F478508
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 242 | 1480 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100260442|Ga0070671_1002604422 |
| Length | 347 |
| Sequence | MSAASPRSIQRDSCAPGNRANAAFNSLSSSLPAAISVAMVKAKAPLALIAGPTASGKSALAMKVAEVTGGAIINADSAQVYRDLPILSAAPGPDDRARAEHLLYGVMDGASACSAADWAALAKTEIAHIHGQGRLPILVGGTGLYLRTLLEGIAPIPAIDPEIRATVRGASVAENLAALAPLDPVAATTLNPGDTTRIARALEVVKSSGTTLAEWQEKREGGIGRHVDLQALSLVPPRPWLYDRCDRRFADMVGHGALEEVRRLVSRGLDQNFPVMRAIGVPELSAHLRGEIDLADAVRAGQQATRRYAKRQYTWFSRQPPPDWLRFQDALEDDVIGRALELLVPAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 163 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 164 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 165 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 166 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 167 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 168 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 169 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 203 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 220 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 224 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 225 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 226 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 228 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 229 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 230 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 231 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 232 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 233 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 234 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 235 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 236 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 237 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 238 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 239 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 240 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 241 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 242 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 0.68 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 92.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100260442 | 3300005355 | Bacteria | 1474 |
| 2 | JGI24741J21665_1011162 | 3300001915 | Bacteria | 1579 |
| 3 | JGI24740J21852_10045791 | 3300001979 | Bacteria | 1288 |
| 4 | JGI24737J22298_10038997 | 3300001990 | Bacteria | 1461 |
| 5 | JGI24744J21845_10001976 | 3300002077 | Bacteria | 4144 |
| 6 | Ga0065712_10099102 | 3300005290 | Bacteria | 2100 |
| 7 | Ga0065715_10089636 | 3300005293 | Bacteria | 9123 |
| 8 | Ga0070658_10006349 | 3300005327 | Bacteria | 9580 |
| 9 | Ga0070658_10012188 | 3300005327 | Bacteria | 6901 |
| 10 | Ga0070658_10020575 | 3300005327 | Bacteria | 5289 |
| 11 | Ga0070658_10141200 | 3300005327 | Bacteria | 2012 |
| 12 | Ga0070658_10275667 | 3300005327 | Bacteria | 1431 |
| 13 | Ga0070676_10006741 | 3300005328 | Bacteria | 6151 |
| 14 | Ga0070676_10027345 | 3300005328 | Bacteria | 3234 |
| 15 | Ga0070683_100260699 | 3300005329 | Bacteria | 1649 |
| 16 | Ga0070690_100000784 | 3300005330 | Bacteria | 16113 |
| 17 | Ga0070690_100001152 | 3300005330 | Bacteria | 13610 |
| 18 | Ga0070670_100005975 | 3300005331 | Bacteria | 10300 |
| 19 | Ga0070670_100007770 | 3300005331 | Bacteria | 9125 |
| 20 | Ga0070677_10001167 | 3300005333 | Bacteria | 8432 |
| 21 | Ga0070677_10018396 | 3300005333 | Bacteria | 2515 |
| 22 | Ga0070666_10000215 | 3300005335 | Bacteria | 39675 |
| 23 | Ga0070666_10017898 | 3300005335 | Bacteria | 4546 |
| 24 | Ga0070680_100004052 | 3300005336 | Bacteria | 10965 |
| 25 | Ga0070680_100017306 | 3300005336 | Bacteria | 5680 |
| 26 | Ga0070680_100034172 | 3300005336 | Bacteria | 4100 |
| 27 | Ga0070680_100307094 | 3300005336 | Bacteria | 1345 |
| 28 | Ga0068868_100003281 | 3300005338 | Bacteria | 11260 |
| 29 | Ga0068868_100019253 | 3300005338 | Bacteria | 5113 |
| 30 | Ga0068868_100080134 | 3300005338 | Bacteria | 2616 |
| 31 | Ga0070660_100000663 | 3300005339 | Bacteria | 22744 |
| 32 | Ga0070660_100005122 | 3300005339 | Bacteria | 9053 |
| 33 | Ga0070660_100068601 | 3300005339 | Bacteria | 2764 |
| 34 | Ga0070660_100133694 | 3300005339 | Bacteria | 1986 |
| 35 | Ga0070660_100140536 | 3300005339 | Bacteria | 1937 |
| 36 | Ga0070660_100153715 | 3300005339 | Bacteria | 1851 |
| 37 | Ga0070661_100008128 | 3300005344 | Bacteria | 7238 |
| 38 | Ga0070661_100009119 | 3300005344 | Bacteria | 6857 |
| 39 | Ga0070661_100054883 | 3300005344 | Bacteria | 2918 |
| 40 | Ga0070661_100148903 | 3300005344 | Bacteria | 1769 |
| 41 | Ga0070661_100245705 | 3300005344 | Bacteria | 1379 |
| 42 | Ga0070661_100253896 | 3300005344 | Bacteria | 1358 |
| 43 | Ga0070661_100287627 | 3300005344 | Bacteria | 1277 |
| 44 | Ga0070692_10007807 | 3300005345 | Bacteria | 4739 |
| 45 | Ga0070668_100007519 | 3300005347 | Bacteria | 8090 |
| 46 | Ga0070668_100254742 | 3300005347 | Bacteria | 1458 |
| 47 | Ga0070668_100487954 | 3300005347 | Bacteria | 1065 |
| 48 | Ga0070669_100001885 | 3300005353 | Bacteria | 15125 |
| 49 | Ga0070669_100041989 | 3300005353 | Bacteria | 3327 |
| 50 | Ga0070669_100074340 | 3300005353 | Bacteria | 2519 |
| 51 | Ga0070669_100116426 | 3300005353 | Bacteria | 2034 |
| 52 | Ga0070675_100000759 | 3300005354 | Bacteria | 22530 |
| 53 | Ga0070671_100055565 | 3300005355 | Bacteria | 3293 |
| 54 | Ga0070671_100124642 | 3300005355 | Bacteria | 2169 |
| 55 | Ga0070671_100126200 | 3300005355 | Bacteria | 2154 |
| 56 | Ga0070671_100177433 | 3300005355 | Bacteria | 1803 |
| 57 | Ga0070674_100012979 | 3300005356 | Bacteria | 5133 |
| 58 | Ga0070674_100017266 | 3300005356 | Bacteria | 4536 |
| 59 | Ga0070674_100025066 | 3300005356 | Bacteria | 3878 |
| 60 | Ga0070674_100078817 | 3300005356 | Bacteria | 2348 |
| 61 | Ga0070673_100001925 | 3300005364 | Bacteria | 12477 |
| 62 | Ga0070673_100069652 | 3300005364 | Bacteria | 2820 |
| 63 | Ga0070673_100111582 | 3300005364 | Bacteria | 2268 |
| 64 | Ga0070673_100154848 | 3300005364 | Bacteria | 1944 |
| 65 | Ga0070673_100210733 | 3300005364 | Bacteria | 1678 |
| 66 | Ga0070673_100221707 | 3300005364 | Bacteria | 1637 |
| 67 | Ga0070659_100001353 | 3300005366 | Bacteria | 17645 |
| 68 | Ga0070659_100008920 | 3300005366 | Bacteria | 7350 |
| 69 | Ga0070659_100033987 | 3300005366 | Bacteria | 3965 |
| 70 | Ga0070659_100058777 | 3300005366 | Bacteria | 3036 |
| 71 | Ga0070659_100113432 | 3300005366 | Bacteria | 2189 |
| 72 | Ga0070659_100167411 | 3300005366 | Bacteria | 1799 |
| 73 | Ga0070659_100188336 | 3300005366 | Bacteria | 1695 |
| 74 | Ga0070667_100000842 | 3300005367 | Bacteria | 28434 |
| 75 | Ga0070667_100003257 | 3300005367 | Bacteria | 13876 |
| 76 | Ga0070667_100024685 | 3300005367 | Bacteria | 4994 |
| 77 | Ga0070667_100036753 | 3300005367 | Bacteria | 4106 |
| 78 | Ga0070667_100169169 | 3300005367 | Bacteria | 1929 |
| 79 | Ga0070667_100310877 | 3300005367 | Bacteria | 1420 |
| 80 | Ga0070667_100548462 | 3300005367 | Bacteria | 1062 |
| 81 | Ga0070714_100364959 | 3300005435 | Bacteria | 1358 |
| 82 | Ga0070701_10005692 | 3300005438 | Bacteria | 5177 |
| 83 | Ga0070694_100021107 | 3300005444 | Bacteria | 4159 |
| 84 | Ga0070663_100003093 | 3300005455 | Bacteria | 9514 |
| 85 | Ga0070663_100005871 | 3300005455 | Bacteria | 7339 |
| 86 | Ga0070663_100019346 | 3300005455 | Bacteria | 4485 |
| 87 | Ga0070663_100135690 | 3300005455 | Bacteria | 1873 |
| 88 | Ga0070663_100173091 | 3300005455 | Bacteria | 1670 |
| 89 | Ga0070663_100186155 | 3300005455 | Bacteria | 1613 |
| 90 | Ga0070663_100239533 | 3300005455 | Bacteria | 1431 |
| 91 | Ga0070662_100004937 | 3300005457 | Bacteria | 8476 |
| 92 | Ga0070662_100006830 | 3300005457 | Bacteria | 7379 |
| 93 | Ga0070662_100013241 | 3300005457 | Bacteria | 5484 |
| 94 | Ga0070662_100020310 | 3300005457 | Bacteria | 4522 |
| 95 | Ga0070662_100044894 | 3300005457 | Bacteria | 3168 |
| 96 | Ga0070681_10058359 | 3300005458 | Bacteria | 3839 |
| 97 | Ga0070681_10067292 | 3300005458 | Bacteria | 3550 |
| 98 | Ga0070681_10138383 | 3300005458 | Bacteria | 2364 |
| 99 | Ga0070681_10477146 | 3300005458 | Bacteria | 1160 |
| 100 | Ga0068867_100009232 | 3300005459 | Bacteria | 6961 |
| 101 | Ga0068867_100014104 | 3300005459 | Bacteria | 5661 |
| 102 | Ga0068867_100044500 | 3300005459 | Bacteria | 3252 |
| 103 | Ga0070679_100030476 | 3300005530 | Bacteria | 5325 |
| 104 | Ga0070679_100094869 | 3300005530 | Bacteria | 2971 |
| 105 | Ga0070679_100151872 | 3300005530 | Bacteria | 2292 |
| 106 | Ga0070679_100181424 | 3300005530 | Bacteria | 2077 |
| 107 | Ga0070679_100243233 | 3300005530 | Bacteria | 1757 |
| 108 | Ga0068853_100008551 | 3300005539 | Bacteria | 8225 |
| 109 | Ga0068853_100010924 | 3300005539 | Bacteria | 7359 |
| 110 | Ga0068853_100013390 | 3300005539 | Bacteria | 6695 |
| 111 | Ga0068853_100033149 | 3300005539 | Bacteria | 4380 |
| 112 | Ga0068853_100044838 | 3300005539 | Bacteria | 3786 |
| 113 | Ga0068853_100048971 | 3300005539 | Bacteria | 3630 |
| 114 | Ga0068853_100079701 | 3300005539 | Bacteria | 2864 |
| 115 | Ga0068853_100100619 | 3300005539 | Bacteria | 2555 |
