 | Ga0530510_0452797 | 3300061734 | Unclassified | 970 |
| 732 | Ga0530510_0575201 | 3300061734 | Bacteria | 856 |
| 733 | Ga0530510_0711617 | 3300061734 | Bacteria | 765 |
| 734 | Ga0530510_0722161 | 3300061734 | Bacteria | 759 |
| 735 | 2585318355 | 2582581314 | Bacteria | 11452267 |
| 736 | 2616699841 | 2616644814 | Bacteria | 11555299 |
| 737 | 2954007593 | 2954002825 | Bacteria | 9173742 |
| 738 | 2954382579 | 2954380949 | Bacteria | 10050426 |
| 739 | 2954696555 | 2954691527 | Bacteria | 10720516 |
| 740 | 2990065682 | 2990059506 | Bacteria | 9321252 |
| 741 | Ga0400483_070898 | |||
| 742 | Ga0065715_10347406 | |||
| 743 | Ga0070670_100527227 | |||
| 744 | Ga0070670_101833080 | |||
| 745 | Ga0070682_100445538 | |||
| 746 | Ga0070682_100847086 | |||
| 747 | Ga0070689_100790144 | |||
| 748 | Ga0070687_100679114 | |||
| 749 | Ga0070668_100441662 | |||
| 750 | Ga0070668_100476806 | |||
| 751 | Ga0070668_101140132 | |||
| 752 | Ga0070668_101173792 | |||
| 753 | Ga0070675_100104873 | |||
| 754 | Ga0070671_101105341 | |||
| 755 | Ga0070674_101171852 | |||
| 756 | Ga0070673_100745084 | |||
| 757 | Ga0070713_100094000 | |||
| 758 | Ga0070713_100525034 | |||
| 759 | Ga0070710_10006578 | |||
| 760 | Ga0070705_101204266 | |||
| 761 | Ga0070708_100771362 | |||
| 762 | Ga0070678_100061449 | |||
| 763 | Ga0070678_100547428 | |||
| 764 | Ga0070678_100864251 | |||
| 765 | Ga0070678_100947588 | |||
| 766 | Ga0070678_101183506 | |||
| 767 | Ga0070679_101141520 | |||
| 768 | Ga0070684_100437921 | |||
| 769 | Ga0070672_100077884 | |||
| 770 | Ga0070672_100316840 | |||
| 771 | Ga0070672_100844539 | |||
| 772 | Ga0070696_100578435 | |||
| 773 | Ga0070696_100955804 | |||
| 774 | Ga0070693_100585887 | |||
| 775 | Ga0070665_100429488 | |||
| 776 | Ga0070704_101000214 | |||
| 777 | Ga0070702_100574403 | |||
| 778 | Ga0070702_101239244 | |||
| 779 | Ga0068861_100144373 | |||
| 780 | Ga0068861_100177583 | |||
| 781 | Ga0068861_100896152 | |||
| 782 | Ga0068863_100106149 | |||
| 783 | Ga0068858_100407235 | |||
| 784 | Ga0068860_100726128 | |||
| 785 | Ga0081455_10108156 | |||
| 786 | Ga0081455_10416033 | |||
| 787 | Ga0081455_10434644 | |||
| 788 | Ga0081539_10030945 | |||
| 789 | Ga0075365_10065937 | |||
| 790 | Ga0075365_10329836 | |||
| 791 | Ga0075365_10338314 | |||
| 792 | Ga0075365_10394832 | |||
| 793 | Ga0075365_10404601 | |||
| 794 | Ga0075365_10652522 | |||
| 795 | Ga0075365_11024953 | |||
| 796 | Ga0075368_10069224 | |||
| 797 | Ga0075368_10367819 | |||
| 798 | Ga0075363_100193951 | |||
| 799 | Ga0075363_100299463 | |||
| 800 | Ga0075364_10008974 | |||
| 801 | Ga0075364_10032317 | |||
| 802 | Ga0075364_10190900 | |||
| 803 | Ga0075364_10257350 | |||
| 804 | Ga0075364_10677977 | |||
| 805 | Ga0075362_10314274 | |||
| 806 | Ga0075367_10078024 | |||
| 807 | Ga0075367_10229036 | |||
| 808 | Ga0075367_10329515 | |||
| 809 | Ga0075367_10355877 | |||
| 810 | Ga0075367_10726875 | |||
| 811 | Ga0075366_10725598 | |||
| 812 | Ga0097621_100373654 | |||
| 813 | Ga0068871_100460263 | |||
| 814 | Ga0075430_100149449 | |||
| 815 | Ga0075430_100607389 | |||
| 816 | Ga0075431_101324245 | |||
| 817 | Ga0075434_100321769 | |||
| 818 | Ga0075429_100649939 | |||
| 819 | Ga0075435_101024150 | |||
| 820 | Ga0111539_10231934 | |||
| 821 | Ga0111539_11508343 | |||
| 822 | Ga0105245_10045885 | |||
| 823 | Ga0105245_11661988 | |||
