F478504
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 289 | 711 | 560 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10012634|rootH1_100126349 |
| Length | 603 |
| Sequence | MHHGIPGCLLAPLQPPIPIILPRSFIFPIFLVINSTCMINLNLKTKAQHTFDAIVVGSGISGGWAAKELCEKGLKVLLLERGRQLEHIKDYTTATQAPWETPHRGRLTPAQKKEHPYLIRERVYSEFNESYWLKDTDSPYTEKKRFDWARADIVGGRSIMWGRGSLRLSDLDFEANAKEGVGIDWPIRYKDLAPWYDHVEAFAGISGQAEGLPHLPDGVFQPPMEMNCFEKEVKARIEKAFPERRMTIFRTANLTQPIGDRGKCQYRDRCARGCPFGAYFSSQSSTLPAAVKTGNLTLQTDAIVNSIIYDESKGKATGVCVIDKHTKAITEYFARIIFLNASTLGSTFVLMNSVSNRFPQGIGNDHGVLGHYLMDHHFHAGASGISEEFGDKYYYGQRPAGFYIPRFRNIGADKRSYRRGFGYTGYSSRTGWSRGIAELGIGGAFKDYLTEPGPWQMGLMGFGECLPYEENQVTLDHSIKDAWGQPVLQFNCEFKDNERQMRKDMDQDAAAMLEAAGLKNVTPFNRDSYPGMAIHEMGTARMGRDPRTSVLNEWNQVHTAKNIFVTDGACMTSSACQNPSLTYMALTARAADHAVKELKRQQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 2 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 3 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 4 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 7 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 8 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 9 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 10 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 11 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 12 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 13 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 14 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 15 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 16 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 17 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 243 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 275 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 277 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 281 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 282 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 283 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 288 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 289 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.62 |
| Metatranscriptomes | 0 |
| Isolates | 3.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.3 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 85.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007451 | 3300001979 | Bacteria | 4450 |
| 2 | JGI25154J39366_1000012 | 3300002738 | Bacteria | 287601 |
| 3 | JGI25406J46586_10005453 | 3300003203 | Bacteria | 5899 |
| 4 | rootH1_10015726 | 3300003316 | Bacteria | 11114 |
| 5 | rootH1_10033153 | 3300003316 | Bacteria | 2179 |
| 6 | rootH1_10077515 | 3300003316 | Bacteria | 6712 |
| 7 | rootH2_10005324 | 3300003320 | Bacteria | 32959 |
| 8 | rootH2_10009145 | 3300003320 | Bacteria | 43855 |
| 9 | rootH2_10009745 | 3300003320 | Bacteria | 3229 |
| 10 | rootH2_10012490 | 3300003320 | Bacteria | 41263 |
| 11 | rootL2_10107065 | 3300003322 | Bacteria | 5848 |
| 12 | rootL2_10174960 | 3300003322 | Bacteria | 6928 |
| 13 | rootL2_10369576 | 3300003322 | Bacteria | 2887 |
| 14 | rootH1_10000238 | 3300003323 | Bacteria | 3953 |
| 15 | rootH1_10002552 | 3300003323 | Bacteria | 44831 |
| 16 | rootH1_10002735 | 3300003323 | Bacteria | 11152 |
| 17 | rootH1_10007412 | 3300003323 | Bacteria | 54111 |
| 18 | rootH1_10012634 | 3300003323 | Bacteria | 10441 |
| 19 | rootH1_10028939 | 3300003323 | Bacteria | 5416 |
| 20 | JGI25160J50197_1000376 | 3300003354 | Bacteria | 29172 |
| 21 | JGI25160J50197_1004764 | 3300003354 | Bacteria | 5792 |
| 22 | JGI25160J50197_1006581 | 3300003354 | Bacteria | 4681 |
| 23 | Ga0055528_1001024 | 3300003790 | Bacteria | 18512 |
| 24 | Ga0055530_10001218 | 3300003791 | Bacteria | 19831 |
| 25 | Ga0055531_10000357 | 3300003794 | Bacteria | 44649 |
| 26 | Ga0055531_10000426 | 3300003794 | Bacteria | 40008 |
| 27 | Ga0055531_10000559 | 3300003794 | Bacteria | 32705 |
| 28 | Ga0065165_1000228 | 3300005262 | Bacteria | 98736 |
| 29 | Ga0065165_1000639 | 3300005262 | Bacteria | 50701 |
| 30 | Ga0065714_10082178 | 3300005288 | Unclassified | 2325 |
| 31 | Ga0065704_10076316 | 3300005289 | Bacteria | 5168 |
| 32 | Ga0065704_10113484 | 3300005289 | Bacteria | 1889 |
| 33 | Ga0065712_10000416 | 3300005290 | Bacteria | 19580 |
| 34 | Ga0065712_10070193 | 3300005290 | Bacteria | 6240 |
| 35 | Ga0065715_10096001 | 3300005293 | Bacteria | 3963 |
| 36 | Ga0065715_10110885 | 3300005293 | Bacteria | 2584 |
| 37 | Ga0065715_10125582 | 3300005293 | Bacteria | 2127 |
| 38 | Ga0070658_10002413 | 3300005327 | Bacteria | 15642 |
| 39 | Ga0070676_10002150 | 3300005328 | Bacteria | 10035 |
| 40 | Ga0070676_10004885 | 3300005328 | Bacteria | 7102 |
| 41 | Ga0070676_10016966 | 3300005328 | Bacteria | 4026 |
| 42 | Ga0070676_10036538 | 3300005328 | Bacteria | 2831 |
| 43 | Ga0070683_100005706 | 3300005329 | Bacteria | 10399 |
| 44 | Ga0070683_100005920 | 3300005329 | Bacteria | 10233 |
| 45 | Ga0070683_100010034 | 3300005329 | Bacteria | 8123 |
| 46 | Ga0070683_100023472 | 3300005329 | Bacteria | 5517 |
| 47 | Ga0070683_100023539 | 3300005329 | Bacteria | 5509 |
| 48 | Ga0070683_100037872 | 3300005329 | Bacteria | 4417 |
| 49 | Ga0070690_100001727 | 3300005330 | Bacteria | 11537 |
| 50 | Ga0070690_100008225 | 3300005330 | Bacteria | 6001 |
| 51 | Ga0070690_100034686 | 3300005330 | Bacteria | 3162 |
| 52 | Ga0070690_100043945 | 3300005330 | Bacteria | 2835 |
| 53 | Ga0070690_100057098 | 3300005330 | Bacteria | 2505 |
| 54 | Ga0070690_100091571 | 3300005330 | Bacteria | 2003 |
| 55 | Ga0070670_100007329 | 3300005331 | Bacteria | 9362 |
| 56 | Ga0070670_100112112 | 3300005331 | Bacteria | 2350 |
| 57 | Ga0068869_100048943 | 3300005334 | Bacteria | 3059 |
| 58 | Ga0068869_100064614 | 3300005334 | Bacteria | 2692 |
| 59 | Ga0070666_10003057 | 3300005335 | Bacteria | 10158 |
| 60 | Ga0070666_10007985 | 3300005335 | Bacteria | 6543 |
| 61 | Ga0070680_100010880 | 3300005336 | Bacteria | 7027 |
| 62 | Ga0070680_100067420 | 3300005336 | Bacteria | 2935 |
| 63 | Ga0068868_100002272 | 3300005338 | Bacteria | 13287 |
| 64 | Ga0068868_100033386 | 3300005338 | Bacteria | 3966 |
| 65 | Ga0068868_100073887 | 3300005338 | Bacteria | 2723 |
| 66 | Ga0068868_100077996 | 3300005338 | Bacteria | 2651 |
| 67 | Ga0070689_100010729 | 3300005340 | Bacteria | 6541 |
| 68 | Ga0070689_100015800 | 3300005340 | Bacteria | 5514 |
| 69 | Ga0070689_100031342 | 3300005340 | Bacteria | 4040 |
| 70 | Ga0070689_100113340 | 3300005340 | Bacteria | 2159 |
| 71 | Ga0070687_100001730 | 3300005343 | Bacteria | 7852 |
| 72 | Ga0070661_100000277 | 3300005344 | Bacteria | 41446 |
| 73 | Ga0070661_100004928 | 3300005344 | Bacteria | 9190 |
| 74 | Ga0070661_100005360 | 3300005344 | Bacteria | 8843 |
| 75 | Ga0070661_100005947 | 3300005344 | Bacteria | 8402 |
| 76 | Ga0070668_100032892 | 3300005347 | Bacteria | 3947 |
| 77 | Ga0070668_100039649 | 3300005347 | Bacteria | 3601 |
| 78 | Ga0070668_100044258 | 3300005347 | Bacteria | 3415 |
| 79 | Ga0070669_100016316 | 3300005353 | Bacteria | 5299 |
| 80 | Ga0070669_100022394 | 3300005353 | Bacteria | 4517 |
| 81 | Ga0070669_100025108 | 3300005353 | Bacteria | 4279 |
| 82 | Ga0070669_100110698 | 3300005353 | Bacteria | 2084 |
| 83 | Ga0070675_100004866 | 3300005354 | Bacteria | 10250 |
| 84 | Ga0070675_100012020 | 3300005354 | Bacteria | 6786 |
| 85 | Ga0070675_100018198 | 3300005354 | Bacteria | 5591 |
| 86 | Ga0070675_100163355 | 3300005354 | Bacteria | 1917 |
| 87 | Ga0070671_100040595 | 3300005355 | Bacteria | 3866 |
| 88 | Ga0070671_100164935 | 3300005355 | Bacteria | 1873 |
| 89 | Ga0070673_100011320 | 3300005364 | Bacteria | 6083 |
| 90 | Ga0070688_100015583 | 3300005365 | Bacteria | 4330 |
| 91 | Ga0070688_100017477 | 3300005365 | Bacteria | 4117 |
| 92 | Ga0070659_100005686 | 3300005366 | Bacteria | 8970 |
| 93 | Ga0070659_100030512 | 3300005366 | Bacteria | 4172 |
| 94 | Ga0070667_100017378 | 3300005367 | Bacteria | 5961 |
| 95 | Ga0070667_100067050 | 3300005367 | Bacteria | 3050 |
| 96 | Ga0070667_100087642 | 3300005367 | Bacteria | 2672 |
| 97 | Ga0070701_10016630 | 3300005438 | Bacteria | 3425 |
| 98 | Ga0070701_10022640 | 3300005438 | Bacteria | 3014 |
| 99 | Ga0070705_100018376 | 3300005440 | Bacteria | 3664 |
| 100 | Ga0070700_100076147 | 3300005441 | Bacteria | 2154 |
| 101 | Ga0070694_100013111 | 3300005444 | Bacteria | 5171 |
| 102 | Ga0070678_100019043 | 3300005456 | Bacteria | 4464 |
| 103 | Ga0070678_100030744 | 3300005456 | Bacteria | 3695 |
| 104 | Ga0070662_100001076 | 3300005457 | Bacteria | 16637 |
| 105 | Ga0070662_100008148 | 3300005457 | Bacteria | 6828 |
| 106 | Ga0070662_100009132 | 3300005457 | Bacteria | 6473 |
| 107 | Ga0070662_100019703 | 3300005457 | Bacteria | 4583 |
| 108 | Ga0070662_100020503 | 3300005457 | Bacteria | 4501 |
| 109 | Ga0070681_10000071 | 3300005458 | Bacteria | 74708 |
| 110 | Ga0070681_10001002 | 3300005458 | Bacteria | 23932 |
| 111 | Ga0068867_100057109 | 3300005459 | Bacteria | 2890 |
| 112 | Ga0068867_100070014 | 3300005459 | Bacteria | 2621 |
| 113 | Ga0070685_10004063 | 3300005466 | Bacteria | 7390 |
| 114 | Ga0070685_10006602 | 3300005466 | Bacteria | 5920 |
| 115 | Ga0070685_10010649 | 3300005466 | Bacteria | 4785 |
| 116 | Ga0070685_10011895 | 3300005466 | Bacteria | 4564 |
| 117 | Ga0070698_100198590 | 3300005471 | Bacteria | 1942 |
| 118 | Ga0070684_100000773 | 3300005535 | Bacteria | 22194 |
| 119 | Ga0070684_100005238 | 3300005535 | Bacteria | 9921 |
| 120 | Ga0070684_100011241 | 3300005535 | Bacteria | 7127 |
| 121 | Ga0070684_100023998 | 3300005535 | Bacteria | 5110 |
| 122 | Ga0070697_100034646 | 3300005536 | Bacteria | 4071 |
| 123 | Ga0068853_100014216 | 3300005539 | Bacteria | 6513 |
| 124 | Ga0068853_100016861 | 3300005539 | Bacteria | 6018 |
| 125 | Ga0070672_100010953 | 3300005543 | Bacteria | 6309 |
| 126 | Ga0070672_100016746 | 3300005543 | Bacteria | 5256 |
| 127 | Ga0070686_100001850 | 3300005544 | Bacteria | 11804 |
| 128 | Ga0070686_100014728 | 3300005544 | Bacteria | 4513 |
| 129 | Ga0070695_100008303 | 3300005545 | Bacteria | 6162 |
| 130 | Ga0070696_100001683 | 3300005546 | Bacteria | 14485 |
| 131 | Ga0070696_100002552 | 3300005546 | Bacteria | 12068 |
| 132 | Ga0070696_100100952 | 3300005546 | Bacteria | 2068 |
| 133 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 134 | Ga0070665_100013512 | 3300005548 | Bacteria | 8213 |
| 135 | Ga0070665_100017804 | 3300005548 | Bacteria | 7133 |
| 136 | Ga0070665_100028807 | 3300005548 | Bacteria | 5591 |
| 137 | Ga0070665_100100081 | 3300005548 | Bacteria | 2903 |
| 138 | Ga0070665_100117742 | 3300005548 | Bacteria | 2659 |
| 139 | Ga0070665_100204701 | 3300005548 | Bacteria | 1974 |
| 140 | Ga0070704_100034290 | 3300005549 | Bacteria | 3440 |
| 141 | Ga0068855_100001185 | 3300005563 | Bacteria | 32417 |
| 142 | Ga0068855_100029754 | 3300005563 | Bacteria | 6530 |
| 143 | Ga0068855_100037991 | 3300005563 | Bacteria | 5723 |
| 144 | Ga0068855_100042733 | 3300005563 | Bacteria | 5371 |
| 145 | Ga0070664_100002918 | 3300005564 | Bacteria | 13840 |
| 146 | Ga0070664_100007602 | 3300005564 | Bacteria | 8752 |
| 147 | Ga0070664_100008983 | 3300005564 | Bacteria | 8104 |
| 148 | Ga0070664_100017557 | 3300005564 | Bacteria | 5877 |
