F478508

General Info

Members Datasets Scaffolds Average Seq Length
740 242 1480 300

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100260442|Ga0070671_1002604422
Length 347
Sequence MSAASPRSIQRDSCAPGNRANAAFNSLSSSLPAAISVAMVKAKAPLALIAGPTASGKSALAMKVAEVTGGAIINADSAQVYRDLPILSAAPGPDDRARAEHLLYGVMDGASACSAADWAALAKTEIAHIHGQGRLPILVGGTGLYLRTLLEGIAPIPAIDPEIRATVRGASVAENLAALAPLDPVAATTLNPGDTTRIARALEVVKSSGTTLAEWQEKREGGIGRHVDLQALSLVPPRPWLYDRCDRRFADMVGHGALEEVRRLVSRGLDQNFPVMRAIGVPELSAHLRGEIDLADAVRAGQQATRRYAKRQYTWFSRQPPPDWLRFQDALEDDVIGRALELLVPAG

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
167 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
230 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
231 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
232 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
233 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
234 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
235 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
236 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
237 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
238 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
239 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
240 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
241 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
242 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.14
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 4.86
Rhizosphere 92.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100260442 3300005355 Bacteria 1474
2 JGI24741J21665_1011162 3300001915 Bacteria 1579
3 JGI24740J21852_10045791 3300001979 Bacteria 1288
4 JGI24737J22298_10038997 3300001990 Bacteria 1461
5 JGI24744J21845_10001976 3300002077 Bacteria 4144
6 Ga0065712_10099102 3300005290 Bacteria 2100
7 Ga0065715_10089636 3300005293 Bacteria 9123
8 Ga0070658_10006349 3300005327 Bacteria 9580
9 Ga0070658_10012188 3300005327 Bacteria 6901
10 Ga0070658_10020575 3300005327 Bacteria 5289
11 Ga0070658_10141200 3300005327 Bacteria 2012
12 Ga0070658_10275667 3300005327 Bacteria 1431
13 Ga0070676_10006741 3300005328 Bacteria 6151
14 Ga0070676_10027345 3300005328 Bacteria 3234
15 Ga0070683_100260699 3300005329 Bacteria 1649
16 Ga0070690_100000784 3300005330 Bacteria 16113
17 Ga0070690_100001152 3300005330 Bacteria 13610
18 Ga0070670_100005975 3300005331 Bacteria 10300
19 Ga0070670_100007770 3300005331 Bacteria 9125
20 Ga0070677_10001167 3300005333 Bacteria 8432
21 Ga0070677_10018396 3300005333 Bacteria 2515
22 Ga0070666_10000215 3300005335 Bacteria 39675
23 Ga0070666_10017898 3300005335 Bacteria 4546
24 Ga0070680_100004052 3300005336 Bacteria 10965
25 Ga0070680_100017306 3300005336 Bacteria 5680
26 Ga0070680_100034172 3300005336 Bacteria 4100
27 Ga0070680_100307094 3300005336 Bacteria 1345
28 Ga0068868_100003281 3300005338 Bacteria 11260
29 Ga0068868_100019253 3300005338 Bacteria 5113
30 Ga0068868_100080134 3300005338 Bacteria 2616
31 Ga0070660_100000663 3300005339 Bacteria 22744
32 Ga0070660_100005122 3300005339 Bacteria 9053
33 Ga0070660_100068601 3300005339 Bacteria 2764
34 Ga0070660_100133694 3300005339 Bacteria 1986
35 Ga0070660_100140536 3300005339 Bacteria 1937
36 Ga0070660_100153715 3300005339 Bacteria 1851
37 Ga0070661_100008128 3300005344 Bacteria 7238
38 Ga0070661_100009119 3300005344 Bacteria 6857
39 Ga0070661_100054883 3300005344 Bacteria 2918
40 Ga0070661_100148903 3300005344 Bacteria 1769
41 Ga0070661_100245705 3300005344 Bacteria 1379
42 Ga0070661_100253896 3300005344 Bacteria 1358
43 Ga0070661_100287627 3300005344 Bacteria 1277
44 Ga0070692_10007807 3300005345 Bacteria 4739
45 Ga0070668_100007519 3300005347 Bacteria 8090
46 Ga0070668_100254742 3300005347 Bacteria 1458
47 Ga0070668_100487954 3300005347 Bacteria 1065
48 Ga0070669_100001885 3300005353 Bacteria 15125
49 Ga0070669_100041989 3300005353 Bacteria 3327
50 Ga0070669_100074340 3300005353 Bacteria 2519
51 Ga0070669_100116426 3300005353 Bacteria 2034
52 Ga0070675_100000759 3300005354 Bacteria 22530
53 Ga0070671_100055565 3300005355 Bacteria 3293
54 Ga0070671_100124642 3300005355 Bacteria 2169
55 Ga0070671_100126200 3300005355 Bacteria 2154
56 Ga0070671_100177433 3300005355 Bacteria 1803
57 Ga0070674_100012979 3300005356 Bacteria 5133
58 Ga0070674_100017266 3300005356 Bacteria 4536
59 Ga0070674_100025066 3300005356 Bacteria 3878
60 Ga0070674_100078817 3300005356 Bacteria 2348
61 Ga0070673_100001925 3300005364 Bacteria 12477
62 Ga0070673_100069652 3300005364 Bacteria 2820
63 Ga0070673_100111582 3300005364 Bacteria 2268
64 Ga0070673_100154848 3300005364 Bacteria 1944
65 Ga0070673_100210733 3300005364 Bacteria 1678
66 Ga0070673_100221707 3300005364 Bacteria 1637
67 Ga0070659_100001353 3300005366 Bacteria 17645
68 Ga0070659_100008920 3300005366 Bacteria 7350
69 Ga0070659_100033987 3300005366 Bacteria 3965
70 Ga0070659_100058777 3300005366 Bacteria 3036
71 Ga0070659_100113432 3300005366 Bacteria 2189
72 Ga0070659_100167411 3300005366 Bacteria 1799
73 Ga0070659_100188336 3300005366 Bacteria 1695
74 Ga0070667_100000842 3300005367 Bacteria 28434
75 Ga0070667_100003257 3300005367 Bacteria 13876
76 Ga0070667_100024685 3300005367 Bacteria 4994
77 Ga0070667_100036753 3300005367 Bacteria 4106
78 Ga0070667_100169169 3300005367 Bacteria 1929
79 Ga0070667_100310877 3300005367 Bacteria 1420
80 Ga0070667_100548462 3300005367 Bacteria 1062
81 Ga0070714_100364959 3300005435 Bacteria 1358
82 Ga0070701_10005692 3300005438 Bacteria 5177
83 Ga0070694_100021107 3300005444 Bacteria 4159
84 Ga0070663_100003093 3300005455 Bacteria 9514
85 Ga0070663_100005871 3300005455 Bacteria 7339
86 Ga0070663_100019346 3300005455 Bacteria 4485
87 Ga0070663_100135690 3300005455 Bacteria 1873
88 Ga0070663_100173091 3300005455 Bacteria 1670
89 Ga0070663_100186155 3300005455 Bacteria 1613
90 Ga0070663_100239533 3300005455 Bacteria 1431
91 Ga0070662_100004937 3300005457 Bacteria 8476
92 Ga0070662_100006830 3300005457 Bacteria 7379
93 Ga0070662_100013241 3300005457 Bacteria 5484
94 Ga0070662_100020310 3300005457 Bacteria 4522
95 Ga0070662_100044894 3300005457 Bacteria 3168
96 Ga0070681_10058359 3300005458 Bacteria 3839
97 Ga0070681_10067292 3300005458 Bacteria 3550
98 Ga0070681_10138383 3300005458 Bacteria 2364
99 Ga0070681_10477146 3300005458 Bacteria 1160
100 Ga0068867_100009232 3300005459 Bacteria 6961
101 Ga0068867_100014104 3300005459 Bacteria 5661
102 Ga0068867_100044500 3300005459 Bacteria 3252
103 Ga0070679_100030476 3300005530 Bacteria 5325
104 Ga0070679_100094869 3300005530 Bacteria 2971
105 Ga0070679_100151872 3300005530 Bacteria 2292
106 Ga0070679_100181424 3300005530 Bacteria 2077
107 Ga0070679_100243233 3300005530 Bacteria 1757
108 Ga0068853_100008551 3300005539 Bacteria 8225
109 Ga0068853_100010924 3300005539 Bacteria 7359
110 Ga0068853_100013390 3300005539 Bacteria 6695
111 Ga0068853_100033149 3300005539 Bacteria 4380
112 Ga0068853_100044838 3300005539 Bacteria 3786
113 Ga0068853_100048971 3300005539 Bacteria 3630
114 Ga0068853_100079701 3300005539 Bacteria 2864
115 Ga0068853_100100619 3300005539 Bacteria 2555
116 Ga0068853_100199547 3300005539 Bacteria 1820
117 Ga0070672_100009674 3300005543 Bacteria 6655
118 Ga0070672_100044818 3300005543 Bacteria 3418
119 Ga0070672_100045010 3300005543 Bacteria 3411
120 Ga0070672_100053815 3300005543 Bacteria 3148
121 Ga0070672_100095954 3300005543 Bacteria 2398
122 Ga0070672_100220558 3300005543 Bacteria 1590
123 Ga0070686_100038860 3300005544 Bacteria 2962
124 Ga0070686_100181599 3300005544 Bacteria 1495
125 Ga0070695_100023208 3300005545 Bacteria 3810
126 Ga0070696_100245573 3300005546 Bacteria 1352
127 Ga0070696_100267599 3300005546 Bacteria 1298
128 Ga0070693_100158427 3300005547 Bacteria 1440
129 Ga0070665_100107109 3300005548 Bacteria 2797
