F478536

General Info

Members Datasets Scaffolds Average Seq Length
740 288 1480 126

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_12107965|Ga0307413_121079651
Length 148
Sequence VQISFTDRELDVMAVLWEHGPSTVAEVRERIADDLAYTTVLTILRTLEEKGHVGHEEEGRAYRYHPLVAREEAGTSALRRLVGTVFGGSSELLLTNLVSDRGLDRAQLERLRRLLDERLGDAGDASSGAAAPDDVGSGPAARGPKGAR

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
102 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
231 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
257 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
260 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
261 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
262 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
268 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
269 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 31.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_12107965 3300031824 Bacteria 510
2 Ga0065712_10153245 3300005290 Unclassified 1353
3 Ga0065712_10204066 3300005290 Unclassified 1097
4 Ga0065707_10140256 3300005295 Unclassified 1782
5 Ga0070658_10311972 3300005327 Bacteria 1342
6 Ga0070658_11511170 3300005327 Bacteria 582
7 Ga0070676_10000995 3300005328 Bacteria 14081
8 Ga0070683_100005838 3300005329 Bacteria 10297
9 Ga0070683_100010496 3300005329 Bacteria 7965
10 Ga0070683_100022740 3300005329 Bacteria 5607
11 Ga0070683_100132306 3300005329 Unclassified 2361
12 Ga0070683_100190488 3300005329 Unclassified 1947
13 Ga0070683_100554301 3300005329 Unclassified 1099
14 Ga0070683_101567756 3300005329 Bacteria 633
15 Ga0070690_100170448 3300005330 Unclassified 1498
16 Ga0070690_100444299 3300005330 Bacteria 960
17 Ga0070670_100000720 3300005331 Bacteria 25696
18 Ga0070670_100014815 3300005331 Bacteria 6688
19 Ga0070670_101133650 3300005331 Unclassified 714
20 Ga0070677_10015292 3300005333 Bacteria 2717
21 Ga0068869_100024495 3300005334 Unclassified 4179
22 Ga0070666_10112407 3300005335 Bacteria 1884
23 Ga0070680_100017396 3300005336 Bacteria 5670
24 Ga0070680_100077761 3300005336 Unclassified 2733
25 Ga0070680_101134415 3300005336 Bacteria 676
26 Ga0070682_100370691 3300005337 Bacteria 1073
27 Ga0070682_101201052 3300005337 Bacteria 640
28 Ga0068868_100078603 3300005338 Unclassified 2642
29 Ga0068868_100238553 3300005338 Bacteria 1527
30 Ga0068868_101155358 3300005338 Bacteria 714
31 Ga0070660_100062471 3300005339 Unclassified 2893
32 Ga0070660_100646092 3300005339 Unclassified 886
33 Ga0070689_100070681 3300005340 Unclassified 2726
34 Ga0070689_100295592 3300005340 Unclassified 1347
35 Ga0070687_100007864 3300005343 Bacteria 4481
36 Ga0070687_100270620 3300005343 Unclassified 1064
37 Ga0070661_100007471 3300005344 Bacteria 7538
38 Ga0070661_100055899 3300005344 Unclassified 2890
39 Ga0070661_100257836 3300005344 Unclassified 1347
40 Ga0070661_100391298 3300005344 Unclassified 1097
41 Ga0070692_10003453 3300005345 Bacteria 6407
42 Ga0070692_11395714 3300005345 Unclassified 506
43 Ga0070668_100000329 3300005347 Bacteria 31144
44 Ga0070668_100082299 3300005347 Bacteria 2525
45 Ga0070669_100010457 3300005353 Bacteria 6589
46 Ga0070669_100014432 3300005353 Bacteria 5622
47 Ga0070669_100115756 3300005353 Unclassified 2040
48 Ga0070675_100002585 3300005354 Bacteria 13565
49 Ga0070675_100010275 3300005354 Bacteria 7305
50 Ga0070675_101356397 3300005354 Bacteria 655
51 Ga0070675_101380182 3300005354 Unclassified 650
52 Ga0070671_100508881 3300005355 Bacteria 1036
53 Ga0070671_100872724 3300005355 Unclassified 785
54 Ga0070671_101271803 3300005355 Unclassified 648
55 Ga0070671_101539795 3300005355 Unclassified 589
56 Ga0070674_100044425 3300005356 Bacteria 3029
57 Ga0070674_100058653 3300005356 Bacteria 2676
58 Ga0070673_100013615 3300005364 Bacteria 5634
59 Ga0070673_100023520 3300005364 Unclassified 4502
60 Ga0070673_100366449 3300005364 Unclassified 1282
61 Ga0070688_100072662 3300005365 Unclassified 2204
62 Ga0070659_100017156 3300005366 Bacteria 5442
63 Ga0070659_100361269 3300005366 Bacteria 1220
64 Ga0070659_100365710 3300005366 Bacteria 1213
65 Ga0070667_100014096 3300005367 Bacteria 6605
66 Ga0070709_10041589 3300005434 Unclassified 2833
67 Ga0070709_10045660 3300005434 Unclassified 2720
68 Ga0070714_100045852 3300005435 Unclassified 3707
69 Ga0070714_100221046 3300005435 Bacteria 1741
70 Ga0070713_100009549 3300005436 Bacteria 6955
71 Ga0070713_100109641 3300005436 Unclassified 2405
72 Ga0070713_100227117 3300005436 Unclassified 1696
73 Ga0070701_10006339 3300005438 Bacteria 4975
74 Ga0070701_10029048 3300005438 Bacteria 2723
75 Ga0070701_10222768 3300005438 Bacteria 1126
76 Ga0070711_100000102 3300005439 Bacteria 44792
77 Ga0070711_101080185 3300005439 Unclassified 691
78 Ga0070705_100013583 3300005440 Bacteria 4169
79 Ga0070705_100087275 3300005440 Unclassified 1933
80 Ga0070705_100147403 3300005440 Bacteria 1557
81 Ga0070705_100878615 3300005440 Bacteria 719
82 Ga0070700_100006376 3300005441 Bacteria 6302
83 Ga0070700_101504045 3300005441 Unclassified 572
84 Ga0070694_100007905 3300005444 Bacteria 6493
85 Ga0070694_100011668 3300005444 Bacteria 5443
86 Ga0070694_100153393 3300005444 Unclassified 1684
87 Ga0070694_100337715 3300005444 Unclassified 1164
88 Ga0070694_101711273 3300005444 Unclassified 535
89 Ga0070708_100075751 3300005445 Bacteria 3037
90 Ga0070663_100125464 3300005455 Unclassified 1944
91 Ga0070663_101164588 3300005455 Bacteria 676
92 Ga0070662_100000076 3300005457 Bacteria 54084
93 Ga0070662_100010602 3300005457 Bacteria 6058
94 Ga0070662_100059250 3300005457 Unclassified 2789
95 Ga0070662_100180275 3300005457 Unclassified 1665
96 Ga0070681_10001178 3300005458 Bacteria 22602
97 Ga0070681_10001446 3300005458 Bacteria 20920
98 Ga0070681_10042484 3300005458 Bacteria 4555
99 Ga0070681_10053920 3300005458 Unclassified 4006
100 Ga0070681_10379214 3300005458 Bacteria 1325
101 Ga0070681_10425545 3300005458 Bacteria 1240
102 Ga0068867_100049476 3300005459 Bacteria 3095
103 Ga0068867_100208701 3300005459 Unclassified 1567
104 Ga0068867_100651064 3300005459 Bacteria 924
105 Ga0070685_10000765 3300005466 Bacteria 17485
106 Ga0070685_10003925 3300005466 Bacteria 7512
107 Ga0070685_10094046 3300005466 Bacteria 1820
108 Ga0070706_100052759 3300005467 Unclassified 3753
109 Ga0070707_100038677 3300005468 Unclassified 4558
110 Ga0070707_100044303 3300005468 Bacteria 4259
111 Ga0070707_100717806 3300005468 Bacteria 962
112 Ga0070698_100081596 3300005471 Unclassified 3228
113 Ga0070698_100402488 3300005471 Bacteria 1302
114 Ga0070698_100818365 3300005471 Unclassified 876
115 Ga0070699_100037678 3300005518 Bacteria 4187
116 Ga0070699_100583480 3300005518 Bacteria 1019
117 Ga0070679_100000085 3300005530 Bacteria 70740
118 Ga0070679_100000688 3300005530 Bacteria 29006
119 Ga0070679_100004925 3300005530 Bacteria 12320
120 Ga0070679_100030669 3300005530 Bacteria 5310
121 Ga0070679_100085167 3300005530 Bacteria 3148
122 Ga0070679_100165865 3300005530 Bacteria 2182
123 Ga0070679_100184371 3300005530 Unclassified 2059
124 Ga0070679_101290200 3300005530 Bacteria 676