| 824 | Ga0105247_10729041 | |||
| 825 | Ga0114129_10210442 | |||
| 826 | Ga0114129_10769494 | |||
| 827 | Ga0114129_11249702 | |||
| 828 | Ga0114129_11306077 | |||
| 829 | Ga0105243_10178525 | |||
| 830 | Ga0105243_10328764 | |||
| 831 | Ga0105241_10039406 | |||
| 832 | Ga0105242_10099286 | |||
| 833 | Ga0105242_10269641 | |||
| 834 | Ga0105242_11518197 | |||
| 835 | Ga0105242_11752319 | |||
| 836 | Ga0105248_11282776 | |||
| 837 | Ga0105238_11598544 | |||
| 838 | Ga0105249_10318152 | |||
| 839 | Ga0105249_12042162 | |||
| 840 | Ga0105030_112858 | |||
| 841 | Ga0105028_120096 | |||
| 842 | Ga0105239_10200717 | |||
| 843 | Ga0105239_10860386 | |||
| 844 | Ga0105239_13521519 | |||
| 845 | Ga0105246_10210980 | |||
| 846 | Ga0105246_10867568 | |||
| 847 | Ga0105246_12297440 | |||
| 848 | Ga0157373_11324250 | |||
| 849 | Ga0157374_10978549 | |||
| 850 | Ga0157378_10176453 | |||
| 851 | Ga0157378_10439045 | |||
| 852 | Ga0157378_11738455 | |||
| 853 | Ga0157378_11929878 | |||
| 854 | Ga0163162_10543256 | |||
| 855 | Ga0163162_11548537 | |||
| 856 | Ga0157372_12324102 | |||
| 857 | Ga0157375_10260855 | |||
| 858 | Ga0157375_10522420 | |||
| 859 | Ga0163163_10080544 | |||
| 860 | Ga0163163_10879446 | |||
| 861 | Ga0157380_10308254 | |||
| 862 | Ga0157380_10694227 | |||
| 863 | Ga0157380_11206079 | |||
| 864 | Ga0157380_11843047 | |||
| 865 | Ga0157377_10408859 | |||
| 866 | Ga0157377_11431775 | |||
| 867 | Ga0157379_10238539 | |||
| 868 | Ga0157379_11465477 | |||
| 869 | Ga0157376_11595532 | |||
| 870 | Ga0157376_12343488 | |||
| 871 | Ga0163161_10167680 | |||
| 872 | Ga0213876_10002892 | |||
| 873 | Ga0207692_10022755 | |||
| 874 | Ga0207692_10255627 | |||
| 875 | Ga0207654_10294935 | |||
| 876 | Ga0207693_10068745 | |||
| 877 | Ga0207662_10564197 | |||
| 878 | Ga0207681_10172182 | |||
| 879 | Ga0207681_10576298 | |||
| 880 | Ga0207650_10410042 | |||
| 881 | Ga0207659_10330426 | |||
| 882 | Ga0207687_10198593 | |||
| 883 | Ga0207687_10721128 | |||
| 884 | Ga0207700_10592659 | |||
| 885 | Ga0207686_10119971 | |||
| 886 | Ga0207686_10594314 | |||
| 887 | Ga0207709_10277930 | |||
| 888 | Ga0207709_10280519 | |||
| 889 | Ga0207669_10777685 | |||
| 890 | Ga0207669_11870889 | |||
| 891 | Ga0207665_11164874 | |||
| 892 | Ga0207691_10084745 | |||
| 893 | Ga0207691_10288254 | |||
| 894 | Ga0207711_10737571 | |||
| 895 | Ga0207661_11444898 | |||
| 896 | Ga0207651_10732231 | |||
| 897 | Ga0207712_10092521 | |||
| 898 | Ga0207712_11144257 | |||
| 899 | Ga0207668_10050821 | |||
| 900 | Ga0207668_10749997 | |||
| 901 | Ga0207668_11049152 | |||
| 902 | Ga0207668_11240841 | |||
| 903 | Ga0207703_10825789 | |||
| 904 | Ga0207678_10642285 | |||
| 905 | Ga0207678_11277482 | |||
| 906 | Ga0207708_10506687 | |||
| 907 | Ga0207708_11654148 | |||
| 908 | Ga0207648_11062489 | |||
| 909 | Ga0207676_10518631 | |||
| 910 | Ga0207675_100302728 | |||
| 911 | Ga0207675_100307656 | |||
| 912 | Ga0207675_100522210 | |||
| 913 | Ga0207675_101226546 | |||
| 914 | Ga0207683_10096827 | |||
| 915 | Ga0207683_10162756 | |||
| 916 | Ga0207683_10328685 | |||
| 917 | Ga0207683_10460364 | |||
| 918 | Ga0207683_10930336 | |||
| 919 | Ga0207698_10936399 | |||
| 920 | Ga0209813_10141382 | |||
| 921 | Ga0209813_10190918 | |||
| 922 | Ga0209813_10208594 | |||
| 923 | Ga0209974_10053671 | |||
| 924 | Ga0268266_11253292 | |||