| 149 | Ga0070664_100117651 | 3300005564 | Bacteria | 2324 |
| 150 | Ga0068857_100000653 | 3300005577 | Bacteria | 25587 |
| 151 | Ga0068857_100003006 | 3300005577 | Bacteria | 13919 |
| 152 | Ga0068857_100003443 | 3300005577 | Bacteria | 13201 |
| 153 | Ga0068857_100003525 | 3300005577 | Bacteria | 13080 |
| 154 | Ga0068857_100007356 | 3300005577 | Bacteria | 9479 |
| 155 | Ga0068857_100014247 | 3300005577 | Bacteria | 6927 |
| 156 | Ga0068857_100017670 | 3300005577 | Bacteria | 6254 |
| 157 | Ga0068857_100047826 | 3300005577 | Bacteria | 3798 |
| 158 | Ga0068854_100006457 | 3300005578 | Bacteria | 7461 |
| 159 | Ga0068854_100019492 | 3300005578 | Bacteria | 4573 |
| 160 | Ga0068856_100058180 | 3300005614 | Bacteria | 3817 |
| 161 | Ga0068856_100063625 | 3300005614 | Bacteria | 3645 |
| 162 | Ga0070702_100036762 | 3300005615 | Bacteria | 2715 |
| 163 | Ga0070702_100037336 | 3300005615 | Bacteria | 2698 |
| 164 | Ga0068852_100001717 | 3300005616 | Bacteria | 14926 |
| 165 | Ga0068852_100005907 | 3300005616 | Bacteria | 8803 |
| 166 | Ga0068852_100017709 | 3300005616 | Bacteria | 5596 |
| 167 | Ga0068852_100049772 | 3300005616 | Bacteria | 3587 |
| 168 | Ga0068852_100128349 | 3300005616 | Bacteria | 2332 |
| 169 | Ga0068859_100000041 | 3300005617 | Bacteria | 162415 |
| 170 | Ga0068859_100008581 | 3300005617 | Bacteria | 10332 |
| 171 | Ga0068859_100017056 | 3300005617 | Bacteria | 7290 |
| 172 | Ga0068859_100047446 | 3300005617 | Bacteria | 4315 |
| 173 | Ga0068859_100060022 | 3300005617 | Bacteria | 3832 |
| 174 | Ga0068859_100077737 | 3300005617 | Bacteria | 3359 |
| 175 | Ga0068859_100092494 | 3300005617 | Bacteria | 3075 |
| 176 | Ga0068859_100120838 | 3300005617 | Bacteria | 2686 |
| 177 | Ga0068859_100161312 | 3300005617 | Bacteria | 2321 |
| 178 | Ga0068864_100002580 | 3300005618 | Bacteria | 14961 |
| 179 | Ga0068864_100006856 | 3300005618 | Bacteria | 9333 |
| 180 | Ga0068864_100007901 | 3300005618 | Bacteria | 8764 |
| 181 | Ga0068864_100012222 | 3300005618 | Bacteria | 7095 |
| 182 | Ga0068864_100017480 | 3300005618 | Bacteria | 5979 |
| 183 | Ga0068864_100018951 | 3300005618 | Bacteria | 5753 |
| 184 | Ga0068864_100139556 | 3300005618 | Bacteria | 2185 |
| 185 | Ga0068866_10016136 | 3300005718 | Bacteria | 3333 |
| 186 | Ga0068861_100001294 | 3300005719 | Bacteria | 15631 |
| 187 | Ga0068861_100005205 | 3300005719 | Bacteria | 8766 |
| 188 | Ga0068861_100010706 | 3300005719 | Bacteria | 6373 |
| 189 | Ga0068861_100013638 | 3300005719 | Bacteria | 5691 |
| 190 | Ga0068861_100030583 | 3300005719 | Bacteria | 3947 |
| 191 | Ga0068861_100076092 | 3300005719 | Bacteria | 2615 |
| 192 | Ga0068863_100002643 | 3300005841 | Bacteria | 17735 |
| 193 | Ga0068863_100002686 | 3300005841 | Bacteria | 17578 |
| 194 | Ga0068863_100003228 | 3300005841 | Bacteria | 16144 |
| 195 | Ga0068863_100004291 | 3300005841 | Bacteria | 14036 |
| 196 | Ga0068863_100034719 | 3300005841 | Bacteria | 4802 |
| 197 | Ga0068863_100040447 | 3300005841 | Bacteria | 4433 |
| 198 | Ga0068863_100044449 | 3300005841 | Bacteria | 4216 |
| 199 | Ga0068863_100050945 | 3300005841 | Bacteria | 3924 |
| 200 | Ga0068863_100073916 | 3300005841 | Bacteria | 3225 |
| 201 | Ga0068863_100096651 | 3300005841 | Bacteria | 2804 |
| 202 | Ga0068863_100171856 | 3300005841 | Bacteria | 2079 |
| 203 | Ga0068858_100002496 | 3300005842 | Bacteria | 18565 |
| 204 | Ga0068858_100036056 | 3300005842 | Bacteria | 4586 |
| 205 | Ga0068858_100220340 | 3300005842 | Bacteria | 1797 |
| 206 | Ga0068860_100000029 | 3300005843 | Bacteria | 259192 |
| 207 | Ga0068860_100000447 | 3300005843 | Bacteria | 52095 |
| 208 | Ga0068860_100005348 | 3300005843 | Bacteria | 13028 |
| 209 | Ga0068860_100008154 | 3300005843 | Bacteria | 10428 |
| 210 | Ga0068860_100009116 | 3300005843 | Bacteria | 9872 |
| 211 | Ga0068860_100012595 | 3300005843 | Bacteria | 8324 |
| 212 | Ga0068860_100031639 | 3300005843 | Bacteria | 5086 |
| 213 | Ga0068860_100096919 | 3300005843 | Bacteria | 2811 |
| 214 | Ga0068862_100005874 | 3300005844 | Bacteria | 10221 |
| 215 | Ga0068862_100011334 | 3300005844 | Bacteria | 7360 |
| 216 | Ga0068862_100014464 | 3300005844 | Bacteria | 6548 |
| 217 | Ga0068862_100052186 | 3300005844 | Bacteria | 3497 |
| 218 | Ga0068862_100111286 | 3300005844 | Bacteria | 2404 |
| 219 | Ga0081455_10016284 | 3300005937 | Bacteria | 7183 |
| 220 | Ga0081540_1009025 | 3300005983 | Bacteria | 6890 |
| 221 | Ga0081539_10000075 | 3300005985 | Bacteria | 229419 |
| 222 | Ga0081539_10004761 | 3300005985 | Bacteria | 14651 |
| 223 | Ga0081539_10034692 | 3300005985 | Bacteria | 3044 |
| 224 | Ga0075432_10002592 | 3300006058 | Bacteria | 6036 |
| 225 | Ga0075367_10007875 | 3300006178 | Bacteria | 5484 |
| 226 | Ga0075366_10000301 | 3300006195 | Bacteria | 22303 |
| 227 | Ga0075366_10005936 | 3300006195 | Bacteria | 6643 |
| 228 | Ga0097621_100000859 | 3300006237 | Bacteria | 21321 |
| 229 | Ga0097621_100012064 | 3300006237 | Bacteria | 6394 |
| 230 | Ga0097621_100013313 | 3300006237 | Bacteria | 6126 |
| 231 | Ga0097621_100030359 | 3300006237 | Bacteria | 4278 |
| 232 | Ga0097621_100038544 | 3300006237 | Bacteria | 3835 |
| 233 | Ga0097621_100046232 | 3300006237 | Bacteria | 3521 |
| 234 | Ga0097621_100114411 | 3300006237 | Bacteria | 2282 |
| 235 | Ga0068871_100005674 | 3300006358 | Bacteria | 8757 |
| 236 | Ga0068871_100005778 | 3300006358 | Bacteria | 8691 |
| 237 | Ga0068871_100026227 | 3300006358 | Bacteria | 4545 |
| 238 | Ga0068871_100029795 | 3300006358 | Bacteria | 4290 |
| 239 | Ga0075428_100009441 | 3300006844 | Bacteria | 10828 |
| 240 | Ga0075428_100012082 | 3300006844 | Bacteria | 9607 |
| 241 | Ga0075428_100021993 | 3300006844 | Bacteria | 7060 |
| 242 | Ga0075428_100117405 | 3300006844 | Unclassified | 2899 |
| 243 | Ga0075428_100124285 | 3300006844 | Bacteria | 2808 |
| 244 | Ga0075430_100001053 | 3300006846 | Bacteria | 21820 |
| 245 | Ga0075430_100008299 | 3300006846 | Bacteria | 8772 |
| 246 | Ga0075431_100011043 | 3300006847 | Bacteria | 9090 |
| 247 | Ga0075431_100014396 | 3300006847 | Bacteria | 7999 |
| 248 | Ga0075431_100094782 | 3300006847 | Bacteria | 3081 |
| 249 | Ga0075431_100117422 | 3300006847 | Unclassified | 2745 |
| 250 | Ga0075431_100197582 | 3300006847 | Bacteria | 2059 |
| 251 | Ga0075434_100004685 | 3300006871 | Bacteria | 12358 |
| 252 | Ga0075434_100007952 | 3300006871 | Bacteria | 9827 |
| 253 | Ga0075429_100000243 | 3300006880 | Bacteria | 37582 |
| 254 | Ga0075429_100044721 | 3300006880 | Bacteria | 3851 |
| 255 | Ga0068865_100034633 | 3300006881 | Bacteria | 3389 |
| 256 | Ga0097620_100000041 | 3300006931 | Bacteria | 162415 |
| 257 | Ga0097620_100008581 | 3300006931 | Bacteria | 10332 |
| 258 | Ga0097620_100017056 | 3300006931 | Bacteria | 7290 |
| 259 | Ga0097620_100047446 | 3300006931 | Bacteria | 4315 |
| 260 | Ga0097620_100060021 | 3300006931 | Bacteria | 3832 |
| 261 | Ga0097620_100077735 | 3300006931 | Bacteria | 3359 |
| 262 | Ga0097620_100092499 | 3300006931 | Bacteria | 3075 |
| 263 | Ga0097620_100120828 | 3300006931 | Bacteria | 2686 |
| 264 | Ga0097620_100161312 | 3300006931 | Bacteria | 2321 |
| 265 | Ga0075435_100070656 | 3300007076 | Bacteria | 2850 |
| 266 | Ga0105240_10000022 | 3300009093 | Bacteria | 387911 |
| 267 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 268 | Ga0105240_10000269 | 3300009093 | Bacteria | 102625 |
| 269 | Ga0105240_10005775 | 3300009093 | Bacteria | 18352 |
| 270 | Ga0105240_10006701 | 3300009093 | Bacteria | 16874 |
| 271 | Ga0105240_10009858 | 3300009093 | Bacteria | 13484 |
| 272 | Ga0105240_10021747 | 3300009093 | Bacteria | 8523 |
| 273 | Ga0111539_10003619 | 3300009094 | Bacteria | 20357 |
| 274 | Ga0111539_10019310 | 3300009094 | Bacteria | 8415 |
| 275 | Ga0111539_10040488 | 3300009094 | Bacteria | 5610 |
| 276 | Ga0111539_10089502 | 3300009094 | Bacteria | 3617 |
| 277 | Ga0111539_10241437 | 3300009094 | Bacteria | 2103 |
| 278 | Ga0105245_10070023 | 3300009098 | Bacteria | 3182 |
| 279 | Ga0105245_10093422 | 3300009098 | Bacteria | 2771 |
| 280 | Ga0105247_10027897 | 3300009101 | Bacteria | 3414 |
| 281 | Ga0114129_10000308 | 3300009147 | Bacteria | 57015 |
| 282 | Ga0114129_10001594 | 3300009147 | Bacteria | 30815 |
| 283 | Ga0114129_10024341 | 3300009147 | Bacteria | 8578 |
| 284 | Ga0114129_10046425 | 3300009147 | Bacteria | 6104 |
| 285 | Ga0114129_10079503 | 3300009147 | Bacteria | 4560 |
| 286 | Ga0114129_10287323 | 3300009147 | Unclassified | 2196 |
| 287 | Ga0105243_10030569 | 3300009148 | Bacteria | 4148 |
| 288 | Ga0105241_10011702 | 3300009174 | Bacteria | 6442 |
| 289 | Ga0105241_10018994 | 3300009174 | Bacteria | 5066 |
| 290 | Ga0105241_10020357 | 3300009174 | Bacteria | 4901 |
| 291 | Ga0105241_10049452 | 3300009174 | Bacteria | 3202 |
| 292 | Ga0105241_10090697 | 3300009174 | Bacteria | 2411 |
| 293 | Ga0105241_10126991 | 3300009174 | Bacteria | 2061 |
| 294 | Ga0105242_10002416 | 3300009176 | Bacteria | 14683 |
| 295 | Ga0105242_10024568 | 3300009176 | Bacteria | 4760 |
| 296 | Ga0105242_10027792 | 3300009176 | Bacteria | 4497 |
| 297 | Ga0105237_10000171 | 3300009545 | Bacteria | 90778 |
| 298 | Ga0105237_10000198 | 3300009545 | Bacteria | 85302 |
| 299 | Ga0105237_10001507 | 3300009545 | Bacteria | 30622 |
| 300 | Ga0105237_10003342 | 3300009545 | Bacteria | 19098 |
| 301 | Ga0105237_10004821 | 3300009545 | Bacteria | 15494 |
| 302 | Ga0105237_10008339 | 3300009545 | Bacteria | 11240 |
| 303 | Ga0105237_10012320 | 3300009545 | Bacteria | 9009 |
| 304 | Ga0105237_10035161 | 3300009545 | Bacteria | 5071 |
| 305 | Ga0105237_10114932 | 3300009545 | Bacteria | 2684 |
| 306 | Ga0105238_10007423 | 3300009551 | Bacteria | 10980 |
| 307 | Ga0105238_10043938 | 3300009551 | Bacteria | 4520 |
| 308 | Ga0105238_10194932 | 3300009551 | Bacteria | 2001 |
| 309 | Ga0105249_10009844 | 3300009553 | Bacteria | 8378 |
| 310 | Ga0105249_10014639 | 3300009553 | Bacteria | 6936 |
| 311 | Ga0105249_10064315 | 3300009553 | Bacteria | 3372 |
| 312 | Ga0105249_10162291 | 3300009553 | Bacteria | 2160 |
| 313 | Ga0105239_10000609 | 3300010375 | Bacteria | 50949 |
| 314 | Ga0105239_10002266 | 3300010375 | Bacteria | 24585 |
| 315 | Ga0105239_10016827 | 3300010375 | Bacteria | 8082 |
| 316 | Ga0105239_10077390 | 3300010375 | Bacteria | 3660 |
| 317 | Ga0105239_10112386 | 3300010375 | Bacteria | 3020 |
| 318 | Ga0105239_10165295 | 3300010375 | Bacteria | 2474 |
| 319 | Ga0105246_10033596 | 3300011119 | Bacteria | 3411 |
| 320 | Ga0105246_10064207 | 3300011119 | Bacteria | 2564 |
| 321 | Ga0157373_10003763 | 3300013100 | Bacteria | 11475 |
| 322 | Ga0157373_10048040 | 3300013100 | Bacteria | 3043 |
| 323 | Ga0157370_10000132 | 3300013104 | Bacteria | 89678 |
| 324 | Ga0157370_10003043 | 3300013104 | Bacteria | 19879 |
| 325 | Ga0157370_10038907 | 3300013104 | Unclassified | 4599 |
| 326 | Ga0157369_10000605 | 3300013105 | Bacteria | 46691 |
| 327 | Ga0157374_10050474 | 3300013296 | Bacteria | 3867 |
| 328 | Ga0157374_10063455 | 3300013296 | Bacteria | 3465 |
| 329 | Ga0157378_10003189 | 3300013297 | Bacteria | 14572 |
| 330 | Ga0157378_10041154 | 3300013297 | Bacteria | 4098 |
| 331 | Ga0157378_10060998 | 3300013297 | Bacteria | 3365 |