130 Ga0070665_100159140 3300005548 Bacteria 2260
131 Ga0068855_100004077 3300005563 Bacteria 17825
132 Ga0068855_100059086 3300005563 Bacteria 4488
133 Ga0070664_100012706 3300005564 Bacteria 6855
134 Ga0070664_100394996 3300005564 Bacteria 1264
135 Ga0068857_100176859 3300005577 Bacteria 1941
136 Ga0068857_100222472 3300005577 Bacteria 1724
137 Ga0068854_100014916 3300005578 Bacteria 5131
138 Ga0068854_100051990 3300005578 Bacteria 2937
139 Ga0068854_100176291 3300005578 Bacteria 1667
140 Ga0068856_100232987 3300005614 Bacteria 1857
141 Ga0068852_100079436 3300005616 Bacteria 2906
142 Ga0068859_100002127 3300005617 Bacteria 20162
143 Ga0068859_100008265 3300005617 Bacteria 10551
144 Ga0068859_100123270 3300005617 Bacteria 2659
145 Ga0068859_100327922 3300005617 Bacteria 1625
146 Ga0068864_100001398 3300005618 Bacteria 19967
147 Ga0068864_100004613 3300005618 Bacteria 11303
148 Ga0068864_100006944 3300005618 Bacteria 9290
149 Ga0068864_100013870 3300005618 Bacteria 6679
150 Ga0068864_100026940 3300005618 Bacteria 4849
151 Ga0068864_100049060 3300005618 Bacteria 3631
152 Ga0068864_100127959 3300005618 Bacteria 2278
153 Ga0068864_100187383 3300005618 Bacteria 1895
154 Ga0068864_100229577 3300005618 Bacteria 1716
155 Ga0068861_100014738 3300005719 Bacteria 5491
156 Ga0068861_100077498 3300005719 Bacteria 2593
157 Ga0068851_10003121 3300005834 Bacteria 7345
158 Ga0068863_100002134 3300005841 Bacteria 19629
159 Ga0068863_100007871 3300005841 Bacteria 10422
160 Ga0068863_100191790 3300005841 Bacteria 1964
161 Ga0068858_100001703 3300005842 Bacteria 22460
162 Ga0068858_100002540 3300005842 Bacteria 18402
163 Ga0068858_100015929 3300005842 Bacteria 7063
164 Ga0068858_100248322 3300005842 Bacteria 1690
165 Ga0068858_100261938 3300005842 Bacteria 1644
166 Ga0068860_100007762 3300005843 Bacteria 10719
167 Ga0068860_100039949 3300005843 Bacteria 4486
168 Ga0068860_100074072 3300005843 Bacteria 3237
169 Ga0068860_100074228 3300005843 Bacteria 3234
170 Ga0068860_100105517 3300005843 Bacteria 2691
171 Ga0068860_100182085 3300005843 Bacteria 2031
172 Ga0068860_100219516 3300005843 Bacteria 1846
173 Ga0068860_100277498 3300005843 Bacteria 1637
174 Ga0068862_100006460 3300005844 Bacteria 9741
175 Ga0068862_100067335 3300005844 Bacteria 3087
176 Ga0097621_100027711 3300006237 Bacteria 4458
177 Ga0097621_100443679 3300006237 Bacteria 1168
178 Ga0068865_100007079 3300006881 Bacteria 6886
179 Ga0068865_100027328 3300006881 Bacteria 3768
180 Ga0097620_100002127 3300006931 Bacteria 20162
181 Ga0097620_100008265 3300006931 Bacteria 10551
182 Ga0097620_100123273 3300006931 Bacteria 2659
183 Ga0097620_100327946 3300006931 Bacteria 1625
184 Ga0105250_10008038 3300009092 Bacteria 4500
185 Ga0105240_10045821 3300009093 Bacteria 5546
186 Ga0105240_10216299 3300009093 Bacteria 2235
187 Ga0105240_10508440 3300009093 Bacteria 1339
188 Ga0111539_10021092 3300009094 Bacteria 8022
189 Ga0105245_10096995 3300009098 Bacteria 2722
190 Ga0105245_10149475 3300009098 Bacteria 2207
191 Ga0105243_10107470 3300009148 Bacteria 2327
192 Ga0105243_10354531 3300009148 Bacteria 1348
193 Ga0105241_10244635 3300009174 Bacteria 1518
194 Ga0105241_10433206 3300009174 Bacteria 1160
195 Ga0105242_10014632 3300009176 Bacteria 6074
196 Ga0105242_10357977 3300009176 Bacteria 1350
197 Ga0105248_10000362 3300009177 Bacteria 53018
198 Ga0105248_10000395 3300009177 Bacteria 50389
199 Ga0105248_10004448 3300009177 Bacteria 15515
200 Ga0105248_10004830 3300009177 Bacteria 14916
201 Ga0105248_10023356 3300009177 Bacteria 6869
202 Ga0105248_10039629 3300009177 Bacteria 5279
203 Ga0105248_10044452 3300009177 Bacteria 4980
204 Ga0105248_10050197 3300009177 Bacteria 4678
205 Ga0105248_10110896 3300009177 Bacteria 3094
206 Ga0105248_10133234 3300009177 Bacteria 2804
207 Ga0105238_10046386 3300009551 Bacteria 4386
208 Ga0105238_10061956 3300009551 Bacteria 3742
209 Ga0105238_10084001 3300009551 Bacteria 3173
210 Ga0105249_10004822 3300009553 Bacteria 11640
211 Ga0105249_10704690 3300009553 Bacteria 1070
212 Ga0105239_10113307 3300010375 Bacteria 3007
213 Ga0105239_10289096 3300010375 Bacteria 1846
214 Ga0105246_10051837 3300011119 Bacteria 2819
215 Ga0157373_10003524 3300013100 Bacteria 11831
216 Ga0157373_10019290 3300013100 Bacteria 4967
217 Ga0157371_10004743 3300013102 Bacteria 11729
218 Ga0157371_10031437 3300013102 Bacteria 3824
219 Ga0157371_10042251 3300013102 Bacteria 3249
220 Ga0157371_10089141 3300013102 Bacteria 2184
221 Ga0157371_10102013 3300013102 Bacteria 2035
222 Ga0157370_10036438 3300013104 Bacteria 4773
223 Ga0157370_10040187 3300013104 Bacteria 4517
224 Ga0157370_10041548 3300013104 Bacteria 4435
225 Ga0157370_10155289 3300013104 Bacteria 2129
226 Ga0157370_10343300 3300013104 Bacteria 1376
227 Ga0157369_10014904 3300013105 Bacteria 8774
228 Ga0157369_10192019 3300013105 Bacteria 2145
229 Ga0157369_10201630 3300013105 Bacteria 2088
230 Ga0157369_10515701 3300013105 Bacteria 1237
231 Ga0157378_10081948 3300013297 Bacteria 2917
232 Ga0157378_10106380 3300013297 Bacteria 2566
233 Ga0163162_10030851 3300013306 Bacteria 5312
234 Ga0163162_10044637 3300013306 Bacteria 4439
235 Ga0163162_10053226 3300013306 Bacteria 4068
236 Ga0163162_10093730 3300013306 Bacteria 3088
237 Ga0163162_10352654 3300013306 Bacteria 1604
238 Ga0163162_10494247 3300013306 Bacteria 1354
239 Ga0163162_10516884 3300013306 Bacteria 1324
240 Ga0157372_10290859 3300013307 Bacteria 1900
241 Ga0157372_10507895 3300013307 Bacteria 1405
242 Ga0157372_10719948 3300013307 Bacteria 1161
243 Ga0157375_10015558 3300013308 Bacteria 6814
244 Ga0157375_10044266 3300013308 Bacteria 4323
245 Ga0157375_10135319 3300013308 Bacteria 2587
246 Ga0157375_10214795 3300013308 Bacteria 2081
247 Ga0157375_10455671 3300013308 Bacteria 1444
248 Ga0163163_10001203 3300014325 Bacteria 21898
249 Ga0163163_10004004 3300014325 Bacteria 12569
250 Ga0163163_10232748 3300014325 Bacteria 1892
251 Ga0157380_10002495 3300014326 Bacteria 12405
252 Ga0157380_10007684 3300014326 Bacteria 7672
253 Ga0157380_10105118 3300014326 Bacteria 2360
254 Ga0157380_10138676 3300014326 Bacteria 2086
255 Ga0157377_10080376 3300014745 Bacteria 1904
256 Ga0157377_10102844 3300014745 Bacteria 1705
257 Ga0157379_10037628 3300014968 Bacteria 4316
258 Ga0157379_10130183 3300014968 Bacteria 2264
259 Ga0157379_10136323 3300014968 Bacteria 2212
260 Ga0157379_10193334 3300014968 Bacteria 1839
261 Ga0157379_10285682 3300014968 Bacteria 1502
262 Ga0163161_10033191 3300017792 Bacteria 3688
263 Ga0163161_10040426 3300017792 Bacteria 3350
264 Ga0163161_10065892 3300017792 Bacteria 2643
265 Ga0206353_11413780 3300020082 Bacteria 3011
266 Ga0207697_10000927 3300025315 Bacteria 16534
267 Ga0207697_10009191 3300025315 Bacteria 4277
268 Ga0207697_10042058 3300025315 Bacteria 1877
269 Ga0207656_10017215 3300025321 Bacteria 2827
270 Ga0207682_10002411 3300025893 Bacteria 8417
271 Ga0207688_10010155 3300025901 Bacteria 5123
272 Ga0207680_10000626 3300025903 Bacteria 16644
273 Ga0207680_10083606 3300025903 Bacteria 2012
274 Ga0207647_10000339 3300025904 Bacteria 38180
275 Ga0207647_10041294 3300025904 Bacteria 2901
276 Ga0207647_10056512 3300025904 Bacteria 2408
277 Ga0207645_10011234 3300025907 Bacteria 6125
278 Ga0207645_10059349 3300025907 Bacteria 2443
279 Ga0207645_10103135 3300025907 Bacteria 1841
280 Ga0207705_10001142 3300025909 Bacteria 21619
281 Ga0207705_10003304 3300025909 Bacteria 12267
282 Ga0207705_10012711 3300025909 Bacteria 6075
283 Ga0207705_10021695 3300025909 Bacteria 4581
284 Ga0207705_10067664 3300025909 Bacteria 2585
285 Ga0207705_10082612 3300025909 Bacteria 2343
286 Ga0207660_10000140 3300025917 Bacteria 43651
287 Ga0207660_10012082 3300025917 Bacteria 5644
288 Ga0207657_10000020 3300025919 Bacteria 157826
289 Ga0207657_10001366 3300025919 Bacteria 26016