| 925 | Ga0268265_10027687 | |||
| 926 | Ga0268265_11982248 | |||
| 927 | Ga0268264_11019043 | |||
| 928 | Ga0265336_10133424 | |||
| 929 | Ga0307517_10046838 | |||
| 930 | Ga0265338_10015936 | |||
| 931 | Ga0265327_10007936 | |||
| 932 | Ga0265327_10013730 | |||
| 933 | Ga0265327_10080506 | |||
| 934 | Ga0265327_10128717 | |||
| 935 | Ga0307408_100926736 | |||
| 936 | Ga0307508_10031427 | |||
| 937 | Ga0307508_10165589 | |||
| 938 | Ga0307508_10383492 | |||
| 939 | Ga0316575_10048373 | |||
| 940 | Ga0316576_10076359 | |||
| 941 | Ga0316576_10170245 | |||
| 942 | Ga0316576_10264720 | |||
| 943 | Ga0316576_10648999 | |||
| 944 | Ga0316578_10086816 | |||
| 945 | Ga0316578_10089879 | |||
| 946 | Ga0307516_10053112 | |||
| 947 | Ga0307516_10109081 | |||
| 948 | Ga0307405_10759771 | |||
| 949 | Ga0316577_10291941 | |||
| 950 | Ga0307413_10072580 | |||
| 951 | Ga0307410_10102100 | |||
| 952 | Ga0307412_10794241 | |||
| 953 | Ga0307412_11003612 | |||
| 954 | Ga0307412_11603822 | |||
| 955 | Ga0307409_100032897 | |||
| 956 | Ga0307409_102240344 | |||
| 957 | Ga0307409_102347522 | |||
| 958 | Ga0307409_102571781 | |||
| 959 | Ga0307416_100344301 | |||
| 960 | Ga0307416_100606555 | |||
| 961 | Ga0307414_10878173 | |||
| 962 | Ga0307411_11590124 | |||
| 963 | Ga0307415_100433623 | |||
| 964 | Ga0307415_100761857 | |||
| 965 | Ga0307415_101524643 | |||
| 966 | Ga0307415_102405703 | |||
| 967 | Ga0307507_10579739 | |||
| 968 | Ga0307510_10185132 | |||
| 969 | Ga0373948_0056806 | |||
| 970 | Ga0373945_0303636 | |||
| 971 | Ga0373955_0089974 | |||
| 972 | Ga0316574_0001032 | |||
| 973 | Ga0316574_0161989 | |||
| 974 | Ga0316574_0206795 | |||
| 975 | Ga0373931_0008215 | |||
| 976 | Ga0373931_0227919 | |||
| 977 | Ga0373931_0805489 | |||
| 978 | Ga0373937_0183996 | |||
| 979 | Ga0373937_0807976 | |||
| 980 | Ga0373937_0948875 | |||
| 981 | Ga0316582_0134621 | |||
| 982 | Ga0316584_0003967 | |||
| 983 | Ga0316584_0025264 | |||
| 984 | Ga0316584_0247887 | |||
| 985 | Ga0395905_0120613 | |||
| 986 | Ga0400485_14901 | |||
| 987 | Ga0400483_027223 | |||
| 988 | Ga0400483_076252 | |||
| 989 | Ga0400483_076253 | |||
| 990 | Ga0400483_101414 | |||
| 991 | Ga0400483_122014 | |||
| 992 | Ga0400483_189648 | |||
| 993 | Ga0400483_223286 | |||
| 994 | Ga0400483_257462 | |||
| 995 | Ga0436365_0345456 | |||
| 996 | Ga0439461_0047190 | |||
| 997 | Ga0451789_0535420 | |||
| 998 | Ga0451791_0895493 | |||
| 999 | Ga0451797_1462242 | |||
| 1000 | Ga0451802_0139828 | |||
| 1001 | Ga0451807_1951674 | |||
| 1002 | Ga0451807_2556943 | |||
| 1003 | Ga0451833_0602750 | |||
| 1004 | Ga0451837_1635401 | |||
| 1005 | Ga0451841_0650166 | |||
| 1006 | Ga0451841_0829097 | |||
| 1007 | Ga0451853_3008136 | |||
| 1008 | Ga0451853_3483290 | |||
| 1009 | Ga0439431_0094080 | |||
| 1010 | Ga0439431_0173568 | |||
| 1011 | Ga0439434_0195660 | |||
| 1012 | Ga0439434_0329350 | |||
| 1013 | Ga0450918_035675 | |||
| 1014 | Ga0439440_0075949 | |||
| 1015 | Ga0495627_053848 | |||
| 1016 | Ga0495592_0040002 | |||
| 1017 | Ga0495603_0301826 | |||
| 1018 | Ga0495603_0865579 | |||
| 1019 | Ga0495629_0252354 | |||
| 1020 | Ga0495629_0814772 | |||
| 1021 | Ga0495638_0428739 | |||
| 1022 | Ga0495641_0076124 | |||
| 1023 | Ga0495641_0180556 | |||
| 1024 | Ga0495641_0337338 | |||
| 1025 | Ga0495641_0390850 | |||
| 1026 | Ga0495641_0454399 | |||