| 332 | Ga0157378_10108845 | 3300013297 | Bacteria | 2538 |
| 333 | Ga0163162_10000038 | 3300013306 | Bacteria | 138065 |
| 334 | Ga0163162_10000546 | 3300013306 | Bacteria | 34761 |
| 335 | Ga0163162_10002051 | 3300013306 | Bacteria | 18927 |
| 336 | Ga0163162_10006412 | 3300013306 | Bacteria | 11394 |
| 337 | Ga0163162_10034203 | 3300013306 | Bacteria | 5056 |
| 338 | Ga0163162_10037185 | 3300013306 | Bacteria | 4856 |
| 339 | Ga0163162_10056064 | 3300013306 | Bacteria | 3969 |
| 340 | Ga0163162_10069363 | 3300013306 | Bacteria | 3577 |
| 341 | Ga0163162_10250748 | 3300013306 | Bacteria | 1902 |
| 342 | Ga0157372_10000231 | 3300013307 | Bacteria | 62248 |
| 343 | Ga0157372_10000894 | 3300013307 | Bacteria | 32388 |
| 344 | Ga0157372_10060380 | 3300013307 | Bacteria | 4242 |
| 345 | Ga0157372_10071598 | 3300013307 | Bacteria | 3904 |
| 346 | Ga0157375_10009344 | 3300013308 | Bacteria | 8607 |
| 347 | Ga0157375_10013323 | 3300013308 | Bacteria | 7314 |
| 348 | Ga0157375_10031471 | 3300013308 | Bacteria | 5016 |
| 349 | Ga0157375_10055146 | 3300013308 | Bacteria | 3918 |
| 350 | Ga0157375_10071752 | 3300013308 | Bacteria | 3477 |
| 351 | Ga0157375_10161838 | 3300013308 | Bacteria | 2380 |
| 352 | Ga0157375_10175088 | 3300013308 | Bacteria | 2295 |
| 353 | Ga0157375_10233366 | 3300013308 | Bacteria | 1999 |
| 354 | Ga0157375_10262369 | 3300013308 | Bacteria | 1889 |
| 355 | Ga0157375_10277080 | 3300013308 | Bacteria | 1840 |
| 356 | Ga0163163_10006007 | 3300014325 | Bacteria | 10563 |
| 357 | Ga0157380_10003457 | 3300014326 | Bacteria | 10843 |
| 358 | Ga0157380_10020263 | 3300014326 | Bacteria | 4970 |
| 359 | Ga0157380_10074202 | 3300014326 | Bacteria | 2761 |
| 360 | Ga0157380_10104166 | 3300014326 | Bacteria | 2369 |
| 361 | Ga0157380_10117699 | 3300014326 | Bacteria | 2245 |
| 362 | Ga0182008_10000954 | 3300014497 | Bacteria | 20159 |
| 363 | Ga0157377_10000700 | 3300014745 | Bacteria | 13815 |
| 364 | Ga0157377_10001475 | 3300014745 | Bacteria | 10171 |
| 365 | Ga0157377_10003779 | 3300014745 | Bacteria | 6872 |
| 366 | Ga0157377_10051629 | 3300014745 | Bacteria | 2320 |
| 367 | Ga0157379_10038215 | 3300014968 | Bacteria | 4283 |
| 368 | Ga0157379_10045511 | 3300014968 | Bacteria | 3916 |
| 369 | Ga0157376_10007058 | 3300014969 | Bacteria | 7973 |
| 370 | Ga0157376_10031635 | 3300014969 | Bacteria | 4240 |
| 371 | Ga0182006_1000418 | 3300015261 | Bacteria | 34080 |
| 372 | Ga0163161_10035000 | 3300017792 | Bacteria | 3593 |
| 373 | Ga0209436_101942 | 3300025208 | Bacteria | 6654 |
| 374 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 375 | Ga0209026_1000197 | 3300025250 | Bacteria | 84123 |
| 376 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 377 | Ga0209676_1000488 | 3300025292 | Bacteria | 64408 |
| 378 | Ga0209564_1011183 | 3300025295 | Bacteria | 4046 |
| 379 | Ga0209564_1011455 | 3300025295 | Bacteria | 3972 |
| 380 | Ga0209758_1007200 | 3300025297 | Bacteria | 7661 |
| 381 | Ga0209758_1012031 | 3300025297 | Bacteria | 4910 |
| 382 | Ga0209050_1000124 | 3300025298 | Bacteria | 194022 |
| 383 | Ga0209050_1002617 | 3300025298 | Bacteria | 14850 |
| 384 | Ga0209050_1011007 | 3300025298 | Bacteria | 4362 |
| 385 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 386 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 387 | Ga0207426_1000052 | 3300025302 | Bacteria | 389825 |
| 388 | Ga0207426_1000555 | 3300025302 | Bacteria | 51462 |
| 389 | Ga0207426_1001572 | 3300025302 | Bacteria | 18424 |
| 390 | Ga0207426_1001894 | 3300025302 | Bacteria | 15188 |
| 391 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 392 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 393 | Ga0207682_10010484 | 3300025893 | Bacteria | 3633 |
| 394 | Ga0207710_10001419 | 3300025900 | Bacteria | 11980 |
| 395 | Ga0207688_10008017 | 3300025901 | Bacteria | 5747 |
| 396 | Ga0207688_10017774 | 3300025901 | Bacteria | 3869 |
| 397 | Ga0207680_10000029 | 3300025903 | Bacteria | 78814 |
| 398 | Ga0207680_10002452 | 3300025903 | Bacteria | 8650 |
| 399 | Ga0207680_10012885 | 3300025903 | Bacteria | 4274 |
| 400 | Ga0207680_10059475 | 3300025903 | Bacteria | 2321 |
| 401 | Ga0207647_10005456 | 3300025904 | Bacteria | 9319 |
| 402 | Ga0207647_10015561 | 3300025904 | Bacteria | 5212 |
| 403 | Ga0207645_10002232 | 3300025907 | Bacteria | 15424 |
| 404 | Ga0207645_10008195 | 3300025907 | Bacteria | 7312 |
| 405 | Ga0207645_10057490 | 3300025907 | Bacteria | 2483 |
| 406 | Ga0207643_10004176 | 3300025908 | Bacteria | 7783 |
| 407 | Ga0207643_10061544 | 3300025908 | Bacteria | 2144 |
| 408 | Ga0207643_10068925 | 3300025908 | Bacteria | 2032 |
| 409 | Ga0207705_10011117 | 3300025909 | Bacteria | 6527 |
| 410 | Ga0207695_10000022 | 3300025913 | Bacteria | 659090 |
| 411 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 412 | Ga0207695_10000244 | 3300025913 | Bacteria | 141138 |
| 413 | Ga0207695_10000686 | 3300025913 | Bacteria | 66411 |
| 414 | Ga0207695_10017906 | 3300025913 | Bacteria | 8206 |
| 415 | Ga0207695_10064801 | 3300025913 | Bacteria | 3760 |
| 416 | Ga0207695_10071704 | 3300025913 | Bacteria | 3538 |
| 417 | Ga0207671_10000254 | 3300025914 | Bacteria | 79974 |
| 418 | Ga0207671_10001757 | 3300025914 | Bacteria | 24379 |
| 419 | Ga0207671_10005220 | 3300025914 | Bacteria | 12075 |
| 420 | Ga0207671_10007815 | 3300025914 | Bacteria | 9197 |
| 421 | Ga0207671_10008072 | 3300025914 | Bacteria | 8993 |
| 422 | Ga0207671_10008328 | 3300025914 | Bacteria | 8810 |
| 423 | Ga0207671_10012425 | 3300025914 | Bacteria | 6846 |
| 424 | Ga0207660_10047825 | 3300025917 | Bacteria | 3026 |
| 425 | Ga0207662_10032319 | 3300025918 | Bacteria | 3045 |
| 426 | Ga0207662_10043131 | 3300025918 | Bacteria | 2661 |
| 427 | Ga0207657_10014264 | 3300025919 | Bacteria | 7768 |
| 428 | Ga0207657_10053364 | 3300025919 | Bacteria | 3502 |
| 429 | Ga0207649_10003070 | 3300025920 | Bacteria | 9169 |
| 430 | Ga0207649_10011854 | 3300025920 | Bacteria | 4822 |
| 431 | Ga0207681_10009868 | 3300025923 | Bacteria | 5841 |
| 432 | Ga0207681_10018912 | 3300025923 | Bacteria | 4345 |
| 433 | Ga0207650_10046953 | 3300025925 | Bacteria | 3181 |
| 434 | Ga0207659_10003683 | 3300025926 | Bacteria | 9240 |
| 435 | Ga0207659_10084408 | 3300025926 | Bacteria | 2357 |
| 436 | Ga0207687_10036322 | 3300025927 | Bacteria | 3356 |
| 437 | Ga0207690_10032235 | 3300025932 | Bacteria | 3361 |
| 438 | Ga0207690_10039094 | 3300025932 | Bacteria | 3093 |
| 439 | Ga0207706_10000494 | 3300025933 | Bacteria | 42203 |
| 440 | Ga0207706_10008493 | 3300025933 | Bacteria | 9474 |
| 441 | Ga0207706_10048298 | 3300025933 | Bacteria | 3764 |
| 442 | Ga0207706_10051989 | 3300025933 | Bacteria | 3618 |
| 443 | Ga0207706_10085264 | 3300025933 | Bacteria | 2777 |
| 444 | Ga0207706_10156787 | 3300025933 | Bacteria | 2002 |
| 445 | Ga0207706_10169891 | 3300025933 | Bacteria | 1916 |
| 446 | Ga0207686_10000998 | 3300025934 | Bacteria | 16801 |
| 447 | Ga0207686_10019648 | 3300025934 | Bacteria | 3846 |
| 448 | Ga0207670_10003107 | 3300025936 | Bacteria | 8788 |
| 449 | Ga0207670_10003276 | 3300025936 | Bacteria | 8578 |
| 450 | Ga0207670_10004819 | 3300025936 | Bacteria | 7325 |
| 451 | Ga0207670_10027340 | 3300025936 | Bacteria | 3605 |
| 452 | Ga0207670_10071926 | 3300025936 | Bacteria | 2393 |
| 453 | Ga0207691_10000914 | 3300025940 | Bacteria | 29268 |
| 454 | Ga0207691_10020187 | 3300025940 | Bacteria | 6302 |
| 455 | Ga0207691_10024267 | 3300025940 | Bacteria | 5703 |
| 456 | Ga0207691_10030013 | 3300025940 | Bacteria | 5084 |
| 457 | Ga0207689_10001749 | 3300025942 | Bacteria | 20508 |
| 458 | Ga0207689_10002450 | 3300025942 | Bacteria | 17287 |
| 459 | Ga0207689_10006705 | 3300025942 | Bacteria | 10156 |
| 460 | Ga0207689_10007182 | 3300025942 | Bacteria | 9784 |
| 461 | Ga0207689_10039516 | 3300025942 | Bacteria | 3906 |
| 462 | Ga0207661_10000840 | 3300025944 | Bacteria | 20127 |
| 463 | Ga0207661_10015790 | 3300025944 | Bacteria | 5562 |
| 464 | Ga0207661_10029385 | 3300025944 | Bacteria | 4221 |
| 465 | Ga0207679_10003308 | 3300025945 | Bacteria | 9948 |
| 466 | Ga0207679_10007619 | 3300025945 | Bacteria | 6875 |
| 467 | Ga0207679_10021110 | 3300025945 | Bacteria | 4407 |
| 468 | Ga0207679_10028954 | 3300025945 | Bacteria | 3851 |
| 469 | Ga0207679_10058235 | 3300025945 | Bacteria | 2861 |
| 470 | Ga0207667_10000100 | 3300025949 | Bacteria | 138482 |
| 471 | Ga0207667_10002398 | 3300025949 | Bacteria | 23465 |
| 472 | Ga0207667_10005713 | 3300025949 | Bacteria | 15172 |
| 473 | Ga0207667_10168859 | 3300025949 | Bacteria | 2249 |
| 474 | Ga0207651_10045912 | 3300025960 | Bacteria | 2933 |
| 475 | Ga0207651_10082060 | 3300025960 | Bacteria | 2326 |
| 476 | Ga0207712_10002419 | 3300025961 | Bacteria | 12064 |
| 477 | Ga0207712_10004337 | 3300025961 | Bacteria | 8961 |
| 478 | Ga0207712_10020414 | 3300025961 | Bacteria | 4338 |
| 479 | Ga0207712_10042677 | 3300025961 | Bacteria | 3125 |
| 480 | Ga0207668_10010298 | 3300025972 | Bacteria | 5647 |
| 481 | Ga0207658_10046192 | 3300025986 | Bacteria | 3179 |
| 482 | Ga0207658_10047481 | 3300025986 | Unclassified | 3143 |
| 483 | Ga0207658_10068107 | 3300025986 | Bacteria | 2684 |
| 484 | Ga0207658_10076596 | 3300025986 | Bacteria | 2549 |
| 485 | Ga0207658_10137665 | 3300025986 | Bacteria | 1971 |
| 486 | Ga0207677_10015482 | 3300026023 | Bacteria | 4489 |
| 487 | Ga0207677_10031065 | 3300026023 | Bacteria | 3418 |
| 488 | Ga0207677_10041939 | 3300026023 | Bacteria | 3030 |
| 489 | Ga0207677_10044267 | 3300026023 | Bacteria | 2964 |
| 490 | Ga0207703_10000864 | 3300026035 | Bacteria | 29667 |
| 491 | Ga0207703_10024730 | 3300026035 | Bacteria | 4726 |
| 492 | Ga0207703_10060627 | 3300026035 | Bacteria | 3094 |
| 493 | Ga0207703_10097039 | 3300026035 | Bacteria | 2490 |
| 494 | Ga0207703_10101179 | 3300026035 | Bacteria | 2443 |
| 495 | Ga0207639_10004235 | 3300026041 | Bacteria | 9670 |
| 496 | Ga0207708_10009532 | 3300026075 | Bacteria | 7199 |
| 497 | Ga0207708_10016241 | 3300026075 | Bacteria | 5594 |
| 498 | Ga0207708_10058078 | 3300026075 | Bacteria | 2952 |
| 499 | Ga0207708_10109139 | 3300026075 | Bacteria | 2147 |
| 500 | Ga0207702_10014935 | 3300026078 | Bacteria | 6442 |
| 501 | Ga0207702_10049621 | 3300026078 | Bacteria | 3542 |
| 502 | Ga0207641_10000044 | 3300026088 | Bacteria | 183824 |
| 503 | Ga0207641_10000637 | 3300026088 | Bacteria | 38255 |
| 504 | Ga0207641_10001165 | 3300026088 | Bacteria | 26454 |
| 505 | Ga0207641_10032020 | 3300026088 | Bacteria | 4364 |
| 506 | Ga0207641_10033364 | 3300026088 | Bacteria | 4277 |
| 507 | Ga0207641_10058264 | 3300026088 | Bacteria | 3287 |
| 508 | Ga0207648_10002156 | 3300026089 | Bacteria | 21404 |
| 509 | Ga0207648_10017045 | 3300026089 | Bacteria | 6621 |
| 510 | Ga0207648_10040809 | 3300026089 | Bacteria | 4077 |
| 511 | Ga0207648_10067175 | 3300026089 | Bacteria | 3126 |
| 512 | Ga0207648_10069700 | 3300026089 | Bacteria | 3064 |
| 513 | Ga0207648_10104438 | 3300026089 | Bacteria | 2485 |
| 514 | Ga0207648_10106021 | 3300026089 | Bacteria | 2466 |
| 515 | Ga0207676_10004478 | 3300026095 | Bacteria | 9877 |
| 516 | Ga0207676_10012759 | 3300026095 | Bacteria | 6029 |