| 116 | Ga0068853_100199547 | 3300005539 | Bacteria | 1820 |
| 117 | Ga0070672_100009674 | 3300005543 | Bacteria | 6655 |
| 118 | Ga0070672_100044818 | 3300005543 | Bacteria | 3418 |
| 119 | Ga0070672_100045010 | 3300005543 | Bacteria | 3411 |
| 120 | Ga0070672_100053815 | 3300005543 | Bacteria | 3148 |
| 121 | Ga0070672_100095954 | 3300005543 | Bacteria | 2398 |
| 122 | Ga0070672_100220558 | 3300005543 | Bacteria | 1590 |
| 123 | Ga0070686_100038860 | 3300005544 | Bacteria | 2962 |
| 124 | Ga0070686_100181599 | 3300005544 | Bacteria | 1495 |
| 125 | Ga0070695_100023208 | 3300005545 | Bacteria | 3810 |
| 126 | Ga0070696_100245573 | 3300005546 | Bacteria | 1352 |
| 127 | Ga0070696_100267599 | 3300005546 | Bacteria | 1298 |
| 128 | Ga0070693_100158427 | 3300005547 | Bacteria | 1440 |
| 129 | Ga0070665_100107109 | 3300005548 | Bacteria | 2797 |
| 130 | Ga0070665_100159140 | 3300005548 | Bacteria | 2260 |
| 131 | Ga0068855_100004077 | 3300005563 | Bacteria | 17825 |
| 132 | Ga0068855_100059086 | 3300005563 | Bacteria | 4488 |
| 133 | Ga0070664_100012706 | 3300005564 | Bacteria | 6855 |
| 134 | Ga0070664_100394996 | 3300005564 | Bacteria | 1264 |
| 135 | Ga0068857_100176859 | 3300005577 | Bacteria | 1941 |
| 136 | Ga0068857_100222472 | 3300005577 | Bacteria | 1724 |
| 137 | Ga0068854_100014916 | 3300005578 | Bacteria | 5131 |
| 138 | Ga0068854_100051990 | 3300005578 | Bacteria | 2937 |
| 139 | Ga0068854_100176291 | 3300005578 | Bacteria | 1667 |
| 140 | Ga0068856_100232987 | 3300005614 | Bacteria | 1857 |
| 141 | Ga0068852_100079436 | 3300005616 | Bacteria | 2906 |
| 142 | Ga0068859_100002127 | 3300005617 | Bacteria | 20162 |
| 143 | Ga0068859_100008265 | 3300005617 | Bacteria | 10551 |
| 144 | Ga0068859_100123270 | 3300005617 | Bacteria | 2659 |
| 145 | Ga0068859_100327922 | 3300005617 | Bacteria | 1625 |
| 146 | Ga0068864_100001398 | 3300005618 | Bacteria | 19967 |
| 147 | Ga0068864_100004613 | 3300005618 | Bacteria | 11303 |
| 148 | Ga0068864_100006944 | 3300005618 | Bacteria | 9290 |
| 149 | Ga0068864_100013870 | 3300005618 | Bacteria | 6679 |
| 150 | Ga0068864_100026940 | 3300005618 | Bacteria | 4849 |
| 151 | Ga0068864_100049060 | 3300005618 | Bacteria | 3631 |
| 152 | Ga0068864_100127959 | 3300005618 | Bacteria | 2278 |
| 153 | Ga0068864_100187383 | 3300005618 | Bacteria | 1895 |
| 154 | Ga0068864_100229577 | 3300005618 | Bacteria | 1716 |
| 155 | Ga0068861_100014738 | 3300005719 | Bacteria | 5491 |
| 156 | Ga0068861_100077498 | 3300005719 | Bacteria | 2593 |
| 157 | Ga0068851_10003121 | 3300005834 | Bacteria | 7345 |
| 158 | Ga0068863_100002134 | 3300005841 | Bacteria | 19629 |
| 159 | Ga0068863_100007871 | 3300005841 | Bacteria | 10422 |
| 160 | Ga0068863_100191790 | 3300005841 | Bacteria | 1964 |
| 161 | Ga0068858_100001703 | 3300005842 | Bacteria | 22460 |
| 162 | Ga0068858_100002540 | 3300005842 | Bacteria | 18402 |
| 163 | Ga0068858_100015929 | 3300005842 | Bacteria | 7063 |
| 164 | Ga0068858_100248322 | 3300005842 | Bacteria | 1690 |
| 165 | Ga0068858_100261938 | 3300005842 | Bacteria | 1644 |
| 166 | Ga0068860_100007762 | 3300005843 | Bacteria | 10719 |
| 167 | Ga0068860_100039949 | 3300005843 | Bacteria | 4486 |
| 168 | Ga0068860_100074072 | 3300005843 | Bacteria | 3237 |
| 169 | Ga0068860_100074228 | 3300005843 | Bacteria | 3234 |
| 170 | Ga0068860_100105517 | 3300005843 | Bacteria | 2691 |
| 171 | Ga0068860_100182085 | 3300005843 | Bacteria | 2031 |
| 172 | Ga0068860_100219516 | 3300005843 | Bacteria | 1846 |
| 173 | Ga0068860_100277498 | 3300005843 | Bacteria | 1637 |
| 174 | Ga0068862_100006460 | 3300005844 | Bacteria | 9741 |
| 175 | Ga0068862_100067335 | 3300005844 | Bacteria | 3087 |
| 176 | Ga0097621_100027711 | 3300006237 | Bacteria | 4458 |
| 177 | Ga0097621_100443679 | 3300006237 | Bacteria | 1168 |
| 178 | Ga0068865_100007079 | 3300006881 | Bacteria | 6886 |
| 179 | Ga0068865_100027328 | 3300006881 | Bacteria | 3768 |
| 180 | Ga0097620_100002127 | 3300006931 | Bacteria | 20162 |
| 181 | Ga0097620_100008265 | 3300006931 | Bacteria | 10551 |
| 182 | Ga0097620_100123273 | 3300006931 | Bacteria | 2659 |
| 183 | Ga0097620_100327946 | 3300006931 | Bacteria | 1625 |
| 184 | Ga0105250_10008038 | 3300009092 | Bacteria | 4500 |
| 185 | Ga0105240_10045821 | 3300009093 | Bacteria | 5546 |
| 186 | Ga0105240_10216299 | 3300009093 | Bacteria | 2235 |
| 187 | Ga0105240_10508440 | 3300009093 | Bacteria | 1339 |
| 188 | Ga0111539_10021092 | 3300009094 | Bacteria | 8022 |
| 189 | Ga0105245_10096995 | 3300009098 | Bacteria | 2722 |
| 190 | Ga0105245_10149475 | 3300009098 | Bacteria | 2207 |
| 191 | Ga0105243_10107470 | 3300009148 | Bacteria | 2327 |
| 192 | Ga0105243_10354531 | 3300009148 | Bacteria | 1348 |
| 193 | Ga0105241_10244635 | 3300009174 | Bacteria | 1518 |
| 194 | Ga0105241_10433206 | 3300009174 | Bacteria | 1160 |
| 195 | Ga0105242_10014632 | 3300009176 | Bacteria | 6074 |
| 196 | Ga0105242_10357977 | 3300009176 | Bacteria | 1350 |
| 197 | Ga0105248_10000362 | 3300009177 | Bacteria | 53018 |
| 198 | Ga0105248_10000395 | 3300009177 | Bacteria | 50389 |
| 199 | Ga0105248_10004448 | 3300009177 | Bacteria | 15515 |
| 200 | Ga0105248_10004830 | 3300009177 | Bacteria | 14916 |
| 201 | Ga0105248_10023356 | 3300009177 | Bacteria | 6869 |
| 202 | Ga0105248_10039629 | 3300009177 | Bacteria | 5279 |
| 203 | Ga0105248_10044452 | 3300009177 | Bacteria | 4980 |
| 204 | Ga0105248_10050197 | 3300009177 | Bacteria | 4678 |
| 205 | Ga0105248_10110896 | 3300009177 | Bacteria | 3094 |
| 206 | Ga0105248_10133234 | 3300009177 | Bacteria | 2804 |
| 207 | Ga0105238_10046386 | 3300009551 | Bacteria | 4386 |
| 208 | Ga0105238_10061956 | 3300009551 | Bacteria | 3742 |
| 209 | Ga0105238_10084001 | 3300009551 | Bacteria | 3173 |
| 210 | Ga0105249_10004822 | 3300009553 | Bacteria | 11640 |
| 211 | Ga0105249_10704690 | 3300009553 | Bacteria | 1070 |
| 212 | Ga0105239_10113307 | 3300010375 | Bacteria | 3007 |
| 213 | Ga0105239_10289096 | 3300010375 | Bacteria | 1846 |
| 214 | Ga0105246_10051837 | 3300011119 | Bacteria | 2819 |
| 215 | Ga0157373_10003524 | 3300013100 | Bacteria | 11831 |
| 216 | Ga0157373_10019290 | 3300013100 | Bacteria | 4967 |
| 217 | Ga0157371_10004743 | 3300013102 | Bacteria | 11729 |
| 218 | Ga0157371_10031437 | 3300013102 | Bacteria | 3824 |
| 219 | Ga0157371_10042251 | 3300013102 | Bacteria | 3249 |
| 220 | Ga0157371_10089141 | 3300013102 | Bacteria | 2184 |
| 221 | Ga0157371_10102013 | 3300013102 | Bacteria | 2035 |
| 222 | Ga0157370_10036438 | 3300013104 | Bacteria | 4773 |
| 223 | Ga0157370_10040187 | 3300013104 | Bacteria | 4517 |
| 224 | Ga0157370_10041548 | 3300013104 | Bacteria | 4435 |
| 225 | Ga0157370_10155289 | 3300013104 | Bacteria | 2129 |
| 226 | Ga0157370_10343300 | 3300013104 | Bacteria | 1376 |
| 227 | Ga0157369_10014904 | 3300013105 | Bacteria | 8774 |
| 228 | Ga0157369_10192019 | 3300013105 | Bacteria | 2145 |
| 229 | Ga0157369_10201630 | 3300013105 | Bacteria | 2088 |
| 230 | Ga0157369_10515701 | 3300013105 | Bacteria | 1237 |
| 231 | Ga0157378_10081948 | 3300013297 | Bacteria | 2917 |
| 232 | Ga0157378_10106380 | 3300013297 | Bacteria | 2566 |
| 233 | Ga0163162_10030851 | 3300013306 | Bacteria | 5312 |
| 234 | Ga0163162_10044637 | 3300013306 | Bacteria | 4439 |
| 235 | Ga0163162_10053226 | 3300013306 | Bacteria | 4068 |
| 236 | Ga0163162_10093730 | 3300013306 | Bacteria | 3088 |
| 237 | Ga0163162_10352654 | 3300013306 | Bacteria | 1604 |
| 238 | Ga0163162_10494247 | 3300013306 | Bacteria | 1354 |
| 239 | Ga0163162_10516884 | 3300013306 | Bacteria | 1324 |
| 240 | Ga0157372_10290859 | 3300013307 | Bacteria | 1900 |
| 241 | Ga0157372_10507895 | 3300013307 | Bacteria | 1405 |
| 242 | Ga0157372_10719948 | 3300013307 | Bacteria | 1161 |
| 243 | Ga0157375_10015558 | 3300013308 | Bacteria | 6814 |
| 244 | Ga0157375_10044266 | 3300013308 | Bacteria | 4323 |
| 245 | Ga0157375_10135319 | 3300013308 | Bacteria | 2587 |
| 246 | Ga0157375_10214795 | 3300013308 | Bacteria | 2081 |
| 247 | Ga0157375_10455671 | 3300013308 | Bacteria | 1444 |
| 248 | Ga0163163_10001203 | 3300014325 | Bacteria | 21898 |
| 249 | Ga0163163_10004004 | 3300014325 | Bacteria | 12569 |
| 250 | Ga0163163_10232748 | 3300014325 | Bacteria | 1892 |
| 251 | Ga0157380_10002495 | 3300014326 | Bacteria | 12405 |
| 252 | Ga0157380_10007684 | 3300014326 | Bacteria | 7672 |
| 253 | Ga0157380_10105118 | 3300014326 | Bacteria | 2360 |
| 254 | Ga0157380_10138676 | 3300014326 | Bacteria | 2086 |
| 255 | Ga0157377_10080376 | 3300014745 | Bacteria | 1904 |
| 256 | Ga0157377_10102844 | 3300014745 | Bacteria | 1705 |
| 257 | Ga0157379_10037628 | 3300014968 | Bacteria | 4316 |
| 258 | Ga0157379_10130183 | 3300014968 | Bacteria | 2264 |
| 259 | Ga0157379_10136323 | 3300014968 | Bacteria | 2212 |
| 260 | Ga0157379_10193334 | 3300014968 | Bacteria | 1839 |
| 261 | Ga0157379_10285682 | 3300014968 | Bacteria | 1502 |
| 262 | Ga0163161_10033191 | 3300017792 | Bacteria | 3688 |
| 263 | Ga0163161_10040426 | 3300017792 | Bacteria | 3350 |
| 264 | Ga0163161_10065892 | 3300017792 | Bacteria | 2643 |
| 265 | Ga0206353_11413780 | 3300020082 | Bacteria | 3011 |
| 266 | Ga0207697_10000927 | 3300025315 | Bacteria | 16534 |