| 1027 | Ga0495641_0555845 | |||
| 1028 | Ga0495651_0009275 | |||
| 1029 | Ga0495651_0064759 | |||
| 1030 | Ga0495653_0018356 | |||
| 1031 | Ga0495653_0245842 | |||
| 1032 | Ga0495653_0510635 | |||
| 1033 | Ga0495662_0132242 | |||
| 1034 | Ga0495594_0127849 | |||
| 1035 | Ga0495594_0836588 | |||
| 1036 | Ga0495608_0011546 | |||
| 1037 | Ga0495608_0215939 | |||
| 1038 | Ga0495618_0043582 | |||
| 1039 | Ga0495628_0007427 | |||
| 1040 | Ga0495628_0200213 | |||
| 1041 | Ga0495630_0568594 | |||
| 1042 | Ga0495630_0579214 | |||
| 1043 | Ga0495630_0808093 | |||
| 1044 | Ga0495643_0003841 | |||
| 1045 | Ga0495644_0232908 | |||
| 1046 | Ga0495642_0284142 | |||
| 1047 | Ga0495652_0021219 | |||
| 1048 | Ga0495652_0527419 | |||
| 1049 | Ga0495640_0001549 | |||
| 1050 | Ga0495586_0084056 | |||
| 1051 | Ga0495586_0593714 | |||
| 1052 | Ga0495645_0504650 | |||
| 1053 | Ga0495622_0088601 | |||
| 1054 | Ga0495667_0058148 | |||
| 1055 | Ga0495667_0275985 | |||
| 1056 | Ga0495667_0526270 | |||
| 1057 | Ga0495634_0183181 | |||
| 1058 | Ga0495611_0084399 | |||
| 1059 | Ga0495635_0052229 | |||
| 1060 | Ga0495635_0355198 | |||
| 1061 | Ga0495657_0021092 | |||
| 1062 | Ga0495657_0022839 | |||
| 1063 | Ga0495657_0395178 | |||
| 1064 | Ga0495657_0568717 | |||
| 1065 | Ga0495599_0202272 | |||
| 1066 | Ga0495599_0335678 | |||
| 1067 | Ga0495623_0040318 | |||
| 1068 | Ga0495623_0047594 | |||
| 1069 | Ga0495647_0198064 | |||
| 1070 | Ga0495658_0044638 | |||
| 1071 | Ga0495658_0191103 | |||
| 1072 | Ga0495658_0288295 | |||
| 1073 | Ga0495658_0409350 | |||
| 1074 | Ga0495658_0564159 | |||
| 1075 | Ga0495613_0294904 | |||
| 1076 | Ga0495613_0570065 | |||
| 1077 | Ga0495613_0744211 | |||
| 1078 | Ga0495589_0482712 | |||
| 1079 | Ga0495600_0127551 | |||
| 1080 | Ga0495600_0152391 | |||
| 1081 | Ga0495600_0716299 | |||
| 1082 | Ga0495604_0002739 | |||
| 1083 | Ga0495604_0048247 | |||
| 1084 | Ga0495636_0027753 | |||
| 1085 | Ga0495674_0686319 | |||
| 1086 | Ga0495672_0005262 | |||
| 1087 | Ga0495672_0148464 | |||
| 1088 | Ga0495676_0062246 | |||
| 1089 | Ga0495676_0258166 | |||
| 1090 | Ga0495676_0506287 | |||
| 1091 | Ga0495680_0016053 | |||
| 1092 | Ga0495680_0022063 | |||
| 1093 | Ga0495680_0213324 | |||
| 1094 | Ga0495687_054210 | |||
| 1095 | Ga0495687_179345 | |||
| 1096 | Ga0495675_0057258 | |||
| 1097 | Ga0495675_0137635 | |||
| 1098 | Ga0495679_016168 | |||
| 1099 | Ga0495685_001048 | |||
| 1100 | Ga0495685_018158 | |||
| 1101 | Ga0495673_0231255 | |||
| 1102 | Ga0495681_0004904 | |||
| 1103 | Ga0495684_0092775 | |||
| 1104 | Ga0495684_0290828 | |||
| 1105 | Ga0495686_0049809 | |||
| 1106 | Ga0495593_0008434 | |||
| 1107 | Ga0495593_0236215 | |||
| 1108 | Ga0495602_0033132 | |||
| 1109 | Ga0495602_0147502 | |||
| 1110 | Ga0495614_0413893 | |||
| 1111 | Ga0495615_0266231 | |||
| 1112 | Ga0496100_0408023 | |||
| 1113 | Ga0496100_0789728 | |||
| 1114 | Ga0496100_0824448 | |||
| 1115 | Ga0496101_0009938 | |||
| 1116 | Ga0496101_0274604 | |||
| 1117 | Ga0496101_1360619 | |||
| 1118 | Ga0496102_0036149 | |||
| 1119 | Ga0496102_0329857 | |||
| 1120 | Ga0496103_0987171 | |||
| 1121 | Ga0496104_0010012 | |||
| 1122 | Ga0496104_0011936 | |||
| 1123 | Ga0496104_0080597 | |||
| 1124 | Ga0496104_0342070 | |||
| 1125 | Ga0496104_1477145 | |||
| 1126 | Ga0496105_0034238 | |||
| 1127 | Ga0496105_0047910 | |||