125 Ga0070684_100004616 3300005535 Bacteria 10503
126 Ga0070684_100025341 3300005535 Bacteria 4985
127 Ga0070684_100060978 3300005535 Unclassified 3301
128 Ga0070684_100060984 3300005535 Unclassified 3300
129 Ga0070684_100067766 3300005535 Bacteria 3136
130 Ga0070684_100225127 3300005535 Unclassified 1712
131 Ga0070684_100668870 3300005535 Bacteria 967
132 Ga0070684_101440747 3300005535 Bacteria 649
133 Ga0070697_100024271 3300005536 Bacteria 4826
134 Ga0070697_100260948 3300005536 Bacteria 1483
135 Ga0068853_100074593 3300005539 Unclassified 2960
136 Ga0068853_100643819 3300005539 Unclassified 1008
137 Ga0070672_100036954 3300005543 Unclassified 3724
138 Ga0070672_100107184 3300005543 Unclassified 2274
139 Ga0070672_100149140 3300005543 Bacteria 1934
140 Ga0070686_100000312 3300005544 Bacteria 32090
141 Ga0070686_100847105 3300005544 Bacteria 740
142 Ga0070695_100019488 3300005545 Unclassified 4131
143 Ga0070695_101275407 3300005545 Bacteria 606
144 Ga0070696_100017017 3300005546 Bacteria 4905
145 Ga0070696_100019315 3300005546 Unclassified 4614
146 Ga0070696_100196028 3300005546 Unclassified 1505
147 Ga0070693_100055741 3300005547 Bacteria 2278
148 Ga0070665_100060114 3300005548 Bacteria 3809
149 Ga0070665_100115327 3300005548 Bacteria 2689
150 Ga0070665_100561469 3300005548 Unclassified 1154
151 Ga0070665_100846952 3300005548 Bacteria 927
152 Ga0070704_100024971 3300005549 Unclassified 3928
153 Ga0070704_100067085 3300005549 Bacteria 2590
154 Ga0070704_100123347 3300005549 Unclassified 1995
155 Ga0070704_100834538 3300005549 Unclassified 825
156 Ga0070704_101942548 3300005549 Unclassified 546
157 Ga0068855_100054133 3300005563 Bacteria 4717
158 Ga0068855_101289687 3300005563 Unclassified 756
159 Ga0070664_100000255 3300005564 Bacteria 38364
160 Ga0070664_100014337 3300005564 Bacteria 6462
161 Ga0070664_100084351 3300005564 Unclassified 2742
162 Ga0070664_100097653 3300005564 Unclassified 2550
163 Ga0070664_100839912 3300005564 Bacteria 860
164 Ga0068857_100001041 3300005577 Bacteria 21457
165 Ga0068857_100018335 3300005577 Bacteria 6141
166 Ga0068857_100080277 3300005577 Bacteria 2913
167 Ga0068857_100184470 3300005577 Bacteria 1899
168 Ga0068857_102483875 3300005577 Bacteria 509
169 Ga0068854_100137950 3300005578 Bacteria 1869
170 Ga0068854_100677494 3300005578 Bacteria 888
171 Ga0070702_100450566 3300005615 Unclassified 933
172 Ga0068852_100155823 3300005616 Unclassified 2128
173 Ga0068852_100257661 3300005616 Unclassified 1674
174 Ga0068859_100009552 3300005617 Bacteria 9792
175 Ga0068859_100054025 3300005617 Bacteria 4039
176 Ga0068859_100143207 3300005617 Unclassified 2464
177 Ga0068864_100010632 3300005618 Bacteria 7606
178 Ga0068864_100219957 3300005618 Archaea 1752
179 Ga0068864_100382929 3300005618 Bacteria 1333
180 Ga0068866_10015774 3300005718 Bacteria 3364
181 Ga0068861_100000880 3300005719 Bacteria 18238
182 Ga0068861_100028672 3300005719 Bacteria 4063
183 Ga0068861_100550422 3300005719 Bacteria 1051
184 Ga0068851_10026126 3300005834 Unclassified 2867
185 Ga0068851_10169908 3300005834 Bacteria 1203
186 Ga0068870_10682533 3300005840 Unclassified 707
187 Ga0068863_100016263 3300005841 Bacteria 7138
188 Ga0068863_100068140 3300005841 Unclassified 3366
189 Ga0068863_100356328 3300005841 Bacteria 1425
190 Ga0068863_100535073 3300005841 Bacteria 1156
191 Ga0068863_100704579 3300005841 Unclassified 1004
192 Ga0068858_100017236 3300005842 Bacteria 6776
193 Ga0068858_101016385 3300005842 Unclassified 813
194 Ga0068860_100150166 3300005843 Unclassified 2243
195 Ga0068860_102358527 3300005843 Bacteria 552
196 Ga0068862_100026985 3300005844 Bacteria 4830
197 Ga0068862_100043434 3300005844 Bacteria 3832
198 Ga0068862_100102984 3300005844 Bacteria 2499
199 Ga0068862_101014282 3300005844 Bacteria 821
200 Ga0070716_100282888 3300006173 Bacteria 1145
201 Ga0070712_100017364 3300006175 Bacteria 4659
202 Ga0070712_100030367 3300006175 Bacteria 3630
203 Ga0070712_100058178 3300006175 Bacteria 2719
204 Ga0070712_101203254 3300006175 Bacteria 659
205 Ga0097621_101005823 3300006237 Archaea 780
206 Ga0068871_100407161 3300006358 Unclassified 1212
207 Ga0068871_101950380 3300006358 Unclassified 558
208 Ga0075428_100190507 3300006844 Bacteria 2218
209 Ga0075428_100255054 3300006844 Bacteria 1889
210 Ga0075428_100476617 3300006844 Bacteria 1336
211 Ga0075428_101459646 3300006844 Bacteria 717
212 Ga0075428_101550629 3300006844 Bacteria 693
213 Ga0075428_102178004 3300006844 Bacteria 572
214 Ga0075430_100000891 3300006846 Bacteria 23423
215 Ga0075430_100150885 3300006846 Bacteria 1935
216 Ga0075430_100384966 3300006846 Bacteria 1157
217 Ga0075430_100944721 3300006846 Unclassified 710
218 Ga0075430_101139549 3300006846 Bacteria 642
219 Ga0075431_100030118 3300006847 Bacteria 5588
220 Ga0075431_100534394 3300006847 Unclassified 1161
221 Ga0075431_100560179 3300006847 Bacteria 1130
222 Ga0075431_100601217 3300006847 Bacteria 1084
223 Ga0075431_100714313 3300006847 Bacteria 979
224 Ga0075431_100743931 3300006847 Bacteria 956
225 Ga0075431_100786748 3300006847 Unclassified 925
226 Ga0075431_100844344 3300006847 Bacteria 887
227 Ga0075431_100848572 3300006847 Bacteria 885
228 Ga0075431_101618486 3300006847 Bacteria 605
229 Ga0075433_10072864 3300006852 Bacteria 3021
230 Ga0075433_10124919 3300006852 Unclassified 2285
231 Ga0075433_10498227 3300006852 Unclassified 1072
232 Ga0075433_10697068 3300006852 Unclassified 889
233 Ga0075434_100007094 3300006871 Bacteria 10348
234 Ga0075434_100011234 3300006871 Bacteria 8432
235 Ga0075434_100036253 3300006871 Bacteria 4879
236 Ga0075429_100002582 3300006880 Bacteria 15270
237 Ga0075429_100039142 3300006880 Bacteria 4127
238 Ga0075429_100152270 3300006880 Unclassified 2025
239 Ga0075429_100816282 3300006880 Unclassified 817
240 Ga0075429_101482068 3300006880 Bacteria 590
241 Ga0068865_100088786 3300006881 Unclassified 2237
242 Ga0068865_100268703 3300006881 Unclassified 1353
243 Ga0068865_100706740 3300006881 Bacteria 862
244 Ga0068865_101062524 3300006881 Unclassified 711
245 Ga0068865_101119008 3300006881 Unclassified 694
246 Ga0075436_100176455 3300006914 Bacteria 1509
247 Ga0075436_100764143 3300006914 Bacteria 718
248 Ga0097620_100009551 3300006931 Bacteria 9792
249 Ga0097620_100054027 3300006931 Bacteria 4039
250 Ga0097620_100143209 3300006931 Unclassified 2464
251 Ga0075435_100075104 3300007076 Bacteria 2766
252 Ga0075435_100654458 3300007076 Bacteria 912
253 Ga0099794_10001416 3300007265 Bacteria 8391
254 Ga0105240_11627906 3300009093 Bacteria 675
255 Ga0111539_10026342 3300009094 Bacteria 7109
256 Ga0111539_10147644 3300009094 Bacteria 2753
257 Ga0111539_10235856 3300009094 Bacteria 2130
258 Ga0105245_10307640 3300009098 Bacteria 1557
259 Ga0114129_10084156 3300009147 Bacteria 4417
260 Ga0114129_10087166 3300009147 Bacteria 4329
261 Ga0114129_10099722 3300009147 Bacteria 4020
262 Ga0114129_10407615 3300009147 Unclassified 1791
263 Ga0114129_11041547 3300009147 Unclassified 1028
264 Ga0105243_10468376 3300009148 Bacteria 1186
265 Ga0105243_11355797 3300009148 Bacteria 730