| 267 | Ga0207697_10009191 | 3300025315 | Bacteria | 4277 |
| 268 | Ga0207697_10042058 | 3300025315 | Bacteria | 1877 |
| 269 | Ga0207656_10017215 | 3300025321 | Bacteria | 2827 |
| 270 | Ga0207682_10002411 | 3300025893 | Bacteria | 8417 |
| 271 | Ga0207688_10010155 | 3300025901 | Bacteria | 5123 |
| 272 | Ga0207680_10000626 | 3300025903 | Bacteria | 16644 |
| 273 | Ga0207680_10083606 | 3300025903 | Bacteria | 2012 |
| 274 | Ga0207647_10000339 | 3300025904 | Bacteria | 38180 |
| 275 | Ga0207647_10041294 | 3300025904 | Bacteria | 2901 |
| 276 | Ga0207647_10056512 | 3300025904 | Bacteria | 2408 |
| 277 | Ga0207645_10011234 | 3300025907 | Bacteria | 6125 |
| 278 | Ga0207645_10059349 | 3300025907 | Bacteria | 2443 |
| 279 | Ga0207645_10103135 | 3300025907 | Bacteria | 1841 |
| 280 | Ga0207705_10001142 | 3300025909 | Bacteria | 21619 |
| 281 | Ga0207705_10003304 | 3300025909 | Bacteria | 12267 |
| 282 | Ga0207705_10012711 | 3300025909 | Bacteria | 6075 |
| 283 | Ga0207705_10021695 | 3300025909 | Bacteria | 4581 |
| 284 | Ga0207705_10067664 | 3300025909 | Bacteria | 2585 |
| 285 | Ga0207705_10082612 | 3300025909 | Bacteria | 2343 |
| 286 | Ga0207660_10000140 | 3300025917 | Bacteria | 43651 |
| 287 | Ga0207660_10012082 | 3300025917 | Bacteria | 5644 |
| 288 | Ga0207657_10000020 | 3300025919 | Bacteria | 157826 |
| 289 | Ga0207657_10001366 | 3300025919 | Bacteria | 26016 |
| 290 | Ga0207657_10003566 | 3300025919 | Bacteria | 16604 |
| 291 | Ga0207657_10004033 | 3300025919 | Bacteria | 15600 |
| 292 | Ga0207657_10007910 | 3300025919 | Bacteria | 10842 |
| 293 | Ga0207657_10041186 | 3300025919 | Bacteria | 4086 |
| 294 | Ga0207657_10043574 | 3300025919 | Bacteria | 3951 |
| 295 | Ga0207657_10048372 | 3300025919 | Bacteria | 3714 |
| 296 | Ga0207657_10147728 | 3300025919 | Bacteria | 1916 |
| 297 | Ga0207657_10169066 | 3300025919 | Bacteria | 1772 |
| 298 | Ga0207657_10263734 | 3300025919 | Bacteria | 1370 |
| 299 | Ga0207657_10314244 | 3300025919 | Bacteria | 1239 |
| 300 | Ga0207649_10030791 | 3300025920 | Bacteria | 3182 |
| 301 | Ga0207652_10048837 | 3300025921 | Bacteria | 3619 |
| 302 | Ga0207652_10058671 | 3300025921 | Bacteria | 3316 |
| 303 | Ga0207652_10226886 | 3300025921 | Bacteria | 1684 |
| 304 | Ga0207681_10006995 | 3300025923 | Bacteria | 6923 |
| 305 | Ga0207681_10133344 | 3300025923 | Bacteria | 1839 |
| 306 | Ga0207681_10162094 | 3300025923 | Bacteria | 1687 |
| 307 | Ga0207681_10175896 | 3300025923 | Bacteria | 1626 |
| 308 | Ga0207694_10018205 | 3300025924 | Bacteria | 5310 |
| 309 | Ga0207650_10006327 | 3300025925 | Bacteria | 8068 |
| 310 | Ga0207650_10007606 | 3300025925 | Bacteria | 7386 |
| 311 | Ga0207650_10103454 | 3300025925 | Bacteria | 2196 |
| 312 | Ga0207650_10105414 | 3300025925 | Bacteria | 2176 |
| 313 | Ga0207659_10002265 | 3300025926 | Bacteria | 11450 |
| 314 | Ga0207659_10026739 | 3300025926 | Bacteria | 3897 |
| 315 | Ga0207659_10121598 | 3300025926 | Bacteria | 2001 |
| 316 | Ga0207687_10166120 | 3300025927 | Bacteria | 1698 |
| 317 | Ga0207664_10393544 | 3300025929 | Bacteria | 1232 |
| 318 | Ga0207644_10000324 | 3300025931 | Bacteria | 31071 |
| 319 | Ga0207644_10028714 | 3300025931 | Bacteria | 3854 |
| 320 | Ga0207644_10043502 | 3300025931 | Bacteria | 3187 |
| 321 | Ga0207644_10047379 | 3300025931 | Bacteria | 3067 |
| 322 | Ga0207644_10089812 | 3300025931 | Bacteria | 2287 |
| 323 | Ga0207644_10117466 | 3300025931 | Bacteria | 2020 |
| 324 | Ga0207690_10009242 | 3300025932 | Bacteria | 5854 |
| 325 | Ga0207690_10013571 | 3300025932 | Bacteria | 4898 |
| 326 | Ga0207690_10041125 | 3300025932 | Bacteria | 3028 |
| 327 | Ga0207690_10122747 | 3300025932 | Bacteria | 1889 |
| 328 | Ga0207690_10152367 | 3300025932 | Bacteria | 1715 |
| 329 | Ga0207706_10004058 | 3300025933 | Bacteria | 13845 |
| 330 | Ga0207706_10004109 | 3300025933 | Bacteria | 13739 |
| 331 | Ga0207706_10008737 | 3300025933 | Bacteria | 9326 |
| 332 | Ga0207706_10020444 | 3300025933 | Bacteria | 5952 |
| 333 | Ga0207706_10052239 | 3300025933 | Bacteria | 3608 |
| 334 | Ga0207706_10053416 | 3300025933 | Bacteria | 3567 |
| 335 | Ga0207706_10056986 | 3300025933 | Bacteria | 3443 |
| 336 | Ga0207706_10279295 | 3300025933 | Bacteria | 1457 |
| 337 | Ga0207686_10050495 | 3300025934 | Bacteria | 2586 |
| 338 | Ga0207709_10121323 | 3300025935 | Bacteria | 1765 |
| 339 | Ga0207709_10153998 | 3300025935 | Bacteria | 1595 |
| 340 | Ga0207669_10002475 | 3300025937 | Bacteria | 7880 |
| 341 | Ga0207669_10056487 | 3300025937 | Bacteria | 2384 |
| 342 | Ga0207669_10137595 | 3300025937 | Bacteria | 1690 |
| 343 | Ga0207704_10012434 | 3300025938 | Bacteria | 4225 |
| 344 | Ga0207691_10000915 | 3300025940 | Bacteria | 29231 |
| 345 | Ga0207691_10001856 | 3300025940 | Bacteria | 20649 |
| 346 | Ga0207691_10012965 | 3300025940 | Bacteria | 7983 |
| 347 | Ga0207691_10034786 | 3300025940 | Bacteria | 4682 |
| 348 | Ga0207691_10044565 | 3300025940 | Bacteria | 4081 |
| 349 | Ga0207691_10118481 | 3300025940 | Bacteria | 2349 |
| 350 | Ga0207691_10310035 | 3300025940 | Bacteria | 1354 |
| 351 | Ga0207711_10000429 | 3300025941 | Bacteria | 43981 |
| 352 | Ga0207711_10000610 | 3300025941 | Bacteria | 36080 |
| 353 | Ga0207711_10002544 | 3300025941 | Bacteria | 16237 |
| 354 | Ga0207711_10004237 | 3300025941 | Bacteria | 12275 |
| 355 | Ga0207711_10029458 | 3300025941 | Bacteria | 4631 |
| 356 | Ga0207711_10034390 | 3300025941 | Bacteria | 4292 |
| 357 | Ga0207711_10058671 | 3300025941 | Bacteria | 3313 |
| 358 | Ga0207711_10141459 | 3300025941 | Bacteria | 2165 |
| 359 | Ga0207711_10388792 | 3300025941 | Bacteria | 1295 |
| 360 | Ga0207689_10002262 | 3300025942 | Bacteria | 18047 |
| 361 | Ga0207679_10018161 | 3300025945 | Bacteria | 4707 |
| 362 | Ga0207679_10055146 | 3300025945 | Bacteria | 2928 |
| 363 | Ga0207679_10344618 | 3300025945 | Bacteria | 1297 |
| 364 | Ga0207667_10002757 | 3300025949 | Bacteria | 21723 |
| 365 | Ga0207651_10000378 | 3300025960 | Bacteria | 18962 |
| 366 | Ga0207651_10002434 | 3300025960 | Bacteria | 8899 |
| 367 | Ga0207651_10111161 | 3300025960 | Bacteria | 2057 |
| 368 | Ga0207651_10158227 | 3300025960 | Bacteria | 1772 |
| 369 | Ga0207651_10160365 | 3300025960 | Bacteria | 1762 |
| 370 | Ga0207712_10016256 | 3300025961 | Bacteria | 4814 |
| 371 | Ga0207668_10006711 | 3300025972 | Bacteria | 6807 |
| 372 | Ga0207640_10009307 | 3300025981 | Bacteria | 5496 |
| 373 | Ga0207640_10042095 | 3300025981 | Bacteria | 2910 |
| 374 | Ga0207658_10001871 | 3300025986 | Bacteria | 15758 |
| 375 | Ga0207658_10003528 | 3300025986 | Bacteria | 11039 |
| 376 | Ga0207658_10005525 | 3300025986 | Bacteria | 8664 |
| 377 | Ga0207658_10057889 | 3300025986 | Bacteria | 2882 |
| 378 | Ga0207658_10090752 | 3300025986 | Bacteria | 2369 |
| 379 | Ga0207677_10003982 | 3300026023 | Bacteria | 7879 |
| 380 | Ga0207677_10031985 | 3300026023 | Bacteria | 3377 |
| 381 | Ga0207703_10006106 | 3300026035 | Bacteria | 9638 |
| 382 | Ga0207703_10017409 | 3300026035 | Bacteria | 5609 |
| 383 | Ga0207703_10025682 | 3300026035 | Bacteria | 4634 |
| 384 | Ga0207703_10048214 | 3300026035 | Bacteria | 3437 |
| 385 | Ga0207639_10002451 | 3300026041 | Bacteria | 12445 |
| 386 | Ga0207639_10036236 | 3300026041 | Bacteria | 3654 |
| 387 | Ga0207639_10064020 | 3300026041 | Bacteria | 2850 |
| 388 | Ga0207639_10152743 | 3300026041 | Bacteria | 1936 |
| 389 | Ga0207639_10299800 | 3300026041 | Bacteria | 1420 |
| 390 | Ga0207678_10005111 | 3300026067 | Bacteria | 11770 |
| 391 | Ga0207678_10032329 | 3300026067 | Bacteria | 4559 |
| 392 | Ga0207678_10060984 | 3300026067 | Bacteria | 3243 |
| 393 | Ga0207678_10165177 | 3300026067 | Bacteria | 1890 |
| 394 | Ga0207702_10030613 | 3300026078 | Bacteria | 4484 |
| 395 | Ga0207641_10002148 | 3300026088 | Bacteria | 18577 |
| 396 | Ga0207641_10006264 | 3300026088 | Bacteria | 10065 |
| 397 | Ga0207641_10167744 | 3300026088 | Bacteria | 2001 |
| 398 | Ga0207648_10013267 | 3300026089 | Bacteria | 7677 |
| 399 | Ga0207648_10021875 | 3300026089 | Bacteria | 5745 |
| 400 | Ga0207648_10022350 | 3300026089 | Bacteria | 5683 |
| 401 | Ga0207648_10023740 | 3300026089 | Bacteria | 5487 |
| 402 | Ga0207676_10007920 | 3300026095 | Bacteria | 7559 |
| 403 | Ga0207676_10019201 | 3300026095 | Bacteria | 4982 |
| 404 | Ga0207676_10064276 | 3300026095 | Bacteria | 2917 |
| 405 | Ga0207676_10132092 | 3300026095 | Bacteria | 2124 |
| 406 | Ga0207676_10573893 | 3300026095 | Bacteria | 1080 |
| 407 | Ga0207674_10037383 | 3300026116 | Bacteria | 5050 |
| 408 | Ga0207674_10037696 | 3300026116 | Bacteria | 5024 |
| 409 | Ga0207674_10059771 | 3300026116 | Bacteria | 3856 |
| 410 | Ga0207675_100011697 | 3300026118 | Bacteria | 8206 |
| 411 | Ga0207683_10003409 | 3300026121 | Bacteria | 13837 |
| 412 | Ga0207698_10213981 | 3300026142 | Bacteria | 1736 |
| 413 | Ga0268266_10009752 | 3300028379 | Bacteria | 8447 |
| 414 | Ga0268266_10083841 | 3300028379 | Bacteria | 2782 |
| 415 | Ga0268266_10147620 | 3300028379 | Bacteria | 2116 |
| 416 | Ga0268265_10007581 | 3300028380 | Bacteria | 7321 |
| 417 | Ga0268265_10008543 | 3300028380 | Bacteria | 6922 |
| 418 | Ga0268265_10021023 | 3300028380 | Bacteria | 4564 |