| 1128 | Ga0496105_0321293 | |||
| 1129 | Ga0496106_0087323 | |||
| 1130 | Ga0496107_0204125 | |||
| 1131 | Ga0496108_0419048 | |||
| 1132 | Ga0496108_1401997 | |||
| 1133 | Ga0496109_0569282 | |||
| 1134 | Ga0496109_0582132 | |||
| 1135 | Ga0496109_0808722 | |||
| 1136 | Ga0496110_1531956 | |||
| 1137 | Ga0496111_0336285 | |||
| 1138 | Ga0496111_0433381 | |||
| 1139 | Ga0496112_0470500 | |||
| 1140 | Ga0496113_0796305 | |||
| 1141 | Ga0496114_0047992 | |||
| 1142 | Ga0496114_0087403 | |||
| 1143 | Ga0496114_1602040 | |||
| 1144 | Ga0496115_0000992 | |||
| 1145 | Ga0501031_0016355 | |||
| 1146 | Ga0501031_0073806 | |||
| 1147 | Ga0501031_0183681 | |||
| 1148 | Ga0501031_0281580 | |||
| 1149 | Ga0501031_0427407 | |||
| 1150 | Ga0501031_0581499 | |||
| 1151 | Ga0501032_0061730 | |||
| 1152 | Ga0501032_0157163 | |||
| 1153 | Ga0501032_0230385 | |||
| 1154 | Ga0501032_0280320 | |||
| 1155 | Ga0501033_0046148 | |||
| 1156 | Ga0501033_0400992 | |||
| 1157 | Ga0501033_0740614 | |||
| 1158 | Ga0501033_0908090 | |||
| 1159 | Ga0501034_0000570 | |||
| 1160 | Ga0501034_0015695 | |||
| 1161 | Ga0501034_0026256 | |||
| 1162 | Ga0501034_0065553 | |||
| 1163 | Ga0501034_0098626 | |||
| 1164 | Ga0501034_0193626 | |||
| 1165 | Ga0501034_0313743 | |||
| 1166 | Ga0501034_0535281 | |||
| 1167 | Ga0501034_0798869 | |||
| 1168 | Ga0501036_0002556 | |||
| 1169 | Ga0501036_0002702 | |||
| 1170 | Ga0501036_0009930 | |||
| 1171 | Ga0501036_0010212 | |||
| 1172 | Ga0501036_0090468 | |||
| 1173 | Ga0501036_0103767 | |||
| 1174 | Ga0501036_0134495 | |||
| 1175 | Ga0501036_0902318 | |||
| 1176 | Ga0501036_1495820 | |||
| 1177 | Ga0501037_0063859 | |||
| 1178 | Ga0501037_0115498 | |||
| 1179 | Ga0501037_0137855 | |||
| 1180 | Ga0501037_1004449 | |||
| 1181 | Ga0501038_0026699 | |||
| 1182 | Ga0501038_0102367 | |||
| 1183 | Ga0501038_0302731 | |||
| 1184 | Ga0501038_0358679 | |||
| 1185 | Ga0501038_0774949 | |||
| 1186 | Ga0501038_0963770 | |||
| 1187 | Ga0501038_1357338 | |||
| 1188 | Ga0501039_0000690 | |||
| 1189 | Ga0501039_0006870 | |||
| 1190 | Ga0501039_0014959 | |||
| 1191 | Ga0501039_0032863 | |||
| 1192 | Ga0501039_0062428 | |||
| 1193 | Ga0501039_0211757 | |||
| 1194 | Ga0501039_0270310 | |||
| 1195 | Ga0501039_0528165 | |||
| 1196 | Ga0501039_1535205 | |||
| 1197 | Ga0501040_0001601 | |||
| 1198 | Ga0501040_0004015 | |||
| 1199 | Ga0501040_0005425 | |||
| 1200 | Ga0501040_0047203 | |||
| 1201 | Ga0501040_0069998 | |||
| 1202 | Ga0501040_0113538 | |||
| 1203 | Ga0501040_0123457 | |||
| 1204 | Ga0501040_0366426 | |||
| 1205 | Ga0501040_0551778 | |||
| 1206 | Ga0501040_0575144 | |||
| 1207 | Ga0501041_0001369 | |||
| 1208 | Ga0501041_0008939 | |||
| 1209 | Ga0501041_0036914 | |||
| 1210 | Ga0501041_0047616 | |||
| 1211 | Ga0501041_0050574 | |||
| 1212 | Ga0501041_0051164 | |||
| 1213 | Ga0501041_0094801 | |||
| 1214 | Ga0501041_0106777 | |||
| 1215 | Ga0501042_0004607 | |||
| 1216 | Ga0501042_0006591 | |||
| 1217 | Ga0501042_0013769 | |||
| 1218 | Ga0501042_0072034 | |||
| 1219 | Ga0501042_0129655 | |||
| 1220 | Ga0501042_0138739 | |||
| 1221 | Ga0501042_0638238 | |||
| 1222 | Ga0501042_0708342 | |||
| 1223 | Ga0501043_0022701 | |||
| 1224 | Ga0501043_0071190 | |||
| 1225 | Ga0501043_0096429 | |||
| 1226 | Ga0501046_0001376 | |||
| 1227 | Ga0501046_0024043 | |||
| 1228 | Ga0501046_0024895 | |||
| 1229 | Ga0501046_0191491 | |||