266 Ga0105242_10063656 3300009176 Unclassified 3037
267 Ga0105242_10305550 3300009176 Bacteria 1453
268 Ga0105242_10482049 3300009176 Unclassified 1176
269 Ga0105248_10154261 3300009177 Bacteria 2591
270 Ga0105248_10335460 3300009177 Bacteria 1703
271 Ga0105248_11470301 3300009177 Bacteria 771
272 Ga0105237_10238838 3300009545 Bacteria 1818
273 Ga0105237_10784048 3300009545 Bacteria 960
274 Ga0105238_10006505 3300009551 Bacteria 11625
275 Ga0105238_10078046 3300009551 Bacteria 3302
276 Ga0105238_10267402 3300009551 Bacteria 1690
277 Ga0105238_11222017 3300009551 Archaea 776
278 Ga0105249_10012918 3300009553 Bacteria 7369
279 Ga0105249_10080279 3300009553 Bacteria 3030
280 Ga0105249_10138689 3300009553 Bacteria 2329
281 Ga0105249_11843259 3300009553 Bacteria 678
282 Ga0105239_10028094 3300010375 Bacteria 6190
283 Ga0105246_10754189 3300011119 Bacteria 859
284 Ga0105246_11199213 3300011119 Bacteria 698
285 Ga0157339_1020019 3300012505 Bacteria 703
286 Ga0157315_1037788 3300012508 Bacteria 598
287 Ga0157373_10284449 3300013100 Unclassified 1172
288 Ga0157371_10057551 3300013102 Unclassified 2757
289 Ga0157371_10510386 3300013102 Unclassified 888
290 Ga0157370_10221651 3300013104 Bacteria 1752
291 Ga0157369_10042336 3300013105 Bacteria 4968
292 Ga0157369_10216813 3300013105 Unclassified 2004
293 Ga0157369_10419257 3300013105 Unclassified 1388
294 Ga0157374_10022475 3300013296 Bacteria 5626
295 Ga0157378_10178293 3300013297 Bacteria 1997
296 Ga0163162_10009698 3300013306 Bacteria 9369
297 Ga0157372_10032791 3300013307 Bacteria 5699
298 Ga0157372_10421285 3300013307 Unclassified 1556
299 Ga0157372_10782149 3300013307 Unclassified 1109
300 Ga0157372_11992152 3300013307 Bacteria 667
301 Ga0157372_12310206 3300013307 Unclassified 618
302 Ga0157375_10088314 3300013308 Unclassified 3154
303 Ga0157375_10140905 3300013308 Bacteria 2538
304 Ga0157375_10588462 3300013308 Unclassified 1273
305 Ga0157375_12237296 3300013308 Unclassified 651
306 Ga0157375_13544346 3300013308 Bacteria 519
307 Ga0163163_10040607 3300014325 Bacteria 4544
308 Ga0163163_10476095 3300014325 Unclassified 1309
309 Ga0157380_10027694 3300014326 Bacteria 4312
310 Ga0157380_10068489 3300014326 Unclassified 2860
311 Ga0157377_10011041 3300014745 Bacteria 4493
312 Ga0157377_10135678 3300014745 Bacteria 1507
313 Ga0157377_10242208 3300014745 Bacteria 1165
314 Ga0157379_10015352 3300014968 Bacteria 6720
315 Ga0157379_10848845 3300014968 Unclassified 864
316 Ga0157376_11178681 3300014969 Unclassified 794
317 Ga0182007_10237390 3300015262 Bacteria 649
318 Ga0163161_10027835 3300017792 Bacteria 4010
319 Ga0163161_10366063 3300017792 Unclassified 1149
320 Ga0206356_10535394 3300020070 Bacteria 635
321 Ga0213875_10013939 3300021388 Bacteria 3932
322 Ga0207666_1021118 3300025271 Unclassified 958
323 Ga0207697_10016342 3300025315 Unclassified 3057
324 Ga0207656_10220665 3300025321 Bacteria 921
325 Ga0207682_10055477 3300025893 Unclassified 1648
326 Ga0207642_10288811 3300025899 Bacteria 946
327 Ga0207688_10002407 3300025901 Bacteria 10084
328 Ga0207680_10066538 3300025903 Unclassified 2217
329 Ga0207647_10491715 3300025904 Unclassified 685
330 Ga0207699_10201184 3300025906 Bacteria 1350
331 Ga0207699_10236031 3300025906 Unclassified 1254
332 Ga0207645_10003089 3300025907 Bacteria 12770
333 Ga0207643_10004512 3300025908 Bacteria 7486
334 Ga0207705_10289973 3300025909 Bacteria 1254
335 Ga0207705_10625356 3300025909 Bacteria 837
336 Ga0207705_11528972 3300025909 Bacteria 505
337 Ga0207684_10144394 3300025910 Bacteria 2047
338 Ga0207707_10010639 3300025912 Bacteria 7991
339 Ga0207707_10060226 3300025912 Bacteria 3303
340 Ga0207707_10315107 3300025912 Bacteria 1351
341 Ga0207707_10372957 3300025912 Bacteria 1228
342 Ga0207707_10428536 3300025912 Bacteria 1133
343 Ga0207695_10088442 3300025913 Bacteria 3118
344 Ga0207693_10040543 3300025915 Bacteria 3667
345 Ga0207693_10221398 3300025915 Bacteria 1487
346 Ga0207663_10010538 3300025916 Bacteria 4927
347 Ga0207663_10669600 3300025916 Bacteria 820
348 Ga0207660_10004899 3300025917 Bacteria 8720
349 Ga0207660_10034315 3300025917 Unclassified 3516
350 Ga0207660_10050743 3300025917 Bacteria 2947
351 Ga0207660_10264943 3300025917 Bacteria 1360
352 Ga0207660_10345131 3300025917 Bacteria 1192
353 Ga0207662_10003015 3300025918 Bacteria 8582
354 Ga0207662_10076750 3300025918 Bacteria 2031
355 Ga0207657_10186386 3300025919 Archaea 1675
356 Ga0207657_10520423 3300025919 Unclassified 931
357 Ga0207657_10561209 3300025919 Bacteria 892
358 Ga0207649_10037616 3300025920 Unclassified 2924
359 Ga0207649_10050062 3300025920 Unclassified 2583
360 Ga0207649_10226692 3300025920 Bacteria 1334
361 Ga0207649_11199001 3300025920 Unclassified 600
362 Ga0207652_10012667 3300025921 Bacteria 6820
363 Ga0207652_10014152 3300025921 Bacteria 6459
364 Ga0207652_10022974 3300025921 Bacteria 5166
365 Ga0207652_10023209 3300025921 Bacteria 5138
366 Ga0207652_10107721 3300025921 Bacteria 2468
367 Ga0207652_10177436 3300025921 Bacteria 1913
368 Ga0207652_10997587 3300025921 Unclassified 736
369 Ga0207646_10034940 3300025922 Bacteria 4543
370 Ga0207646_10038123 3300025922 Bacteria 4331
371 Ga0207646_10079481 3300025922 Unclassified 2932
372 Ga0207681_10039579 3300025923 Bacteria 3131
373 Ga0207681_10084822 3300025923 Unclassified 2246
374 Ga0207681_10258505 3300025923 Unclassified 1362
375 Ga0207694_10000027 3300025924 Bacteria 248544
376 Ga0207694_10367587 3300025924 Bacteria 1193
377 Ga0207694_10986027 3300025924 Archaea 713
378 Ga0207694_11312090 3300025924 Bacteria 612
379 Ga0207650_10033592 3300025925 Bacteria 3716
380 Ga0207650_10179399 3300025925 Bacteria 1687
381 Ga0207650_10234772 3300025925 Unclassified 1480
382 Ga0207650_10573701 3300025925 Unclassified 947
383 Ga0207659_10143110 3300025926 Unclassified 1858
384 Ga0207687_10976336 3300025927 Bacteria 726
385 Ga0207700_10004803 3300025928 Bacteria 8020
386 Ga0207700_10008206 3300025928 Bacteria 6451
387 Ga0207664_10184966 3300025929 Bacteria 1791
388 Ga0207664_11128284 3300025929 Bacteria 700
389 Ga0207644_10158938 3300025931 Bacteria 1755
390 Ga0207644_10455126 3300025931 Unclassified 1052
391 Ga0207644_10736210 3300025931 Unclassified 823
392 Ga0207690_10017112 3300025932 Unclassified 4422
393 Ga0207690_10030550 3300025932 Unclassified 3438
394 Ga0207690_10123768 3300025932 Archaea 1882
395 Ga0207690_10289158 3300025932 Bacteria 1279
396 Ga0207706_10000323 3300025933 Bacteria 51731
397 Ga0207706_10000546 3300025933 Bacteria 39964
398 Ga0207706_10035898 3300025933 Bacteria 4405
399 Ga0207706_10311569 3300025933 Unclassified 1370
400 Ga0207686_10293383 3300025934 Bacteria 1205
401 Ga0207670_10045763 3300025936 Unclassified 2902
402 Ga0207670_10148885 3300025936 Unclassified 1734
403 Ga0207669_10450800 3300025937 Unclassified 1019
404 Ga0207669_11255041 3300025937 Unclassified 629
405 Ga0207704_10235538 3300025938 Unclassified 1364
406 Ga0207665_10318055 3300025939 Bacteria 1167
407 Ga0207691_10003812 3300025940 Bacteria 14638
408 Ga0207691_10009496 3300025940 Bacteria 9342