| 517 | Ga0207676_10019563 | 3300026095 | Bacteria | 4941 |
| 518 | Ga0207676_10020245 | 3300026095 | Bacteria | 4864 |
| 519 | Ga0207676_10107257 | 3300026095 | Bacteria | 2329 |
| 520 | Ga0207674_10001313 | 3300026116 | Bacteria | 32421 |
| 521 | Ga0207674_10001764 | 3300026116 | Bacteria | 27663 |
| 522 | Ga0207674_10003326 | 3300026116 | Bacteria | 19763 |
| 523 | Ga0207674_10006323 | 3300026116 | Bacteria | 13959 |
| 524 | Ga0207674_10008347 | 3300026116 | Bacteria | 11981 |
| 525 | Ga0207674_10009319 | 3300026116 | Bacteria | 11241 |
| 526 | Ga0207674_10114254 | 3300026116 | Bacteria | 2672 |
| 527 | Ga0207675_100000051 | 3300026118 | Bacteria | 83288 |
| 528 | Ga0207675_100002116 | 3300026118 | Bacteria | 19675 |
| 529 | Ga0207675_100003210 | 3300026118 | Bacteria | 16031 |
| 530 | Ga0207675_100003409 | 3300026118 | Bacteria | 15512 |
| 531 | Ga0207675_100003772 | 3300026118 | Bacteria | 14760 |
| 532 | Ga0207675_100003982 | 3300026118 | Bacteria | 14328 |
| 533 | Ga0207675_100033955 | 3300026118 | Bacteria | 4754 |
| 534 | Ga0207683_10017645 | 3300026121 | Bacteria | 6084 |
| 535 | Ga0207683_10027125 | 3300026121 | Bacteria | 4950 |
| 536 | Ga0207698_10001532 | 3300026142 | Bacteria | 13470 |
| 537 | Ga0207698_10029155 | 3300026142 | Bacteria | 3948 |
| 538 | Ga0207698_10049230 | 3300026142 | Bacteria | 3206 |
| 539 | Ga0207698_10051247 | 3300026142 | Bacteria | 3155 |
| 540 | Ga0207428_10013362 | 3300027907 | Bacteria | 7176 |
| 541 | Ga0207428_10111494 | 3300027907 | Bacteria | 2105 |
| 542 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 543 | Ga0268266_10011305 | 3300028379 | Bacteria | 7770 |
| 544 | Ga0268266_10018956 | 3300028379 | Bacteria | 5862 |
| 545 | Ga0268266_10023629 | 3300028379 | Bacteria | 5232 |
| 546 | Ga0268266_10107275 | 3300028379 | Bacteria | 2470 |
| 547 | Ga0268266_10158612 | 3300028379 | Bacteria | 2045 |
| 548 | Ga0268265_10018882 | 3300028380 | Bacteria | 4785 |
| 549 | Ga0268265_10020040 | 3300028380 | Bacteria | 4661 |
| 550 | Ga0268265_10020727 | 3300028380 | Bacteria | 4593 |
| 551 | Ga0268265_10079730 | 3300028380 | Bacteria | 2580 |
| 552 | Ga0268265_10086772 | 3300028380 | Bacteria | 2488 |
| 553 | Ga0268265_10088484 | 3300028380 | Bacteria | 2467 |
| 554 | Ga0268265_10160067 | 3300028380 | Bacteria | 1911 |
| 555 | Ga0268264_10000072 | 3300028381 | Bacteria | 260791 |
| 556 | Ga0268264_10000327 | 3300028381 | Bacteria | 75326 |
| 557 | Ga0268264_10004249 | 3300028381 | Bacteria | 12226 |
| 558 | Ga0268264_10007773 | 3300028381 | Bacteria | 8927 |
| 559 | Ga0268264_10017550 | 3300028381 | Bacteria | 5861 |
| 560 | Ga0268264_10098967 | 3300028381 | Bacteria | 2530 |
| 561 | Ga0268264_10144900 | 3300028381 | Bacteria | 2122 |
| 562 | Ga0268264_10168024 | 3300028381 | Bacteria | 1982 |
| 563 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 564 | Ga0307515_10001652 | 3300028794 | Bacteria | 49628 |
| 565 | Ga0307515_10019786 | 3300028794 | Bacteria | 12078 |
| 566 | Ga0265332_10000647 | 3300031238 | Bacteria | 22595 |
| 567 | Ga0265327_10004167 | 3300031251 | Bacteria | 13044 |
| 568 | Ga0265327_10023360 | 3300031251 | Bacteria | 3664 |
| 569 | Ga0307513_10021988 | 3300031456 | Bacteria | 7512 |
| 570 | Ga0307509_10021227 | 3300031507 | Bacteria | 7347 |
| 571 | Ga0307408_100006344 | 3300031548 | Bacteria | 7848 |
| 572 | Ga0307508_10005018 | 3300031616 | Bacteria | 12721 |
| 573 | Ga0316575_10000740 | 3300031665 | Bacteria | 9794 |
| 574 | Ga0265342_10031964 | 3300031712 | Bacteria | 3249 |
| 575 | Ga0307516_10130496 | 3300031730 | Bacteria | 2293 |
| 576 | Ga0307405_10035592 | 3300031731 | Bacteria | 2975 |
| 577 | Ga0307413_10002877 | 3300031824 | Bacteria | 7101 |
| 578 | Ga0307412_10011841 | 3300031911 | Bacteria | 5064 |
| 579 | Ga0307409_100041559 | 3300031995 | Bacteria | 3435 |
| 580 | Ga0307416_100066279 | 3300032002 | Bacteria | 2972 |
| 581 | Ga0307414_10004512 | 3300032004 | Bacteria | 7569 |
| 582 | Ga0307414_10025626 | 3300032004 | Unclassified | 3782 |
| 583 | Ga0307414_10083559 | 3300032004 | Bacteria | 2345 |
| 584 | Ga0373943_0016519 | 3300035170 | Bacteria | 3367 |
| 585 | Ga0373931_0011261 | 3300035691 | Bacteria | 4320 |
| 586 | Ga0373937_0021247 | 3300036401 | Bacteria | 5824 |
| 587 | Ga0316584_0052706 | 3300036712 | Bacteria | 3043 |
| 588 | Ga0395900_0021965 | 3300037418 | Bacteria | 6525 |
| 589 | Ga0395905_0036008 | 3300037471 | Bacteria | 4648 |
| 590 | Ga0395905_0247213 | 3300037471 | Unclassified | 1666 |
| 591 | Ga0451577_0059330 | 3300042876 | Bacteria | 3411 |
| 592 | Ga0451577_0114585 | 3300042876 | Bacteria | 2413 |
| 593 | Ga0466972_0026806 | 3300044658 | Bacteria | 2855 |
| 594 | Ga0466961_0011359 | 3300044693 | Bacteria | 5695 |
| 595 | Ga0453684_0007730 | 3300044712 | Bacteria | 19633 |
| 596 | Ga0453684_0008982 | 3300044712 | Bacteria | 17660 |
| 597 | Ga0453684_0011736 | 3300044712 | Bacteria | 14608 |
| 598 | Ga0453684_0161376 | 3300044712 | Bacteria | 2651 |
| 599 | Ga0466957_0067096 | 3300044842 | Bacteria | 2213 |
| 600 | Ga0466959_0003205 | 3300045049 | Bacteria | 10634 |
| 601 | Ga0451576_0001902 | 3300045051 | Bacteria | 33495 |
| 602 | Ga0451576_0003836 | 3300045051 | Bacteria | 20204 |
| 603 | Ga0451576_0067534 | 3300045051 | Bacteria | 3722 |
| 604 | Ga0466958_0028706 | 3300045836 | Bacteria | 3300 |
| 605 | Ga0495603_0075626 | 3300046455 | Bacteria | 1977 |
| 606 | Ga0495629_0007537 | 3300046459 | Bacteria | 8021 |
| 607 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 608 | Ga0495638_0000156 | 3300046460 | Bacteria | 107923 |
| 609 | Ga0495582_0028223 | 3300046473 | Bacteria | 3080 |
| 610 | Ga0495628_0033702 | 3300046516 | Bacteria | 4125 |
| 611 | Ga0495648_0000348 | 3300046524 | Bacteria | 50841 |
| 612 | Ga0495633_0000176 | 3300046558 | Bacteria | 83645 |
| 613 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 614 | Ga0495625_0120642 | 3300046660 | Bacteria | 1784 |
| 615 | Ga0495661_0021927 | 3300046665 | Bacteria | 4157 |
| 616 | Ga0495672_0022099 | 3300047320 | Bacteria | 4140 |
| 617 | Ga0495672_0075408 | 3300047320 | Bacteria | 1897 |
| 618 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 619 | Ga0495687_000144 | 3300047443 | Bacteria | 108217 |
| 620 | Ga0495626_0002351 | 3300048091 | Bacteria | 13316 |
| 621 | Ga0496104_0029345 | 3300048907 | Bacteria | 5101 |
| 622 | Ga0496108_0122397 | 3300048911 | Bacteria | 2232 |
| 623 | Ga0496109_0013211 | 3300048912 | Bacteria | 7148 |
| 624 | Ga0496109_0028307 | 3300048912 | Bacteria | 5010 |
| 625 | Ga0496109_0057224 | 3300048912 | Bacteria | 3559 |
| 626 | Ga0496110_0028886 | 3300048913 | Bacteria | 4767 |
| 627 | Ga0496112_0064120 | 3300048915 | Bacteria | 3625 |
| 628 | Ga0496113_0003993 | 3300048916 | Bacteria | 8967 |
| 629 | Ga0496113_0016974 | 3300048916 | Bacteria | 5041 |
| 630 | Ga0496114_0092553 | 3300048917 | Bacteria | 2569 |
| 631 | Ga0496115_0015939 | 3300048918 | Bacteria | 5713 |
| 632 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 633 | Ga0496122_0001437 | 3300048925 | Bacteria | 38528 |
| 634 | Ga0496123_0003831 | 3300048926 | Bacteria | 16411 |
| 635 | Ga0496125_0001731 | 3300048928 | Bacteria | 30348 |
| 636 | Ga0501031_0009209 | 3300049568 | Bacteria | 6419 |
| 637 | Ga0501032_0024121 | 3300049569 | Bacteria | 4201 |
| 638 | Ga0501036_0043239 | 3300049572 | Bacteria | 3814 |
| 639 | Ga0501037_0025030 | 3300049573 | Bacteria | 4412 |
| 640 | Ga0501037_0042733 | 3300049573 | Bacteria | 3331 |
| 641 | Ga0501038_0014745 | 3300049574 | Bacteria | 7120 |
| 642 | Ga0501038_0056967 | 3300049574 | Bacteria | 3356 |
| 643 | Ga0501042_0005729 | 3300049578 | Bacteria | 8024 |
| 644 | Ga0501043_0022394 | 3300049579 | Bacteria | 4956 |
| 645 | Ga0501046_0010927 | 3300049580 | Bacteria | 7783 |
| 646 | Ga0501046_0029613 | 3300049580 | Bacteria | 4450 |
| 647 | Ga0501047_0046305 | 3300049581 | Bacteria | 4204 |
| 648 | Ga0501047_0161116 | 3300049581 | Bacteria | 2115 |
| 649 | Ga0501070_0000444 | 3300049586 | Bacteria | 37674 |
| 650 | Ga0501071_0034816 | 3300049587 | Bacteria | 3586 |
| 651 | Ga0501073_0072869 | 3300049589 | Bacteria | 2392 |
| 652 | Ga0501075_0075405 | 3300049591 | Bacteria | 2550 |
| 653 | Ga0501236_000136 | 3300049670 | Bacteria | 7306 |
| 654 | Ga0501242_000052 | 3300049674 | Bacteria | 7216 |
| 655 | Ga0501243_000825 | 3300049675 | Bacteria | 4312 |
| 656 | Ga0501259_001854 | 3300049688 | Bacteria | 3504 |
| 657 | Ga0501079_0050855 | 3300049741 | Bacteria | 3198 |
| 658 | Ga0501264_000168 | 3300049761 | Bacteria | 10594 |
| 659 | Ga0501035_0008768 | 3300049822 | Bacteria | 9414 |
| 660 | Ga0501035_0039542 | 3300049822 | Bacteria | 4268 |
| 661 | Ga0501044_0005009 | 3300049823 | Bacteria | 14789 |
| 662 | Ga0501044_0006015 | 3300049823 | Bacteria | 13405 |
| 663 | Ga0501044_0006539 | 3300049823 | Bacteria | 12867 |
| 664 | Ga0501044_0009683 | 3300049823 | Bacteria | 10482 |
| 665 | nmdc:mga05p37_1200_c1 | 3300050507 | Bacteria | 29977 |
| 666 | nmdc:mga05p37_123136_c1 | 3300050507 | Bacteria | 3185 |
| 667 | nmdc:mga05p37_15857_c1 | 3300050507 | Bacteria | 9063 |
| 668 | nmdc:mga05p37_49201_c1 | 3300050507 | Bacteria | 5185 |
| 669 | nmdc:mga05p37_4977_c1 | 3300050507 | Bacteria | 15573 |
| 670 | nmdc:mga09592_3115_c1 | 3300050508 | Bacteria | 13468 |
| 671 | nmdc:mga09592_391_c1 | 3300050508 | Bacteria | 32150 |
| 672 | nmdc:mga09592_41537_c1 | 3300050508 | Bacteria | 3867 |
| 673 | nmdc:mga0qj67_25986_c1 | 3300050509 | Bacteria | 4530 |
| 674 | nmdc:mga0qj67_6314_c1 | 3300050509 | Bacteria | 8700 |
| 675 | nmdc:mga0qj67_905_c2 | 3300050509 | Bacteria | 9438 |
| 676 | nmdc:mga06r32_111989_c1 | 3300050510 | Unclassified | 2686 |
| 677 | nmdc:mga06r32_41909_c1 | 3300050510 | Bacteria | 4351 |
| 678 | nmdc:mga06r32_8273_c2 | 3300050510 | Bacteria | 7321 |
| 679 | nmdc:mga08y16_16388_c1 | 3300050511 | Bacteria | 7792 |
| 680 | nmdc:mga08y16_198652_c1 | 3300050511 | Bacteria | 2078 |
| 681 | nmdc:mga08y16_26164_c1 | 3300050511 | Bacteria | 6154 |
| 682 | nmdc:mga08y16_33730_c1 | 3300050511 | Bacteria | 5376 |
| 683 | nmdc:mga08y16_36100_c1 | 3300050511 | Bacteria | 5190 |
| 684 | nmdc:mga08y16_92063_c1 | 3300050511 | Bacteria | 2287 |
| 685 | nmdc:mga0n895_123396_c1 | 3300050512 | Bacteria | 2612 |
| 686 | nmdc:mga0n895_4222_c1 | 3300050512 | Bacteria | 11745 |
| 687 | nmdc:mga0n895_71823_c1 | 3300050512 | Bacteria | 3433 |
| 688 | nmdc:mga08x19_2409_c1 | 3300050514 | Bacteria | 11345 |
| 689 | nmdc:mga0a205_106816_c1 | 3300050515 | Bacteria | 2697 |
| 690 | nmdc:mga0a205_17601_c1 | 3300050515 | Bacteria | 6705 |
| 691 | Ga0500635_0000557 | 3300053080 | Bacteria | 9937 |
| 692 | Ga0500644_0001758 | 3300053088 | Bacteria | 5608 |
| 693 | Ga0500583_0000927 | 3300053092 | Bacteria | 8373 |
| 694 | Ga0500557_002379 | 3300053105 | Bacteria | 3434 |
| 695 | Ga0500595_000011 | 3300053119 | Bacteria | 268589 |
| 696 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 697 | Ga0500652_005630 | 3300053131 | Bacteria | 3965 |
| 698 | Ga0500559_0010370 | 3300053136 | Bacteria | 4004 |
| 699 | Ga0500568_0007246 | 3300053139 | Bacteria | 5465 |
| 700 | Ga0500604_0012502 | 3300053151 | Bacteria | 2292 |