| 1230 | Ga0501046_0316790 | |||
| 1231 | Ga0501046_0692671 | |||
| 1232 | Ga0501047_0028858 | |||
| 1233 | Ga0501048_0009921 | |||
| 1234 | Ga0501048_0013753 | |||
| 1235 | Ga0501048_0030398 | |||
| 1236 | Ga0501048_0041524 | |||
| 1237 | Ga0501067_0103285 | |||
| 1238 | Ga0501067_0357923 | |||
| 1239 | Ga0501068_0006687 | |||
| 1240 | Ga0501068_0048594 | |||
| 1241 | Ga0501068_0085219 | |||
| 1242 | Ga0501068_0119788 | |||
| 1243 | Ga0501068_0163213 | |||
| 1244 | Ga0501068_0548107 | |||
| 1245 | Ga0501068_0743338 | |||
| 1246 | Ga0501068_1155283 | |||
| 1247 | Ga0501069_0011957 | |||
| 1248 | Ga0501069_0061850 | |||
| 1249 | Ga0501069_0236160 | |||
| 1250 | Ga0501070_0057065 | |||
| 1251 | Ga0501070_0140787 | |||
| 1252 | Ga0501070_0155781 | |||
| 1253 | Ga0501070_0301702 | |||
| 1254 | Ga0501070_0405620 | |||
| 1255 | Ga0501070_0649655 | |||
| 1256 | Ga0501071_0003674 | |||
| 1257 | Ga0501071_0007173 | |||
| 1258 | Ga0501071_0010752 | |||
| 1259 | Ga0501071_0028753 | |||
| 1260 | Ga0501071_0043245 | |||
| 1261 | Ga0501071_0048882 | |||
| 1262 | Ga0501071_0084694 | |||
| 1263 | Ga0501071_0130004 | |||
| 1264 | Ga0501071_0148244 | |||
| 1265 | Ga0501071_0172788 | |||
| 1266 | Ga0501071_0999335 | |||
| 1267 | Ga0501071_1234429 | |||
| 1268 | Ga0501072_0004339 | |||
| 1269 | Ga0501072_0006189 | |||
| 1270 | Ga0501072_0008619 | |||
| 1271 | Ga0501072_0008950 | |||
| 1272 | Ga0501072_0015718 | |||
| 1273 | Ga0501072_0024631 | |||
| 1274 | Ga0501072_0075050 | |||
| 1275 | Ga0501072_0086472 | |||
| 1276 | Ga0501072_0117369 | |||
| 1277 | Ga0501072_0142466 | |||
| 1278 | Ga0501072_0156477 | |||
| 1279 | Ga0501072_0446862 | |||
| 1280 | Ga0501072_0804266 | |||
| 1281 | Ga0501072_0923382 | |||
| 1282 | Ga0501072_1040290 | |||
| 1283 | Ga0501073_0013887 | |||
| 1284 | Ga0501073_0920518 | |||
| 1285 | Ga0501074_0009316 | |||
| 1286 | Ga0501074_0012090 | |||
| 1287 | Ga0501074_0034293 | |||
| 1288 | Ga0501074_0104696 | |||
| 1289 | Ga0501074_0176388 | |||
| 1290 | Ga0501074_0222454 | |||
| 1291 | Ga0501074_0370326 | |||
| 1292 | Ga0501074_0372409 | |||
| 1293 | Ga0501074_0489885 | |||
| 1294 | Ga0501075_0011836 | |||
| 1295 | Ga0501075_0021163 | |||
| 1296 | Ga0501075_0023092 | |||
| 1297 | Ga0501075_0047329 | |||
| 1298 | Ga0501075_0077028 | |||
| 1299 | Ga0501075_0078996 | |||
| 1300 | Ga0501075_0134879 | |||
| 1301 | Ga0501075_0156201 | |||
| 1302 | Ga0501075_0161849 | |||
| 1303 | Ga0501075_0168256 | |||
| 1304 | Ga0501075_0430535 | |||
| 1305 | Ga0501075_0867590 | |||
| 1306 | Ga0501076_0004054 | |||
| 1307 | Ga0501076_0006049 | |||
| 1308 | Ga0501076_0010222 | |||
| 1309 | Ga0501076_0011417 | |||
| 1310 | Ga0501076_0032725 | |||
| 1311 | Ga0501076_0036845 | |||
| 1312 | Ga0501076_0064673 | |||
| 1313 | Ga0501076_0184050 | |||
| 1314 | Ga0501076_0192769 | |||
| 1315 | Ga0501076_0287603 | |||
| 1316 | Ga0501076_0383027 | |||
| 1317 | Ga0501076_0414992 | |||
| 1318 | Ga0501076_0722879 | |||
| 1319 | Ga0501077_0001526 | |||
| 1320 | Ga0501077_0016021 | |||
| 1321 | Ga0501077_0058658 | |||
| 1322 | Ga0501077_0070556 | |||
| 1323 | Ga0501077_0070995 | |||
| 1324 | Ga0501077_0085885 | |||
| 1325 | Ga0501077_0107351 | |||
| 1326 | Ga0501077_0182309 | |||
| 1327 | Ga0501077_0219917 | |||
| 1328 | Ga0501079_0002334 | |||
| 1329 | Ga0501079_0006783 | |||
| 1330 | Ga0501079_0011085 | |||