| 419 | Ga0268264_10005351 | 3300028381 | Bacteria | 10879 |
| 420 | Ga0268264_10232928 | 3300028381 | Bacteria | 1702 |
| 421 | Ga0268264_10271156 | 3300028381 | Bacteria | 1585 |
| 422 | Ga0268264_10290261 | 3300028381 | Bacteria | 1536 |
| 423 | Ga0316182_1337346 | 3300030745 | Bacteria | 1764 |
| 424 | Ga0307408_100053920 | 3300031548 | Bacteria | 2906 |
| 425 | Ga0307408_100057257 | 3300031548 | Bacteria | 2829 |
| 426 | Ga0307408_100062616 | 3300031548 | Bacteria | 2719 |
| 427 | Ga0307408_100138666 | 3300031548 | Bacteria | 1906 |
| 428 | Ga0307408_100150670 | 3300031548 | Bacteria | 1835 |
| 429 | Ga0307408_100205013 | 3300031548 | Bacteria | 1599 |
| 430 | Ga0307405_10020665 | 3300031731 | Bacteria | 3683 |
| 431 | Ga0307405_10055410 | 3300031731 | Bacteria | 2481 |
| 432 | Ga0307405_10059872 | 3300031731 | Bacteria | 2401 |
| 433 | Ga0307405_10219337 | 3300031731 | Bacteria | 1394 |
| 434 | Ga0307405_10226453 | 3300031731 | Bacteria | 1375 |
| 435 | Ga0307413_10002121 | 3300031824 | Bacteria | 7956 |
| 436 | Ga0307413_10003459 | 3300031824 | Bacteria | 6647 |
| 437 | Ga0307413_10007360 | 3300031824 | Bacteria | 5107 |
| 438 | Ga0307413_10025511 | 3300031824 | Bacteria | 3241 |
| 439 | Ga0307413_10025931 | 3300031824 | Bacteria | 3222 |
| 440 | Ga0307413_10051349 | 3300031824 | Bacteria | 2484 |
| 441 | Ga0307413_10070193 | 3300031824 | Bacteria | 2201 |
| 442 | Ga0307413_10074113 | 3300031824 | Bacteria | 2154 |
| 443 | Ga0307413_10113855 | 3300031824 | Bacteria | 1817 |
| 444 | Ga0307413_10214601 | 3300031824 | Bacteria | 1400 |
| 445 | Ga0307410_10000582 | 3300031852 | Bacteria | 15008 |
| 446 | Ga0307410_10006823 | 3300031852 | Bacteria | 6199 |
| 447 | Ga0307410_10014820 | 3300031852 | Bacteria | 4602 |
| 448 | Ga0307410_10077697 | 3300031852 | Bacteria | 2321 |
| 449 | Ga0307410_10082024 | 3300031852 | Bacteria | 2267 |
| 450 | Ga0307410_10133301 | 3300031852 | Bacteria | 1828 |
| 451 | Ga0307410_10155262 | 3300031852 | Bacteria | 1708 |
| 452 | Ga0307406_10020099 | 3300031901 | Bacteria | 3927 |
| 453 | Ga0307406_10041590 | 3300031901 | Bacteria | 2864 |
| 454 | Ga0307406_10052027 | 3300031901 | Bacteria | 2603 |
| 455 | Ga0307406_10057799 | 3300031901 | Bacteria | 2490 |
| 456 | Ga0307406_10100383 | 3300031901 | Bacteria | 1970 |
| 457 | Ga0307406_10111370 | 3300031901 | Bacteria | 1885 |
| 458 | Ga0307406_10121872 | 3300031901 | Bacteria | 1815 |
| 459 | Ga0307406_10282623 | 3300031901 | Bacteria | 1266 |
| 460 | Ga0307407_10002061 | 3300031903 | Bacteria | 7692 |
| 461 | Ga0307407_10008454 | 3300031903 | Bacteria | 4728 |
| 462 | Ga0307407_10009916 | 3300031903 | Bacteria | 4462 |
| 463 | Ga0307407_10024424 | 3300031903 | Bacteria | 3170 |
| 464 | Ga0307407_10053392 | 3300031903 | Bacteria | 2325 |
| 465 | Ga0307412_10028081 | 3300031911 | Bacteria | 3516 |
| 466 | Ga0307412_10039422 | 3300031911 | Bacteria | 3049 |
| 467 | Ga0307412_10045502 | 3300031911 | Bacteria | 2869 |
| 468 | Ga0307412_10078529 | 3300031911 | Bacteria | 2274 |
| 469 | Ga0307412_10081779 | 3300031911 | Bacteria | 2235 |
| 470 | Ga0307412_10088777 | 3300031911 | Bacteria | 2157 |
| 471 | Ga0307412_10103298 | 3300031911 | Bacteria | 2020 |
| 472 | Ga0307412_10148841 | 3300031911 | Bacteria | 1725 |
| 473 | Ga0307409_100006126 | 3300031995 | Bacteria | 7031 |
| 474 | Ga0307409_100024952 | 3300031995 | Bacteria | 4182 |
| 475 | Ga0307409_100059131 | 3300031995 | Bacteria | 2981 |
| 476 | Ga0307409_100163759 | 3300031995 | Bacteria | 1948 |
| 477 | Ga0307409_100181092 | 3300031995 | Bacteria | 1865 |
| 478 | Ga0307409_100261945 | 3300031995 | Bacteria | 1587 |
| 479 | Ga0307409_100285331 | 3300031995 | Bacteria | 1528 |
| 480 | Ga0307416_100001945 | 3300032002 | Bacteria | 11564 |
| 481 | Ga0307416_100008194 | 3300032002 | Bacteria | 6717 |
| 482 | Ga0307416_100008380 | 3300032002 | Bacteria | 6664 |
| 483 | Ga0307416_100085128 | 3300032002 | Bacteria | 2689 |
| 484 | Ga0307416_100132207 | 3300032002 | Bacteria | 2249 |
| 485 | Ga0307416_100223146 | 3300032002 | Bacteria | 1809 |
| 486 | Ga0307416_100223821 | 3300032002 | Bacteria | 1807 |
| 487 | Ga0307416_100250437 | 3300032002 | Bacteria | 1723 |
| 488 | Ga0307416_100377248 | 3300032002 | Bacteria | 1447 |
| 489 | Ga0307414_10015279 | 3300032004 | Bacteria | 4632 |
| 490 | Ga0307414_10029340 | 3300032004 | Bacteria | 3579 |
| 491 | Ga0307414_10037396 | 3300032004 | Bacteria | 3250 |
| 492 | Ga0307414_10049216 | 3300032004 | Bacteria | 2913 |
| 493 | Ga0307414_10056665 | 3300032004 | Bacteria | 2750 |
| 494 | Ga0307414_10085637 | 3300032004 | Bacteria | 2322 |
| 495 | Ga0307414_10197199 | 3300032004 | Bacteria | 1634 |
| 496 | Ga0307414_10375584 | 3300032004 | Bacteria | 1227 |
| 497 | Ga0307411_10000911 | 3300032005 | Bacteria | 11227 |
| 498 | Ga0307411_10001680 | 3300032005 | Bacteria | 9267 |
| 499 | Ga0307411_10002663 | 3300032005 | Bacteria | 7996 |
| 500 | Ga0307411_10009739 | 3300032005 | Bacteria | 5076 |
| 501 | Ga0307411_10021862 | 3300032005 | Bacteria | 3754 |
| 502 | Ga0307411_10028517 | 3300032005 | Bacteria | 3395 |
| 503 | Ga0307411_10036258 | 3300032005 | Bacteria | 3088 |
| 504 | Ga0307411_10057229 | 3300032005 | Bacteria | 2574 |
| 505 | Ga0307411_10123114 | 3300032005 | Bacteria | 1880 |
| 506 | Ga0307411_10128273 | 3300032005 | Bacteria | 1849 |
| 507 | Ga0307411_10178408 | 3300032005 | Bacteria | 1609 |
| 508 | Ga0307411_10221747 | 3300032005 | Bacteria | 1467 |
| 509 | Ga0307411_10226723 | 3300032005 | Bacteria | 1453 |
| 510 | Ga0307415_100000243 | 3300032126 | Bacteria | 23624 |
| 511 | Ga0307415_100001952 | 3300032126 | Bacteria | 10151 |
| 512 | Ga0307415_100002407 | 3300032126 | Bacteria | 9327 |
| 513 | Ga0307415_100062346 | 3300032126 | Bacteria | 2586 |
| 514 | Ga0307415_100113801 | 3300032126 | Bacteria | 2013 |
| 515 | Ga0307415_100121951 | 3300032126 | Bacteria | 1956 |
| 516 | Ga0307415_100320689 | 3300032126 | Bacteria | 1292 |
| 517 | Ga0373930_0014809 | 3300034816 | Bacteria | 1457 |
| 518 | Ga0373946_0004744 | 3300035171 | Bacteria | 4887 |
| 519 | Ga0373962_0072758 | 3300035242 | Bacteria | 1030 |
| 520 | Ga0373935_0042878 | 3300035692 | Bacteria | 2846 |
| 521 | Ga0373935_0099795 | 3300035692 | Bacteria | 1912 |
| 522 | Ga0373927_0052303 | 3300035695 | Bacteria | 2642 |
| 523 | Ga0373947_0030905 | 3300035725 | Bacteria | 3149 |
| 524 | Ga0373937_0004732 | 3300036401 | Bacteria | 11577 |
| 525 | Ga0373925_0061658 | 3300037068 | Bacteria | 2817 |
| 526 | Ga0395899_0023635 | 3300037312 | Bacteria | 4652 |
| 527 | Ga0395899_0024278 | 3300037312 | Bacteria | 4585 |
| 528 | Ga0395899_0026240 | 3300037312 | Bacteria | 4396 |
| 529 | Ga0395899_0035263 | 3300037312 | Bacteria | 3755 |
| 530 | Ga0395899_0057955 | 3300037312 | Bacteria | 2858 |
| 531 | Ga0395899_0065702 | 3300037312 | Bacteria | 2665 |
| 532 | Ga0395899_0069010 | 3300037312 | Bacteria | 2590 |
| 533 | Ga0395900_0000572 | 3300037418 | Bacteria | 50991 |
| 534 | Ga0395900_0006142 | 3300037418 | Bacteria | 12535 |
| 535 | Ga0395900_0006337 | 3300037418 | Bacteria | 12335 |
| 536 | Ga0395900_0006462 | 3300037418 | Bacteria | 12219 |
| 537 | Ga0395900_0016540 | 3300037418 | Bacteria | 7525 |
| 538 | Ga0395900_0017172 | 3300037418 | Bacteria | 7387 |
| 539 | Ga0395900_0020092 | 3300037418 | Bacteria | 6813 |
| 540 | Ga0395900_0040825 | 3300037418 | Bacteria | 4782 |
| 541 | Ga0395900_0052413 | 3300037418 | Bacteria | 4200 |
| 542 | Ga0395900_0056622 | 3300037418 | Bacteria | 4035 |
| 543 | Ga0395900_0077444 | 3300037418 | Bacteria | 3416 |
| 544 | Ga0395900_0190887 | 3300037418 | Bacteria | 2078 |
| 545 | Ga0395900_0303199 | 3300037418 | Bacteria | 1583 |
| 546 | Ga0395900_0531746 | 3300037418 | Bacteria | 1122 |
| 547 | Ga0395900_0553639 | 3300037418 | Bacteria | 1094 |
| 548 | Ga0395898_0007452 | 3300037466 | Bacteria | 11615 |
| 549 | Ga0395898_0029190 | 3300037466 | Bacteria | 5526 |
| 550 | Ga0395898_0049447 | 3300037466 | Bacteria | 4120 |
| 551 | Ga0395898_0070544 | 3300037466 | Bacteria | 3377 |
| 552 | Ga0395898_0150416 | 3300037466 | Bacteria | 2228 |
| 553 | Ga0395898_0153572 | 3300037466 | Bacteria | 2202 |
| 554 | Ga0395898_0157213 | 3300037466 | Bacteria | 2174 |
| 555 | Ga0395898_0495129 | 3300037466 | Bacteria | 1163 |
| 556 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 557 | Ga0395905_0001408 | 3300037471 | Bacteria | 29105 |
| 558 | Ga0395905_0001429 | 3300037471 | Bacteria | 28769 |
| 559 | Ga0395905_0004924 | 3300037471 | Bacteria | 13752 |
| 560 | Ga0395905_0010680 | 3300037471 | Bacteria | 8905 |
| 561 | Ga0395905_0012129 | 3300037471 | Bacteria | 8302 |
| 562 | Ga0395905_0012840 | 3300037471 | Bacteria | 8051 |
| 563 | Ga0395905_0017323 | 3300037471 | Bacteria | 6841 |
| 564 | Ga0395905_0019534 | 3300037471 | Bacteria | 6423 |
| 565 | Ga0395905_0023864 | 3300037471 | Bacteria | 5774 |
| 566 | Ga0395905_0034996 | 3300037471 | Bacteria | 4715 |
| 567 | Ga0395905_0036173 | 3300037471 | Bacteria | 4637 |
| 568 | Ga0395905_0076037 | 3300037471 | Bacteria | 3146 |
| 569 | Ga0395905_0090199 | 3300037471 | Bacteria | 2873 |
| 570 | Ga0395905_0096254 | 3300037471 | Bacteria | 2779 |
| 571 | Ga0395905_0114645 | 3300037471 | Bacteria | 2532 |