290 Ga0207657_10003566 3300025919 Bacteria 16604
291 Ga0207657_10004033 3300025919 Bacteria 15600
292 Ga0207657_10007910 3300025919 Bacteria 10842
293 Ga0207657_10041186 3300025919 Bacteria 4086
294 Ga0207657_10043574 3300025919 Bacteria 3951
295 Ga0207657_10048372 3300025919 Bacteria 3714
296 Ga0207657_10147728 3300025919 Bacteria 1916
297 Ga0207657_10169066 3300025919 Bacteria 1772
298 Ga0207657_10263734 3300025919 Bacteria 1370
299 Ga0207657_10314244 3300025919 Bacteria 1239
300 Ga0207649_10030791 3300025920 Bacteria 3182
301 Ga0207652_10048837 3300025921 Bacteria 3619
302 Ga0207652_10058671 3300025921 Bacteria 3316
303 Ga0207652_10226886 3300025921 Bacteria 1684
304 Ga0207681_10006995 3300025923 Bacteria 6923
305 Ga0207681_10133344 3300025923 Bacteria 1839
306 Ga0207681_10162094 3300025923 Bacteria 1687
307 Ga0207681_10175896 3300025923 Bacteria 1626
308 Ga0207694_10018205 3300025924 Bacteria 5310
309 Ga0207650_10006327 3300025925 Bacteria 8068
310 Ga0207650_10007606 3300025925 Bacteria 7386
311 Ga0207650_10103454 3300025925 Bacteria 2196
312 Ga0207650_10105414 3300025925 Bacteria 2176
313 Ga0207659_10002265 3300025926 Bacteria 11450
314 Ga0207659_10026739 3300025926 Bacteria 3897
315 Ga0207659_10121598 3300025926 Bacteria 2001
316 Ga0207687_10166120 3300025927 Bacteria 1698
317 Ga0207664_10393544 3300025929 Bacteria 1232
318 Ga0207644_10000324 3300025931 Bacteria 31071
319 Ga0207644_10028714 3300025931 Bacteria 3854
320 Ga0207644_10043502 3300025931 Bacteria 3187
321 Ga0207644_10047379 3300025931 Bacteria 3067
322 Ga0207644_10089812 3300025931 Bacteria 2287
323 Ga0207644_10117466 3300025931 Bacteria 2020
324 Ga0207690_10009242 3300025932 Bacteria 5854
325 Ga0207690_10013571 3300025932 Bacteria 4898
326 Ga0207690_10041125 3300025932 Bacteria 3028
327 Ga0207690_10122747 3300025932 Bacteria 1889
328 Ga0207690_10152367 3300025932 Bacteria 1715
329 Ga0207706_10004058 3300025933 Bacteria 13845
330 Ga0207706_10004109 3300025933 Bacteria 13739
331 Ga0207706_10008737 3300025933 Bacteria 9326
332 Ga0207706_10020444 3300025933 Bacteria 5952
333 Ga0207706_10052239 3300025933 Bacteria 3608
334 Ga0207706_10053416 3300025933 Bacteria 3567
335 Ga0207706_10056986 3300025933 Bacteria 3443
336 Ga0207706_10279295 3300025933 Bacteria 1457
337 Ga0207686_10050495 3300025934 Bacteria 2586
338 Ga0207709_10121323 3300025935 Bacteria 1765
339 Ga0207709_10153998 3300025935 Bacteria 1595
340 Ga0207669_10002475 3300025937 Bacteria 7880
341 Ga0207669_10056487 3300025937 Bacteria 2384
342 Ga0207669_10137595 3300025937 Bacteria 1690
343 Ga0207704_10012434 3300025938 Bacteria 4225
344 Ga0207691_10000915 3300025940 Bacteria 29231
345 Ga0207691_10001856 3300025940 Bacteria 20649
346 Ga0207691_10012965 3300025940 Bacteria 7983
347 Ga0207691_10034786 3300025940 Bacteria 4682
348 Ga0207691_10044565 3300025940 Bacteria 4081
349 Ga0207691_10118481 3300025940 Bacteria 2349
350 Ga0207691_10310035 3300025940 Bacteria 1354
351 Ga0207711_10000429 3300025941 Bacteria 43981
352 Ga0207711_10000610 3300025941 Bacteria 36080
353 Ga0207711_10002544 3300025941 Bacteria 16237
354 Ga0207711_10004237 3300025941 Bacteria 12275
355 Ga0207711_10029458 3300025941 Bacteria 4631
356 Ga0207711_10034390 3300025941 Bacteria 4292
357 Ga0207711_10058671 3300025941 Bacteria 3313
358 Ga0207711_10141459 3300025941 Bacteria 2165
359 Ga0207711_10388792 3300025941 Bacteria 1295
360 Ga0207689_10002262 3300025942 Bacteria 18047
361 Ga0207679_10018161 3300025945 Bacteria 4707
362 Ga0207679_10055146 3300025945 Bacteria 2928
363 Ga0207679_10344618 3300025945 Bacteria 1297
364 Ga0207667_10002757 3300025949 Bacteria 21723
365 Ga0207651_10000378 3300025960 Bacteria 18962
366 Ga0207651_10002434 3300025960 Bacteria 8899
367 Ga0207651_10111161 3300025960 Bacteria 2057
368 Ga0207651_10158227 3300025960 Bacteria 1772
369 Ga0207651_10160365 3300025960 Bacteria 1762
370 Ga0207712_10016256 3300025961 Bacteria 4814
371 Ga0207668_10006711 3300025972 Bacteria 6807
372 Ga0207640_10009307 3300025981 Bacteria 5496
373 Ga0207640_10042095 3300025981 Bacteria 2910
374 Ga0207658_10001871 3300025986 Bacteria 15758
375 Ga0207658_10003528 3300025986 Bacteria 11039
376 Ga0207658_10005525 3300025986 Bacteria 8664
377 Ga0207658_10057889 3300025986 Bacteria 2882
378 Ga0207658_10090752 3300025986 Bacteria 2369
379 Ga0207677_10003982 3300026023 Bacteria 7879
380 Ga0207677_10031985 3300026023 Bacteria 3377
381 Ga0207703_10006106 3300026035 Bacteria 9638
382 Ga0207703_10017409 3300026035 Bacteria 5609
383 Ga0207703_10025682 3300026035 Bacteria 4634
384 Ga0207703_10048214 3300026035 Bacteria 3437
385 Ga0207639_10002451 3300026041 Bacteria 12445
386 Ga0207639_10036236 3300026041 Bacteria 3654
387 Ga0207639_10064020 3300026041 Bacteria 2850
388 Ga0207639_10152743 3300026041 Bacteria 1936
389 Ga0207639_10299800 3300026041 Bacteria 1420
390 Ga0207678_10005111 3300026067 Bacteria 11770
391 Ga0207678_10032329 3300026067 Bacteria 4559
392 Ga0207678_10060984 3300026067 Bacteria 3243
393 Ga0207678_10165177 3300026067 Bacteria 1890
394 Ga0207702_10030613 3300026078 Bacteria 4484
395 Ga0207641_10002148 3300026088 Bacteria 18577
396 Ga0207641_10006264 3300026088 Bacteria 10065
397 Ga0207641_10167744 3300026088 Bacteria 2001
398 Ga0207648_10013267 3300026089 Bacteria 7677
399 Ga0207648_10021875 3300026089 Bacteria 5745
400 Ga0207648_10022350 3300026089 Bacteria 5683
401 Ga0207648_10023740 3300026089 Bacteria 5487
402 Ga0207676_10007920 3300026095 Bacteria 7559
403 Ga0207676_10019201 3300026095 Bacteria 4982
404 Ga0207676_10064276 3300026095 Bacteria 2917
405 Ga0207676_10132092 3300026095 Bacteria 2124
406 Ga0207676_10573893 3300026095 Bacteria 1080
407 Ga0207674_10037383 3300026116 Bacteria 5050
408 Ga0207674_10037696 3300026116 Bacteria 5024
409 Ga0207674_10059771 3300026116 Bacteria 3856
410 Ga0207675_100011697 3300026118 Bacteria 8206
411 Ga0207683_10003409 3300026121 Bacteria 13837
412 Ga0207698_10213981 3300026142 Bacteria 1736
413 Ga0268266_10009752 3300028379 Bacteria 8447
414 Ga0268266_10083841 3300028379 Bacteria 2782
415 Ga0268266_10147620 3300028379 Bacteria 2116
416 Ga0268265_10007581 3300028380 Bacteria 7321
417 Ga0268265_10008543 3300028380 Bacteria 6922
418 Ga0268265_10021023 3300028380 Bacteria 4564
419 Ga0268264_10005351 3300028381 Bacteria 10879
420 Ga0268264_10232928 3300028381 Bacteria 1702
421 Ga0268264_10271156 3300028381 Bacteria 1585
422 Ga0268264_10290261 3300028381 Bacteria 1536
423 Ga0316182_1337346 3300030745 Bacteria 1764
424 Ga0307408_100053920 3300031548 Bacteria 2906
425 Ga0307408_100057257 3300031548 Bacteria 2829
426 Ga0307408_100062616 3300031548 Bacteria 2719
427 Ga0307408_100138666 3300031548 Bacteria 1906
428 Ga0307408_100150670 3300031548 Bacteria 1835
429 Ga0307408_100205013 3300031548 Bacteria 1599
430 Ga0307405_10020665 3300031731 Bacteria 3683
431 Ga0307405_10055410 3300031731 Bacteria 2481
432 Ga0307405_10059872 3300031731 Bacteria 2401
433 Ga0307405_10219337 3300031731 Bacteria 1394
434 Ga0307405_10226453 3300031731 Bacteria 1375
435 Ga0307413_10002121 3300031824 Bacteria 7956
436 Ga0307413_10003459 3300031824 Bacteria 6647
437 Ga0307413_10007360 3300031824 Bacteria 5107
438 Ga0307413_10025511 3300031824 Bacteria 3241
439 Ga0307413_10025931 3300031824 Bacteria 3222
440 Ga0307413_10051349 3300031824 Bacteria 2484
441 Ga0307413_10070193 3300031824 Bacteria 2201
442 Ga0307413_10074113 3300031824 Bacteria 2154
443 Ga0307413_10113855 3300031824 Bacteria 1817
444 Ga0307413_10214601 3300031824 Bacteria 1400
445 Ga0307410_10000582 3300031852 Bacteria 15008
446 Ga0307410_10006823 3300031852 Bacteria 6199
447 Ga0307410_10014820 3300031852 Bacteria 4602
448 Ga0307410_10077697 3300031852 Bacteria 2321
449 Ga0307410_10082024 3300031852 Bacteria 2267
450 Ga0307410_10133301 3300031852 Bacteria 1828
451 Ga0307410_10155262 3300031852 Bacteria 1708