| 1331 | Ga0501079_0051493 | |||
| 1332 | Ga0501079_0057630 | |||
| 1333 | Ga0501079_0141375 | |||
| 1334 | Ga0501079_0153164 | |||
| 1335 | Ga0501079_0230208 | |||
| 1336 | Ga0501079_0376088 | |||
| 1337 | Ga0501079_0425112 | |||
| 1338 | Ga0501080_0004741 | |||
| 1339 | Ga0501080_0012395 | |||
| 1340 | Ga0501080_0028501 | |||
| 1341 | Ga0501080_0187489 | |||
| 1342 | Ga0501080_0199210 | |||
| 1343 | Ga0501080_0891763 | |||
| 1344 | Ga0501081_0000702 | |||
| 1345 | Ga0501081_0005627 | |||
| 1346 | Ga0501081_0009944 | |||
| 1347 | Ga0501081_0015059 | |||
| 1348 | Ga0501081_0030099 | |||
| 1349 | Ga0501081_0068527 | |||
| 1350 | Ga0501081_0086006 | |||
| 1351 | Ga0501081_0228520 | |||
| 1352 | Ga0501081_0245223 | |||
| 1353 | Ga0501081_0301216 | |||
| 1354 | Ga0501081_0527893 | |||
| 1355 | Ga0501081_0911999 | |||
| 1356 | Ga0501083_0012150 | |||
| 1357 | Ga0501083_0081167 | |||
| 1358 | Ga0501083_0149430 | |||
| 1359 | Ga0501035_0003872 | |||
| 1360 | Ga0501035_0046652 | |||
| 1361 | Ga0501044_0084927 | |||
| 1362 | Ga0501044_0278462 | |||
| 1363 | Ga0501044_0759767 | |||
| 1364 | Ga0501044_1073637 | |||
| 1365 | Ga0501045_0003901 | |||
| 1366 | Ga0501045_0004200 | |||
| 1367 | Ga0501045_0005551 | |||
| 1368 | Ga0501045_0010341 | |||
| 1369 | Ga0501045_0088541 | |||
| 1370 | Ga0501045_0092989 | |||
| 1371 | Ga0501045_0259070 | |||
| 1372 | Ga0501045_0567843 | |||
| 1373 | Ga0501045_0879463 | |||
| 1374 | Ga0501045_0951626 | |||
| 1375 | Ga0501045_0971352 | |||
| 1376 | nmdc:mga03683_280742_c1 | |||
| 1377 | nmdc:mga03n38_338483_c1 | |||
| 1378 | nmdc:mga03n38_469375_c1 | |||
| 1379 | nmdc:mga03n38_54923_c1 | |||
| 1380 | nmdc:mga00v17_153179_c1 | |||
| 1381 | nmdc:mga00v17_318119_c1 | |||
| 1382 | nmdc:mga00v17_3280_c1 | |||
| 1383 | nmdc:mga00v17_583170_c1 | |||
| 1384 | nmdc:mga00v17_90230_c1 | |||
| 1385 | nmdc:mga0yw44_228418_c1 | |||
| 1386 | nmdc:mga0yw44_42798_c1 | |||
| 1387 | nmdc:mga0yw44_62615_c1 | |||
| 1388 | nmdc:mga0yw44_65244_c1 | |||
| 1389 | nmdc:mga0yw44_702040_c1 | |||
| 1390 | nmdc:mga06z11_312063_c1 | |||
| 1391 | nmdc:mga06z11_3801_c1 | |||
| 1392 | nmdc:mga06z11_51551_c1 | |||
| 1393 | nmdc:mga06z11_53742_c1 | |||
| 1394 | nmdc:mga04h51_165261_c1 | |||
| 1395 | nmdc:mga04h51_258143_c1 | |||
| 1396 | nmdc:mga04h51_329238_c1 | |||
| 1397 | nmdc:mga05p37_1335043_c1 | |||
| 1398 | nmdc:mga05p37_821865_c1 | |||
| 1399 | nmdc:mga05p37_880453_c1 | |||
| 1400 | nmdc:mga09592_1045264_c1 | |||
| 1401 | nmdc:mga09592_426853_c1 | |||
| 1402 | nmdc:mga09592_909113_c1 | |||
| 1403 | nmdc:mga0qj67_179264_c1 | |||
| 1404 | nmdc:mga08y16_1293604_c1 | |||
| 1405 | nmdc:mga0n895_473951_c1 | |||
| 1406 | nmdc:mga0rr50_499622_c1 | |||
| 1407 | Ga0495601_0074672 | |||
| 1408 | Ga0495601_0189397 | |||
| 1409 | Ga0495612_0199875 | |||
| 1410 | Ga0495612_0231789 | |||
| 1411 | Ga0495612_0459321 | |||
| 1412 | Ga0500635_0077839 | |||
| 1413 | Ga0495655_0007225 | |||
| 1414 | Ga0495655_0072683 | |||
| 1415 | Ga0495595_0003693 | |||
| 1416 | Ga0495595_0284152 | |||
| 1417 | Ga0495595_0705410 | |||
| 1418 | Ga0495619_0047297 | |||
| 1419 | Ga0495619_0079511 | |||
| 1420 | Ga0495619_0251134 | |||
| 1421 | Ga0495619_0315015 | |||
| 1422 | Ga0495619_0967219 | |||
| 1423 | Ga0500646_0149339 | |||
| 1424 | Ga0500566_0076821 | |||
| 1425 | Ga0500660_022531 | |||
| 1426 | Ga0500553_176646 | |||