| 701 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 702 | Ga0500616_0000082 | 3300053153 | Bacteria | 198665 |
| 703 | Ga0500616_0009227 | 3300053153 | Bacteria | 6017 |
| 704 | Ga0500616_0015760 | 3300053153 | Bacteria | 4315 |
| 705 | Ga0500622_0000009 | 3300053156 | Bacteria | 419980 |
| 706 | Ga0500622_0000096 | 3300053156 | Bacteria | 90621 |
| 707 | Ga0500622_0003253 | 3300053156 | Bacteria | 11021 |
| 708 | Ga0500622_0003329 | 3300053156 | Bacteria | 10843 |
| 709 | Ga0500622_0012098 | 3300053156 | Bacteria | 4685 |
| 710 | Ga0501082_0045483 | 3300060353 | Bacteria | 3786 |
| 711 | Ga0530510_0052054 | 3300061734 | Bacteria | 2959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0024121 | Ga0501032_0024121_535_1962 | 435 |
| 2 | 3300005548 | Ga0070665_100204701 | Ga0070665_1002047012 | 449 |
| 3 | 3300025298 | Ga0209050_1011007 | Ga0209050_10110073 | 450 |
| 4 | 3300053136 | Ga0500559_0010370 | Ga0500559_0010370_2444_3919 | 468 |
| 5 | 3300046660 | Ga0495625_0120642 | Ga0495625_0120642_46_1587 | 471 |
| 6 | 3300037471 | Ga0395905_0247213 | Ga0395905_0247213_19_1503 | 476 |
| 7 | 3300049674 | Ga0501242_000052 | Ga0501242_000052_3478_4968 | 478 |
| 8 | 3300005842 | Ga0068858_100002496 | Ga0068858_10000249613 | 492 |
| 9 | 3300026035 | Ga0207703_10000864 | Ga0207703_100008645 | 492 |
| 10 | 3300048928 | Ga0496125_0001731 | Ga0496125_0001731_22068_23753 | 492 |
| 11 | 3300028794 | Ga0307515_10019786 | Ga0307515_100197865 | 495 |
| 12 | 3300025893 | Ga0207682_10010484 | Ga0207682_100104842 | 505 |
| 13 | 3300006844 | Ga0075428_100012082 | Ga0075428_1000120825 | 509 |
| 14 | 3300006847 | Ga0075431_100094782 | Ga0075431_1000947823 | 509 |
| 15 | 3300050509 | nmdc:mga0qj67_6314_c1 | nmdc:mga0qj67_6314_c1_1898_3568 | 509 |
| 16 | 3300005841 | Ga0068863_100040447 | Ga0068863_1000404475 | 513 |
| 17 | 3300006237 | Ga0097621_100012064 | Ga0097621_1000120643 | 513 |
| 18 | 3300006358 | Ga0068871_100026227 | Ga0068871_1000262272 | 513 |
| 19 | 3300009176 | Ga0105242_10002416 | Ga0105242_100024163 | 513 |
| 20 | 3300014969 | Ga0157376_10031635 | Ga0157376_100316352 | 513 |
| 21 | 3300048091 | Ga0495626_0002351 | Ga0495626_0002351_8820_10559 | 514 |
| 22 | 3300003794 | Ga0055531_10000559 | Ga0055531_1000055919 | 515 |
| 23 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007518 | 515 |
| 24 | 3300006237 | Ga0097621_100030359 | Ga0097621_1000303593 | 518 |
| 25 | 3300009101 | Ga0105247_10027897 | Ga0105247_100278973 | 519 |
| 26 | 3300025903 | Ga0207680_10002452 | Ga0207680_100024529 | 519 |
| 27 | 3300047443 | Ga0495687_000144 | Ga0495687_000144_57475_59157 | 519 |
| 28 | iso_pu_bacteria | 2643221614 | 2644087882 | 520 |
| 29 | iso_pu_bacteria | 2643221661 | 2644345487 | 520 |
| 30 | iso_pu_bacteria | 2643221666 | 2644367238 | 520 |
| 31 | 3300003316 | rootH1_10033153 | rootH1_100331532 | 521 |
| 32 | 3300003320 | rootH2_10009145 | rootH2_100091454 | 521 |
| 33 | 3300049573 | Ga0501037_0042733 | Ga0501037_0042733_712_2409 | 521 |
| 34 | 3300049574 | Ga0501038_0014745 | Ga0501038_0014745_3921_5618 | 521 |
| 35 | 3300049586 | Ga0501070_0000444 | Ga0501070_0000444_14661_16358 | 521 |
| 36 | 3300049822 | Ga0501035_0008768 | Ga0501035_0008768_7661_9358 | 521 |
| 37 | 3300049823 | Ga0501044_0005009 | Ga0501044_0005009_6945_8642 | 521 |
| 38 | 3300005937 | Ga0081455_10016284 | Ga0081455_100162843 | 522 |
| 39 | 3300009553 | Ga0105249_10014639 | Ga0105249_100146392 | 522 |
| 40 | 3300010375 | Ga0105239_10002266 | Ga0105239_1000226620 | 522 |
| 41 | 3300013306 | Ga0163162_10056064 | Ga0163162_100560642 | 522 |
| 42 | 3300014326 | Ga0157380_10117699 | Ga0157380_101176992 | 522 |
| 43 | 3300014745 | Ga0157377_10051629 | Ga0157377_100516292 | 522 |
| 44 | 3300014968 | Ga0157379_10045511 | Ga0157379_100455113 | 522 |
| 45 | 3300025961 | Ga0207712_10042677 | Ga0207712_100426772 | 522 |
| 46 | 3300032004 | Ga0307414_10004512 | Ga0307414_100045127 | 522 |
| 47 | 3300049581 | Ga0501047_0161116 | Ga0501047_0161116_407_2089 | 522 |
| 48 | 3300049823 | Ga0501044_0006015 | Ga0501044_0006015_7511_9193 | 522 |
| 49 | 3300044693 | Ga0466961_0011359 | Ga0466961_0011359_2825_4510 | 524 |
| 50 | 3300044842 | Ga0466957_0067096 | Ga0466957_0067096_412_2097 | 524 |
| 51 | 3300045049 | Ga0466959_0003205 | Ga0466959_0003205_4010_5695 | 524 |
| 52 | 3300045836 | Ga0466958_0028706 | Ga0466958_0028706_1426_3111 | 524 |
| 53 | 3300049823 | Ga0501044_0006539 | Ga0501044_0006539_7531_9222 | 524 |
| 54 | 3300053153 | Ga0500616_0009227 | Ga0500616_0009227_2693_4393 | 524 |
| 55 | 3300005262 | Ga0065165_1000639 | Ga0065165_100063913 | 525 |
| 56 | 3300025292 | Ga0209676_1000488 | Ga0209676_100048828 | 525 |
| 57 | 3300028794 | Ga0307515_10000012 | Ga0307515_10000012469 | 525 |
| 58 | 3300005618 | Ga0068864_100018951 | Ga0068864_1000189512 | 526 |
| 59 | 3300026095 | Ga0207676_10012759 | Ga0207676_100127593 | 526 |
| 60 | 3300050508 | nmdc:mga09592_3115_c1 | nmdc:mga09592_3115_c1_2359_4026 | 526 |
| 61 | 3300006844 | Ga0075428_100124285 | Ga0075428_1001242853 | 527 |
| 62 | 3300009147 | Ga0114129_10287323 | Ga0114129_102873232 | 527 |
| 63 | 3300005290 | Ga0065712_10070193 | Ga0065712_100701934 | 528 |
| 64 | 3300005354 | Ga0070675_100163355 | Ga0070675_1001633552 | 528 |
| 65 | 3300005466 | Ga0070685_10010649 | Ga0070685_100106492 | 528 |
| 66 | 3300005841 | Ga0068863_100004291 | Ga0068863_1000042916 | 528 |
| 67 | 3300009553 | Ga0105249_10009844 | Ga0105249_100098445 | 528 |
| 68 | 3300017792 | Ga0163161_10035000 | Ga0163161_100350003 | 528 |
| 69 | 3300025961 | Ga0207712_10004337 | Ga0207712_100043373 | 528 |
| 70 | 3300026035 | Ga0207703_10097039 | Ga0207703_100970391 | 528 |
| 71 | 3300026088 | Ga0207641_10001165 | Ga0207641_100011656 | 528 |
| 72 | 3300026116 | Ga0207674_10114254 | Ga0207674_101142543 | 528 |
| 73 | 3300003316 | rootH1_10077515 | rootH1_100775154 | 529 |
| 74 | 3300005843 | Ga0068860_100000447 | Ga0068860_10000044734 | 529 |
| 75 | 3300005983 | Ga0081540_1009025 | Ga0081540_10090253 | 529 |
| 76 | 3300006058 | Ga0075432_10002592 | Ga0075432_100025921 | 529 |
| 77 | 3300013306 | Ga0163162_10002051 | Ga0163162_100020516 | 529 |
| 78 | 3300028381 | Ga0268264_10000327 | Ga0268264_1000032733 | 529 |
| 79 | 3300053125 | Ga0500618_000004 | Ga0500618_000004_267209_268924 | 529 |
| 80 | 3300005327 | Ga0070658_10002413 | Ga0070658_100024135 | 530 |
| 81 | 3300025908 | Ga0207643_10061544 | Ga0207643_100615441 | 530 |
| 82 | 3300025909 | Ga0207705_10011117 | Ga0207705_100111172 | 530 |
| 83 | 3300025919 | Ga0207657_10053364 | Ga0207657_100533643 | 530 |
| 84 | 3300005328 | Ga0070676_10004885 | Ga0070676_100048852 | 532 |
| 85 | 3300005329 | Ga0070683_100005920 | Ga0070683_1000059205 | 532 |
| 86 | 3300005329 | Ga0070683_100037872 | Ga0070683_1000378721 | 532 |
| 87 | 3300005330 | Ga0070690_100001727 | Ga0070690_1000017279 | 532 |
| 88 | 3300005330 | Ga0070690_100043945 | Ga0070690_1000439451 | 532 |
| 89 | 3300005330 | Ga0070690_100057098 | Ga0070690_1000570982 | 532 |
| 90 | 3300005334 | Ga0068869_100048943 | Ga0068869_1000489432 | 532 |
| 91 | 3300005338 | Ga0068868_100002272 | Ga0068868_10000227214 | 532 |
| 92 | 3300005338 | Ga0068868_100073887 | Ga0068868_1000738872 | 532 |
| 93 | 3300005338 | Ga0068868_100077996 | Ga0068868_1000779962 | 532 |
| 94 | 3300005340 | Ga0070689_100015800 | Ga0070689_1000158003 | 532 |
| 95 | 3300005344 | Ga0070661_100000277 | Ga0070661_10000027728 | 532 |
| 96 | 3300005355 | Ga0070671_100040595 | Ga0070671_1000405952 | 532 |
| 97 | 3300005365 | Ga0070688_100017477 | Ga0070688_1000174773 | 532 |
| 98 | 3300005367 | Ga0070667_100017378 | Ga0070667_1000173782 | 532 |
| 99 | 3300005438 | Ga0070701_10016630 | Ga0070701_100166303 | 532 |
| 100 | 3300005457 | Ga0070662_100019703 | Ga0070662_1000197032 | 532 |
| 101 | 3300005457 | Ga0070662_100020503 | Ga0070662_1000205032 | 532 |
| 102 | 3300005466 | Ga0070685_10011895 | Ga0070685_100118952 | 532 |
| 103 | 3300005535 | Ga0070684_100000773 | Ga0070684_1000007734 | 532 |
| 104 | 3300005539 | Ga0068853_100014216 | Ga0068853_1000142162 | 532 |
| 105 | 3300005548 | Ga0070665_100100081 | Ga0070665_1001000812 | 532 |
| 106 | 3300005564 | Ga0070664_100008983 | Ga0070664_1000089835 | 532 |
| 107 | 3300005577 | Ga0068857_100003006 | Ga0068857_1000030069 | 532 |
| 108 | 3300005577 | Ga0068857_100014247 | Ga0068857_1000142474 | 532 |
| 109 | 3300005615 | Ga0070702_100036762 | Ga0070702_1000367622 | 532 |
| 110 | 3300005616 | Ga0068852_100049772 | Ga0068852_1000497722 | 532 |
| 111 | 3300005616 | Ga0068852_100128349 | Ga0068852_1001283492 | 532 |
| 112 | 3300005617 | Ga0068859_100017056 | Ga0068859_1000170564 | 532 |
| 113 | 3300005618 | Ga0068864_100002580 | Ga0068864_1000025802 | 532 |
| 114 | 3300005719 | Ga0068861_100001294 | Ga0068861_1000012949 | 532 |
| 115 | 3300005719 | Ga0068861_100010706 | Ga0068861_1000107064 | 532 |
| 116 | 3300005841 | Ga0068863_100044449 | Ga0068863_1000444493 | 532 |
| 117 | 3300005842 | Ga0068858_100220340 | Ga0068858_1002203401 | 532 |
| 118 | 3300005843 | Ga0068860_100031639 | Ga0068860_1000316392 | 532 |
| 119 | 3300005844 | Ga0068862_100111286 | Ga0068862_1001112862 | 532 |
| 120 | 3300005985 | Ga0081539_10004761 | Ga0081539_100047614 | 532 |
| 121 | 3300006871 | Ga0075434_100007952 | Ga0075434_1000079524 | 532 |
| 122 | 3300006931 | Ga0097620_100017056 | Ga0097620_1000170563 | 532 |
| 123 | 3300013100 | Ga0157373_10048040 | Ga0157373_100480401 | 532 |
| 124 | 3300013296 | Ga0157374_10063455 | Ga0157374_100634552 | 532 |
| 125 | 3300013297 | Ga0157378_10060998 | Ga0157378_100609982 | 532 |
| 126 | 3300013306 | Ga0163162_10034203 | Ga0163162_100342034 | 532 |
| 127 | 3300013307 | Ga0157372_10071598 | Ga0157372_100715983 | 532 |
| 128 | 3300013308 | Ga0157375_10013323 | Ga0157375_100133232 | 532 |
| 129 | 3300013308 | Ga0157375_10055146 | Ga0157375_100551462 | 532 |
| 130 | 3300025302 | Ga0207426_1000052 | Ga0207426_1000052108 | 532 |
| 131 | 3300025903 | Ga0207680_10059475 | Ga0207680_100594751 | 532 |
| 132 | 3300025907 | Ga0207645_10008195 | Ga0207645_100081952 | 532 |
| 133 | 3300025920 | Ga0207649_10003070 | Ga0207649_100030707 | 532 |
| 134 | 3300025932 | Ga0207690_10032235 | Ga0207690_100322352 | 532 |
| 135 | 3300025933 | Ga0207706_10048298 | Ga0207706_100482982 | 532 |
| 136 | 3300025933 | Ga0207706_10085264 | Ga0207706_100852642 | 532 |
| 137 | 3300025933 | Ga0207706_10156787 | Ga0207706_101567871 | 532 |
| 138 | 3300025936 | Ga0207670_10003107 | Ga0207670_100031071 | 532 |
| 139 | 3300025936 | Ga0207670_10071926 | Ga0207670_100719262 | 532 |
| 140 | 3300025940 | Ga0207691_10024267 | Ga0207691_100242673 | 532 |
| 141 | 3300025942 | Ga0207689_10001749 | Ga0207689_1000174913 | 532 |
| 142 | 3300025944 | Ga0207661_10000840 | Ga0207661_100008404 | 532 |
| 143 | 3300025944 | Ga0207661_10029385 | Ga0207661_100293853 | 532 |
| 144 | 3300025945 | Ga0207679_10021110 | Ga0207679_100211102 | 532 |
| 145 | 3300025986 | Ga0207658_10068107 | Ga0207658_100681072 | 532 |
| 146 | 3300025986 | Ga0207658_10076596 | Ga0207658_100765962 | 532 |
| 147 | 3300026023 | Ga0207677_10031065 | Ga0207677_100310653 | 532 |
| 148 | 3300026023 | Ga0207677_10041939 | Ga0207677_100419392 | 532 |
| 149 | 3300026035 | Ga0207703_10060627 | Ga0207703_100606272 | 532 |