452 Ga0307406_10020099 3300031901 Bacteria 3927
453 Ga0307406_10041590 3300031901 Bacteria 2864
454 Ga0307406_10052027 3300031901 Bacteria 2603
455 Ga0307406_10057799 3300031901 Bacteria 2490
456 Ga0307406_10100383 3300031901 Bacteria 1970
457 Ga0307406_10111370 3300031901 Bacteria 1885
458 Ga0307406_10121872 3300031901 Bacteria 1815
459 Ga0307406_10282623 3300031901 Bacteria 1266
460 Ga0307407_10002061 3300031903 Bacteria 7692
461 Ga0307407_10008454 3300031903 Bacteria 4728
462 Ga0307407_10009916 3300031903 Bacteria 4462
463 Ga0307407_10024424 3300031903 Bacteria 3170
464 Ga0307407_10053392 3300031903 Bacteria 2325
465 Ga0307412_10028081 3300031911 Bacteria 3516
466 Ga0307412_10039422 3300031911 Bacteria 3049
467 Ga0307412_10045502 3300031911 Bacteria 2869
468 Ga0307412_10078529 3300031911 Bacteria 2274
469 Ga0307412_10081779 3300031911 Bacteria 2235
470 Ga0307412_10088777 3300031911 Bacteria 2157
471 Ga0307412_10103298 3300031911 Bacteria 2020
472 Ga0307412_10148841 3300031911 Bacteria 1725
473 Ga0307409_100006126 3300031995 Bacteria 7031
474 Ga0307409_100024952 3300031995 Bacteria 4182
475 Ga0307409_100059131 3300031995 Bacteria 2981
476 Ga0307409_100163759 3300031995 Bacteria 1948
477 Ga0307409_100181092 3300031995 Bacteria 1865
478 Ga0307409_100261945 3300031995 Bacteria 1587
479 Ga0307409_100285331 3300031995 Bacteria 1528
480 Ga0307416_100001945 3300032002 Bacteria 11564
481 Ga0307416_100008194 3300032002 Bacteria 6717
482 Ga0307416_100008380 3300032002 Bacteria 6664
483 Ga0307416_100085128 3300032002 Bacteria 2689
484 Ga0307416_100132207 3300032002 Bacteria 2249
485 Ga0307416_100223146 3300032002 Bacteria 1809
486 Ga0307416_100223821 3300032002 Bacteria 1807
487 Ga0307416_100250437 3300032002 Bacteria 1723
488 Ga0307416_100377248 3300032002 Bacteria 1447
489 Ga0307414_10015279 3300032004 Bacteria 4632
490 Ga0307414_10029340 3300032004 Bacteria 3579
491 Ga0307414_10037396 3300032004 Bacteria 3250
492 Ga0307414_10049216 3300032004 Bacteria 2913
493 Ga0307414_10056665 3300032004 Bacteria 2750
494 Ga0307414_10085637 3300032004 Bacteria 2322
495 Ga0307414_10197199 3300032004 Bacteria 1634
496 Ga0307414_10375584 3300032004 Bacteria 1227
497 Ga0307411_10000911 3300032005 Bacteria 11227
498 Ga0307411_10001680 3300032005 Bacteria 9267
499 Ga0307411_10002663 3300032005 Bacteria 7996
500 Ga0307411_10009739 3300032005 Bacteria 5076
501 Ga0307411_10021862 3300032005 Bacteria 3754
502 Ga0307411_10028517 3300032005 Bacteria 3395
503 Ga0307411_10036258 3300032005 Bacteria 3088
504 Ga0307411_10057229 3300032005 Bacteria 2574
505 Ga0307411_10123114 3300032005 Bacteria 1880
506 Ga0307411_10128273 3300032005 Bacteria 1849
507 Ga0307411_10178408 3300032005 Bacteria 1609
508 Ga0307411_10221747 3300032005 Bacteria 1467
509 Ga0307411_10226723 3300032005 Bacteria 1453
510 Ga0307415_100000243 3300032126 Bacteria 23624
511 Ga0307415_100001952 3300032126 Bacteria 10151
512 Ga0307415_100002407 3300032126 Bacteria 9327
513 Ga0307415_100062346 3300032126 Bacteria 2586
514 Ga0307415_100113801 3300032126 Bacteria 2013
515 Ga0307415_100121951 3300032126 Bacteria 1956
516 Ga0307415_100320689 3300032126 Bacteria 1292
517 Ga0373930_0014809 3300034816 Bacteria 1457
518 Ga0373946_0004744 3300035171 Bacteria 4887
519 Ga0373962_0072758 3300035242 Bacteria 1030
520 Ga0373935_0042878 3300035692 Bacteria 2846
521 Ga0373935_0099795 3300035692 Bacteria 1912
522 Ga0373927_0052303 3300035695 Bacteria 2642
523 Ga0373947_0030905 3300035725 Bacteria 3149
524 Ga0373937_0004732 3300036401 Bacteria 11577
525 Ga0373925_0061658 3300037068 Bacteria 2817
526 Ga0395899_0023635 3300037312 Bacteria 4652
527 Ga0395899_0024278 3300037312 Bacteria 4585
528 Ga0395899_0026240 3300037312 Bacteria 4396
529 Ga0395899_0035263 3300037312 Bacteria 3755
530 Ga0395899_0057955 3300037312 Bacteria 2858
531 Ga0395899_0065702 3300037312 Bacteria 2665
532 Ga0395899_0069010 3300037312 Bacteria 2590
533 Ga0395900_0000572 3300037418 Bacteria 50991
534 Ga0395900_0006142 3300037418 Bacteria 12535
535 Ga0395900_0006337 3300037418 Bacteria 12335
536 Ga0395900_0006462 3300037418 Bacteria 12219
537 Ga0395900_0016540 3300037418 Bacteria 7525
538 Ga0395900_0017172 3300037418 Bacteria 7387
539 Ga0395900_0020092 3300037418 Bacteria 6813
540 Ga0395900_0040825 3300037418 Bacteria 4782
541 Ga0395900_0052413 3300037418 Bacteria 4200
542 Ga0395900_0056622 3300037418 Bacteria 4035
543 Ga0395900_0077444 3300037418 Bacteria 3416
544 Ga0395900_0190887 3300037418 Bacteria 2078
545 Ga0395900_0303199 3300037418 Bacteria 1583
546 Ga0395900_0531746 3300037418 Bacteria 1122
547 Ga0395900_0553639 3300037418 Bacteria 1094
548 Ga0395898_0007452 3300037466 Bacteria 11615
549 Ga0395898_0029190 3300037466 Bacteria 5526
550 Ga0395898_0049447 3300037466 Bacteria 4120
551 Ga0395898_0070544 3300037466 Bacteria 3377
552 Ga0395898_0150416 3300037466 Bacteria 2228
553 Ga0395898_0153572 3300037466 Bacteria 2202
554 Ga0395898_0157213 3300037466 Bacteria 2174
555 Ga0395898_0495129 3300037466 Bacteria 1163
556 Ga0395905_0000165 3300037471 Bacteria 109385
557 Ga0395905_0001408 3300037471 Bacteria 29105
558 Ga0395905_0001429 3300037471 Bacteria 28769
559 Ga0395905_0004924 3300037471 Bacteria 13752
560 Ga0395905_0010680 3300037471 Bacteria 8905
561 Ga0395905_0012129 3300037471 Bacteria 8302
562 Ga0395905_0012840 3300037471 Bacteria 8051
563 Ga0395905_0017323 3300037471 Bacteria 6841
564 Ga0395905_0019534 3300037471 Bacteria 6423
565 Ga0395905_0023864 3300037471 Bacteria 5774
566 Ga0395905_0034996 3300037471 Bacteria 4715
567 Ga0395905_0036173 3300037471 Bacteria 4637
568 Ga0395905_0076037 3300037471 Bacteria 3146
569 Ga0395905_0090199 3300037471 Bacteria 2873
570 Ga0395905_0096254 3300037471 Bacteria 2779
571 Ga0395905_0114645 3300037471 Bacteria 2532
572 Ga0395905_0115824 3300037471 Bacteria 2518
573 Ga0395905_0148678 3300037471 Bacteria 2204
574 Ga0395905_0210921 3300037471 Bacteria 1820
575 Ga0395905_0229223 3300037471 Bacteria 1737
576 Ga0395905_0550060 3300037471 Bacteria 1055
577 Ga0436364_0351177 3300037853 Bacteria 1059
578 Ga0436364_1265496 3300037853 Bacteria 15678
579 Ga0395901_0001927 3300038443 Bacteria 21367
580 Ga0395901_0006471 3300038443 Bacteria 11862
581 Ga0395901_0011045 3300038443 Bacteria 9149
582 Ga0395901_0028662 3300038443 Bacteria 5727
583 Ga0395901_0043708 3300038443 Bacteria 4647
584 Ga0395901_0070295 3300038443 Bacteria 3647
585 Ga0395901_0110482 3300038443 Bacteria 2886
586 Ga0395901_0130566 3300038443 Bacteria 2640
587 Ga0395901_0154763 3300038443 Bacteria 2408
588 Ga0395901_0166840 3300038443 Bacteria 2311
589 Ga0395901_0184450 3300038443 Bacteria 2188
590 Ga0439465_0038497 3300041413 Bacteria 1541
591 Ga0439445_0000030 3300042004 Bacteria 19033
592 Ga0439432_048420 3300042006 Bacteria 1331
593 Ga0439432_057938 3300042006 Bacteria 1198
594 Ga0439449_0058955 3300042007 Bacteria 1417
595 Ga0439449_0064812 3300042007 Bacteria 1348
596 Ga0450905_003777 3300042142 Bacteria 1993
597 Ga0450889_000275 3300042144 Bacteria 5731
598 Ga0439464_0002488 3300042439 Bacteria 4540
599 Ga0466972_0076180 3300044658 Bacteria 1598
600 Ga0466966_0041197 3300044684 Bacteria 2968
601 Ga0466966_0089919 3300044684 Bacteria 1907
602 Ga0466961_0069118 3300044693 Bacteria 2243
603 Ga0466961_0107360 3300044693 Bacteria 1757
604 Ga0466961_0145736 3300044693 Bacteria 1481
605 Ga0466963_0012905 3300044694 Bacteria 5120
606 Ga0466963_0027548 3300044694 Bacteria 3640
607 Ga0466963_0038555 3300044694 Bacteria 3125
608 Ga0466963_0176015 3300044694 Bacteria 1493
609 Ga0466964_0013633 3300044706 Bacteria 3084
610 Ga0466971_0003355 3300044719 Bacteria 6840
611 Ga0466971_0024442 3300044719 Bacteria 2696
612 Ga0466971_0040542 3300044719 Bacteria 2091
613 Ga0466968_0018145 3300044735 Bacteria 2820
614 Ga0466970_0022613 3300044765 Bacteria 3282