409 Ga0207691_10089530 3300025940 Bacteria 2760
410 Ga0207691_10091791 3300025940 Unclassified 2720
411 Ga0207691_11225343 3300025940 Unclassified 622
412 Ga0207711_10265626 3300025941 Bacteria 1578
413 Ga0207711_10680646 3300025941 Bacteria 959
414 Ga0207711_11141727 3300025941 Bacteria 720
415 Ga0207689_10021667 3300025942 Bacteria 5405
416 Ga0207661_10006723 3300025944 Bacteria 8136
417 Ga0207661_10033161 3300025944 Unclassified 4007
418 Ga0207661_10039907 3300025944 Bacteria 3687
419 Ga0207661_10050706 3300025944 Bacteria 3308
420 Ga0207661_10085949 3300025944 Unclassified 2609
421 Ga0207661_10122274 3300025944 Unclassified 2218
422 Ga0207661_11351272 3300025944 Bacteria 654
423 Ga0207679_10001816 3300025945 Bacteria 13292
424 Ga0207679_10018171 3300025945 Bacteria 4706
425 Ga0207679_10031681 3300025945 Unclassified 3703
426 Ga0207679_11173303 3300025945 Bacteria 705
427 Ga0207679_12147304 3300025945 Unclassified 507
428 Ga0207667_10041785 3300025949 Bacteria 4875
429 Ga0207651_10122509 3300025960 Unclassified 1975
430 Ga0207651_10285080 3300025960 Unclassified 1367
431 Ga0207651_10412780 3300025960 Unclassified 1151
432 Ga0207712_10040006 3300025961 Unclassified 3215
433 Ga0207712_10054016 3300025961 Bacteria 2821
434 Ga0207668_10023931 3300025972 Bacteria 3935
435 Ga0207668_10102279 3300025972 Unclassified 2131
436 Ga0207668_10423377 3300025972 Unclassified 1131
437 Ga0207640_10475778 3300025981 Unclassified 1035
438 Ga0207640_11398846 3300025981 Bacteria 627
439 Ga0207640_12196280 3300025981 Unclassified 501
440 Ga0207658_10013021 3300025986 Bacteria 5681
441 Ga0207658_10550809 3300025986 Unclassified 1032
442 Ga0207677_10446579 3300026023 Bacteria 1107
443 Ga0207677_10527767 3300026023 Unclassified 1025
444 Ga0207703_10017061 3300026035 Bacteria 5662
445 Ga0207639_10054405 3300026041 Unclassified 3059
446 Ga0207678_10024119 3300026067 Bacteria 5315
447 Ga0207708_10009814 3300026075 Bacteria 7103
448 Ga0207708_11695183 3300026075 Unclassified 555
449 Ga0207702_10612911 3300026078 Bacteria 1069
450 Ga0207702_11451822 3300026078 Bacteria 680
451 Ga0207641_10054592 3300026088 Unclassified 3391
452 Ga0207641_10260225 3300026088 Unclassified 1624
453 Ga0207641_10395527 3300026088 Bacteria 1326
454 Ga0207641_10492398 3300026088 Unclassified 1190
455 Ga0207641_10596396 3300026088 Bacteria 1081
456 Ga0207641_10731750 3300026088 Bacteria 976
457 Ga0207648_10030280 3300026089 Bacteria 4794
458 Ga0207648_10066956 3300026089 Bacteria 3132
459 Ga0207648_10602048 3300026089 Bacteria 1013
460 Ga0207676_10034335 3300026095 Bacteria 3840
461 Ga0207676_10064754 3300026095 Unclassified 2908
462 Ga0207676_10589882 3300026095 Archaea 1066
463 Ga0207674_10001447 3300026116 Bacteria 30653
464 Ga0207674_10004605 3300026116 Bacteria 16556
465 Ga0207674_10006565 3300026116 Bacteria 13683
466 Ga0207674_10039966 3300026116 Bacteria 4860
467 Ga0207675_100000372 3300026118 Bacteria 43036
468 Ga0207675_100070400 3300026118 Bacteria 3269
469 Ga0207675_100911465 3300026118 Bacteria 895
470 Ga0207683_10261735 3300026121 Bacteria 1579
471 Ga0207698_10014737 3300026142 Bacteria 5208
472 Ga0207698_10276977 3300026142 Unclassified 1550
473 Ga0209588_1000851 3300027671 Bacteria 7786
474 Ga0207428_10030892 3300027907 Bacteria 4425
475 Ga0268266_10081231 3300028379 Bacteria 2826
476 Ga0268266_11205046 3300028379 Unclassified 732
477 Ga0268265_10018325 3300028380 Unclassified 4848
478 Ga0268265_10033418 3300028380 Bacteria 3740
479 Ga0268265_10074083 3300028380 Bacteria 2661
480 Ga0268264_10119039 3300028381 Bacteria 2325
481 Ga0268264_10387098 3300028381 Bacteria 1340
482 Ga0268264_10434311 3300028381 Bacteria 1269
483 Ga0268264_10616024 3300028381 Unclassified 1071
484 Ga0307517_10268107 3300028786 Unclassified 985
485 Ga0307408_100386507 3300031548 Bacteria 1198
486 Ga0307408_100740535 3300031548 Bacteria 887
487 Ga0307408_101721831 3300031548 Unclassified 598
488 Ga0307405_10015432 3300031731 Bacteria 4139
489 Ga0307405_10105709 3300031731 Bacteria 1897
490 Ga0307405_10164183 3300031731 Bacteria 1577
491 Ga0307405_10473714 3300031731 Bacteria 998
492 Ga0307405_10854588 3300031731 Bacteria 766
493 Ga0307405_11535888 3300031731 Bacteria 586
494 Ga0307413_10167502 3300031824 Bacteria 1551
495 Ga0307413_10678364 3300031824 Unclassified 853
496 Ga0307413_10902935 3300031824 Bacteria 750
497 Ga0307410_10060023 3300031852 Bacteria 2598
498 Ga0307406_10011674 3300031901 Bacteria 4986
499 Ga0307406_10104562 3300031901 Bacteria 1936
500 Ga0307406_10341260 3300031901 Unclassified 1167
501 Ga0307406_10406597 3300031901 Bacteria 1081
502 Ga0307406_10447192 3300031901 Bacteria 1036
503 Ga0307406_11155191 3300031901 Bacteria 671
504 Ga0307406_11500935 3300031901 Unclassified 593
505 Ga0307407_10039205 3300031903 Unclassified 2633
506 Ga0307412_10042736 3300031911 Bacteria 2947
507 Ga0307412_10235002 3300031911 Bacteria 1414
508 Ga0307412_11366891 3300031911 Unclassified 640
509 Ga0307412_11587353 3300031911 Bacteria 597
510 Ga0307412_11905107 3300031911 Unclassified 549
511 Ga0307409_100057532 3300031995 Bacteria 3014
512 Ga0307409_100495101 3300031995 Bacteria 1189
513 Ga0307409_101131960 3300031995 Bacteria 805
514 Ga0307416_100003378 3300032002 Bacteria 9353
515 Ga0307416_100430546 3300032002 Unclassified 1366
516 Ga0307416_100660549 3300032002 Unclassified 1131
517 Ga0307416_100813411 3300032002 Bacteria 1031
518 Ga0307416_101778386 3300032002 Bacteria 720
519 Ga0307416_103281134 3300032002 Bacteria 541
520 Ga0307414_10470307 3300032004 Bacteria 1107
521 Ga0307414_12322017 3300032004 Bacteria 501
522 Ga0307411_10129959 3300032005 Bacteria 1839
523 Ga0307411_10457779 3300032005 Bacteria 1069
524 Ga0307411_10509837 3300032005 Bacteria 1019
525 Ga0307411_10976907 3300032005 Bacteria 757
526 Ga0307411_11329511 3300032005 Bacteria 656
527 Ga0307415_100327098 3300032126 Unclassified 1281
528 Ga0307415_100500097 3300032126 Bacteria 1063
529 Ga0307415_101022312 3300032126 Bacteria 769
530 Ga0307415_101076268 3300032126 Bacteria 751
531 Ga0373958_0167250 3300034819 Bacteria 559
532 Ga0373923_0669174 3300035111 Bacteria 514
533 Ga0373956_0570484 3300035119 Bacteria 540
534 Ga0373955_1006546 3300035172 Unclassified 513
535 Ga0373935_0061352 3300035692 Bacteria 2407
536 Ga0395899_0223162 3300037312 Bacteria 1304
537 Ga0395900_0017234 3300037418 Bacteria 7372
538 Ga0395898_0083501 3300037466 Bacteria 3079
539 Ga0395898_0201341 3300037466 Bacteria 1901
540 Ga0395905_0016853 3300037471 Bacteria 6943
541 Ga0395905_0104014 3300037471 Bacteria 2665
542 Ga0395905_0689634 3300037471 Bacteria 924
543 Ga0395901_0070239 3300038443 Bacteria 3648
544 Ga0395901_0103560 3300038443 Bacteria 2986
545 Ga0395901_0417508 3300038443 Bacteria 1376
546 Ga0436365_1097422 3300039437 Bacteria 1037
547 Ga0439439_0108076 3300041406 Unclassified 769
548 Ga0451841_0335638 3300041498 Bacteria 691
549 Ga0439448_0161789 3300042005 Bacteria 779
550 Ga0466961_0011472 3300044693 Bacteria 5668
551 Ga0451576_0017985 3300045051 Bacteria 7756
552 Ga0451576_0202584 3300045051 Bacteria 2073
553 Ga0451576_1945618 3300045051 Unclassified 606