| 572 | Ga0395905_0115824 | 3300037471 | Bacteria | 2518 |
| 573 | Ga0395905_0148678 | 3300037471 | Bacteria | 2204 |
| 574 | Ga0395905_0210921 | 3300037471 | Bacteria | 1820 |
| 575 | Ga0395905_0229223 | 3300037471 | Bacteria | 1737 |
| 576 | Ga0395905_0550060 | 3300037471 | Bacteria | 1055 |
| 577 | Ga0436364_0351177 | 3300037853 | Bacteria | 1059 |
| 578 | Ga0436364_1265496 | 3300037853 | Bacteria | 15678 |
| 579 | Ga0395901_0001927 | 3300038443 | Bacteria | 21367 |
| 580 | Ga0395901_0006471 | 3300038443 | Bacteria | 11862 |
| 581 | Ga0395901_0011045 | 3300038443 | Bacteria | 9149 |
| 582 | Ga0395901_0028662 | 3300038443 | Bacteria | 5727 |
| 583 | Ga0395901_0043708 | 3300038443 | Bacteria | 4647 |
| 584 | Ga0395901_0070295 | 3300038443 | Bacteria | 3647 |
| 585 | Ga0395901_0110482 | 3300038443 | Bacteria | 2886 |
| 586 | Ga0395901_0130566 | 3300038443 | Bacteria | 2640 |
| 587 | Ga0395901_0154763 | 3300038443 | Bacteria | 2408 |
| 588 | Ga0395901_0166840 | 3300038443 | Bacteria | 2311 |
| 589 | Ga0395901_0184450 | 3300038443 | Bacteria | 2188 |
| 590 | Ga0439465_0038497 | 3300041413 | Bacteria | 1541 |
| 591 | Ga0439445_0000030 | 3300042004 | Bacteria | 19033 |
| 592 | Ga0439432_048420 | 3300042006 | Bacteria | 1331 |
| 593 | Ga0439432_057938 | 3300042006 | Bacteria | 1198 |
| 594 | Ga0439449_0058955 | 3300042007 | Bacteria | 1417 |
| 595 | Ga0439449_0064812 | 3300042007 | Bacteria | 1348 |
| 596 | Ga0450905_003777 | 3300042142 | Bacteria | 1993 |
| 597 | Ga0450889_000275 | 3300042144 | Bacteria | 5731 |
| 598 | Ga0439464_0002488 | 3300042439 | Bacteria | 4540 |
| 599 | Ga0466972_0076180 | 3300044658 | Bacteria | 1598 |
| 600 | Ga0466966_0041197 | 3300044684 | Bacteria | 2968 |
| 601 | Ga0466966_0089919 | 3300044684 | Bacteria | 1907 |
| 602 | Ga0466961_0069118 | 3300044693 | Bacteria | 2243 |
| 603 | Ga0466961_0107360 | 3300044693 | Bacteria | 1757 |
| 604 | Ga0466961_0145736 | 3300044693 | Bacteria | 1481 |
| 605 | Ga0466963_0012905 | 3300044694 | Bacteria | 5120 |
| 606 | Ga0466963_0027548 | 3300044694 | Bacteria | 3640 |
| 607 | Ga0466963_0038555 | 3300044694 | Bacteria | 3125 |
| 608 | Ga0466963_0176015 | 3300044694 | Bacteria | 1493 |
| 609 | Ga0466964_0013633 | 3300044706 | Bacteria | 3084 |
| 610 | Ga0466971_0003355 | 3300044719 | Bacteria | 6840 |
| 611 | Ga0466971_0024442 | 3300044719 | Bacteria | 2696 |
| 612 | Ga0466971_0040542 | 3300044719 | Bacteria | 2091 |
| 613 | Ga0466968_0018145 | 3300044735 | Bacteria | 2820 |
| 614 | Ga0466970_0022613 | 3300044765 | Bacteria | 3282 |
| 615 | Ga0466957_0003051 | 3300044842 | Bacteria | 9106 |
| 616 | Ga0466957_0004212 | 3300044842 | Bacteria | 7977 |
| 617 | Ga0466959_0076411 | 3300045049 | Bacteria | 2418 |
| 618 | Ga0466958_0000385 | 3300045836 | Bacteria | 17978 |
| 619 | Ga0466958_0006390 | 3300045836 | Bacteria | 6410 |
| 620 | Ga0466958_0035540 | 3300045836 | Bacteria | 2977 |
| 621 | Ga0466958_0079590 | 3300045836 | Bacteria | 2015 |
| 622 | Ga0466958_0123894 | 3300045836 | Bacteria | 1619 |
| 623 | Ga0466958_0147971 | 3300045836 | Bacteria | 1481 |
| 624 | Ga0466967_0000053 | 3300045976 | Bacteria | 41252 |
| 625 | Ga0466967_0000840 | 3300045976 | Bacteria | 16221 |
| 626 | Ga0466967_0045010 | 3300045976 | Bacteria | 3833 |
| 627 | Ga0466967_0181171 | 3300045976 | Bacteria | 1987 |
| 628 | Ga0466967_0183554 | 3300045976 | Bacteria | 1974 |
| 629 | Ga0466967_0192434 | 3300045976 | Bacteria | 1928 |
| 630 | Ga0466967_0263993 | 3300045976 | Bacteria | 1648 |
| 631 | Ga0466967_0278317 | 3300045976 | Bacteria | 1605 |
| 632 | Ga0466967_0395487 | 3300045976 | Bacteria | 1344 |
| 633 | Ga0466967_0604403 | 3300045976 | Bacteria | 1083 |
| 634 | Ga0495638_0014243 | 3300046460 | Bacteria | 5382 |
| 635 | Ga0495580_0097892 | 3300046472 | Bacteria | 2041 |
| 636 | Ga0495583_0000766 | 3300046506 | Bacteria | 40320 |
| 637 | Ga0495663_0002000 | 3300046525 | Bacteria | 6270 |
| 638 | Ga0495663_0025180 | 3300046525 | Bacteria | 1733 |
| 639 | Ga0495663_0098763 | 3300046525 | Bacteria | 959 |
| 640 | Ga0495598_0000521 | 3300046537 | Bacteria | 7138 |
| 641 | Ga0495621_0000194 | 3300046539 | Bacteria | 14011 |
| 642 | Ga0495621_0000361 | 3300046539 | Bacteria | 11072 |
| 643 | Ga0495621_0000708 | 3300046539 | Bacteria | 8433 |
| 644 | Ga0495621_0002382 | 3300046539 | Bacteria | 5056 |
| 645 | Ga0495621_0007750 | 3300046539 | Bacteria | 3190 |
| 646 | Ga0495621_0112192 | 3300046539 | Bacteria | 1046 |
| 647 | Ga0495633_0010211 | 3300046558 | Bacteria | 5137 |
| 648 | Ga0495668_0010612 | 3300046616 | Bacteria | 5566 |
| 649 | Ga0495668_0011181 | 3300046616 | Bacteria | 5387 |
| 650 | Ga0495668_0112915 | 3300046616 | Bacteria | 1486 |
| 651 | Ga0495668_0162201 | 3300046616 | Bacteria | 1224 |
| 652 | Ga0495611_0071796 | 3300046648 | Bacteria | 1583 |
| 653 | Ga0495661_0046511 | 3300046665 | Bacteria | 2649 |
| 654 | Ga0495661_0169200 | 3300046665 | Bacteria | 1167 |
| 655 | Ga0495669_0000890 | 3300046684 | Bacteria | 12578 |
| 656 | Ga0495669_0002557 | 3300046684 | Bacteria | 7428 |
| 657 | Ga0495669_0005935 | 3300046684 | Bacteria | 5090 |
| 658 | Ga0495669_0013465 | 3300046684 | Bacteria | 3485 |
| 659 | Ga0495669_0027019 | 3300046684 | Bacteria | 2510 |
| 660 | Ga0495669_0161401 | 3300046684 | Bacteria | 1064 |
| 661 | Ga0495670_0001443 | 3300046691 | Bacteria | 11626 |
| 662 | Ga0495670_0004013 | 3300046691 | Bacteria | 7218 |
| 663 | Ga0495670_0006704 | 3300046691 | Bacteria | 5663 |
| 664 | Ga0495670_0010867 | 3300046691 | Bacteria | 4474 |
| 665 | Ga0495670_0017447 | 3300046691 | Bacteria | 3533 |
| 666 | Ga0495670_0051506 | 3300046691 | Bacteria | 2060 |
| 667 | Ga0495670_0090148 | 3300046691 | Bacteria | 1569 |
| 668 | Ga0495677_0012156 | 3300047445 | Bacteria | 3141 |
| 669 | Ga0495686_0000530 | 3300047472 | Bacteria | 54741 |
| 670 | Ga0496100_0014655 | 3300048903 | Bacteria | 4557 |
| 671 | Ga0496100_0067833 | 3300048903 | Bacteria | 2370 |
| 672 | Ga0496100_0124940 | 3300048903 | Bacteria | 1805 |
| 673 | Ga0496100_0134235 | 3300048903 | Bacteria | 1747 |
| 674 | Ga0496101_0012653 | 3300048904 | Bacteria | 5637 |
| 675 | Ga0496101_0018340 | 3300048904 | Bacteria | 4756 |
| 676 | Ga0496101_0105521 | 3300048904 | Bacteria | 2115 |
| 677 | Ga0496102_0000036 | 3300048905 | Bacteria | 201896 |
| 678 | Ga0496102_0082710 | 3300048905 | Bacteria | 2961 |
| 679 | Ga0496102_0116445 | 3300048905 | Bacteria | 2494 |
| 680 | Ga0496102_0266502 | 3300048905 | Bacteria | 1615 |
| 681 | Ga0496103_0000120 | 3300048906 | Bacteria | 85481 |
| 682 | Ga0496104_0084239 | 3300048907 | Bacteria | 3033 |
| 683 | Ga0496105_0055104 | 3300048908 | Bacteria | 3283 |
| 684 | Ga0496106_0038953 | 3300048909 | Bacteria | 3559 |
| 685 | Ga0496107_0021732 | 3300048910 | Bacteria | 4534 |
| 686 | Ga0496107_0073909 | 3300048910 | Bacteria | 2480 |
| 687 | Ga0496107_0078297 | 3300048910 | Bacteria | 2408 |
| 688 | Ga0496108_0001272 | 3300048911 | Bacteria | 19736 |
| 689 | Ga0496108_0003147 | 3300048911 | Bacteria | 13271 |
| 690 | Ga0496108_0016911 | 3300048911 | Bacteria | 5961 |
| 691 | Ga0496109_0003815 | 3300048912 | Bacteria | 12585 |
| 692 | Ga0496109_0026042 | 3300048912 | Bacteria | 5213 |
| 693 | Ga0496109_0180649 | 3300048912 | Bacteria | 1981 |
| 694 | Ga0496110_0003918 | 3300048913 | Bacteria | 11450 |
| 695 | Ga0496110_0040422 | 3300048913 | Bacteria | 4065 |
| 696 | Ga0496110_0411211 | 3300048913 | Bacteria | 1233 |
| 697 | Ga0496111_0013395 | 3300048914 | Bacteria | 5578 |
| 698 | Ga0496111_0077896 | 3300048914 | Bacteria | 2417 |
| 699 | Ga0496111_0385450 | 3300048914 | Bacteria | 1036 |
| 700 | Ga0496112_0000761 | 3300048915 | Bacteria | 22616 |
| 701 | Ga0496112_0328237 | 3300048915 | Bacteria | 1474 |
| 702 | Ga0496113_0003741 | 3300048916 | Bacteria | 9170 |
| 703 | Ga0496113_0006102 | 3300048916 | Bacteria | 7601 |
| 704 | Ga0496113_0134307 | 3300048916 | Bacteria | 1943 |
| 705 | Ga0496115_0002148 | 3300048918 | Bacteria | 14095 |
| 706 | Ga0496116_0002277 | 3300048919 | Bacteria | 20365 |
| 707 | Ga0496117_0000093 | 3300048920 | Bacteria | 201862 |
| 708 | Ga0496117_0011338 | 3300048920 | Bacteria | 7990 |
| 709 | Ga0496118_0000070 | 3300048921 | Bacteria | 201866 |
| 710 | Ga0496118_0096376 | 3300048921 | Bacteria | 2016 |
| 711 | Ga0496124_0000302 | 3300048927 | Bacteria | 91124 |
| 712 | Ga0496125_0072689 | 3300048928 | Bacteria | 2678 |
| 713 | Ga0501068_0063686 | 3300049584 | Bacteria | 2243 |
| 714 | Ga0501070_0136140 | 3300049586 | Bacteria | 2028 |
| 715 | Ga0501225_0014655 | 3300049705 | Bacteria | 2187 |
| 716 | Ga0501083_0024482 | 3300049744 | Bacteria | 4182 |
| 717 | Ga0501273_010559 | 3300049770 | Bacteria | 1137 |
| 718 | Ga0501283_001484 | 3300049779 | Bacteria | 3034 |
| 719 | nmdc:mga06r32_139412_c1 | 3300050510 | Bacteria | 2401 |
| 720 | nmdc:mga08y16_21958_c1 | 3300050511 | Bacteria | 6737 |
| 721 | Ga0500643_002599 | 3300053087 | Bacteria | 9161 |
| 722 | Ga0500641_0002882 | 3300053096 | Bacteria | 6098 |
| 723 | Ga0500595_001987 | 3300053119 | Bacteria | 10493 |
| 724 | Ga0500618_007755 | 3300053125 | Bacteria | 3036 |
| 725 | Ga0500636_0088847 | 3300053177 | Bacteria | 1772 |