615 Ga0466957_0003051 3300044842 Bacteria 9106
616 Ga0466957_0004212 3300044842 Bacteria 7977
617 Ga0466959_0076411 3300045049 Bacteria 2418
618 Ga0466958_0000385 3300045836 Bacteria 17978
619 Ga0466958_0006390 3300045836 Bacteria 6410
620 Ga0466958_0035540 3300045836 Bacteria 2977
621 Ga0466958_0079590 3300045836 Bacteria 2015
622 Ga0466958_0123894 3300045836 Bacteria 1619
623 Ga0466958_0147971 3300045836 Bacteria 1481
624 Ga0466967_0000053 3300045976 Bacteria 41252
625 Ga0466967_0000840 3300045976 Bacteria 16221
626 Ga0466967_0045010 3300045976 Bacteria 3833
627 Ga0466967_0181171 3300045976 Bacteria 1987
628 Ga0466967_0183554 3300045976 Bacteria 1974
629 Ga0466967_0192434 3300045976 Bacteria 1928
630 Ga0466967_0263993 3300045976 Bacteria 1648
631 Ga0466967_0278317 3300045976 Bacteria 1605
632 Ga0466967_0395487 3300045976 Bacteria 1344
633 Ga0466967_0604403 3300045976 Bacteria 1083
634 Ga0495638_0014243 3300046460 Bacteria 5382
635 Ga0495580_0097892 3300046472 Bacteria 2041
636 Ga0495583_0000766 3300046506 Bacteria 40320
637 Ga0495663_0002000 3300046525 Bacteria 6270
638 Ga0495663_0025180 3300046525 Bacteria 1733
639 Ga0495663_0098763 3300046525 Bacteria 959
640 Ga0495598_0000521 3300046537 Bacteria 7138
641 Ga0495621_0000194 3300046539 Bacteria 14011
642 Ga0495621_0000361 3300046539 Bacteria 11072
643 Ga0495621_0000708 3300046539 Bacteria 8433
644 Ga0495621_0002382 3300046539 Bacteria 5056
645 Ga0495621_0007750 3300046539 Bacteria 3190
646 Ga0495621_0112192 3300046539 Bacteria 1046
647 Ga0495633_0010211 3300046558 Bacteria 5137
648 Ga0495668_0010612 3300046616 Bacteria 5566
649 Ga0495668_0011181 3300046616 Bacteria 5387
650 Ga0495668_0112915 3300046616 Bacteria 1486
651 Ga0495668_0162201 3300046616 Bacteria 1224
652 Ga0495611_0071796 3300046648 Bacteria 1583
653 Ga0495661_0046511 3300046665 Bacteria 2649
654 Ga0495661_0169200 3300046665 Bacteria 1167
655 Ga0495669_0000890 3300046684 Bacteria 12578
656 Ga0495669_0002557 3300046684 Bacteria 7428
657 Ga0495669_0005935 3300046684 Bacteria 5090
658 Ga0495669_0013465 3300046684 Bacteria 3485
659 Ga0495669_0027019 3300046684 Bacteria 2510
660 Ga0495669_0161401 3300046684 Bacteria 1064
661 Ga0495670_0001443 3300046691 Bacteria 11626
662 Ga0495670_0004013 3300046691 Bacteria 7218
663 Ga0495670_0006704 3300046691 Bacteria 5663
664 Ga0495670_0010867 3300046691 Bacteria 4474
665 Ga0495670_0017447 3300046691 Bacteria 3533
666 Ga0495670_0051506 3300046691 Bacteria 2060
667 Ga0495670_0090148 3300046691 Bacteria 1569
668 Ga0495677_0012156 3300047445 Bacteria 3141
669 Ga0495686_0000530 3300047472 Bacteria 54741
670 Ga0496100_0014655 3300048903 Bacteria 4557
671 Ga0496100_0067833 3300048903 Bacteria 2370
672 Ga0496100_0124940 3300048903 Bacteria 1805
673 Ga0496100_0134235 3300048903 Bacteria 1747
674 Ga0496101_0012653 3300048904 Bacteria 5637
675 Ga0496101_0018340 3300048904 Bacteria 4756
676 Ga0496101_0105521 3300048904 Bacteria 2115
677 Ga0496102_0000036 3300048905 Bacteria 201896
678 Ga0496102_0082710 3300048905 Bacteria 2961
679 Ga0496102_0116445 3300048905 Bacteria 2494
680 Ga0496102_0266502 3300048905 Bacteria 1615
681 Ga0496103_0000120 3300048906 Bacteria 85481
682 Ga0496104_0084239 3300048907 Bacteria 3033
683 Ga0496105_0055104 3300048908 Bacteria 3283
684 Ga0496106_0038953 3300048909 Bacteria 3559
685 Ga0496107_0021732 3300048910 Bacteria 4534
686 Ga0496107_0073909 3300048910 Bacteria 2480
687 Ga0496107_0078297 3300048910 Bacteria 2408
688 Ga0496108_0001272 3300048911 Bacteria 19736
689 Ga0496108_0003147 3300048911 Bacteria 13271
690 Ga0496108_0016911 3300048911 Bacteria 5961
691 Ga0496109_0003815 3300048912 Bacteria 12585
692 Ga0496109_0026042 3300048912 Bacteria 5213
693 Ga0496109_0180649 3300048912 Bacteria 1981
694 Ga0496110_0003918 3300048913 Bacteria 11450
695 Ga0496110_0040422 3300048913 Bacteria 4065
696 Ga0496110_0411211 3300048913 Bacteria 1233
697 Ga0496111_0013395 3300048914 Bacteria 5578
698 Ga0496111_0077896 3300048914 Bacteria 2417
699 Ga0496111_0385450 3300048914 Bacteria 1036
700 Ga0496112_0000761 3300048915 Bacteria 22616
701 Ga0496112_0328237 3300048915 Bacteria 1474
702 Ga0496113_0003741 3300048916 Bacteria 9170
703 Ga0496113_0006102 3300048916 Bacteria 7601
704 Ga0496113_0134307 3300048916 Bacteria 1943
705 Ga0496115_0002148 3300048918 Bacteria 14095
706 Ga0496116_0002277 3300048919 Bacteria 20365
707 Ga0496117_0000093 3300048920 Bacteria 201862
708 Ga0496117_0011338 3300048920 Bacteria 7990
709 Ga0496118_0000070 3300048921 Bacteria 201866
710 Ga0496118_0096376 3300048921 Bacteria 2016
711 Ga0496124_0000302 3300048927 Bacteria 91124
712 Ga0496125_0072689 3300048928 Bacteria 2678
713 Ga0501068_0063686 3300049584 Bacteria 2243
714 Ga0501070_0136140 3300049586 Bacteria 2028
715 Ga0501225_0014655 3300049705 Bacteria 2187
716 Ga0501083_0024482 3300049744 Bacteria 4182
717 Ga0501273_010559 3300049770 Bacteria 1137
718 Ga0501283_001484 3300049779 Bacteria 3034
719 nmdc:mga06r32_139412_c1 3300050510 Bacteria 2401
720 nmdc:mga08y16_21958_c1 3300050511 Bacteria 6737
721 Ga0500643_002599 3300053087 Bacteria 9161
722 Ga0500641_0002882 3300053096 Bacteria 6098
723 Ga0500595_001987 3300053119 Bacteria 10493
724 Ga0500618_007755 3300053125 Bacteria 3036
725 Ga0500636_0088847 3300053177 Bacteria 1772
726 Ga0466962_0088593 3300061719 Bacteria 1482
727 2738709296 2738541275 Bacteria 4830863
728 2738847721 2738541301 Bacteria 4834102
729 2738863450 2738541304 Bacteria 4833665
730 2739295968 2738543022 Bacteria 4835059
731 2739357646 2738543033 Bacteria 4833336
732 2883293080 2883291878 Bacteria 5894118
733 2883356080 2883354860 Bacteria 5865246
734 2896430155 2896429255 Bacteria 2557483
735 2928030734 2928027323 Bacteria 4382488
736 2928102914 2928100450 Bacteria 4837635
737 2928959480 2928959182 Bacteria 4725774
738 2946789078 2946787523 Bacteria 4366789
739 2984557563 2984555340 Bacteria 4247089
740 2993359119 2993356040 Bacteria 4247105
741 Ga0070671_100260442
742 JGI24741J21665_1011162
743 JGI24740J21852_10045791
744 JGI24737J22298_10038997
745 JGI24744J21845_10001976
746 Ga0065712_10099102
747 Ga0065715_10089636
748 Ga0070658_10006349
749 Ga0070658_10012188
750 Ga0070658_10020575
751 Ga0070658_10141200
752 Ga0070658_10275667
753 Ga0070676_10006741
754 Ga0070676_10027345
755 Ga0070683_100260699
756 Ga0070690_100000784
757 Ga0070690_100001152
758 Ga0070670_100005975
759 Ga0070670_100007770
760 Ga0070677_10001167
761 Ga0070677_10018396
762 Ga0070666_10000215
763 Ga0070666_10017898
764 Ga0070680_100004052
765 Ga0070680_100017306
766 Ga0070680_100034172
767 Ga0070680_100307094
768 Ga0068868_100003281
769 Ga0068868_100019253
770 Ga0068868_100080134
771 Ga0070660_100000663
772 Ga0070660_100005122
773 Ga0070660_100068601
774 Ga0070660_100133694
775 Ga0070660_100140536
776 Ga0070660_100153715
777 Ga0070661_100008128
778 Ga0070661_100009119
779 Ga0070661_100054883
780 Ga0070661_100148903
781 Ga0070661_100245705
782 Ga0070661_100253896
783 Ga0070661_100287627
784 Ga0070692_10007807
785 Ga0070668_100007519
786 Ga0070668_100254742
787 Ga0070668_100487954
788 Ga0070669_100001885
789 Ga0070669_100041989
790 Ga0070669_100074340
791 Ga0070669_100116426
792 Ga0070675_100000759
793 Ga0070671_100055565
794 Ga0070671_100124642
795 Ga0070671_100126200
796 Ga0070671_100177433
797 Ga0070674_100012979
798 Ga0070674_100017266
799 Ga0070674_100025066
800 Ga0070674_100078817
801 Ga0070673_100001925
802 Ga0070673_100069652
803 Ga0070673_100111582
804 Ga0070673_100154848
805 Ga0070673_100210733
806 Ga0070673_100221707
807 Ga0070659_100001353
808 Ga0070659_100008920
809 Ga0070659_100033987
810 Ga0070659_100058777
811 Ga0070659_100113432
812 Ga0070659_100167411
813 Ga0070659_100188336
814 Ga0070667_100000842
815 Ga0070667_100003257
816 Ga0070667_100024685
817 Ga0070667_100036753