554 Ga0495629_0318167 3300046459 Unclassified 1064
555 Ga0495582_0019243 3300046473 Bacteria 3734
556 Ga0495594_0006622 3300046499 Bacteria 5961
557 Ga0495643_0000045 3300046522 Bacteria 224043
558 Ga0495586_0801504 3300046535 Bacteria 543
559 Ga0495658_0073306 3300046683 Bacteria 1993
560 Ga0495669_0022139 3300046684 Bacteria 2761
561 Ga0495593_0315277 3300047673 Bacteria 782
562 Ga0496100_1383597 3300048903 Unclassified 555
563 Ga0496108_0336946 3300048911 Unclassified 1316
564 Ga0496108_0700114 3300048911 Unclassified 879
565 Ga0496108_1651950 3300048911 Unclassified 529
566 Ga0496109_0044957 3300048912 Bacteria 4007
567 Ga0496112_0210259 3300048915 Bacteria 1903
568 Ga0496112_1218821 3300048915 Unclassified 669
569 Ga0496113_0848155 3300048916 Bacteria 724
570 Ga0496115_0665110 3300048918 Unclassified 822
571 Ga0501291_006822 3300049514 Unclassified 1532
572 Ga0501292_072602 3300049515 Bacteria 642
573 Ga0501031_0249836 3300049568 Bacteria 1153
574 Ga0501031_0328087 3300049568 Eukaryota 991
575 Ga0501031_0757213 3300049568 Bacteria 623
576 Ga0501032_0002274 3300049569 Bacteria 15092
577 Ga0501032_0082833 3300049569 Unclassified 2134
578 Ga0501032_0236371 3300049569 Bacteria 1187
579 Ga0501032_0245762 3300049569 Unclassified 1162
580 Ga0501033_0003489 3300049570 Bacteria 12899
581 Ga0501033_0113690 3300049570 Bacteria 1968
582 Ga0501033_0124117 3300049570 Bacteria 1872
583 Ga0501034_0075606 3300049571 Bacteria 3374
584 Ga0501034_0087559 3300049571 Unclassified 3114
585 Ga0501034_0109447 3300049571 Unclassified 2754
586 Ga0501034_0162512 3300049571 Bacteria 2203
587 Ga0501034_0166260 3300049571 Unclassified 2174
588 Ga0501034_0221490 3300049571 Bacteria 1844
589 Ga0501036_0039829 3300049572 Bacteria 3976
590 Ga0501036_0130531 3300049572 Bacteria 2121
591 Ga0501036_0298053 3300049572 Unclassified 1349
592 Ga0501036_0351672 3300049572 Bacteria 1230
593 Ga0501037_0023323 3300049573 Bacteria 4577
594 Ga0501037_0394109 3300049573 Unclassified 950
595 Ga0501038_0004704 3300049574 Bacteria 12696
596 Ga0501038_0088000 3300049574 Bacteria 2607
597 Ga0501038_0100803 3300049574 Unclassified 2405
598 Ga0501038_0179616 3300049574 Bacteria 1708
599 Ga0501039_0161261 3300049575 Unclassified 1762
600 Ga0501039_0864614 3300049575 Bacteria 704
601 Ga0501041_0287144 3300049577 Bacteria 1036
602 Ga0501042_0723274 3300049578 Bacteria 724
603 Ga0501042_0754137 3300049578 Bacteria 708
604 Ga0501043_0003501 3300049579 Bacteria 12910
605 Ga0501043_0025150 3300049579 Bacteria 4671
606 Ga0501043_0063216 3300049579 Bacteria 2906
607 Ga0501043_0073172 3300049579 Unclassified 2692
608 Ga0501043_0091892 3300049579 Unclassified 2386
609 Ga0501043_0119227 3300049579 Bacteria 2069
610 Ga0501046_0009565 3300049580 Bacteria 8364
611 Ga0501046_0039107 3300049580 Bacteria 3801
612 Ga0501046_0074351 3300049580 Bacteria 2636
613 Ga0501046_0207537 3300049580 Bacteria 1455
614 Ga0501046_0550410 3300049580 Bacteria 823
615 Ga0501047_0000775 3300049581 Bacteria 33390
616 Ga0501047_0001138 3300049581 Bacteria 26407
617 Ga0501047_0002054 3300049581 Bacteria 19237
618 Ga0501047_0022098 3300049581 Bacteria 6111
619 Ga0501047_0112357 3300049581 Bacteria 2606
620 Ga0501047_0293729 3300049581 Unclassified 1468
621 Ga0501047_0375505 3300049581 Bacteria 1256
622 Ga0501047_0580830 3300049581 Bacteria 943
623 Ga0501048_0281159 3300049582 Bacteria 1183
624 Ga0501048_0315359 3300049582 Bacteria 1113
625 Ga0501048_0508658 3300049582 Unclassified 864
626 Ga0501048_0978718 3300049582 Bacteria 608
627 Ga0501067_0021063 3300049583 Unclassified 3608
628 Ga0501067_0073873 3300049583 Unclassified 1889
629 Ga0501067_0149451 3300049583 Bacteria 1301
630 Ga0501068_0020924 3300049584 Bacteria 3817
631 Ga0501068_0324983 3300049584 Bacteria 986
632 Ga0501068_0656742 3300049584 Unclassified 685
633 Ga0501069_0032614 3300049585 Bacteria 2867
634 Ga0501070_0064425 3300049586 Bacteria 3035
635 Ga0501070_0156307 3300049586 Bacteria 1880
636 Ga0501070_1053289 3300049586 Bacteria 629
637 Ga0501072_0073763 3300049588 Bacteria 2698
638 Ga0501072_0085685 3300049588 Bacteria 2499
639 Ga0501072_0267191 3300049588 Bacteria 1361
640 Ga0501072_0656704 3300049588 Bacteria 825
641 Ga0501073_0033601 3300049589 Bacteria 3651
642 Ga0501073_0037326 3300049589 Bacteria 3450
643 Ga0501073_0179914 3300049589 Bacteria 1463
644 Ga0501073_0577706 3300049589 Bacteria 776
645 Ga0501073_1276280 3300049589 Bacteria 503
646 Ga0501074_0155934 3300049590 Bacteria 1631
647 Ga0501074_0906206 3300049590 Bacteria 620
648 Ga0501075_0036369 3300049591 Bacteria 3675
649 Ga0501075_0734450 3300049591 Unclassified 752
650 Ga0501076_0580333 3300049592 Bacteria 925
651 Ga0501076_1330302 3300049592 Bacteria 591
652 Ga0501077_0070643 3300049593 Bacteria 2213
653 Ga0501077_0291264 3300049593 Bacteria 1040
654 Ga0501233_253528 3300049668 Bacteria 530
655 Ga0501243_137937 3300049675 Bacteria 513
656 Ga0501249_081232 3300049679 Unclassified 763
657 Ga0501250_090300 3300049680 Bacteria 533
658 Ga0501251_096231 3300049681 Unclassified 537
659 Ga0501219_004349 3300049703 Bacteria 1009
660 Ga0501229_029757 3300049706 Unclassified 745
661 Ga0501079_0183738 3300049741 Bacteria 1632
662 Ga0501079_0554905 3300049741 Bacteria 903
663 Ga0501079_0557953 3300049741 Bacteria 901
664 Ga0501079_0680085 3300049741 Bacteria 810
665 Ga0501080_0000738 3300049742 Bacteria 26435
666 Ga0501080_0212323 3300049742 Unclassified 1773
667 Ga0501080_0379103 3300049742 Unclassified 1274
668 Ga0501080_0950405 3300049742 Bacteria 747
669 Ga0501081_0042793 3300049743 Bacteria 3105
670 Ga0501081_0387179 3300049743 Unclassified 1034
671 Ga0501083_0015182 3300049744 Bacteria 5392
672 Ga0501083_0261304 3300049744 Unclassified 1126
673 Ga0501264_040574 3300049761 Bacteria 570
674 Ga0501268_053482 3300049765 Unclassified 786
675 Ga0501268_158025 3300049765 Unclassified 527
676 Ga0501273_090496 3300049770 Unclassified 520
677 Ga0501035_0002768 3300049822 Bacteria 16987
678 Ga0501035_0220255 3300049822 Bacteria 1620
679 Ga0501035_0244891 3300049822 Bacteria 1524
680 Ga0501035_0319583 3300049822 Unclassified 1304
681 Ga0501035_0576486 3300049822 Bacteria 919
682 Ga0501035_0787566 3300049822 Bacteria 760
683 Ga0501035_1239513 3300049822 Unclassified 577
684 Ga0501044_0001048 3300049823 Bacteria 33230
685 Ga0501044_0028741 3300049823 Bacteria 5866
686 Ga0501044_0576921 3300049823 Bacteria 1019
687 Ga0501044_0614973 3300049823 Unclassified 978
688 Ga0501045_0772467 3300049824 Bacteria 708
689 Ga0501045_0887556 3300049824 Unclassified 655
690 nmdc:mga05p37_142922_c1 3300050507 Archaea 2931
691 nmdc:mga05p37_1446191_c1 3300050507 Unclassified 689
692 nmdc:mga05p37_487579_c1 3300050507 Bacteria 1418
693 nmdc:mga05p37_603836_c1 3300050507 Bacteria 1238
694 nmdc:mga09592_1250374_c1 3300050508 Bacteria 612
695 nmdc:mga09592_3287_c1 3300050508 Bacteria 13091
696 nmdc:mga09592_36228_c1 3300050508 Bacteria 4133
697 nmdc:mga09592_50457_c1 3300050508 Unclassified 3509
698 nmdc:mga09592_72345_c1 3300050508 Bacteria 2927
699 nmdc:mga09592_809219_c1 3300050508 Unclassified 792