| 1427 | Ga0500569_008855 | |||
| 1428 | Ga0500593_194193 | |||
| 1429 | Ga0500614_119960 | |||
| 1430 | Ga0500568_0000389 | |||
| 1431 | Ga0500573_0141891 | |||
| 1432 | Ga0500577_0122415 | |||
| 1433 | Ga0500579_115325 | |||
| 1434 | Ga0500600_0045429 | |||
| 1435 | Ga0500603_193238 | |||
| 1436 | Ga0500616_0191240 | |||
| 1437 | Ga0500616_0191886 | |||
| 1438 | Ga0500634_0260735 | |||
| 1439 | Ga0501084_0000577 | |||
| 1440 | Ga0501084_0000970 | |||
| 1441 | Ga0501084_0029885 | |||
| 1442 | Ga0501084_0047742 | |||
| 1443 | Ga0501084_0119169 | |||
| 1444 | Ga0501084_0223357 | |||
| 1445 | Ga0501084_0263111 | |||
| 1446 | Ga0501084_0428978 | |||
| 1447 | Ga0501084_0445752 | |||
| 1448 | Ga0501084_0517297 | |||
| 1449 | Ga0501084_1113113 | |||
| 1450 | Ga0501082_0012107 | |||
| 1451 | Ga0501082_0043410 | |||
| 1452 | Ga0501082_0066585 | |||
| 1453 | Ga0501082_0078206 | |||
| 1454 | Ga0501082_0085285 | |||
| 1455 | Ga0501082_0086198 | |||
| 1456 | Ga0501082_0105787 | |||
| 1457 | Ga0501082_0357651 | |||
| 1458 | Ga0501082_0425013 | |||
| 1459 | Ga0501082_0723354 | |||
| 1460 | Ga0501082_0737354 | |||
| 1461 | Ga0501082_0893859 | |||
| 1462 | Ga0501082_1046946 | |||
| 1463 | Ga0501082_1476016 | |||
| 1464 | Ga0530510_0004811 | |||
| 1465 | Ga0530510_0016132 | |||
| 1466 | Ga0530510_0019264 | |||
| 1467 | Ga0530510_0049683 | |||
| 1468 | Ga0530510_0060708 | |||
| 1469 | Ga0530510_0078925 | |||
| 1470 | Ga0530510_0211077 | |||
| 1471 | Ga0530510_0452797 | |||
| 1472 | Ga0530510_0575201 | |||
| 1473 | Ga0530510_0711617 | |||
| 1474 | Ga0530510_0722161 | |||
| 1475 | 2585318355 | |||
| 1476 | 2616699841 | |||
| 1477 | 2954007593 | |||
| 1478 | 2954382579 | |||
| 1479 | 2954696555 | |||
| 1480 | 2990065682 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kye-assembly2.cif.gz_C | crystal structure of roadblock/lc7 domain from streptomyces avermitilis | 0.9333 | 13 | 109 |
| 7f8m-assembly3.cif.gz_F | roadblock from thorarchaeota smtz1-45 | 0.904 | 9 | 111 |
| 7yh1-assembly2.cif.gz_C | roadblock from candidatus prometheoarchaeum syntrophicum strain mk-d1 | 0.8971 | 9 | 107 |
| 3t1r-assembly2.cif.gz_C | mglb with tetrameric arrangement | 0.8836 | 1 | 110 |
| 1j3w-assembly1.cif.gz_B | structure of gliding protein-mglb from thermus thermophilus hb8 | 0.8568 | 1 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50393_7_130_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.9501 | 11 | 109 | 3.30.450.30 |
| af_Q58736_1_114_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.9146 | 11 | 111 | 3.30.450.30 |
| 3kyeD00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.8897 | 11 | 111 | 3.30.450.30 |
| 3t1rC00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.8836 | 1 | 110 | 3.30.450.30 |
| af_Q54DY3_5_86_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.8342 | 23 | 85 | 3.30.450.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G6DT07-F1-model_v4 | Dynein regulation protein LC7 | 0.9671 | 7 | 121 |
|
| AF-A0A1Q9P609-F1-model_v4 | Roadblock/LAMTOR2 domain-containing protein | 0.953 | 5 | 110 |
GO:0005085
GO:0032008 GO:0060090 |
| AF-A0A7X6D3J9-F1-model_v4 | Roadblock/LC7 domain-containing protein | 0.9526 | 4 | 122 |
|
| AF-A0A662HNR7-F1-model_v4 | Roadblock/LAMTOR2 domain-containing protein | 0.9517 | 6 | 113 |
|
| AF-G0FLQ2-F1-model_v4 | deleted | 0.9502 | 8 | 111 |
|