818 Ga0070667_100169169
819 Ga0070667_100310877
820 Ga0070667_100548462
821 Ga0070714_100364959
822 Ga0070701_10005692
823 Ga0070694_100021107
824 Ga0070663_100003093
825 Ga0070663_100005871
826 Ga0070663_100019346
827 Ga0070663_100135690
828 Ga0070663_100173091
829 Ga0070663_100186155
830 Ga0070663_100239533
831 Ga0070662_100004937
832 Ga0070662_100006830
833 Ga0070662_100013241
834 Ga0070662_100020310
835 Ga0070662_100044894
836 Ga0070681_10058359
837 Ga0070681_10067292
838 Ga0070681_10138383
839 Ga0070681_10477146
840 Ga0068867_100009232
841 Ga0068867_100014104
842 Ga0068867_100044500
843 Ga0070679_100030476
844 Ga0070679_100094869
845 Ga0070679_100151872
846 Ga0070679_100181424
847 Ga0070679_100243233
848 Ga0068853_100008551
849 Ga0068853_100010924
850 Ga0068853_100013390
851 Ga0068853_100033149
852 Ga0068853_100044838
853 Ga0068853_100048971
854 Ga0068853_100079701
855 Ga0068853_100100619
856 Ga0068853_100199547
857 Ga0070672_100009674
858 Ga0070672_100044818
859 Ga0070672_100045010
860 Ga0070672_100053815
861 Ga0070672_100095954
862 Ga0070672_100220558
863 Ga0070686_100038860
864 Ga0070686_100181599
865 Ga0070695_100023208
866 Ga0070696_100245573
867 Ga0070696_100267599
868 Ga0070693_100158427
869 Ga0070665_100107109
870 Ga0070665_100159140
871 Ga0068855_100004077
872 Ga0068855_100059086
873 Ga0070664_100012706
874 Ga0070664_100394996
875 Ga0068857_100176859
876 Ga0068857_100222472
877 Ga0068854_100014916
878 Ga0068854_100051990
879 Ga0068854_100176291
880 Ga0068856_100232987
881 Ga0068852_100079436
882 Ga0068859_100002127
883 Ga0068859_100008265
884 Ga0068859_100123270
885 Ga0068859_100327922
886 Ga0068864_100001398
887 Ga0068864_100004613
888 Ga0068864_100006944
889 Ga0068864_100013870
890 Ga0068864_100026940
891 Ga0068864_100049060
892 Ga0068864_100127959
893 Ga0068864_100187383
894 Ga0068864_100229577
895 Ga0068861_100014738
896 Ga0068861_100077498
897 Ga0068851_10003121
898 Ga0068863_100002134
899 Ga0068863_100007871
900 Ga0068863_100191790
901 Ga0068858_100001703
902 Ga0068858_100002540
903 Ga0068858_100015929
904 Ga0068858_100248322
905 Ga0068858_100261938
906 Ga0068860_100007762
907 Ga0068860_100039949
908 Ga0068860_100074072
909 Ga0068860_100074228
910 Ga0068860_100105517
911 Ga0068860_100182085
912 Ga0068860_100219516
913 Ga0068860_100277498
914 Ga0068862_100006460
915 Ga0068862_100067335
916 Ga0097621_100027711
917 Ga0097621_100443679
918 Ga0068865_100007079
919 Ga0068865_100027328
920 Ga0097620_100002127
921 Ga0097620_100008265
922 Ga0097620_100123273
923 Ga0097620_100327946
924 Ga0105250_10008038
925 Ga0105240_10045821
926 Ga0105240_10216299
927 Ga0105240_10508440
928 Ga0111539_10021092
929 Ga0105245_10096995
930 Ga0105245_10149475
931 Ga0105243_10107470
932 Ga0105243_10354531
933 Ga0105241_10244635
934 Ga0105241_10433206
935 Ga0105242_10014632
936 Ga0105242_10357977
937 Ga0105248_10000362
938 Ga0105248_10000395
939 Ga0105248_10004448
940 Ga0105248_10004830
941 Ga0105248_10023356
942 Ga0105248_10039629
943 Ga0105248_10044452
944 Ga0105248_10050197
945 Ga0105248_10110896
946 Ga0105248_10133234
947 Ga0105238_10046386
948 Ga0105238_10061956
949 Ga0105238_10084001
950 Ga0105249_10004822
951 Ga0105249_10704690
952 Ga0105239_10113307
953 Ga0105239_10289096
954 Ga0105246_10051837
955 Ga0157373_10003524
956 Ga0157373_10019290
957 Ga0157371_10004743
958 Ga0157371_10031437
959 Ga0157371_10042251
960 Ga0157371_10089141
961 Ga0157371_10102013
962 Ga0157370_10036438
963 Ga0157370_10040187
964 Ga0157370_10041548
965 Ga0157370_10155289
966 Ga0157370_10343300
967 Ga0157369_10014904
968 Ga0157369_10192019
969 Ga0157369_10201630
970 Ga0157369_10515701
971 Ga0157378_10081948
972 Ga0157378_10106380
973 Ga0163162_10030851
974 Ga0163162_10044637
975 Ga0163162_10053226
976 Ga0163162_10093730
977 Ga0163162_10352654
978 Ga0163162_10494247
979 Ga0163162_10516884
980 Ga0157372_10290859
981 Ga0157372_10507895
982 Ga0157372_10719948
983 Ga0157375_10015558
984 Ga0157375_10044266
985 Ga0157375_10135319
986 Ga0157375_10214795
987 Ga0157375_10455671
988 Ga0163163_10001203
989 Ga0163163_10004004
990 Ga0163163_10232748
991 Ga0157380_10002495
992 Ga0157380_10007684
993 Ga0157380_10105118
994 Ga0157380_10138676
995 Ga0157377_10080376
996 Ga0157377_10102844
997 Ga0157379_10037628
998 Ga0157379_10130183
999 Ga0157379_10136323
1000 Ga0157379_10193334
1001 Ga0157379_10285682
1002 Ga0163161_10033191
1003 Ga0163161_10040426
1004 Ga0163161_10065892
1005 Ga0206353_11413780
1006 Ga0207697_10000927
1007 Ga0207697_10009191
1008 Ga0207697_10042058
1009 Ga0207656_10017215
1010 Ga0207682_10002411
1011 Ga0207688_10010155
1012 Ga0207680_10000626
1013 Ga0207680_10083606
1014 Ga0207647_10000339
1015 Ga0207647_10041294
1016 Ga0207647_10056512
1017 Ga0207645_10011234
1018 Ga0207645_10059349
1019 Ga0207645_10103135
1020 Ga0207705_10001142
1021 Ga0207705_10003304
1022 Ga0207705_10012711
1023 Ga0207705_10021695
1024 Ga0207705_10067664
1025 Ga0207705_10082612
1026 Ga0207660_10000140
1027 Ga0207660_10012082
1028 Ga0207657_10000020
1029 Ga0207657_10001366
1030 Ga0207657_10003566
1031 Ga0207657_10004033
1032 Ga0207657_10007910
1033 Ga0207657_10041186
1034 Ga0207657_10043574
1035 Ga0207657_10048372
1036 Ga0207657_10147728
1037 Ga0207657_10169066
1038 Ga0207657_10263734
1039 Ga0207657_10314244
1040 Ga0207649_10030791
1041 Ga0207652_10048837
1042 Ga0207652_10058671
1043 Ga0207652_10226886
1044 Ga0207681_10006995
1045 Ga0207681_10133344
1046 Ga0207681_10162094
1047 Ga0207681_10175896
1048 Ga0207694_10018205
1049 Ga0207650_10006327
1050 Ga0207650_10007606
1051 Ga0207650_10103454
1052 Ga0207650_10105414
1053 Ga0207659_10002265
1054 Ga0207659_10026739
1055 Ga0207659_10121598
1056 Ga0207687_10166120
1057 Ga0207664_10393544
1058 Ga0207644_10000324
1059 Ga0207644_10028714
1060 Ga0207644_10043502
1061 Ga0207644_10047379
1062 Ga0207644_10089812
1063 Ga0207644_10117466
1064 Ga0207690_10009242
1065 Ga0207690_10013571
1066 Ga0207690_10041125
1067 Ga0207690_10122747
1068 Ga0207690_10152367
1069 Ga0207706_10004058
1070 Ga0207706_10004109
1071 Ga0207706_10008737
1072 Ga0207706_10020444
1073 Ga0207706_10052239
1074 Ga0207706_10053416
1075 Ga0207706_10056986
1076 Ga0207706_10279295
1077 Ga0207686_10050495
1078 Ga0207709_10121323
1079 Ga0207709_10153998
1080 Ga0207669_10002475
1081 Ga0207669_10056487
1082 Ga0207669_10137595
1083 Ga0207704_10012434
1084 Ga0207691_10000915
1085 Ga0207691_10001856
1086 Ga0207691_10012965
1087 Ga0207691_10034786
1088 Ga0207691_10044565
1089 Ga0207691_10118481
1090 Ga0207691_10310035
1091 Ga0207711_10000429
1092 Ga0207711_10000610
1093 Ga0207711_10002544
1094 Ga0207711_10004237
1095 Ga0207711_10029458
1096 Ga0207711_10034390
1097 Ga0207711_10058671
1098 Ga0207711_10141459
1099 Ga0207711_10388792
1100 Ga0207689_10002262
1101 Ga0207679_10018161
1102 Ga0207679_10055146
1103 Ga0207679_10344618
1104 Ga0207667_10002757
1105 Ga0207651_10000378
1106 Ga0207651_10002434
1107 Ga0207651_10111161
1108 Ga0207651_10158227
1109 Ga0207651_10160365
1110 Ga0207712_10016256
1111 Ga0207668_10006711
1112 Ga0207640_10009307
1113 Ga0207640_10042095
1114 Ga0207658_10001871
1115 Ga0207658_10003528
1116 Ga0207658_10005525
1117 Ga0207658_10057889
1118 Ga0207658_10090752
1119 Ga0207677_10003982
1120 Ga0207677_10031985
1121 Ga0207703_10006106
1122 Ga0207703_10017409
1123 Ga0207703_10025682
1124 Ga0207703_10048214
1125 Ga0207639_10002451
1126 Ga0207639_10036236
1127 Ga0207639_10064020
1128 Ga0207639_10152743
1129 Ga0207639_10299800
1130 Ga0207678_10005111
1131 Ga0207678_10032329
1132 Ga0207678_10060984
1133 Ga0207678_10165177
1134 Ga0207702_10030613
1135 Ga0207641_10002148
1136 Ga0207641_10006264
1137 Ga0207641_10167744
1138 Ga0207648_10013267
1139 Ga0207648_10021875
1140 Ga0207648_10022350
1141 Ga0207648_10023740
1142 Ga0207676_10007920
1143 Ga0207676_10019201
1144 Ga0207676_10064276