700 nmdc:mga0qj67_152649_c1 3300050509 Bacteria 1874
701 nmdc:mga0qj67_223036_c1 3300050509 Bacteria 1530
702 nmdc:mga0qj67_5220_c1 3300050509 Bacteria 9479
703 nmdc:mga0qj67_58220_c1 3300050509 Unclassified 3063
704 nmdc:mga06r32_1107631_c1 3300050510 Bacteria 741
705 nmdc:mga06r32_174914_c1 3300050510 Bacteria 2131
706 nmdc:mga06r32_416637_c1 3300050510 Unclassified 1324
707 nmdc:mga06r32_55816_c1 3300050510 Unclassified 3790
708 nmdc:mga06r32_618532_c1 3300050510 Bacteria 1053
709 nmdc:mga06r32_754546_c1 3300050510 Bacteria 936
710 nmdc:mga06r32_769655_c1 3300050510 Unclassified 925
711 nmdc:mga06r32_824452_c1 3300050510 Bacteria 887
712 nmdc:mga08y16_109468_c1 3300050511 Bacteria 2876
713 nmdc:mga08y16_255051_c1 3300050511 Bacteria 1812
714 nmdc:mga08y16_63125_c1 3300050511 Bacteria 3868
715 nmdc:mga0n895_16887_c1 3300050512 Bacteria 6711
716 nmdc:mga0n895_578608_c1 3300050512 Bacteria 1127
717 nmdc:mga0n895_65557_c1 3300050512 Bacteria 3595
718 nmdc:mga0n895_988_c2 3300050512 Unclassified 2253
719 nmdc:mga0rr50_1898771_c1 3300050513 Unclassified 500
720 nmdc:mga0rr50_283082_c1 3300050513 Bacteria 1384
721 nmdc:mga0rr50_738219_c1 3300050513 Bacteria 840
722 nmdc:mga0rr50_862278_c1 3300050513 Unclassified 772
723 nmdc:mga08x19_160838_c1 3300050514 Bacteria 1525
724 nmdc:mga0a205_1335774_c1 3300050515 Bacteria 565
725 nmdc:mga0a205_17114_c1 3300050515 Bacteria 6788
726 nmdc:mga0a205_195274_c1 3300050515 Bacteria 1915
727 nmdc:mga0a205_867370_c1 3300050515 Bacteria 750
728 Ga0495601_0300901 3300053077 Unclassified 1045
729 Ga0495612_0182102 3300053078 Unclassified 923
730 Ga0500628_023390 3300053129 Unclassified 1273
731 Ga0501084_0042197 3300054114 Unclassified 3815
732 Ga0501084_0755942 3300054114 Bacteria 819
733 Ga0501084_0859442 3300054114 Unclassified 763
734 Ga0501084_1178148 3300054114 Unclassified 643
735 Ga0590071_109621 3300059421 Bacteria 700
736 Ga0590077_004435 3300059426 Bacteria 2882
737 Ga0501082_0002266 3300060353 Bacteria 16861
738 Ga0501082_0083346 3300060353 Bacteria 2758
739 Ga0501082_0588460 3300060353 Bacteria 973
740 Ga0501082_1092192 3300060353 Bacteria 697
741 Ga0307413_12107965
742 Ga0065712_10153245
743 Ga0065712_10204066
744 Ga0065707_10140256
745 Ga0070658_10311972
746 Ga0070658_11511170
747 Ga0070676_10000995
748 Ga0070683_100005838
749 Ga0070683_100010496
750 Ga0070683_100022740
751 Ga0070683_100132306
752 Ga0070683_100190488
753 Ga0070683_100554301
754 Ga0070683_101567756
755 Ga0070690_100170448
756 Ga0070690_100444299
757 Ga0070670_100000720
758 Ga0070670_100014815
759 Ga0070670_101133650
760 Ga0070677_10015292
761 Ga0068869_100024495
762 Ga0070666_10112407
763 Ga0070680_100017396
764 Ga0070680_100077761
765 Ga0070680_101134415
766 Ga0070682_100370691
767 Ga0070682_101201052
768 Ga0068868_100078603
769 Ga0068868_100238553
770 Ga0068868_101155358
771 Ga0070660_100062471
772 Ga0070660_100646092
773 Ga0070689_100070681
774 Ga0070689_100295592
775 Ga0070687_100007864
776 Ga0070687_100270620
777 Ga0070661_100007471
778 Ga0070661_100055899
779 Ga0070661_100257836
780 Ga0070661_100391298
781 Ga0070692_10003453
782 Ga0070692_11395714
783 Ga0070668_100000329
784 Ga0070668_100082299
785 Ga0070669_100010457
786 Ga0070669_100014432
787 Ga0070669_100115756
788 Ga0070675_100002585
789 Ga0070675_100010275
790 Ga0070675_101356397
791 Ga0070675_101380182
792 Ga0070671_100508881
793 Ga0070671_100872724
794 Ga0070671_101271803
795 Ga0070671_101539795
796 Ga0070674_100044425
797 Ga0070674_100058653
798 Ga0070673_100013615
799 Ga0070673_100023520
800 Ga0070673_100366449
801 Ga0070688_100072662
802 Ga0070659_100017156
803 Ga0070659_100361269
804 Ga0070659_100365710
805 Ga0070667_100014096
806 Ga0070709_10041589
807 Ga0070709_10045660
808 Ga0070714_100045852
809 Ga0070714_100221046
810 Ga0070713_100009549
811 Ga0070713_100109641
812 Ga0070713_100227117
813 Ga0070701_10006339
814 Ga0070701_10029048
815 Ga0070701_10222768
816 Ga0070711_100000102
817 Ga0070711_101080185
818 Ga0070705_100013583
819 Ga0070705_100087275
820 Ga0070705_100147403
821 Ga0070705_100878615
822 Ga0070700_100006376
823 Ga0070700_101504045
824 Ga0070694_100007905
825 Ga0070694_100011668
826 Ga0070694_100153393
827 Ga0070694_100337715
828 Ga0070694_101711273
829 Ga0070708_100075751
830 Ga0070663_100125464
831 Ga0070663_101164588
832 Ga0070662_100000076
833 Ga0070662_100010602
834 Ga0070662_100059250
835 Ga0070662_100180275
836 Ga0070681_10001178
837 Ga0070681_10001446
838 Ga0070681_10042484
839 Ga0070681_10053920
840 Ga0070681_10379214
841 Ga0070681_10425545
842 Ga0068867_100049476
843 Ga0068867_100208701
844 Ga0068867_100651064
845 Ga0070685_10000765
846 Ga0070685_10003925
847 Ga0070685_10094046
848 Ga0070706_100052759
849 Ga0070707_100038677
850 Ga0070707_100044303
851 Ga0070707_100717806
852 Ga0070698_100081596
853 Ga0070698_100402488
854 Ga0070698_100818365
855 Ga0070699_100037678
856 Ga0070699_100583480
857 Ga0070679_100000085
858 Ga0070679_100000688
859 Ga0070679_100004925
860 Ga0070679_100030669
861 Ga0070679_100085167
862 Ga0070679_100165865
863 Ga0070679_100184371
864 Ga0070679_101290200
865 Ga0070684_100004616
866 Ga0070684_100025341
867 Ga0070684_100060978
868 Ga0070684_100060984
869 Ga0070684_100067766
870 Ga0070684_100225127
871 Ga0070684_100668870
872 Ga0070684_101440747
873 Ga0070697_100024271
874 Ga0070697_100260948
875 Ga0068853_100074593
876 Ga0068853_100643819
877 Ga0070672_100036954
878 Ga0070672_100107184
879 Ga0070672_100149140
880 Ga0070686_100000312
881 Ga0070686_100847105
882 Ga0070695_100019488
883 Ga0070695_101275407
884 Ga0070696_100017017
885 Ga0070696_100019315
886 Ga0070696_100196028
887 Ga0070693_100055741
888 Ga0070665_100060114
889 Ga0070665_100115327
890 Ga0070665_100561469
891 Ga0070665_100846952
892 Ga0070704_100024971
893 Ga0070704_100067085
894 Ga0070704_100123347
895 Ga0070704_100834538
896 Ga0070704_101942548
897 Ga0068855_100054133
898 Ga0068855_101289687
899 Ga0070664_100000255
900 Ga0070664_100014337
901 Ga0070664_100084351
902 Ga0070664_100097653
903 Ga0070664_100839912
904 Ga0068857_100001041
905 Ga0068857_100018335
906 Ga0068857_100080277
907 Ga0068857_100184470
908 Ga0068857_102483875
909 Ga0068854_100137950
910 Ga0068854_100677494
911 Ga0070702_100450566
912 Ga0068852_100155823
913 Ga0068852_100257661
914 Ga0068859_100009552
915 Ga0068859_100054025
916 Ga0068859_100143207
917 Ga0068864_100010632
918 Ga0068864_100219957
919 Ga0068864_100382929
920 Ga0068866_10015774
921 Ga0068861_100000880
922 Ga0068861_100028672
923 Ga0068861_100550422
924 Ga0068851_10026126
925 Ga0068851_10169908
926 Ga0068870_10682533
927 Ga0068863_100016263
928 Ga0068863_100068140
929 Ga0068863_100356328
930 Ga0068863_100535073
931 Ga0068863_100704579
932 Ga0068858_100017236
933 Ga0068858_101016385
934 Ga0068860_100150166
935 Ga0068860_102358527
936 Ga0068862_100026985
937 Ga0068862_100043434
938 Ga0068862_100102984
939 Ga0068862_101014282
940 Ga0070716_100282888
941 Ga0070712_100017364
942 Ga0070712_100030367
943 Ga0070712_100058178
944 Ga0070712_101203254
945 Ga0097621_101005823