| 726 | Ga0466962_0088593 | 3300061719 | Bacteria | 1482 |
| 727 | 2738709296 | 2738541275 | Bacteria | 4830863 |
| 728 | 2738847721 | 2738541301 | Bacteria | 4834102 |
| 729 | 2738863450 | 2738541304 | Bacteria | 4833665 |
| 730 | 2739295968 | 2738543022 | Bacteria | 4835059 |
| 731 | 2739357646 | 2738543033 | Bacteria | 4833336 |
| 732 | 2883293080 | 2883291878 | Bacteria | 5894118 |
| 733 | 2883356080 | 2883354860 | Bacteria | 5865246 |
| 734 | 2896430155 | 2896429255 | Bacteria | 2557483 |
| 735 | 2928030734 | 2928027323 | Bacteria | 4382488 |
| 736 | 2928102914 | 2928100450 | Bacteria | 4837635 |
| 737 | 2928959480 | 2928959182 | Bacteria | 4725774 |
| 738 | 2946789078 | 2946787523 | Bacteria | 4366789 |
| 739 | 2984557563 | 2984555340 | Bacteria | 4247089 |
| 740 | 2993359119 | 2993356040 | Bacteria | 4247105 |
| 741 | Ga0070671_100260442 | |||
| 742 | JGI24741J21665_1011162 | |||
| 743 | JGI24740J21852_10045791 | |||
| 744 | JGI24737J22298_10038997 | |||
| 745 | JGI24744J21845_10001976 | |||
| 746 | Ga0065712_10099102 | |||
| 747 | Ga0065715_10089636 | |||
| 748 | Ga0070658_10006349 | |||
| 749 | Ga0070658_10012188 | |||
| 750 | Ga0070658_10020575 | |||
| 751 | Ga0070658_10141200 | |||
| 752 | Ga0070658_10275667 | |||
| 753 | Ga0070676_10006741 | |||
| 754 | Ga0070676_10027345 | |||
| 755 | Ga0070683_100260699 | |||
| 756 | Ga0070690_100000784 | |||
| 757 | Ga0070690_100001152 | |||
| 758 | Ga0070670_100005975 | |||
| 759 | Ga0070670_100007770 | |||
| 760 | Ga0070677_10001167 | |||
| 761 | Ga0070677_10018396 | |||
| 762 | Ga0070666_10000215 | |||
| 763 | Ga0070666_10017898 | |||
| 764 | Ga0070680_100004052 | |||
| 765 | Ga0070680_100017306 | |||
| 766 | Ga0070680_100034172 | |||
| 767 | Ga0070680_100307094 | |||
| 768 | Ga0068868_100003281 | |||
| 769 | Ga0068868_100019253 | |||
| 770 | Ga0068868_100080134 | |||
| 771 | Ga0070660_100000663 | |||
| 772 | Ga0070660_100005122 | |||
| 773 | Ga0070660_100068601 | |||
| 774 | Ga0070660_100133694 | |||
| 775 | Ga0070660_100140536 | |||
| 776 | Ga0070660_100153715 | |||
| 777 | Ga0070661_100008128 | |||
| 778 | Ga0070661_100009119 | |||
| 779 | Ga0070661_100054883 | |||
| 780 | Ga0070661_100148903 | |||
| 781 | Ga0070661_100245705 | |||
| 782 | Ga0070661_100253896 | |||
| 783 | Ga0070661_100287627 | |||
| 784 | Ga0070692_10007807 | |||
| 785 | Ga0070668_100007519 | |||
| 786 | Ga0070668_100254742 | |||
| 787 | Ga0070668_100487954 | |||
| 788 | Ga0070669_100001885 | |||
| 789 | Ga0070669_100041989 | |||
| 790 | Ga0070669_100074340 | |||
| 791 | Ga0070669_100116426 | |||
| 792 | Ga0070675_100000759 | |||
| 793 | Ga0070671_100055565 | |||
| 794 | Ga0070671_100124642 | |||
| 795 | Ga0070671_100126200 | |||
| 796 | Ga0070671_100177433 | |||
| 797 | Ga0070674_100012979 | |||
| 798 | Ga0070674_100017266 | |||
| 799 | Ga0070674_100025066 | |||
| 800 | Ga0070674_100078817 | |||
| 801 | Ga0070673_100001925 | |||
| 802 | Ga0070673_100069652 | |||
| 803 | Ga0070673_100111582 | |||
| 804 | Ga0070673_100154848 | |||
| 805 | Ga0070673_100210733 | |||
| 806 | Ga0070673_100221707 | |||
| 807 | Ga0070659_100001353 | |||
| 808 | Ga0070659_100008920 | |||
| 809 | Ga0070659_100033987 | |||
| 810 | Ga0070659_100058777 | |||
| 811 | Ga0070659_100113432 | |||
| 812 | Ga0070659_100167411 | |||
| 813 | Ga0070659_100188336 | |||
| 814 | Ga0070667_100000842 | |||
| 815 | Ga0070667_100003257 | |||
| 816 | Ga0070667_100024685 | |||
| 817 | Ga0070667_100036753 | |||
| 818 | Ga0070667_100169169 | |||
| 819 | Ga0070667_100310877 | |||
| 820 | Ga0070667_100548462 | |||
| 821 | Ga0070714_100364959 | |||
| 822 | Ga0070701_10005692 | |||
| 823 | Ga0070694_100021107 | |||
| 824 | Ga0070663_100003093 | |||
| 825 | Ga0070663_100005871 | |||
| 826 | Ga0070663_100019346 | |||
| 827 | Ga0070663_100135690 | |||
| 828 | Ga0070663_100173091 | |||
| 829 | Ga0070663_100186155 | |||
| 830 | Ga0070663_100239533 | |||
| 831 | Ga0070662_100004937 | |||
| 832 | Ga0070662_100006830 | |||
| 833 | Ga0070662_100013241 | |||
| 834 | Ga0070662_100020310 | |||
| 835 | Ga0070662_100044894 | |||
| 836 | Ga0070681_10058359 | |||
| 837 | Ga0070681_10067292 | |||
| 838 | Ga0070681_10138383 | |||
| 839 | Ga0070681_10477146 | |||
| 840 | Ga0068867_100009232 | |||
| 841 | Ga0068867_100014104 | |||
| 842 | Ga0068867_100044500 | |||
| 843 | Ga0070679_100030476 | |||
| 844 | Ga0070679_100094869 | |||
| 845 | Ga0070679_100151872 | |||
| 846 | Ga0070679_100181424 | |||
| 847 | Ga0070679_100243233 | |||
| 848 | Ga0068853_100008551 | |||
| 849 | Ga0068853_100010924 | |||
| 850 | Ga0068853_100013390 | |||
| 851 | Ga0068853_100033149 | |||
| 852 | Ga0068853_100044838 | |||
| 853 | Ga0068853_100048971 | |||
| 854 | Ga0068853_100079701 | |||
| 855 | Ga0068853_100100619 | |||
| 856 | Ga0068853_100199547 | |||
| 857 | Ga0070672_100009674 | |||
| 858 | Ga0070672_100044818 | |||
| 859 | Ga0070672_100045010 | |||
| 860 | Ga0070672_100053815 | |||
| 861 | Ga0070672_100095954 | |||
| 862 | Ga0070672_100220558 | |||
| 863 | Ga0070686_100038860 | |||
| 864 | Ga0070686_100181599 | |||
| 865 | Ga0070695_100023208 | |||
| 866 | Ga0070696_100245573 | |||
| 867 | Ga0070696_100267599 | |||
| 868 | Ga0070693_100158427 | |||
| 869 | Ga0070665_100107109 | |||
| 870 | Ga0070665_100159140 | |||
| 871 | Ga0068855_100004077 | |||
| 872 | Ga0068855_100059086 | |||
| 873 | Ga0070664_100012706 | |||
| 874 | Ga0070664_100394996 | |||
| 875 | Ga0068857_100176859 | |||
| 876 | Ga0068857_100222472 | |||
| 877 | Ga0068854_100014916 | |||
| 878 | Ga0068854_100051990 | |||
| 879 | Ga0068854_100176291 | |||
| 880 | Ga0068856_100232987 | |||
| 881 | Ga0068852_100079436 | |||
| 882 | Ga0068859_100002127 | |||
| 883 | Ga0068859_100008265 | |||
| 884 | Ga0068859_100123270 | |||
| 885 | Ga0068859_100327922 | |||
| 886 | Ga0068864_100001398 | |||
| 887 | Ga0068864_100004613 | |||
| 888 | Ga0068864_100006944 | |||
| 889 | Ga0068864_100013870 | |||
| 890 | Ga0068864_100026940 | |||
| 891 | Ga0068864_100049060 | |||
| 892 | Ga0068864_100127959 | |||
| 893 | Ga0068864_100187383 | |||
| 894 | Ga0068864_100229577 | |||
| 895 | Ga0068861_100014738 | |||
| 896 | Ga0068861_100077498 | |||
| 897 | Ga0068851_10003121 | |||
| 898 | Ga0068863_100002134 | |||
| 899 | Ga0068863_100007871 | |||
| 900 | Ga0068863_100191790 | |||
| 901 | Ga0068858_100001703 | |||
| 902 | Ga0068858_100002540 | |||
| 903 | Ga0068858_100015929 | |||
| 904 | Ga0068858_100248322 | |||
| 905 | Ga0068858_100261938 | |||
| 906 | Ga0068860_100007762 | |||
| 907 | Ga0068860_100039949 | |||
| 908 | Ga0068860_100074072 | |||
| 909 | Ga0068860_100074228 | |||
| 910 | Ga0068860_100105517 | |||
| 911 | Ga0068860_100182085 | |||
| 912 | Ga0068860_100219516 | |||
| 913 | Ga0068860_100277498 | |||
| 914 | Ga0068862_100006460 | |||
| 915 | Ga0068862_100067335 | |||
| 916 | Ga0097621_100027711 | |||
| 917 | Ga0097621_100443679 | |||
| 918 | Ga0068865_100007079 | |||
| 919 | Ga0068865_100027328 | |||
| 920 | Ga0097620_100002127 | |||
| 921 | Ga0097620_100008265 | |||
| 922 | Ga0097620_100123273 | |||
| 923 | Ga0097620_100327946 | |||
| 924 | Ga0105250_10008038 | |||
| 925 | Ga0105240_10045821 | |||
| 926 | Ga0105240_10216299 | |||
| 927 | Ga0105240_10508440 | |||
| 928 | Ga0111539_10021092 | |||
| 929 | Ga0105245_10096995 | |||
| 930 | Ga0105245_10149475 | |||
| 931 | Ga0105243_10107470 | |||
| 932 | Ga0105243_10354531 | |||
| 933 | Ga0105241_10244635 | |||
| 934 | Ga0105241_10433206 | |||
| 935 | Ga0105242_10014632 | |||
| 936 | Ga0105242_10357977 | |||
| 937 | Ga0105248_10000362 | |||
| 938 | Ga0105248_10000395 | |||
| 939 | Ga0105248_10004448 | |||
| 940 | Ga0105248_10004830 | |||
| 941 | Ga0105248_10023356 | |||
| 942 | Ga0105248_10039629 | |||
| 943 | Ga0105248_10044452 | |||
| 944 | Ga0105248_10050197 | |||
| 945 | Ga0105248_10110896 | |||
| 946 | Ga0105248_10133234 | |||
| 947 | Ga0105238_10046386 | |||
| 948 | Ga0105238_10061956 | |||
| 949 | Ga0105238_10084001 | |||
| 950 | Ga0105249_10004822 | |||
| 951 | Ga0105249_10704690 | |||
| 952 | Ga0105239_10113307 | |||
| 953 | Ga0105239_10289096 | |||
| 954 | Ga0105246_10051837 | |||
| 955 | Ga0157373_10003524 | |||
| 956 | Ga0157373_10019290 | |||
| 957 | Ga0157371_10004743 | |||
| 958 | Ga0157371_10031437 | |||
| 959 | Ga0157371_10042251 | |||
| 960 | Ga0157371_10089141 | |||
| 961 | Ga0157371_10102013 | |||
| 962 | Ga0157370_10036438 | |||
| 963 | Ga0157370_10040187 | |||
| 964 | Ga0157370_10041548 | |||
| 965 | Ga0157370_10155289 | |||
| 966 | Ga0157370_10343300 | |||
| 967 | Ga0157369_10014904 | |||
| 968 | Ga0157369_10192019 | |||
| 969 | Ga0157369_10201630 | |||
| 970 | Ga0157369_10515701 | |||
| 971 | Ga0157378_10081948 | |||
| 972 | Ga0157378_10106380 | |||
| 973 | Ga0163162_10030851 | |||
| 974 | Ga0163162_10044637 | |||
| 975 | Ga0163162_10053226 | |||
| 976 | Ga0163162_10093730 | |||
| 977 | Ga0163162_10352654 | |||
| 978 | Ga0163162_10494247 | |||
| 979 | Ga0163162_10516884 | |||
| 980 | Ga0157372_10290859 | |||
| 981 | Ga0157372_10507895 | |||
| 982 | Ga0157372_10719948 | |||
| 983 | Ga0157375_10015558 | |||
| 984 | Ga0157375_10044266 | |||
| 985 | Ga0157375_10135319 | |||
| 986 | Ga0157375_10214795 | |||
| 987 | Ga0157375_10455671 | |||