| 150 | 3300026041 | Ga0207639_10004235 | Ga0207639_100042356 | 532 |
| 151 | 3300026089 | Ga0207648_10040809 | Ga0207648_100408093 | 532 |
| 152 | 3300026089 | Ga0207648_10069700 | Ga0207648_100697002 | 532 |
| 153 | 3300026116 | Ga0207674_10006323 | Ga0207674_100063239 | 532 |
| 154 | 3300026118 | Ga0207675_100003409 | Ga0207675_10000340910 | 532 |
| 155 | 3300026118 | Ga0207675_100003982 | Ga0207675_1000039826 | 532 |
| 156 | 3300026142 | Ga0207698_10029155 | Ga0207698_100291552 | 532 |
| 157 | 3300028380 | Ga0268265_10088484 | Ga0268265_100884842 | 532 |
| 158 | 3300028381 | Ga0268264_10144900 | Ga0268264_101449002 | 532 |
| 159 | 3300036401 | Ga0373937_0021247 | Ga0373937_0021247_2823_4499 | 532 |
| 160 | 3300046516 | Ga0495628_0033702 | Ga0495628_0033702_2388_4064 | 532 |
| 161 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_344323_346011 | 532 |
| 162 | 3300048913 | Ga0496110_0028886 | Ga0496110_0028886_1951_3627 | 532 |
| 163 | 3300049568 | Ga0501031_0009209 | Ga0501031_0009209_3278_4954 | 532 |
| 164 | 3300049572 | Ga0501036_0043239 | Ga0501036_0043239_1541_3217 | 532 |
| 165 | 3300049573 | Ga0501037_0025030 | Ga0501037_0025030_2356_4032 | 532 |
| 166 | 3300049574 | Ga0501038_0056967 | Ga0501038_0056967_90_1766 | 532 |
| 167 | 3300049579 | Ga0501043_0022394 | Ga0501043_0022394_1253_2929 | 532 |
| 168 | 3300049580 | Ga0501046_0029613 | Ga0501046_0029613_687_2363 | 532 |
| 169 | 3300049581 | Ga0501047_0046305 | Ga0501047_0046305_1488_3164 | 532 |
| 170 | 3300049822 | Ga0501035_0039542 | Ga0501035_0039542_1837_3513 | 532 |
| 171 | 3300049823 | Ga0501044_0009683 | Ga0501044_0009683_3550_5226 | 532 |
| 172 | 3300053119 | Ga0500595_000011 | Ga0500595_000011_210263_211936 | 532 |
| 173 | 3300005355 | Ga0070671_100164935 | Ga0070671_1001649351 | 533 |
| 174 | 3300025208 | Ga0209436_101942 | Ga0209436_1019425 | 533 |
| 175 | 3300025302 | Ga0207426_1000555 | Ga0207426_10005555 | 533 |
| 176 | 3300045051 | Ga0451576_0001902 | Ga0451576_0001902_7266_8960 | 533 |
| 177 | 3300003320 | rootH2_10012490 | rootH2_100124908 | 534 |
| 178 | 3300005617 | Ga0068859_100161312 | Ga0068859_1001613122 | 534 |
| 179 | 3300006237 | Ga0097621_100000859 | Ga0097621_1000008593 | 534 |
| 180 | 3300006237 | Ga0097621_100038544 | Ga0097621_1000385444 | 534 |
| 181 | 3300006358 | Ga0068871_100005778 | Ga0068871_1000057787 | 534 |
| 182 | 3300006880 | Ga0075429_100044721 | Ga0075429_1000447212 | 534 |
| 183 | 3300006881 | Ga0068865_100034633 | Ga0068865_1000346334 | 534 |
| 184 | 3300006931 | Ga0097620_100161312 | Ga0097620_1001613122 | 534 |
| 185 | 3300009093 | Ga0105240_10000083 | Ga0105240_10000083179 | 534 |
| 186 | 3300009094 | Ga0111539_10241437 | Ga0111539_102414372 | 534 |
| 187 | 3300009147 | Ga0114129_10001594 | Ga0114129_100015949 | 534 |
| 188 | 3300009147 | Ga0114129_10024341 | Ga0114129_100243412 | 534 |
| 189 | 3300009147 | Ga0114129_10079503 | Ga0114129_100795032 | 534 |
| 190 | 3300009174 | Ga0105241_10011702 | Ga0105241_100117024 | 534 |
| 191 | 3300009174 | Ga0105241_10018994 | Ga0105241_100189945 | 534 |
| 192 | 3300009176 | Ga0105242_10027792 | Ga0105242_100277924 | 534 |
| 193 | 3300009545 | Ga0105237_10000198 | Ga0105237_1000019823 | 534 |
| 194 | 3300009545 | Ga0105237_10114932 | Ga0105237_101149322 | 534 |
| 195 | 3300009551 | Ga0105238_10043938 | Ga0105238_100439382 | 534 |
| 196 | 3300010375 | Ga0105239_10016827 | Ga0105239_100168272 | 534 |
| 197 | 3300010375 | Ga0105239_10165295 | Ga0105239_101652952 | 534 |
| 198 | 3300013306 | Ga0163162_10250748 | Ga0163162_102507482 | 534 |
| 199 | 3300013308 | Ga0157375_10175088 | Ga0157375_101750882 | 534 |
| 200 | 3300014326 | Ga0157380_10020263 | Ga0157380_100202632 | 534 |
| 201 | 3300025913 | Ga0207695_10000127 | Ga0207695_10000127179 | 534 |
| 202 | 3300025914 | Ga0207671_10000254 | Ga0207671_1000025422 | 534 |
| 203 | 3300025919 | Ga0207657_10014264 | Ga0207657_100142643 | 534 |
| 204 | 3300025960 | Ga0207651_10045912 | Ga0207651_100459123 | 534 |
| 205 | 3300026023 | Ga0207677_10044267 | Ga0207677_100442672 | 534 |
| 206 | 3300026075 | Ga0207708_10109139 | Ga0207708_101091391 | 534 |
| 207 | 3300026089 | Ga0207648_10067175 | Ga0207648_100671753 | 534 |
| 208 | 3300028379 | Ga0268266_10018956 | Ga0268266_100189564 | 534 |
| 209 | 3300028379 | Ga0268266_10158612 | Ga0268266_101586121 | 534 |
| 210 | 3300031730 | Ga0307516_10130496 | Ga0307516_101304961 | 534 |
| 211 | 3300046455 | Ga0495603_0075626 | Ga0495603_0075626_157_1836 | 534 |
| 212 | 3300049578 | Ga0501042_0005729 | Ga0501042_0005729_1784_3466 | 534 |
| 213 | 3300049580 | Ga0501046_0010927 | Ga0501046_0010927_4733_6415 | 534 |
| 214 | 3300049587 | Ga0501071_0034816 | Ga0501071_0034816_480_2162 | 534 |
| 215 | 3300049589 | Ga0501073_0072869 | Ga0501073_0072869_60_1742 | 534 |
| 216 | 3300049591 | Ga0501075_0075405 | Ga0501075_0075405_766_2448 | 534 |
| 217 | 3300050507 | nmdc:mga05p37_1200_c1 | nmdc:mga05p37_1200_c1_22045_23751 | 534 |
| 218 | 3300050507 | nmdc:mga05p37_123136_c1 | nmdc:mga05p37_123136_c1_322_2004 | 534 |
| 219 | 3300050507 | nmdc:mga05p37_15857_c1 | nmdc:mga05p37_15857_c1_7007_8689 | 534 |
| 220 | 3300050507 | nmdc:mga05p37_49201_c1 | nmdc:mga05p37_49201_c1_77_1762 | 534 |
| 221 | 3300050508 | nmdc:mga09592_41537_c1 | nmdc:mga09592_41537_c1_878_2560 | 534 |
| 222 | 3300050511 | nmdc:mga08y16_16388_c1 | nmdc:mga08y16_16388_c1_4170_5852 | 534 |
| 223 | 3300050512 | nmdc:mga0n895_4222_c1 | nmdc:mga0n895_4222_c1_4071_5777 | 534 |
| 224 | 3300050512 | nmdc:mga0n895_71823_c1 | nmdc:mga0n895_71823_c1_1147_2853 | 534 |
| 225 | 3300050514 | nmdc:mga08x19_2409_c1 | nmdc:mga08x19_2409_c1_1867_3573 | 534 |
| 226 | 3300050515 | nmdc:mga0a205_17601_c1 | nmdc:mga0a205_17601_c1_415_2121 | 534 |
| 227 | 3300060353 | Ga0501082_0045483 | Ga0501082_0045483_1182_2864 | 534 |
| 228 | 3300061734 | Ga0530510_0052054 | Ga0530510_0052054_645_2327 | 534 |
| 229 | iso_pu_bacteria | 2894414249 | 2894415675 | 534 |
| 230 | iso_pu_bacteria | 2977232053 | 2977233122 | 534 |
| 231 | 3300003322 | rootL2_10174960 | rootL2_101749603 | 535 |
| 232 | 3300003794 | Ga0055531_10000426 | Ga0055531_1000042613 | 535 |
| 233 | 3300005289 | Ga0065704_10076316 | Ga0065704_100763163 | 535 |
| 234 | 3300005335 | Ga0070666_10003057 | Ga0070666_100030575 | 535 |
| 235 | 3300005347 | Ga0070668_100032892 | Ga0070668_1000328923 | 535 |
| 236 | 3300005577 | Ga0068857_100003443 | Ga0068857_1000034436 | 535 |
| 237 | 3300005578 | Ga0068854_100006457 | Ga0068854_1000064572 | 535 |
| 238 | 3300005614 | Ga0068856_100063625 | Ga0068856_1000636253 | 535 |
| 239 | 3300005616 | Ga0068852_100005907 | Ga0068852_1000059072 | 535 |
| 240 | 3300005843 | Ga0068860_100005348 | Ga0068860_1000053487 | 535 |
| 241 | 3300009093 | Ga0105240_10000269 | Ga0105240_1000026952 | 535 |
| 242 | 3300009093 | Ga0105240_10006701 | Ga0105240_100067018 | 535 |
| 243 | 3300009093 | Ga0105240_10021747 | Ga0105240_100217476 | 535 |
| 244 | 3300009174 | Ga0105241_10090697 | Ga0105241_100906972 | 535 |
| 245 | 3300009174 | Ga0105241_10126991 | Ga0105241_101269911 | 535 |
| 246 | 3300009545 | Ga0105237_10000171 | Ga0105237_1000017132 | 535 |
| 247 | 3300009545 | Ga0105237_10001507 | Ga0105237_1000150716 | 535 |
| 248 | 3300009545 | Ga0105237_10004821 | Ga0105237_1000482111 | 535 |
| 249 | 3300009545 | Ga0105237_10008339 | Ga0105237_100083398 | 535 |
| 250 | 3300009551 | Ga0105238_10007423 | Ga0105238_100074235 | 535 |
| 251 | 3300010375 | Ga0105239_10000609 | Ga0105239_100006093 | 535 |
| 252 | 3300013105 | Ga0157369_10000605 | Ga0157369_1000060512 | 535 |
| 253 | 3300013307 | Ga0157372_10000894 | Ga0157372_100008944 | 535 |
| 254 | 3300013308 | Ga0157375_10233366 | Ga0157375_102333662 | 535 |
| 255 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007481 | 535 |
| 256 | 3300025903 | Ga0207680_10012885 | Ga0207680_100128853 | 535 |
| 257 | 3300025904 | Ga0207647_10015561 | Ga0207647_100155613 | 535 |
| 258 | 3300025913 | Ga0207695_10000244 | Ga0207695_1000024464 | 535 |
| 259 | 3300025913 | Ga0207695_10017906 | Ga0207695_100179065 | 535 |
| 260 | 3300025913 | Ga0207695_10064801 | Ga0207695_100648013 | 535 |
| 261 | 3300025914 | Ga0207671_10001757 | Ga0207671_1000175718 | 535 |
| 262 | 3300025914 | Ga0207671_10005220 | Ga0207671_100052208 | 535 |
| 263 | 3300025914 | Ga0207671_10007815 | Ga0207671_100078155 | 535 |
| 264 | 3300025914 | Ga0207671_10008072 | Ga0207671_100080725 | 535 |
| 265 | 3300025949 | Ga0207667_10002398 | Ga0207667_100023986 | 535 |
| 266 | 3300026078 | Ga0207702_10014935 | Ga0207702_100149354 | 535 |
| 267 | 3300028381 | Ga0268264_10004249 | Ga0268264_100042491 | 535 |
| 268 | 3300028381 | Ga0268264_10007773 | Ga0268264_100077733 | 535 |
| 269 | 3300037418 | Ga0395900_0021965 | Ga0395900_0021965_1867_3558 | 535 |
| 270 | 3300037471 | Ga0395905_0036008 | Ga0395905_0036008_1205_2908 | 535 |
| 271 | 3300042876 | Ga0451577_0114585 | Ga0451577_0114585_699_2357 | 535 |
| 272 | 3300044658 | Ga0466972_0026806 | Ga0466972_0026806_445_2115 | 535 |
| 273 | 3300044712 | Ga0453684_0011736 | Ga0453684_0011736_8240_9898 | 535 |
| 274 | 3300044712 | Ga0453684_0161376 | Ga0453684_0161376_695_2362 | 535 |
| 275 | 3300047320 | Ga0495672_0022099 | Ga0495672_0022099_1508_3217 | 535 |
| 276 | 3300053156 | Ga0500622_0003329 | Ga0500622_0003329_2611_4296 | 535 |
| 277 | iso_pu_bacteria | 2919692658 | 2919695975 | 535 |
| 278 | 3300005329 | Ga0070683_100023539 | Ga0070683_1000235397 | 536 |
| 279 | 3300005536 | Ga0070697_100034646 | Ga0070697_1000346463 | 536 |
| 280 | 3300005545 | Ga0070695_100008303 | Ga0070695_1000083033 | 536 |
| 281 | 3300005546 | Ga0070696_100001683 | Ga0070696_1000016834 | 536 |
| 282 | 3300005549 | Ga0070704_100034290 | Ga0070704_1000342902 | 536 |
| 283 | 3300005563 | Ga0068855_100037991 | Ga0068855_1000379913 | 536 |
| 284 | 3300005577 | Ga0068857_100017670 | Ga0068857_1000176702 | 536 |
| 285 | 3300005578 | Ga0068854_100019492 | Ga0068854_1000194926 | 536 |
| 286 | 3300005616 | Ga0068852_100001717 | Ga0068852_1000017173 | 536 |
| 287 | 3300005841 | Ga0068863_100073916 | Ga0068863_1000739163 | 536 |
| 288 | 3300007076 | Ga0075435_100070656 | Ga0075435_1000706561 | 536 |
| 289 | 3300009093 | Ga0105240_10009858 | Ga0105240_100098585 | 536 |
| 290 | 3300009545 | Ga0105237_10012320 | Ga0105237_100123206 | 536 |
| 291 | 3300009551 | Ga0105238_10194932 | Ga0105238_101949322 | 536 |
| 292 | 3300013104 | Ga0157370_10003043 | Ga0157370_1000304311 | 536 |
| 293 | 3300013307 | Ga0157372_10000231 | Ga0157372_1000023112 | 536 |
| 294 | 3300013308 | Ga0157375_10161838 | Ga0157375_101618382 | 536 |
| 295 | 3300025904 | Ga0207647_10005456 | Ga0207647_1000545610 | 536 |
| 296 | 3300025914 | Ga0207671_10012425 | Ga0207671_100124253 | 536 |
| 297 | 3300025949 | Ga0207667_10000100 | Ga0207667_1000010013 | 536 |
| 298 | 3300026088 | Ga0207641_10058264 | Ga0207641_100582642 | 536 |
| 299 | 3300026116 | Ga0207674_10009319 | Ga0207674_100093198 | 536 |
| 300 | 3300026142 | Ga0207698_10001532 | Ga0207698_100015323 | 536 |
| 301 | 3300032004 | Ga0307414_10025626 | Ga0307414_100256261 | 536 |
| 302 | 3300044712 | Ga0453684_0008982 | Ga0453684_0008982_10137_11855 | 536 |