946 Ga0068871_100407161
947 Ga0068871_101950380
948 Ga0075428_100190507
949 Ga0075428_100255054
950 Ga0075428_100476617
951 Ga0075428_101459646
952 Ga0075428_101550629
953 Ga0075428_102178004
954 Ga0075430_100000891
955 Ga0075430_100150885
956 Ga0075430_100384966
957 Ga0075430_100944721
958 Ga0075430_101139549
959 Ga0075431_100030118
960 Ga0075431_100534394
961 Ga0075431_100560179
962 Ga0075431_100601217
963 Ga0075431_100714313
964 Ga0075431_100743931
965 Ga0075431_100786748
966 Ga0075431_100844344
967 Ga0075431_100848572
968 Ga0075431_101618486
969 Ga0075433_10072864
970 Ga0075433_10124919
971 Ga0075433_10498227
972 Ga0075433_10697068
973 Ga0075434_100007094
974 Ga0075434_100011234
975 Ga0075434_100036253
976 Ga0075429_100002582
977 Ga0075429_100039142
978 Ga0075429_100152270
979 Ga0075429_100816282
980 Ga0075429_101482068
981 Ga0068865_100088786
982 Ga0068865_100268703
983 Ga0068865_100706740
984 Ga0068865_101062524
985 Ga0068865_101119008
986 Ga0075436_100176455
987 Ga0075436_100764143
988 Ga0097620_100009551
989 Ga0097620_100054027
990 Ga0097620_100143209
991 Ga0075435_100075104
992 Ga0075435_100654458
993 Ga0099794_10001416
994 Ga0105240_11627906
995 Ga0111539_10026342
996 Ga0111539_10147644
997 Ga0111539_10235856
998 Ga0105245_10307640
999 Ga0114129_10084156
1000 Ga0114129_10087166
1001 Ga0114129_10099722
1002 Ga0114129_10407615
1003 Ga0114129_11041547
1004 Ga0105243_10468376
1005 Ga0105243_11355797
1006 Ga0105242_10063656
1007 Ga0105242_10305550
1008 Ga0105242_10482049
1009 Ga0105248_10154261
1010 Ga0105248_10335460
1011 Ga0105248_11470301
1012 Ga0105237_10238838
1013 Ga0105237_10784048
1014 Ga0105238_10006505
1015 Ga0105238_10078046
1016 Ga0105238_10267402
1017 Ga0105238_11222017
1018 Ga0105249_10012918
1019 Ga0105249_10080279
1020 Ga0105249_10138689
1021 Ga0105249_11843259
1022 Ga0105239_10028094
1023 Ga0105246_10754189
1024 Ga0105246_11199213
1025 Ga0157339_1020019
1026 Ga0157315_1037788
1027 Ga0157373_10284449
1028 Ga0157371_10057551
1029 Ga0157371_10510386
1030 Ga0157370_10221651
1031 Ga0157369_10042336
1032 Ga0157369_10216813
1033 Ga0157369_10419257
1034 Ga0157374_10022475
1035 Ga0157378_10178293
1036 Ga0163162_10009698
1037 Ga0157372_10032791
1038 Ga0157372_10421285
1039 Ga0157372_10782149
1040 Ga0157372_11992152
1041 Ga0157372_12310206
1042 Ga0157375_10088314
1043 Ga0157375_10140905
1044 Ga0157375_10588462
1045 Ga0157375_12237296
1046 Ga0157375_13544346
1047 Ga0163163_10040607
1048 Ga0163163_10476095
1049 Ga0157380_10027694
1050 Ga0157380_10068489
1051 Ga0157377_10011041
1052 Ga0157377_10135678
1053 Ga0157377_10242208
1054 Ga0157379_10015352
1055 Ga0157379_10848845
1056 Ga0157376_11178681
1057 Ga0182007_10237390
1058 Ga0163161_10027835
1059 Ga0163161_10366063
1060 Ga0206356_10535394
1061 Ga0213875_10013939
1062 Ga0207666_1021118
1063 Ga0207697_10016342
1064 Ga0207656_10220665
1065 Ga0207682_10055477
1066 Ga0207642_10288811
1067 Ga0207688_10002407
1068 Ga0207680_10066538
1069 Ga0207647_10491715
1070 Ga0207699_10201184
1071 Ga0207699_10236031
1072 Ga0207645_10003089
1073 Ga0207643_10004512
1074 Ga0207705_10289973
1075 Ga0207705_10625356
1076 Ga0207705_11528972
1077 Ga0207684_10144394
1078 Ga0207707_10010639
1079 Ga0207707_10060226
1080 Ga0207707_10315107
1081 Ga0207707_10372957
1082 Ga0207707_10428536
1083 Ga0207695_10088442
1084 Ga0207693_10040543
1085 Ga0207693_10221398
1086 Ga0207663_10010538
1087 Ga0207663_10669600
1088 Ga0207660_10004899
1089 Ga0207660_10034315
1090 Ga0207660_10050743
1091 Ga0207660_10264943
1092 Ga0207660_10345131
1093 Ga0207662_10003015
1094 Ga0207662_10076750
1095 Ga0207657_10186386
1096 Ga0207657_10520423
1097 Ga0207657_10561209
1098 Ga0207649_10037616
1099 Ga0207649_10050062
1100 Ga0207649_10226692
1101 Ga0207649_11199001
1102 Ga0207652_10012667
1103 Ga0207652_10014152
1104 Ga0207652_10022974
1105 Ga0207652_10023209
1106 Ga0207652_10107721
1107 Ga0207652_10177436
1108 Ga0207652_10997587
1109 Ga0207646_10034940
1110 Ga0207646_10038123
1111 Ga0207646_10079481
1112 Ga0207681_10039579
1113 Ga0207681_10084822
1114 Ga0207681_10258505
1115 Ga0207694_10000027
1116 Ga0207694_10367587
1117 Ga0207694_10986027
1118 Ga0207694_11312090
1119 Ga0207650_10033592
1120 Ga0207650_10179399
1121 Ga0207650_10234772
1122 Ga0207650_10573701
1123 Ga0207659_10143110
1124 Ga0207687_10976336
1125 Ga0207700_10004803
1126 Ga0207700_10008206
1127 Ga0207664_10184966
1128 Ga0207664_11128284
1129 Ga0207644_10158938
1130 Ga0207644_10455126
1131 Ga0207644_10736210
1132 Ga0207690_10017112
1133 Ga0207690_10030550
1134 Ga0207690_10123768
1135 Ga0207690_10289158
1136 Ga0207706_10000323
1137 Ga0207706_10000546
1138 Ga0207706_10035898
1139 Ga0207706_10311569
1140 Ga0207686_10293383
1141 Ga0207670_10045763
1142 Ga0207670_10148885
1143 Ga0207669_10450800
1144 Ga0207669_11255041
1145 Ga0207704_10235538
1146 Ga0207665_10318055
1147 Ga0207691_10003812
1148 Ga0207691_10009496
1149 Ga0207691_10089530
1150 Ga0207691_10091791
1151 Ga0207691_11225343
1152 Ga0207711_10265626
1153 Ga0207711_10680646
1154 Ga0207711_11141727
1155 Ga0207689_10021667
1156 Ga0207661_10006723
1157 Ga0207661_10033161
1158 Ga0207661_10039907
1159 Ga0207661_10050706
1160 Ga0207661_10085949
1161 Ga0207661_10122274
1162 Ga0207661_11351272
1163 Ga0207679_10001816
1164 Ga0207679_10018171
1165 Ga0207679_10031681
1166 Ga0207679_11173303
1167 Ga0207679_12147304
1168 Ga0207667_10041785
1169 Ga0207651_10122509
1170 Ga0207651_10285080
1171 Ga0207651_10412780
1172 Ga0207712_10040006
1173 Ga0207712_10054016
1174 Ga0207668_10023931
1175 Ga0207668_10102279
1176 Ga0207668_10423377
1177 Ga0207640_10475778
1178 Ga0207640_11398846
1179 Ga0207640_12196280
1180 Ga0207658_10013021
1181 Ga0207658_10550809
1182 Ga0207677_10446579
1183 Ga0207677_10527767
1184 Ga0207703_10017061
1185 Ga0207639_10054405
1186 Ga0207678_10024119
1187 Ga0207708_10009814
1188 Ga0207708_11695183
1189 Ga0207702_10612911
1190 Ga0207702_11451822
1191 Ga0207641_10054592
1192 Ga0207641_10260225
1193 Ga0207641_10395527
1194 Ga0207641_10492398
1195 Ga0207641_10596396
1196 Ga0207641_10731750
1197 Ga0207648_10030280
1198 Ga0207648_10066956
1199 Ga0207648_10602048
1200 Ga0207676_10034335
1201 Ga0207676_10064754
1202 Ga0207676_10589882
1203 Ga0207674_10001447
1204 Ga0207674_10004605
1205 Ga0207674_10006565
1206 Ga0207674_10039966
1207 Ga0207675_100000372
1208 Ga0207675_100070400
1209 Ga0207675_100911465
1210 Ga0207683_10261735
1211 Ga0207698_10014737
1212 Ga0207698_10276977
1213 Ga0209588_1000851
1214 Ga0207428_10030892
1215 Ga0268266_10081231
1216 Ga0268266_11205046
1217 Ga0268265_10018325
1218 Ga0268265_10033418
1219 Ga0268265_10074083
1220 Ga0268264_10119039
1221 Ga0268264_10387098
1222 Ga0268264_10434311
1223 Ga0268264_10616024
1224 Ga0307517_10268107
1225 Ga0307408_100386507
1226 Ga0307408_100740535
1227 Ga0307408_101721831
1228 Ga0307405_10015432
1229 Ga0307405_10105709
1230 Ga0307405_10164183
1231 Ga0307405_10473714
1232 Ga0307405_10854588
1233 Ga0307405_11535888
1234 Ga0307413_10167502
1235 Ga0307413_10678364
1236 Ga0307413_10902935
1237 Ga0307410_10060023
1238 Ga0307406_10011674