1145 Ga0207676_10132092
1146 Ga0207676_10573893
1147 Ga0207674_10037383
1148 Ga0207674_10037696
1149 Ga0207674_10059771
1150 Ga0207675_100011697
1151 Ga0207683_10003409
1152 Ga0207698_10213981
1153 Ga0268266_10009752
1154 Ga0268266_10083841
1155 Ga0268266_10147620
1156 Ga0268265_10007581
1157 Ga0268265_10008543
1158 Ga0268265_10021023
1159 Ga0268264_10005351
1160 Ga0268264_10232928
1161 Ga0268264_10271156
1162 Ga0268264_10290261
1163 Ga0316182_1337346
1164 Ga0307408_100053920
1165 Ga0307408_100057257
1166 Ga0307408_100062616
1167 Ga0307408_100138666
1168 Ga0307408_100150670
1169 Ga0307408_100205013
1170 Ga0307405_10020665
1171 Ga0307405_10055410
1172 Ga0307405_10059872
1173 Ga0307405_10219337
1174 Ga0307405_10226453
1175 Ga0307413_10002121
1176 Ga0307413_10003459
1177 Ga0307413_10007360
1178 Ga0307413_10025511
1179 Ga0307413_10025931
1180 Ga0307413_10051349
1181 Ga0307413_10070193
1182 Ga0307413_10074113
1183 Ga0307413_10113855
1184 Ga0307413_10214601
1185 Ga0307410_10000582
1186 Ga0307410_10006823
1187 Ga0307410_10014820
1188 Ga0307410_10077697
1189 Ga0307410_10082024
1190 Ga0307410_10133301
1191 Ga0307410_10155262
1192 Ga0307406_10020099
1193 Ga0307406_10041590
1194 Ga0307406_10052027
1195 Ga0307406_10057799
1196 Ga0307406_10100383
1197 Ga0307406_10111370
1198 Ga0307406_10121872
1199 Ga0307406_10282623
1200 Ga0307407_10002061
1201 Ga0307407_10008454
1202 Ga0307407_10009916
1203 Ga0307407_10024424
1204 Ga0307407_10053392
1205 Ga0307412_10028081
1206 Ga0307412_10039422
1207 Ga0307412_10045502
1208 Ga0307412_10078529
1209 Ga0307412_10081779
1210 Ga0307412_10088777
1211 Ga0307412_10103298
1212 Ga0307412_10148841
1213 Ga0307409_100006126
1214 Ga0307409_100024952
1215 Ga0307409_100059131
1216 Ga0307409_100163759
1217 Ga0307409_100181092
1218 Ga0307409_100261945
1219 Ga0307409_100285331
1220 Ga0307416_100001945
1221 Ga0307416_100008194
1222 Ga0307416_100008380
1223 Ga0307416_100085128
1224 Ga0307416_100132207
1225 Ga0307416_100223146
1226 Ga0307416_100223821
1227 Ga0307416_100250437
1228 Ga0307416_100377248
1229 Ga0307414_10015279
1230 Ga0307414_10029340
1231 Ga0307414_10037396
1232 Ga0307414_10049216
1233 Ga0307414_10056665
1234 Ga0307414_10085637
1235 Ga0307414_10197199
1236 Ga0307414_10375584
1237 Ga0307411_10000911
1238 Ga0307411_10001680
1239 Ga0307411_10002663
1240 Ga0307411_10009739
1241 Ga0307411_10021862
1242 Ga0307411_10028517
1243 Ga0307411_10036258
1244 Ga0307411_10057229
1245 Ga0307411_10123114
1246 Ga0307411_10128273
1247 Ga0307411_10178408
1248 Ga0307411_10221747
1249 Ga0307411_10226723
1250 Ga0307415_100000243
1251 Ga0307415_100001952
1252 Ga0307415_100002407
1253 Ga0307415_100062346
1254 Ga0307415_100113801
1255 Ga0307415_100121951
1256 Ga0307415_100320689
1257 Ga0373930_0014809
1258 Ga0373946_0004744
1259 Ga0373962_0072758
1260 Ga0373935_0042878
1261 Ga0373935_0099795
1262 Ga0373927_0052303
1263 Ga0373947_0030905
1264 Ga0373937_0004732
1265 Ga0373925_0061658
1266 Ga0395899_0023635
1267 Ga0395899_0024278
1268 Ga0395899_0026240
1269 Ga0395899_0035263
1270 Ga0395899_0057955
1271 Ga0395899_0065702
1272 Ga0395899_0069010
1273 Ga0395900_0000572
1274 Ga0395900_0006142
1275 Ga0395900_0006337
1276 Ga0395900_0006462
1277 Ga0395900_0016540
1278 Ga0395900_0017172
1279 Ga0395900_0020092
1280 Ga0395900_0040825
1281 Ga0395900_0052413
1282 Ga0395900_0056622
1283 Ga0395900_0077444
1284 Ga0395900_0190887
1285 Ga0395900_0303199
1286 Ga0395900_0531746
1287 Ga0395900_0553639
1288 Ga0395898_0007452
1289 Ga0395898_0029190
1290 Ga0395898_0049447
1291 Ga0395898_0070544
1292 Ga0395898_0150416
1293 Ga0395898_0153572
1294 Ga0395898_0157213
1295 Ga0395898_0495129
1296 Ga0395905_0000165
1297 Ga0395905_0001408
1298 Ga0395905_0001429
1299 Ga0395905_0004924
1300 Ga0395905_0010680
1301 Ga0395905_0012129
1302 Ga0395905_0012840
1303 Ga0395905_0017323
1304 Ga0395905_0019534
1305 Ga0395905_0023864
1306 Ga0395905_0034996
1307 Ga0395905_0036173
1308 Ga0395905_0076037
1309 Ga0395905_0090199
1310 Ga0395905_0096254
1311 Ga0395905_0114645
1312 Ga0395905_0115824
1313 Ga0395905_0148678
1314 Ga0395905_0210921
1315 Ga0395905_0229223
1316 Ga0395905_0550060
1317 Ga0436364_0351177
1318 Ga0436364_1265496
1319 Ga0395901_0001927
1320 Ga0395901_0006471
1321 Ga0395901_0011045
1322 Ga0395901_0028662
1323 Ga0395901_0043708
1324 Ga0395901_0070295
1325 Ga0395901_0110482
1326 Ga0395901_0130566
1327 Ga0395901_0154763
1328 Ga0395901_0166840
1329 Ga0395901_0184450
1330 Ga0439465_0038497
1331 Ga0439445_0000030
1332 Ga0439432_048420
1333 Ga0439432_057938
1334 Ga0439449_0058955
1335 Ga0439449_0064812
1336 Ga0450905_003777
1337 Ga0450889_000275
1338 Ga0439464_0002488
1339 Ga0466972_0076180
1340 Ga0466966_0041197
1341 Ga0466966_0089919
1342 Ga0466961_0069118
1343 Ga0466961_0107360
1344 Ga0466961_0145736
1345 Ga0466963_0012905
1346 Ga0466963_0027548
1347 Ga0466963_0038555
1348 Ga0466963_0176015
1349 Ga0466964_0013633
1350 Ga0466971_0003355
1351 Ga0466971_0024442
1352 Ga0466971_0040542
1353 Ga0466968_0018145
1354 Ga0466970_0022613
1355 Ga0466957_0003051
1356 Ga0466957_0004212
1357 Ga0466959_0076411
1358 Ga0466958_0000385
1359 Ga0466958_0006390
1360 Ga0466958_0035540
1361 Ga0466958_0079590
1362 Ga0466958_0123894
1363 Ga0466958_0147971
1364 Ga0466967_0000053
1365 Ga0466967_0000840
1366 Ga0466967_0045010
1367 Ga0466967_0181171
1368 Ga0466967_0183554
1369 Ga0466967_0192434
1370 Ga0466967_0263993
1371 Ga0466967_0278317
1372 Ga0466967_0395487
1373 Ga0466967_0604403
1374 Ga0495638_0014243
1375 Ga0495580_0097892
1376 Ga0495583_0000766
1377 Ga0495663_0002000
1378 Ga0495663_0025180
1379 Ga0495663_0098763
1380 Ga0495598_0000521
1381 Ga0495621_0000194
1382 Ga0495621_0000361
1383 Ga0495621_0000708
1384 Ga0495621_0002382
1385 Ga0495621_0007750
1386 Ga0495621_0112192
1387 Ga0495633_0010211
1388 Ga0495668_0010612
1389 Ga0495668_0011181
1390 Ga0495668_0112915
1391 Ga0495668_0162201
1392 Ga0495611_0071796
1393 Ga0495661_0046511
1394 Ga0495661_0169200
1395 Ga0495669_0000890
1396 Ga0495669_0002557
1397 Ga0495669_0005935
1398 Ga0495669_0013465
1399 Ga0495669_0027019
1400 Ga0495669_0161401
1401 Ga0495670_0001443
1402 Ga0495670_0004013
1403 Ga0495670_0006704
1404 Ga0495670_0010867
1405 Ga0495670_0017447
1406 Ga0495670_0051506
1407 Ga0495670_0090148
1408 Ga0495677_0012156
1409 Ga0495686_0000530
1410 Ga0496100_0014655
1411 Ga0496100_0067833
1412 Ga0496100_0124940
1413 Ga0496100_0134235
1414 Ga0496101_0012653
1415 Ga0496101_0018340
1416 Ga0496101_0105521
1417 Ga0496102_0000036
1418 Ga0496102_0082710
1419 Ga0496102_0116445
1420 Ga0496102_0266502
1421 Ga0496103_0000120
1422 Ga0496104_0084239
1423 Ga0496105_0055104
1424 Ga0496106_0038953
1425 Ga0496107_0021732
1426 Ga0496107_0073909
1427 Ga0496107_0078297
1428 Ga0496108_0001272
1429 Ga0496108_0003147
1430 Ga0496108_0016911
1431 Ga0496109_0003815
1432 Ga0496109_0026042
1433 Ga0496109_0180649
1434 Ga0496110_0003918
1435 Ga0496110_0040422
1436 Ga0496110_0411211
1437 Ga0496111_0013395
1438 Ga0496111_0077896
1439 Ga0496111_0385450
1440 Ga0496112_0000761
1441 Ga0496112_0328237
1442 Ga0496113_0003741
1443 Ga0496113_0006102
1444 Ga0496113_0134307
1445 Ga0496115_0002148
1446 Ga0496116_0002277
1447 Ga0496117_0000093
1448 Ga0496117_0011338
1449 Ga0496118_0000070
1450 Ga0496118_0096376
1451 Ga0496124_0000302
1452 Ga0496125_0072689
1453 Ga0501068_0063686
1454 Ga0501070_0136140
1455 Ga0501225_0014655
1456 Ga0501083_0024482
1457 Ga0501273_010559
1458 Ga0501283_001484
1459 nmdc:mga06r32_139412_c1
1460 nmdc:mga08y16_21958_c1
1461 Ga0500643_002599
1462 Ga0500641_0002882
1463 Ga0500595_001987
1464 Ga0500618_007755
1465 Ga0500636_0088847
1466 Ga0466962_0088593
1467 2738709296
1468 2738847721
1469 2738863450
1470 2739295968
1471 2739357646
1472 2883293080
1473 2883356080
1474 2896430155
1475 2928030734
1476 2928102914
1477 2928959480
1478 2946789078
1479 2984557563
1480 2993359119