| 303 | 3300045051 | Ga0451576_0003836 | Ga0451576_0003836_14862_16580 | 536 |
| 304 | 3300049741 | Ga0501079_0050855 | Ga0501079_0050855_885_2570 | 536 |
| 305 | 3300050512 | nmdc:mga0n895_123396_c1 | nmdc:mga0n895_123396_c1_99_1784 | 536 |
| 306 | 3300050515 | nmdc:mga0a205_106816_c1 | nmdc:mga0a205_106816_c1_818_2503 | 536 |
| 307 | 3300053156 | Ga0500622_0012098 | Ga0500622_0012098_2227_3918 | 536 |
| 308 | 3300003203 | JGI25406J46586_10005453 | JGI25406J46586_100054535 | 537 |
| 309 | 3300005293 | Ga0065715_10125582 | Ga0065715_101255822 | 537 |
| 310 | 3300005329 | Ga0070683_100010034 | Ga0070683_1000100344 | 537 |
| 311 | 3300005330 | Ga0070690_100008225 | Ga0070690_1000082253 | 537 |
| 312 | 3300005336 | Ga0070680_100010880 | Ga0070680_1000108804 | 537 |
| 313 | 3300005340 | Ga0070689_100031342 | Ga0070689_1000313422 | 537 |
| 314 | 3300005353 | Ga0070669_100025108 | Ga0070669_1000251083 | 537 |
| 315 | 3300005365 | Ga0070688_100015583 | Ga0070688_1000155834 | 537 |
| 316 | 3300005438 | Ga0070701_10022640 | Ga0070701_100226403 | 537 |
| 317 | 3300005444 | Ga0070694_100013111 | Ga0070694_1000131113 | 537 |
| 318 | 3300005458 | Ga0070681_10001002 | Ga0070681_1000100218 | 537 |
| 319 | 3300005466 | Ga0070685_10004063 | Ga0070685_100040634 | 537 |
| 320 | 3300005471 | Ga0070698_100198590 | Ga0070698_1001985901 | 537 |
| 321 | 3300005535 | Ga0070684_100011241 | Ga0070684_1000112415 | 537 |
| 322 | 3300005546 | Ga0070696_100002552 | Ga0070696_1000025526 | 537 |
| 323 | 3300005546 | Ga0070696_100100952 | Ga0070696_1001009521 | 537 |
| 324 | 3300005617 | Ga0068859_100077737 | Ga0068859_1000777372 | 537 |
| 325 | 3300005617 | Ga0068859_100092494 | Ga0068859_1000924943 | 537 |
| 326 | 3300005618 | Ga0068864_100139556 | Ga0068864_1001395562 | 537 |
| 327 | 3300005841 | Ga0068863_100002643 | Ga0068863_1000026433 | 537 |
| 328 | 3300005841 | Ga0068863_100050945 | Ga0068863_1000509452 | 537 |
| 329 | 3300005985 | Ga0081539_10000075 | Ga0081539_1000007598 | 537 |
| 330 | 3300006931 | Ga0097620_100077735 | Ga0097620_1000777352 | 537 |
| 331 | 3300006931 | Ga0097620_100092499 | Ga0097620_1000924993 | 537 |
| 332 | 3300009176 | Ga0105242_10024568 | Ga0105242_100245682 | 537 |
| 333 | 3300013306 | Ga0163162_10037185 | Ga0163162_100371854 | 537 |
| 334 | 3300013306 | Ga0163162_10069363 | Ga0163162_100693634 | 537 |
| 335 | 3300013308 | Ga0157375_10009344 | Ga0157375_100093446 | 537 |
| 336 | 3300025923 | Ga0207681_10018912 | Ga0207681_100189123 | 537 |
| 337 | 3300025925 | Ga0207650_10046953 | Ga0207650_100469531 | 537 |
| 338 | 3300025934 | Ga0207686_10000998 | Ga0207686_1000099810 | 537 |
| 339 | 3300025934 | Ga0207686_10019648 | Ga0207686_100196481 | 537 |
| 340 | 3300025936 | Ga0207670_10003276 | Ga0207670_100032764 | 537 |
| 341 | 3300025936 | Ga0207670_10004819 | Ga0207670_100048192 | 537 |
| 342 | 3300025961 | Ga0207712_10002419 | Ga0207712_100024195 | 537 |
| 343 | 3300025961 | Ga0207712_10020414 | Ga0207712_100204142 | 537 |
| 344 | 3300025986 | Ga0207658_10047481 | Ga0207658_100474812 | 537 |
| 345 | 3300026075 | Ga0207708_10058078 | Ga0207708_100580782 | 537 |
| 346 | 3300026088 | Ga0207641_10000637 | Ga0207641_1000063715 | 537 |
| 347 | 3300026088 | Ga0207641_10033364 | Ga0207641_100333642 | 537 |
| 348 | 3300026095 | Ga0207676_10107257 | Ga0207676_101072572 | 537 |
| 349 | 3300026118 | Ga0207675_100002116 | Ga0207675_1000021168 | 537 |
| 350 | 3300028380 | Ga0268265_10086772 | Ga0268265_100867722 | 537 |
| 351 | 3300031238 | Ga0265332_10000647 | Ga0265332_100006472 | 537 |
| 352 | 3300035691 | Ga0373931_0011261 | Ga0373931_0011261_1354_3045 | 537 |
| 353 | 3300046459 | Ga0495629_0007537 | Ga0495629_0007537_6298_7989 | 537 |
| 354 | 3300048912 | Ga0496109_0057224 | Ga0496109_0057224_347_2038 | 537 |
| 355 | 3300048916 | Ga0496113_0016974 | Ga0496113_0016974_476_2167 | 537 |
| 356 | 3300050511 | nmdc:mga08y16_198652_c1 | nmdc:mga08y16_198652_c1_344_2032 | 537 |
| 357 | iso_pu_bacteria | 8055588893 | 8055589502 | 537 |
| 358 | 3300005293 | Ga0065715_10110885 | Ga0065715_101108852 | 538 |
| 359 | 3300005328 | Ga0070676_10002150 | Ga0070676_100021503 | 538 |
| 360 | 3300005328 | Ga0070676_10036538 | Ga0070676_100365382 | 538 |
| 361 | 3300005329 | Ga0070683_100023472 | Ga0070683_1000234722 | 538 |
| 362 | 3300005330 | Ga0070690_100091571 | Ga0070690_1000915711 | 538 |
| 363 | 3300005338 | Ga0068868_100033386 | Ga0068868_1000333862 | 538 |
| 364 | 3300005344 | Ga0070661_100004928 | Ga0070661_1000049285 | 538 |
| 365 | 3300005344 | Ga0070661_100005360 | Ga0070661_1000053605 | 538 |
| 366 | 3300005347 | Ga0070668_100044258 | Ga0070668_1000442582 | 538 |
| 367 | 3300005366 | Ga0070659_100005686 | Ga0070659_1000056862 | 538 |
| 368 | 3300005366 | Ga0070659_100030512 | Ga0070659_1000305122 | 538 |
| 369 | 3300005441 | Ga0070700_100076147 | Ga0070700_1000761471 | 538 |
| 370 | 3300005457 | Ga0070662_100001076 | Ga0070662_10000107611 | 538 |
| 371 | 3300005458 | Ga0070681_10000071 | Ga0070681_1000007136 | 538 |
| 372 | 3300005535 | Ga0070684_100005238 | Ga0070684_1000052385 | 538 |
| 373 | 3300005539 | Ga0068853_100016861 | Ga0068853_1000168614 | 538 |
| 374 | 3300005543 | Ga0070672_100010953 | Ga0070672_1000109533 | 538 |
| 375 | 3300005544 | Ga0070686_100014728 | Ga0070686_1000147282 | 538 |
| 376 | 3300005548 | Ga0070665_100013512 | Ga0070665_1000135129 | 538 |
| 377 | 3300005563 | Ga0068855_100042733 | Ga0068855_1000427333 | 538 |
| 378 | 3300005564 | Ga0070664_100002918 | Ga0070664_1000029187 | 538 |
| 379 | 3300005564 | Ga0070664_100007602 | Ga0070664_1000076025 | 538 |
| 380 | 3300005577 | Ga0068857_100000653 | Ga0068857_1000006536 | 538 |
| 381 | 3300005577 | Ga0068857_100003525 | Ga0068857_1000035257 | 538 |
| 382 | 3300005617 | Ga0068859_100120838 | Ga0068859_1001208383 | 538 |
| 383 | 3300005719 | Ga0068861_100030583 | Ga0068861_1000305833 | 538 |
| 384 | 3300005719 | Ga0068861_100076092 | Ga0068861_1000760922 | 538 |
| 385 | 3300005841 | Ga0068863_100096651 | Ga0068863_1000966511 | 538 |
| 386 | 3300005844 | Ga0068862_100005874 | Ga0068862_1000058746 | 538 |
| 387 | 3300006844 | Ga0075428_100117405 | Ga0075428_1001174053 | 538 |
| 388 | 3300006846 | Ga0075430_100008299 | Ga0075430_1000082991 | 538 |
| 389 | 3300006847 | Ga0075431_100117422 | Ga0075431_1001174223 | 538 |
| 390 | 3300006847 | Ga0075431_100197582 | Ga0075431_1001975822 | 538 |
| 391 | 3300006871 | Ga0075434_100004685 | Ga0075434_1000046858 | 538 |
| 392 | 3300006931 | Ga0097620_100120828 | Ga0097620_1001208283 | 538 |
| 393 | 3300009098 | Ga0105245_10093422 | Ga0105245_100934222 | 538 |
| 394 | 3300009147 | Ga0114129_10046425 | Ga0114129_100464252 | 538 |
| 395 | 3300013307 | Ga0157372_10060380 | Ga0157372_100603803 | 538 |
| 396 | 3300025298 | Ga0209050_1002617 | Ga0209050_10026174 | 538 |
| 397 | 3300025901 | Ga0207688_10008017 | Ga0207688_100080172 | 538 |
| 398 | 3300025907 | Ga0207645_10002232 | Ga0207645_100022323 | 538 |
| 399 | 3300025918 | Ga0207662_10032319 | Ga0207662_100323193 | 538 |
| 400 | 3300025920 | Ga0207649_10011854 | Ga0207649_100118543 | 538 |
| 401 | 3300025932 | Ga0207690_10039094 | Ga0207690_100390942 | 538 |
| 402 | 3300025933 | Ga0207706_10000494 | Ga0207706_1000049433 | 538 |
| 403 | 3300025936 | Ga0207670_10027340 | Ga0207670_100273402 | 538 |
| 404 | 3300025940 | Ga0207691_10000914 | Ga0207691_1000091420 | 538 |
| 405 | 3300025944 | Ga0207661_10015790 | Ga0207661_100157905 | 538 |
| 406 | 3300025945 | Ga0207679_10003308 | Ga0207679_100033085 | 538 |
| 407 | 3300025945 | Ga0207679_10007619 | Ga0207679_100076196 | 538 |
| 408 | 3300025949 | Ga0207667_10168859 | Ga0207667_101688592 | 538 |
| 409 | 3300026023 | Ga0207677_10015482 | Ga0207677_100154822 | 538 |
| 410 | 3300026035 | Ga0207703_10101179 | Ga0207703_101011792 | 538 |
| 411 | 3300026075 | Ga0207708_10009532 | Ga0207708_100095325 | 538 |
| 412 | 3300026089 | Ga0207648_10106021 | Ga0207648_101060213 | 538 |
| 413 | 3300026116 | Ga0207674_10001313 | Ga0207674_1000131314 | 538 |
| 414 | 3300026116 | Ga0207674_10001764 | Ga0207674_100017646 | 538 |
| 415 | 3300026118 | Ga0207675_100003210 | Ga0207675_10000321012 | 538 |
| 416 | 3300027907 | Ga0207428_10111494 | Ga0207428_101114942 | 538 |
| 417 | 3300028380 | Ga0268265_10079730 | Ga0268265_100797302 | 538 |
| 418 | 3300031456 | Ga0307513_10021988 | Ga0307513_100219885 | 538 |
| 419 | 3300031548 | Ga0307408_100006344 | Ga0307408_1000063444 | 538 |
| 420 | 3300031911 | Ga0307412_10011841 | Ga0307412_100118414 | 538 |
| 421 | 3300032002 | Ga0307416_100066279 | Ga0307416_1000662792 | 538 |
| 422 | 3300035170 | Ga0373943_0016519 | Ga0373943_0016519_1118_2827 | 538 |
| 423 | 3300046460 | Ga0495638_0000156 | Ga0495638_0000156_33360_35063 | 538 |
| 424 | 3300046473 | Ga0495582_0028223 | Ga0495582_0028223_826_2520 | 538 |
| 425 | 3300048924 | Ga0496121_0000007 | Ga0496121_0000007_149293_150969 | 538 |
| 426 | 3300050509 | nmdc:mga0qj67_25986_c1 | nmdc:mga0qj67_25986_c1_252_1946 | 538 |
| 427 | 3300050510 | nmdc:mga06r32_111989_c1 | nmdc:mga06r32_111989_c1_332_2035 | 538 |
| 428 | 3300050511 | nmdc:mga08y16_26164_c1 | nmdc:mga08y16_26164_c1_3469_5172 | 538 |
| 429 | 3300053153 | Ga0500616_0000082 | Ga0500616_0000082_182931_184634 | 538 |
| 430 | iso_pu_bacteria | 2738541283 | 2738757745 | 538 |
| 431 | iso_pu_bacteria | 2919186247 | 2919187297 | 538 |
| 432 | iso_pu_bacteria | 2939664404 | 2939665434 | 538 |
| 433 | 3300005288 | Ga0065714_10082178 | Ga0065714_100821782 | 539 |
| 434 | 3300005290 | Ga0065712_10000416 | Ga0065712_100004161 | 539 |
| 435 | 3300005293 | Ga0065715_10096001 | Ga0065715_100960013 | 539 |
| 436 | 3300005328 | Ga0070676_10016966 | Ga0070676_100169665 | 539 |
| 437 | 3300005330 | Ga0070690_100034686 | Ga0070690_1000346862 | 539 |
| 438 | 3300005331 | Ga0070670_100007329 | Ga0070670_1000073294 | 539 |
| 439 | 3300005336 | Ga0070680_100067420 | Ga0070680_1000674202 | 539 |
| 440 | 3300005340 | Ga0070689_100010729 | Ga0070689_1000107293 | 539 |
| 441 | 3300005343 | Ga0070687_100001730 | Ga0070687_1000017304 | 539 |
| 442 | 3300005344 | Ga0070661_100005947 | Ga0070661_1000059476 | 539 |
| 443 | 3300005353 | Ga0070669_100022394 | Ga0070669_1000223942 | 539 |
| 444 | 3300005354 | Ga0070675_100004866 | Ga0070675_1000048664 | 539 |
| 445 | 3300005354 | Ga0070675_100012020 | Ga0070675_1000120204 | 539 |
| 446 | 3300005367 | Ga0070667_100087642 | Ga0070667_1000876422 | 539 |
| 447 | 3300005440 | Ga0070705_100018376 | Ga0070705_1000183762 | 539 |
| 448 | 3300005456 | Ga0070678_100030744 | Ga0070678_1000307443 | 539 |
| 449 | 3300005457 | Ga0070662_100009132 | Ga0070662_1000091323 | 539 |
| 450 | 3300005466 | Ga0070685_10006602 | Ga0070685_100066023 | 539 |
| 451 | 3300005535 | Ga0070684_100023998 | Ga0070684_1000239984 | 539 |
| 452 | 3300005544 | Ga0070686_100001850 | Ga0070686_10000185010 | 539 |
| 453 | 3300005548 | Ga0070665_100017804 | Ga0070665_1000178042 | 539 |
| 454 | 3300005564 | Ga0070664_100017557 | Ga0070664_1000175576 | 539 |
| 455 | 3300005577 | Ga0068857_100007356 | Ga0068857_1000073565 | 539 |
| 456 | 3300005615 | Ga0070702_100037336 | Ga0070702_1000373362 | 539 |
| 457 | 3300005617 | Ga0068859_100047446 | Ga0068859_1000474463 | 539 |