1239 Ga0307406_10104562
1240 Ga0307406_10341260
1241 Ga0307406_10406597
1242 Ga0307406_10447192
1243 Ga0307406_11155191
1244 Ga0307406_11500935
1245 Ga0307407_10039205
1246 Ga0307412_10042736
1247 Ga0307412_10235002
1248 Ga0307412_11366891
1249 Ga0307412_11587353
1250 Ga0307412_11905107
1251 Ga0307409_100057532
1252 Ga0307409_100495101
1253 Ga0307409_101131960
1254 Ga0307416_100003378
1255 Ga0307416_100430546
1256 Ga0307416_100660549
1257 Ga0307416_100813411
1258 Ga0307416_101778386
1259 Ga0307416_103281134
1260 Ga0307414_10470307
1261 Ga0307414_12322017
1262 Ga0307411_10129959
1263 Ga0307411_10457779
1264 Ga0307411_10509837
1265 Ga0307411_10976907
1266 Ga0307411_11329511
1267 Ga0307415_100327098
1268 Ga0307415_100500097
1269 Ga0307415_101022312
1270 Ga0307415_101076268
1271 Ga0373958_0167250
1272 Ga0373923_0669174
1273 Ga0373956_0570484
1274 Ga0373955_1006546
1275 Ga0373935_0061352
1276 Ga0395899_0223162
1277 Ga0395900_0017234
1278 Ga0395898_0083501
1279 Ga0395898_0201341
1280 Ga0395905_0016853
1281 Ga0395905_0104014
1282 Ga0395905_0689634
1283 Ga0395901_0070239
1284 Ga0395901_0103560
1285 Ga0395901_0417508
1286 Ga0436365_1097422
1287 Ga0439439_0108076
1288 Ga0451841_0335638
1289 Ga0439448_0161789
1290 Ga0466961_0011472
1291 Ga0451576_0017985
1292 Ga0451576_0202584
1293 Ga0451576_1945618
1294 Ga0495629_0318167
1295 Ga0495582_0019243
1296 Ga0495594_0006622
1297 Ga0495643_0000045
1298 Ga0495586_0801504
1299 Ga0495658_0073306
1300 Ga0495669_0022139
1301 Ga0495593_0315277
1302 Ga0496100_1383597
1303 Ga0496108_0336946
1304 Ga0496108_0700114
1305 Ga0496108_1651950
1306 Ga0496109_0044957
1307 Ga0496112_0210259
1308 Ga0496112_1218821
1309 Ga0496113_0848155
1310 Ga0496115_0665110
1311 Ga0501291_006822
1312 Ga0501292_072602
1313 Ga0501031_0249836
1314 Ga0501031_0328087
1315 Ga0501031_0757213
1316 Ga0501032_0002274
1317 Ga0501032_0082833
1318 Ga0501032_0236371
1319 Ga0501032_0245762
1320 Ga0501033_0003489
1321 Ga0501033_0113690
1322 Ga0501033_0124117
1323 Ga0501034_0075606
1324 Ga0501034_0087559
1325 Ga0501034_0109447
1326 Ga0501034_0162512
1327 Ga0501034_0166260
1328 Ga0501034_0221490
1329 Ga0501036_0039829
1330 Ga0501036_0130531
1331 Ga0501036_0298053
1332 Ga0501036_0351672
1333 Ga0501037_0023323
1334 Ga0501037_0394109
1335 Ga0501038_0004704
1336 Ga0501038_0088000
1337 Ga0501038_0100803
1338 Ga0501038_0179616
1339 Ga0501039_0161261
1340 Ga0501039_0864614
1341 Ga0501041_0287144
1342 Ga0501042_0723274
1343 Ga0501042_0754137
1344 Ga0501043_0003501
1345 Ga0501043_0025150
1346 Ga0501043_0063216
1347 Ga0501043_0073172
1348 Ga0501043_0091892
1349 Ga0501043_0119227
1350 Ga0501046_0009565
1351 Ga0501046_0039107
1352 Ga0501046_0074351
1353 Ga0501046_0207537
1354 Ga0501046_0550410
1355 Ga0501047_0000775
1356 Ga0501047_0001138
1357 Ga0501047_0002054
1358 Ga0501047_0022098
1359 Ga0501047_0112357
1360 Ga0501047_0293729
1361 Ga0501047_0375505
1362 Ga0501047_0580830
1363 Ga0501048_0281159
1364 Ga0501048_0315359
1365 Ga0501048_0508658
1366 Ga0501048_0978718
1367 Ga0501067_0021063
1368 Ga0501067_0073873
1369 Ga0501067_0149451
1370 Ga0501068_0020924
1371 Ga0501068_0324983
1372 Ga0501068_0656742
1373 Ga0501069_0032614
1374 Ga0501070_0064425
1375 Ga0501070_0156307
1376 Ga0501070_1053289
1377 Ga0501072_0073763
1378 Ga0501072_0085685
1379 Ga0501072_0267191
1380 Ga0501072_0656704
1381 Ga0501073_0033601
1382 Ga0501073_0037326
1383 Ga0501073_0179914
1384 Ga0501073_0577706
1385 Ga0501073_1276280
1386 Ga0501074_0155934
1387 Ga0501074_0906206
1388 Ga0501075_0036369
1389 Ga0501075_0734450
1390 Ga0501076_0580333
1391 Ga0501076_1330302
1392 Ga0501077_0070643
1393 Ga0501077_0291264
1394 Ga0501233_253528
1395 Ga0501243_137937
1396 Ga0501249_081232
1397 Ga0501250_090300
1398 Ga0501251_096231
1399 Ga0501219_004349
1400 Ga0501229_029757
1401 Ga0501079_0183738
1402 Ga0501079_0554905
1403 Ga0501079_0557953
1404 Ga0501079_0680085
1405 Ga0501080_0000738
1406 Ga0501080_0212323
1407 Ga0501080_0379103
1408 Ga0501080_0950405
1409 Ga0501081_0042793
1410 Ga0501081_0387179
1411 Ga0501083_0015182
1412 Ga0501083_0261304
1413 Ga0501264_040574
1414 Ga0501268_053482
1415 Ga0501268_158025
1416 Ga0501273_090496
1417 Ga0501035_0002768
1418 Ga0501035_0220255
1419 Ga0501035_0244891
1420 Ga0501035_0319583
1421 Ga0501035_0576486
1422 Ga0501035_0787566
1423 Ga0501035_1239513
1424 Ga0501044_0001048
1425 Ga0501044_0028741
1426 Ga0501044_0576921
1427 Ga0501044_0614973
1428 Ga0501045_0772467
1429 Ga0501045_0887556
1430 nmdc:mga05p37_142922_c1
1431 nmdc:mga05p37_1446191_c1
1432 nmdc:mga05p37_487579_c1
1433 nmdc:mga05p37_603836_c1
1434 nmdc:mga09592_1250374_c1
1435 nmdc:mga09592_3287_c1
1436 nmdc:mga09592_36228_c1
1437 nmdc:mga09592_50457_c1
1438 nmdc:mga09592_72345_c1
1439 nmdc:mga09592_809219_c1
1440 nmdc:mga0qj67_152649_c1
1441 nmdc:mga0qj67_223036_c1
1442 nmdc:mga0qj67_5220_c1
1443 nmdc:mga0qj67_58220_c1
1444 nmdc:mga06r32_1107631_c1
1445 nmdc:mga06r32_174914_c1
1446 nmdc:mga06r32_416637_c1
1447 nmdc:mga06r32_55816_c1
1448 nmdc:mga06r32_618532_c1
1449 nmdc:mga06r32_754546_c1
1450 nmdc:mga06r32_769655_c1
1451 nmdc:mga06r32_824452_c1
1452 nmdc:mga08y16_109468_c1
1453 nmdc:mga08y16_255051_c1
1454 nmdc:mga08y16_63125_c1
1455 nmdc:mga0n895_16887_c1
1456 nmdc:mga0n895_578608_c1
1457 nmdc:mga0n895_65557_c1
1458 nmdc:mga0n895_988_c2
1459 nmdc:mga0rr50_1898771_c1
1460 nmdc:mga0rr50_283082_c1
1461 nmdc:mga0rr50_738219_c1
1462 nmdc:mga0rr50_862278_c1
1463 nmdc:mga08x19_160838_c1
1464 nmdc:mga0a205_1335774_c1
1465 nmdc:mga0a205_17114_c1
1466 nmdc:mga0a205_195274_c1
1467 nmdc:mga0a205_867370_c1
1468 Ga0495601_0300901
1469 Ga0495612_0182102
1470 Ga0500628_023390
1471 Ga0501084_0042197
1472 Ga0501084_0755942
1473 Ga0501084_0859442
1474 Ga0501084_1178148
1475 Ga0590071_109621
1476 Ga0590077_004435
1477 Ga0501082_0002266
1478 Ga0501082_0083346
1479 Ga0501082_0588460
1480 Ga0501082_1092192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

5

117

0.99

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

2

70

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9475 9 67
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9154 7 68
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9061 6 66
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9005 7 68
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.8991 9 67
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9572 5 65 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 8 66 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9475 9 67 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.938 7 67 1.10.10.10
af_P9WMI9_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9299 6 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5SU18-F1-model_v4 deleted 0.9789 5 68
AF-A0A2D6Q9B9-F1-model_v4 ArsR family transcriptional regulator 0.9604 9 66
AF-A0A538NYA2-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9601 3 70 GO:0003677
GO:0045892
AF-A0A7C2ASF8-F1-model_v4 Orc1-like AAA ATPase domain-containing protein 0.9559 5 68
AF-A0A359M5J0-F1-model_v4 CopY family transcriptional regulator 0.9478 5 69 GO:0003677
GO:0045892

Map