| 988 | Ga0163163_10001203 | |||
| 989 | Ga0163163_10004004 | |||
| 990 | Ga0163163_10232748 | |||
| 991 | Ga0157380_10002495 | |||
| 992 | Ga0157380_10007684 | |||
| 993 | Ga0157380_10105118 | |||
| 994 | Ga0157380_10138676 | |||
| 995 | Ga0157377_10080376 | |||
| 996 | Ga0157377_10102844 | |||
| 997 | Ga0157379_10037628 | |||
| 998 | Ga0157379_10130183 | |||
| 999 | Ga0157379_10136323 | |||
| 1000 | Ga0157379_10193334 | |||
| 1001 | Ga0157379_10285682 | |||
| 1002 | Ga0163161_10033191 | |||
| 1003 | Ga0163161_10040426 | |||
| 1004 | Ga0163161_10065892 | |||
| 1005 | Ga0206353_11413780 | |||
| 1006 | Ga0207697_10000927 | |||
| 1007 | Ga0207697_10009191 | |||
| 1008 | Ga0207697_10042058 | |||
| 1009 | Ga0207656_10017215 | |||
| 1010 | Ga0207682_10002411 | |||
| 1011 | Ga0207688_10010155 | |||
| 1012 | Ga0207680_10000626 | |||
| 1013 | Ga0207680_10083606 | |||
| 1014 | Ga0207647_10000339 | |||
| 1015 | Ga0207647_10041294 | |||
| 1016 | Ga0207647_10056512 | |||
| 1017 | Ga0207645_10011234 | |||
| 1018 | Ga0207645_10059349 | |||
| 1019 | Ga0207645_10103135 | |||
| 1020 | Ga0207705_10001142 | |||
| 1021 | Ga0207705_10003304 | |||
| 1022 | Ga0207705_10012711 | |||
| 1023 | Ga0207705_10021695 | |||
| 1024 | Ga0207705_10067664 | |||
| 1025 | Ga0207705_10082612 | |||
| 1026 | Ga0207660_10000140 | |||
| 1027 | Ga0207660_10012082 | |||
| 1028 | Ga0207657_10000020 | |||
| 1029 | Ga0207657_10001366 | |||
| 1030 | Ga0207657_10003566 | |||
| 1031 | Ga0207657_10004033 | |||
| 1032 | Ga0207657_10007910 | |||
| 1033 | Ga0207657_10041186 | |||
| 1034 | Ga0207657_10043574 | |||
| 1035 | Ga0207657_10048372 | |||
| 1036 | Ga0207657_10147728 | |||
| 1037 | Ga0207657_10169066 | |||
| 1038 | Ga0207657_10263734 | |||
| 1039 | Ga0207657_10314244 | |||
| 1040 | Ga0207649_10030791 | |||
| 1041 | Ga0207652_10048837 | |||
| 1042 | Ga0207652_10058671 | |||
| 1043 | Ga0207652_10226886 | |||
| 1044 | Ga0207681_10006995 | |||
| 1045 | Ga0207681_10133344 | |||
| 1046 | Ga0207681_10162094 | |||
| 1047 | Ga0207681_10175896 | |||
| 1048 | Ga0207694_10018205 | |||
| 1049 | Ga0207650_10006327 | |||
| 1050 | Ga0207650_10007606 | |||
| 1051 | Ga0207650_10103454 | |||
| 1052 | Ga0207650_10105414 | |||
| 1053 | Ga0207659_10002265 | |||
| 1054 | Ga0207659_10026739 | |||
| 1055 | Ga0207659_10121598 | |||
| 1056 | Ga0207687_10166120 | |||
| 1057 | Ga0207664_10393544 | |||
| 1058 | Ga0207644_10000324 | |||
| 1059 | Ga0207644_10028714 | |||
| 1060 | Ga0207644_10043502 | |||
| 1061 | Ga0207644_10047379 | |||
| 1062 | Ga0207644_10089812 | |||
| 1063 | Ga0207644_10117466 | |||
| 1064 | Ga0207690_10009242 | |||
| 1065 | Ga0207690_10013571 | |||
| 1066 | Ga0207690_10041125 | |||
| 1067 | Ga0207690_10122747 | |||
| 1068 | Ga0207690_10152367 | |||
| 1069 | Ga0207706_10004058 | |||
| 1070 | Ga0207706_10004109 | |||
| 1071 | Ga0207706_10008737 | |||
| 1072 | Ga0207706_10020444 | |||
| 1073 | Ga0207706_10052239 | |||
| 1074 | Ga0207706_10053416 | |||
| 1075 | Ga0207706_10056986 | |||
| 1076 | Ga0207706_10279295 | |||
| 1077 | Ga0207686_10050495 | |||
| 1078 | Ga0207709_10121323 | |||
| 1079 | Ga0207709_10153998 | |||
| 1080 | Ga0207669_10002475 | |||
| 1081 | Ga0207669_10056487 | |||
| 1082 | Ga0207669_10137595 | |||
| 1083 | Ga0207704_10012434 | |||
| 1084 | Ga0207691_10000915 | |||
| 1085 | Ga0207691_10001856 | |||
| 1086 | Ga0207691_10012965 | |||
| 1087 | Ga0207691_10034786 | |||
| 1088 | Ga0207691_10044565 | |||
| 1089 | Ga0207691_10118481 | |||
| 1090 | Ga0207691_10310035 | |||
| 1091 | Ga0207711_10000429 | |||
| 1092 | Ga0207711_10000610 | |||
| 1093 | Ga0207711_10002544 | |||
| 1094 | Ga0207711_10004237 | |||
| 1095 | Ga0207711_10029458 | |||
| 1096 | Ga0207711_10034390 | |||
| 1097 | Ga0207711_10058671 | |||
| 1098 | Ga0207711_10141459 | |||
| 1099 | Ga0207711_10388792 | |||
| 1100 | Ga0207689_10002262 | |||
| 1101 | Ga0207679_10018161 | |||
| 1102 | Ga0207679_10055146 | |||
| 1103 | Ga0207679_10344618 | |||
| 1104 | Ga0207667_10002757 | |||
| 1105 | Ga0207651_10000378 | |||
| 1106 | Ga0207651_10002434 | |||
| 1107 | Ga0207651_10111161 | |||
| 1108 | Ga0207651_10158227 | |||
| 1109 | Ga0207651_10160365 | |||
| 1110 | Ga0207712_10016256 | |||
| 1111 | Ga0207668_10006711 | |||
| 1112 | Ga0207640_10009307 | |||
| 1113 | Ga0207640_10042095 | |||
| 1114 | Ga0207658_10001871 | |||
| 1115 | Ga0207658_10003528 | |||
| 1116 | Ga0207658_10005525 | |||
| 1117 | Ga0207658_10057889 | |||
| 1118 | Ga0207658_10090752 | |||
| 1119 | Ga0207677_10003982 | |||
| 1120 | Ga0207677_10031985 | |||
| 1121 | Ga0207703_10006106 | |||
| 1122 | Ga0207703_10017409 | |||
| 1123 | Ga0207703_10025682 | |||
| 1124 | Ga0207703_10048214 | |||
| 1125 | Ga0207639_10002451 | |||
| 1126 | Ga0207639_10036236 | |||
| 1127 | Ga0207639_10064020 | |||
| 1128 | Ga0207639_10152743 | |||
| 1129 | Ga0207639_10299800 | |||
| 1130 | Ga0207678_10005111 | |||
| 1131 | Ga0207678_10032329 | |||
| 1132 | Ga0207678_10060984 | |||
| 1133 | Ga0207678_10165177 | |||
| 1134 | Ga0207702_10030613 | |||
| 1135 | Ga0207641_10002148 | |||
| 1136 | Ga0207641_10006264 | |||
| 1137 | Ga0207641_10167744 | |||
| 1138 | Ga0207648_10013267 | |||
| 1139 | Ga0207648_10021875 | |||
| 1140 | Ga0207648_10022350 | |||
| 1141 | Ga0207648_10023740 | |||
| 1142 | Ga0207676_10007920 | |||
| 1143 | Ga0207676_10019201 | |||
| 1144 | Ga0207676_10064276 | |||
| 1145 | Ga0207676_10132092 | |||
| 1146 | Ga0207676_10573893 | |||
| 1147 | Ga0207674_10037383 | |||
| 1148 | Ga0207674_10037696 | |||
| 1149 | Ga0207674_10059771 | |||
| 1150 | Ga0207675_100011697 | |||
| 1151 | Ga0207683_10003409 | |||
| 1152 | Ga0207698_10213981 | |||
| 1153 | Ga0268266_10009752 | |||
| 1154 | Ga0268266_10083841 | |||
| 1155 | Ga0268266_10147620 | |||
| 1156 | Ga0268265_10007581 | |||
| 1157 | Ga0268265_10008543 | |||
| 1158 | Ga0268265_10021023 | |||
| 1159 | Ga0268264_10005351 | |||
| 1160 | Ga0268264_10232928 | |||
| 1161 | Ga0268264_10271156 | |||
| 1162 | Ga0268264_10290261 | |||
| 1163 | Ga0316182_1337346 | |||
| 1164 | Ga0307408_100053920 | |||
| 1165 | Ga0307408_100057257 | |||
| 1166 | Ga0307408_100062616 | |||
| 1167 | Ga0307408_100138666 | |||
| 1168 | Ga0307408_100150670 | |||
| 1169 | Ga0307408_100205013 | |||
| 1170 | Ga0307405_10020665 | |||
| 1171 | Ga0307405_10055410 | |||
| 1172 | Ga0307405_10059872 | |||
| 1173 | Ga0307405_10219337 | |||
| 1174 | Ga0307405_10226453 | |||
| 1175 | Ga0307413_10002121 | |||
| 1176 | Ga0307413_10003459 | |||
| 1177 | Ga0307413_10007360 | |||
| 1178 | Ga0307413_10025511 | |||
| 1179 | Ga0307413_10025931 | |||
| 1180 | Ga0307413_10051349 | |||
| 1181 | Ga0307413_10070193 | |||
| 1182 | Ga0307413_10074113 | |||
| 1183 | Ga0307413_10113855 | |||
| 1184 | Ga0307413_10214601 | |||
| 1185 | Ga0307410_10000582 | |||
| 1186 | Ga0307410_10006823 | |||
| 1187 | Ga0307410_10014820 | |||
| 1188 | Ga0307410_10077697 | |||
| 1189 | Ga0307410_10082024 | |||
| 1190 | Ga0307410_10133301 | |||
| 1191 | Ga0307410_10155262 | |||
| 1192 | Ga0307406_10020099 | |||
| 1193 | Ga0307406_10041590 | |||
| 1194 | Ga0307406_10052027 | |||
| 1195 | Ga0307406_10057799 | |||
| 1196 | Ga0307406_10100383 | |||
| 1197 | Ga0307406_10111370 | |||
| 1198 | Ga0307406_10121872 | |||
| 1199 | Ga0307406_10282623 | |||
| 1200 | Ga0307407_10002061 | |||
| 1201 | Ga0307407_10008454 | |||
| 1202 | Ga0307407_10009916 | |||
| 1203 | Ga0307407_10024424 | |||
| 1204 | Ga0307407_10053392 | |||
| 1205 | Ga0307412_10028081 | |||
| 1206 | Ga0307412_10039422 | |||
| 1207 | Ga0307412_10045502 | |||
| 1208 | Ga0307412_10078529 | |||
| 1209 | Ga0307412_10081779 | |||
| 1210 | Ga0307412_10088777 | |||
| 1211 | Ga0307412_10103298 | |||
| 1212 | Ga0307412_10148841 | |||
| 1213 | Ga0307409_100006126 | |||
| 1214 | Ga0307409_100024952 | |||
| 1215 | Ga0307409_100059131 | |||
| 1216 | Ga0307409_100163759 | |||
| 1217 | Ga0307409_100181092 | |||
| 1218 | Ga0307409_100261945 | |||
| 1219 | Ga0307409_100285331 | |||
| 1220 | Ga0307416_100001945 | |||
| 1221 | Ga0307416_100008194 | |||
| 1222 | Ga0307416_100008380 | |||
| 1223 | Ga0307416_100085128 | |||
| 1224 | Ga0307416_100132207 | |||
| 1225 | Ga0307416_100223146 | |||
| 1226 | Ga0307416_100223821 | |||
| 1227 | Ga0307416_100250437 | |||
| 1228 | Ga0307416_100377248 | |||
| 1229 | Ga0307414_10015279 | |||
| 1230 | Ga0307414_10029340 | |||
| 1231 | Ga0307414_10037396 | |||
| 1232 | Ga0307414_10049216 | |||
| 1233 | Ga0307414_10056665 | |||
| 1234 | Ga0307414_10085637 | |||
| 1235 | Ga0307414_10197199 | |||
| 1236 | Ga0307414_10375584 | |||
| 1237 | Ga0307411_10000911 | |||
| 1238 | Ga0307411_10001680 | |||
| 1239 | Ga0307411_10002663 | |||
| 1240 | Ga0307411_10009739 | |||
| 1241 | Ga0307411_10021862 | |||
| 1242 | Ga0307411_10028517 | |||
| 1243 | Ga0307411_10036258 | |||
| 1244 | Ga0307411_10057229 | |||
| 1245 | Ga0307411_10123114 | |||
| 1246 | Ga0307411_10128273 | |||
| 1247 | Ga0307411_10178408 | |||
| 1248 | Ga0307411_10221747 | |||
| 1249 | Ga0307411_10226723 | |||
| 1250 | Ga0307415_100000243 | |||
| 1251 | Ga0307415_100001952 | |||
| 1252 | Ga0307415_100002407 | |||
| 1253 | Ga0307415_100062346 | |||
| 1254 | Ga0307415_100113801 | |||
| 1255 | Ga0307415_100121951 | |||
| 1256 | Ga0307415_100320689 | |||