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

79

319

0.95

PF01745

IPT

Isopentenyl transferase

44

110

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9354 8 306
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.8978 8 306
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8941 8 306
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8885 9 307
3eph-assembly1.cif.gz_A crystallographic snapshots of eukaryotic dimethylallyltransferase acting on trna: insight into trna recognition and reaction mechanism 0.8688 9 280
ID Description Score Start End Superfamily
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 8 118 3.40.50.300
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9258 7 113 3.40.50.300
2zm5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8971 9 308 3.40.50.300
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.8942 202 283 1.10.287.890
2zm5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8934 9 308 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A496JYQ4-F1-model_v4 deleted 0.9831 11 108
AF-A0A7J8YA77-F1-model_v4 Isopentenyltransferase 0.9814 7 116 GO:0005739
GO:0006400
GO:0009691
GO:0052381
AF-A0A352SST4-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9727 11 124 GO:0005524
GO:0006400
GO:0052381
AF-A0A0K8TFV6-F1-model_v4 tRNA dimethylallyltransferase, mitochondrial 0.9634 6 114 GO:0005524
GO:0005739
GO:0006400
GO:0052381
AF-A0A5A7QHC1-F1-model_v4 tRNA dimethylallyltransferase 0.9621 1 114 GO:0005739
GO:0006400
GO:0009691
GO:0052381

Map