| 1257 | Ga0373930_0014809 | |||
| 1258 | Ga0373946_0004744 | |||
| 1259 | Ga0373962_0072758 | |||
| 1260 | Ga0373935_0042878 | |||
| 1261 | Ga0373935_0099795 | |||
| 1262 | Ga0373927_0052303 | |||
| 1263 | Ga0373947_0030905 | |||
| 1264 | Ga0373937_0004732 | |||
| 1265 | Ga0373925_0061658 | |||
| 1266 | Ga0395899_0023635 | |||
| 1267 | Ga0395899_0024278 | |||
| 1268 | Ga0395899_0026240 | |||
| 1269 | Ga0395899_0035263 | |||
| 1270 | Ga0395899_0057955 | |||
| 1271 | Ga0395899_0065702 | |||
| 1272 | Ga0395899_0069010 | |||
| 1273 | Ga0395900_0000572 | |||
| 1274 | Ga0395900_0006142 | |||
| 1275 | Ga0395900_0006337 | |||
| 1276 | Ga0395900_0006462 | |||
| 1277 | Ga0395900_0016540 | |||
| 1278 | Ga0395900_0017172 | |||
| 1279 | Ga0395900_0020092 | |||
| 1280 | Ga0395900_0040825 | |||
| 1281 | Ga0395900_0052413 | |||
| 1282 | Ga0395900_0056622 | |||
| 1283 | Ga0395900_0077444 | |||
| 1284 | Ga0395900_0190887 | |||
| 1285 | Ga0395900_0303199 | |||
| 1286 | Ga0395900_0531746 | |||
| 1287 | Ga0395900_0553639 | |||
| 1288 | Ga0395898_0007452 | |||
| 1289 | Ga0395898_0029190 | |||
| 1290 | Ga0395898_0049447 | |||
| 1291 | Ga0395898_0070544 | |||
| 1292 | Ga0395898_0150416 | |||
| 1293 | Ga0395898_0153572 | |||
| 1294 | Ga0395898_0157213 | |||
| 1295 | Ga0395898_0495129 | |||
| 1296 | Ga0395905_0000165 | |||
| 1297 | Ga0395905_0001408 | |||
| 1298 | Ga0395905_0001429 | |||
| 1299 | Ga0395905_0004924 | |||
| 1300 | Ga0395905_0010680 | |||
| 1301 | Ga0395905_0012129 | |||
| 1302 | Ga0395905_0012840 | |||
| 1303 | Ga0395905_0017323 | |||
| 1304 | Ga0395905_0019534 | |||
| 1305 | Ga0395905_0023864 | |||
| 1306 | Ga0395905_0034996 | |||
| 1307 | Ga0395905_0036173 | |||
| 1308 | Ga0395905_0076037 | |||
| 1309 | Ga0395905_0090199 | |||
| 1310 | Ga0395905_0096254 | |||
| 1311 | Ga0395905_0114645 | |||
| 1312 | Ga0395905_0115824 | |||
| 1313 | Ga0395905_0148678 | |||
| 1314 | Ga0395905_0210921 | |||
| 1315 | Ga0395905_0229223 | |||
| 1316 | Ga0395905_0550060 | |||
| 1317 | Ga0436364_0351177 | |||
| 1318 | Ga0436364_1265496 | |||
| 1319 | Ga0395901_0001927 | |||
| 1320 | Ga0395901_0006471 | |||
| 1321 | Ga0395901_0011045 | |||
| 1322 | Ga0395901_0028662 | |||
| 1323 | Ga0395901_0043708 | |||
| 1324 | Ga0395901_0070295 | |||
| 1325 | Ga0395901_0110482 | |||
| 1326 | Ga0395901_0130566 | |||
| 1327 | Ga0395901_0154763 | |||
| 1328 | Ga0395901_0166840 | |||
| 1329 | Ga0395901_0184450 | |||
| 1330 | Ga0439465_0038497 | |||
| 1331 | Ga0439445_0000030 | |||
| 1332 | Ga0439432_048420 | |||
| 1333 | Ga0439432_057938 | |||
| 1334 | Ga0439449_0058955 | |||
| 1335 | Ga0439449_0064812 | |||
| 1336 | Ga0450905_003777 | |||
| 1337 | Ga0450889_000275 | |||
| 1338 | Ga0439464_0002488 | |||
| 1339 | Ga0466972_0076180 | |||
| 1340 | Ga0466966_0041197 | |||
| 1341 | Ga0466966_0089919 | |||
| 1342 | Ga0466961_0069118 | |||
| 1343 | Ga0466961_0107360 | |||
| 1344 | Ga0466961_0145736 | |||
| 1345 | Ga0466963_0012905 | |||
| 1346 | Ga0466963_0027548 | |||
| 1347 | Ga0466963_0038555 | |||
| 1348 | Ga0466963_0176015 | |||
| 1349 | Ga0466964_0013633 | |||
| 1350 | Ga0466971_0003355 | |||
| 1351 | Ga0466971_0024442 | |||
| 1352 | Ga0466971_0040542 | |||
| 1353 | Ga0466968_0018145 | |||
| 1354 | Ga0466970_0022613 | |||
| 1355 | Ga0466957_0003051 | |||
| 1356 | Ga0466957_0004212 | |||
| 1357 | Ga0466959_0076411 | |||
| 1358 | Ga0466958_0000385 | |||
| 1359 | Ga0466958_0006390 | |||
| 1360 | Ga0466958_0035540 | |||
| 1361 | Ga0466958_0079590 | |||
| 1362 | Ga0466958_0123894 | |||
| 1363 | Ga0466958_0147971 | |||
| 1364 | Ga0466967_0000053 | |||
| 1365 | Ga0466967_0000840 | |||
| 1366 | Ga0466967_0045010 | |||
| 1367 | Ga0466967_0181171 | |||
| 1368 | Ga0466967_0183554 | |||
| 1369 | Ga0466967_0192434 | |||
| 1370 | Ga0466967_0263993 | |||
| 1371 | Ga0466967_0278317 | |||
| 1372 | Ga0466967_0395487 | |||
| 1373 | Ga0466967_0604403 | |||
| 1374 | Ga0495638_0014243 | |||
| 1375 | Ga0495580_0097892 | |||
| 1376 | Ga0495583_0000766 | |||
| 1377 | Ga0495663_0002000 | |||
| 1378 | Ga0495663_0025180 | |||
| 1379 | Ga0495663_0098763 | |||
| 1380 | Ga0495598_0000521 | |||
| 1381 | Ga0495621_0000194 | |||
| 1382 | Ga0495621_0000361 | |||
| 1383 | Ga0495621_0000708 | |||
| 1384 | Ga0495621_0002382 | |||
| 1385 | Ga0495621_0007750 | |||
| 1386 | Ga0495621_0112192 | |||
| 1387 | Ga0495633_0010211 | |||
| 1388 | Ga0495668_0010612 | |||
| 1389 | Ga0495668_0011181 | |||
| 1390 | Ga0495668_0112915 | |||
| 1391 | Ga0495668_0162201 | |||
| 1392 | Ga0495611_0071796 | |||
| 1393 | Ga0495661_0046511 | |||
| 1394 | Ga0495661_0169200 | |||
| 1395 | Ga0495669_0000890 | |||
| 1396 | Ga0495669_0002557 | |||
| 1397 | Ga0495669_0005935 | |||
| 1398 | Ga0495669_0013465 | |||
| 1399 | Ga0495669_0027019 | |||
| 1400 | Ga0495669_0161401 | |||
| 1401 | Ga0495670_0001443 | |||
| 1402 | Ga0495670_0004013 | |||
| 1403 | Ga0495670_0006704 | |||
| 1404 | Ga0495670_0010867 | |||
| 1405 | Ga0495670_0017447 | |||
| 1406 | Ga0495670_0051506 | |||
| 1407 | Ga0495670_0090148 | |||
| 1408 | Ga0495677_0012156 | |||
| 1409 | Ga0495686_0000530 | |||
| 1410 | Ga0496100_0014655 | |||
| 1411 | Ga0496100_0067833 | |||
| 1412 | Ga0496100_0124940 | |||
| 1413 | Ga0496100_0134235 | |||
| 1414 | Ga0496101_0012653 | |||
| 1415 | Ga0496101_0018340 | |||
| 1416 | Ga0496101_0105521 | |||
| 1417 | Ga0496102_0000036 | |||
| 1418 | Ga0496102_0082710 | |||
| 1419 | Ga0496102_0116445 | |||
| 1420 | Ga0496102_0266502 | |||
| 1421 | Ga0496103_0000120 | |||
| 1422 | Ga0496104_0084239 | |||
| 1423 | Ga0496105_0055104 | |||
| 1424 | Ga0496106_0038953 | |||
| 1425 | Ga0496107_0021732 | |||
| 1426 | Ga0496107_0073909 | |||
| 1427 | Ga0496107_0078297 | |||
| 1428 | Ga0496108_0001272 | |||
| 1429 | Ga0496108_0003147 | |||
| 1430 | Ga0496108_0016911 | |||
| 1431 | Ga0496109_0003815 | |||
| 1432 | Ga0496109_0026042 | |||
| 1433 | Ga0496109_0180649 | |||
| 1434 | Ga0496110_0003918 | |||
| 1435 | Ga0496110_0040422 | |||
| 1436 | Ga0496110_0411211 | |||
| 1437 | Ga0496111_0013395 | |||
| 1438 | Ga0496111_0077896 | |||
| 1439 | Ga0496111_0385450 | |||
| 1440 | Ga0496112_0000761 | |||
| 1441 | Ga0496112_0328237 | |||
| 1442 | Ga0496113_0003741 | |||
| 1443 | Ga0496113_0006102 | |||
| 1444 | Ga0496113_0134307 | |||
| 1445 | Ga0496115_0002148 | |||
| 1446 | Ga0496116_0002277 | |||
| 1447 | Ga0496117_0000093 | |||
| 1448 | Ga0496117_0011338 | |||
| 1449 | Ga0496118_0000070 | |||
| 1450 | Ga0496118_0096376 | |||
| 1451 | Ga0496124_0000302 | |||
| 1452 | Ga0496125_0072689 | |||
| 1453 | Ga0501068_0063686 | |||
| 1454 | Ga0501070_0136140 | |||
| 1455 | Ga0501225_0014655 | |||
| 1456 | Ga0501083_0024482 | |||
| 1457 | Ga0501273_010559 | |||
| 1458 | Ga0501283_001484 | |||
| 1459 | nmdc:mga06r32_139412_c1 | |||
| 1460 | nmdc:mga08y16_21958_c1 | |||
| 1461 | Ga0500643_002599 | |||
| 1462 | Ga0500641_0002882 | |||
| 1463 | Ga0500595_001987 | |||
| 1464 | Ga0500618_007755 | |||
| 1465 | Ga0500636_0088847 | |||
| 1466 | Ga0466962_0088593 | |||
| 1467 | 2738709296 | |||
| 1468 | 2738847721 | |||
| 1469 | 2738863450 | |||
| 1470 | 2739295968 | |||
| 1471 | 2739357646 | |||
| 1472 | 2883293080 | |||
| 1473 | 2883356080 | |||
| 1474 | 2896430155 | |||
| 1475 | 2928030734 | |||
| 1476 | 2928102914 | |||
| 1477 | 2928959480 | |||
| 1478 | 2946789078 | |||
| 1479 | 2984557563 | |||
| 1480 | 2993359119 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3crr-assembly1.cif.gz_A | structure of trna dimethylallyltransferase: rna modification through a channel | 0.9354 | 8 | 306 |
| 2qgn-assembly1.cif.gz_A | crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. | 0.8978 | 8 | 306 |
| 3crr-assembly1.cif.gz_A | structure of trna dimethylallyltransferase: rna modification through a channel | 0.8941 | 8 | 306 |
| 2zm5-assembly1.cif.gz_A | crystal structure of trna modification enzyme miaa in the complex with trna(phe) | 0.8885 | 9 | 307 |
| 3eph-assembly1.cif.gz_A | crystallographic snapshots of eukaryotic dimethylallyltransferase acting on trna: insight into trna recognition and reaction mechanism | 0.8688 | 9 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3crrA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9599 | 8 | 118 | 3.40.50.300 |
| 3exaA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9258 | 7 | 113 | 3.40.50.300 |
| 2zm5B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8971 | 9 | 308 | 3.40.50.300 |
| 3exaA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain | 0.8942 | 202 | 283 | 1.10.287.890 |
| 2zm5B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8934 | 9 | 308 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496JYQ4-F1-model_v4 | deleted | 0.9831 | 11 | 108 |
|
| AF-A0A7J8YA77-F1-model_v4 | Isopentenyltransferase | 0.9814 | 7 | 116 |
GO:0005739
GO:0006400 GO:0009691 GO:0052381 |
| AF-A0A352SST4-F1-model_v4 | tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA | 0.9727 | 11 | 124 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-A0A0K8TFV6-F1-model_v4 | tRNA dimethylallyltransferase, mitochondrial | 0.9634 | 6 | 114 |
GO:0005524
GO:0005739 GO:0006400 GO:0052381 |
| AF-A0A5A7QHC1-F1-model_v4 | tRNA dimethylallyltransferase | 0.9621 | 1 | 114 |
GO:0005739
GO:0006400 GO:0009691 GO:0052381 |