| 458 | 3300005617 | Ga0068859_100060022 | Ga0068859_1000600224 | 539 |
| 459 | 3300005618 | Ga0068864_100006856 | Ga0068864_1000068564 | 539 |
| 460 | 3300005618 | Ga0068864_100007901 | Ga0068864_1000079012 | 539 |
| 461 | 3300005618 | Ga0068864_100017480 | Ga0068864_1000174803 | 539 |
| 462 | 3300005719 | Ga0068861_100013638 | Ga0068861_1000136384 | 539 |
| 463 | 3300005841 | Ga0068863_100002686 | Ga0068863_1000026867 | 539 |
| 464 | 3300005841 | Ga0068863_100034719 | Ga0068863_1000347192 | 539 |
| 465 | 3300005843 | Ga0068860_100096919 | Ga0068860_1000969192 | 539 |
| 466 | 3300005844 | Ga0068862_100011334 | Ga0068862_1000113346 | 539 |
| 467 | 3300005844 | Ga0068862_100014464 | Ga0068862_1000144643 | 539 |
| 468 | 3300006844 | Ga0075428_100009441 | Ga0075428_1000094414 | 539 |
| 469 | 3300006846 | Ga0075430_100001053 | Ga0075430_10000105314 | 539 |
| 470 | 3300006847 | Ga0075431_100011043 | Ga0075431_1000110439 | 539 |
| 471 | 3300006847 | Ga0075431_100014396 | Ga0075431_1000143967 | 539 |
| 472 | 3300006880 | Ga0075429_100000243 | Ga0075429_1000002437 | 539 |
| 473 | 3300006931 | Ga0097620_100047446 | Ga0097620_1000474463 | 539 |
| 474 | 3300006931 | Ga0097620_100060021 | Ga0097620_1000600214 | 539 |
| 475 | 3300009094 | Ga0111539_10040488 | Ga0111539_100404882 | 539 |
| 476 | 3300009098 | Ga0105245_10070023 | Ga0105245_100700232 | 539 |
| 477 | 3300009147 | Ga0114129_10000308 | Ga0114129_1000030848 | 539 |
| 478 | 3300009148 | Ga0105243_10030569 | Ga0105243_100305692 | 539 |
| 479 | 3300009553 | Ga0105249_10064315 | Ga0105249_100643153 | 539 |
| 480 | 3300009553 | Ga0105249_10162291 | Ga0105249_101622911 | 539 |
| 481 | 3300013308 | Ga0157375_10277080 | Ga0157375_102770802 | 539 |
| 482 | 3300014326 | Ga0157380_10104166 | Ga0157380_101041662 | 539 |
| 483 | 3300014968 | Ga0157379_10038215 | Ga0157379_100382154 | 539 |
| 484 | 3300025900 | Ga0207710_10001419 | Ga0207710_100014194 | 539 |
| 485 | 3300025901 | Ga0207688_10017774 | Ga0207688_100177742 | 539 |
| 486 | 3300025907 | Ga0207645_10057490 | Ga0207645_100574902 | 539 |
| 487 | 3300025908 | Ga0207643_10004176 | Ga0207643_100041762 | 539 |
| 488 | 3300025917 | Ga0207660_10047825 | Ga0207660_100478252 | 539 |
| 489 | 3300025918 | Ga0207662_10043131 | Ga0207662_100431313 | 539 |
| 490 | 3300025926 | Ga0207659_10003683 | Ga0207659_100036835 | 539 |
| 491 | 3300025926 | Ga0207659_10084408 | Ga0207659_100844081 | 539 |
| 492 | 3300025933 | Ga0207706_10051989 | Ga0207706_100519893 | 539 |
| 493 | 3300025933 | Ga0207706_10169891 | Ga0207706_101698911 | 539 |
| 494 | 3300025940 | Ga0207691_10030013 | Ga0207691_100300133 | 539 |
| 495 | 3300025942 | Ga0207689_10007182 | Ga0207689_100071826 | 539 |
| 496 | 3300025945 | Ga0207679_10028954 | Ga0207679_100289542 | 539 |
| 497 | 3300025960 | Ga0207651_10082060 | Ga0207651_100820601 | 539 |
| 498 | 3300025986 | Ga0207658_10046192 | Ga0207658_100461921 | 539 |
| 499 | 3300026075 | Ga0207708_10016241 | Ga0207708_100162413 | 539 |
| 500 | 3300026088 | Ga0207641_10032020 | Ga0207641_100320202 | 539 |
| 501 | 3300026089 | Ga0207648_10017045 | Ga0207648_100170453 | 539 |
| 502 | 3300026095 | Ga0207676_10004478 | Ga0207676_100044784 | 539 |
| 503 | 3300026095 | Ga0207676_10019563 | Ga0207676_100195632 | 539 |
| 504 | 3300026095 | Ga0207676_10020245 | Ga0207676_100202452 | 539 |
| 505 | 3300026116 | Ga0207674_10008347 | Ga0207674_100083478 | 539 |
| 506 | 3300026118 | Ga0207675_100003772 | Ga0207675_1000037729 | 539 |
| 507 | 3300026118 | Ga0207675_100033955 | Ga0207675_1000339552 | 539 |
| 508 | 3300026121 | Ga0207683_10017645 | Ga0207683_100176455 | 539 |
| 509 | 3300028379 | Ga0268266_10011305 | Ga0268266_100113052 | 539 |
| 510 | 3300028380 | Ga0268265_10020040 | Ga0268265_100200402 | 539 |
| 511 | 3300028380 | Ga0268265_10020727 | Ga0268265_100207273 | 539 |
| 512 | 3300048907 | Ga0496104_0029345 | Ga0496104_0029345_509_2191 | 539 |
| 513 | 3300048912 | Ga0496109_0013211 | Ga0496109_0013211_1724_3406 | 539 |
| 514 | 3300048916 | Ga0496113_0003993 | Ga0496113_0003993_3958_5640 | 539 |
| 515 | 3300050507 | nmdc:mga05p37_4977_c1 | nmdc:mga05p37_4977_c1_2561_4255 | 539 |
| 516 | 3300050508 | nmdc:mga09592_391_c1 | nmdc:mga09592_391_c1_27896_29590 | 539 |
| 517 | 3300050509 | nmdc:mga0qj67_905_c2 | nmdc:mga0qj67_905_c2_549_2243 | 539 |
| 518 | 3300050510 | nmdc:mga06r32_8273_c2 | nmdc:mga06r32_8273_c2_375_2069 | 539 |
| 519 | 3300050511 | nmdc:mga08y16_92063_c1 | nmdc:mga08y16_92063_c1_455_2149 | 539 |
| 520 | 3300005548 | Ga0070665_100117742 | Ga0070665_1001177422 | 540 |
| 521 | 3300005718 | Ga0068866_10016136 | Ga0068866_100161361 | 540 |
| 522 | 3300028380 | Ga0268265_10160067 | Ga0268265_101600671 | 540 |
| 523 | 3300036712 | Ga0316584_0052706 | Ga0316584_0052706_150_1871 | 540 |
| 524 | 3300046665 | Ga0495661_0021927 | Ga0495661_0021927_2161_3873 | 540 |
| 525 | 3300050510 | nmdc:mga06r32_41909_c1 | nmdc:mga06r32_41909_c1_305_2005 | 540 |
| 526 | iso_pu_bacteria | 2884791551 | 2884792077 | 540 |
| 527 | iso_pu_bacteria | 2929921140 | 2929924406 | 540 |
| 528 | iso_pu_bacteria | 8003151029 | 8003155366 | 540 |
| 529 | 3300006195 | Ga0075366_10000301 | Ga0075366_100003016 | 541 |
| 530 | 3300053080 | Ga0500635_0000557 | Ga0500635_0000557_3391_5103 | 541 |
| 531 | iso_pu_bacteria | 2818991460 | 2819678552 | 541 |
| 532 | iso_pu_bacteria | 2883068021 | 2883071972 | 541 |
| 533 | iso_pu_bacteria | 2884791551 | 2884794120 | 541 |
| 534 | iso_pu_bacteria | 2896109856 | 2896110748 | 541 |
| 535 | iso_pu_bacteria | 2896109856 | 2896111999 | 541 |
| 536 | 3300003323 | rootH1_10012634 | rootH1_100126349 | 542 |
| 537 | 3300003354 | JGI25160J50197_1004764 | JGI25160J50197_10047643 | 542 |
| 538 | 3300003354 | JGI25160J50197_1006581 | JGI25160J50197_10065812 | 542 |
| 539 | 3300003790 | Ga0055528_1001024 | Ga0055528_10010245 | 542 |
| 540 | 3300003791 | Ga0055530_10001218 | Ga0055530_1000121816 | 542 |
| 541 | 3300005262 | Ga0065165_1000228 | Ga0065165_100022849 | 542 |
| 542 | 3300005543 | Ga0070672_100016746 | Ga0070672_1000167463 | 542 |
| 543 | 3300005563 | Ga0068855_100001185 | Ga0068855_10000118514 | 542 |
| 544 | 3300005842 | Ga0068858_100036056 | Ga0068858_1000360562 | 542 |
| 545 | 3300006178 | Ga0075367_10007875 | Ga0075367_100078755 | 542 |
| 546 | 3300006844 | Ga0075428_100021993 | Ga0075428_1000219933 | 542 |
| 547 | 3300009093 | Ga0105240_10000022 | Ga0105240_1000002227 | 542 |
| 548 | 3300009094 | Ga0111539_10019310 | Ga0111539_100193103 | 542 |
| 549 | 3300009094 | Ga0111539_10089502 | Ga0111539_100895023 | 542 |
| 550 | 3300013104 | Ga0157370_10000132 | Ga0157370_1000013256 | 542 |
| 551 | 3300013297 | Ga0157378_10108845 | Ga0157378_101088452 | 542 |
| 552 | 3300014325 | Ga0163163_10006007 | Ga0163163_100060079 | 542 |
| 553 | 3300014497 | Ga0182008_10000954 | Ga0182008_100009545 | 542 |
| 554 | 3300014745 | Ga0157377_10001475 | Ga0157377_100014754 | 542 |
| 555 | 3300015261 | Ga0182006_1000418 | Ga0182006_100041816 | 542 |
| 556 | 3300025273 | Ga0209673_1000016 | Ga0209673_1000016163 | 542 |
| 557 | 3300025295 | Ga0209564_1011183 | Ga0209564_10111832 | 542 |
| 558 | 3300025295 | Ga0209564_1011455 | Ga0209564_10114552 | 542 |
| 559 | 3300025297 | Ga0209758_1007200 | Ga0209758_10072006 | 542 |
| 560 | 3300025297 | Ga0209758_1012031 | Ga0209758_10120312 | 542 |
| 561 | 3300025298 | Ga0209050_1000124 | Ga0209050_100012416 | 542 |
| 562 | 3300025302 | Ga0207426_1001572 | Ga0207426_10015729 | 542 |
| 563 | 3300025302 | Ga0207426_1001894 | Ga0207426_100189410 | 542 |
| 564 | 3300025913 | Ga0207695_10000022 | Ga0207695_10000022492 | 542 |
| 565 | 3300025913 | Ga0207695_10071704 | Ga0207695_100717043 | 542 |
| 566 | 3300025940 | Ga0207691_10020187 | Ga0207691_100201873 | 542 |
| 567 | 3300026035 | Ga0207703_10024730 | Ga0207703_100247301 | 542 |
| 568 | 3300028794 | Ga0307515_10001652 | Ga0307515_100016529 | 542 |
| 569 | 3300031251 | Ga0265327_10023360 | Ga0265327_100233603 | 542 |
| 570 | 3300046558 | Ga0495633_0000176 | Ga0495633_0000176_45642_47342 | 542 |
| 571 | 3300048912 | Ga0496109_0028307 | Ga0496109_0028307_594_2297 | 542 |
| 572 | 3300048925 | Ga0496122_0001437 | Ga0496122_0001437_24370_26061 | 542 |
| 573 | 3300048926 | Ga0496123_0003831 | Ga0496123_0003831_6553_8244 | 542 |
| 574 | 3300050511 | nmdc:mga08y16_36100_c1 | nmdc:mga08y16_36100_c1_3218_4909 | 542 |
| 575 | 3300053131 | Ga0500652_005630 | Ga0500652_005630_1267_2964 | 542 |
| 576 | 3300003316 | rootH1_10015726 | rootH1_100157266 | 543 |
| 577 | 3300003320 | rootH2_10005324 | rootH2_1000532436 | 543 |
| 578 | 3300003320 | rootH2_10009745 | rootH2_100097452 | 543 |
| 579 | 3300003322 | rootL2_10107065 | rootL2_101070652 | 543 |
| 580 | 3300003322 | rootL2_10369576 | rootL2_103695762 | 543 |
| 581 | 3300003323 | rootH1_10000238 | rootH1_100002382 | 543 |
| 582 | 3300003323 | rootH1_10002552 | rootH1_100025526 | 543 |
| 583 | 3300003323 | rootH1_10002735 | rootH1_100027358 | 543 |
| 584 | 3300003323 | rootH1_10007412 | rootH1_1000741233 | 543 |
| 585 | 3300003323 | rootH1_10028939 | rootH1_100289393 | 543 |
| 586 | 3300003354 | JGI25160J50197_1000376 | JGI25160J50197_100037611 | 543 |
| 587 | 3300005329 | Ga0070683_100005706 | Ga0070683_1000057062 | 543 |
| 588 | 3300005331 | Ga0070670_100112112 | Ga0070670_1001121121 | 543 |
| 589 | 3300005335 | Ga0070666_10007985 | Ga0070666_100079852 | 543 |
| 590 | 3300005340 | Ga0070689_100113340 | Ga0070689_1001133402 | 543 |
| 591 | 3300005353 | Ga0070669_100016316 | Ga0070669_1000163162 | 543 |
| 592 | 3300005354 | Ga0070675_100018198 | Ga0070675_1000181983 | 543 |
| 593 | 3300005364 | Ga0070673_100011320 | Ga0070673_1000113203 | 543 |
| 594 | 3300005367 | Ga0070667_100067050 | Ga0070667_1000670501 | 543 |
| 595 | 3300005457 | Ga0070662_100008148 | Ga0070662_1000081484 | 543 |
| 596 | 3300005459 | Ga0068867_100057109 | Ga0068867_1000571091 | 543 |
| 597 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008210 | 543 |
| 598 | 3300005563 | Ga0068855_100029754 | Ga0068855_1000297545 | 543 |
| 599 | 3300005564 | Ga0070664_100117651 | Ga0070664_1001176511 | 543 |
| 600 | 3300005577 | Ga0068857_100047826 | Ga0068857_1000478263 | 543 |
| 601 | 3300005614 | Ga0068856_100058180 | Ga0068856_1000581802 | 543 |
| 602 | 3300005616 | Ga0068852_100017709 | Ga0068852_1000177093 | 543 |
| 603 | 3300005617 | Ga0068859_100000041 | Ga0068859_100000041102 | 543 |
| 604 | 3300005617 | Ga0068859_100008581 | Ga0068859_1000085816 | 543 |
| 605 | 3300005618 | Ga0068864_100012222 | Ga0068864_1000122222 | 543 |
| 606 | 3300005719 | Ga0068861_100005205 | Ga0068861_1000052056 | 543 |
| 607 | 3300005841 | Ga0068863_100003228 | Ga0068863_1000032289 | 543 |
| 608 | 3300005841 | Ga0068863_100171856 | Ga0068863_1001718561 | 543 |
| 609 | 3300005843 | Ga0068860_100000029 | Ga0068860_10000002958 | 543 |
| 610 | 3300005843 | Ga0068860_100008154 | Ga0068860_10000815410 | 543 |
| 611 | 3300005843 | Ga0068860_100009116 | Ga0068860_10000911610 | 543 |
| 612 | 3300005843 | Ga0068860_100012595 | Ga0068860_1000125958 | 543 |
| 613 | 3300005844 | Ga0068862_100052186 | Ga0068862_1000521863 | 543 |
| 614 | 3300005985 | Ga0081539_10034692 | Ga0081539_100346921 | 543 |
| 615 | 3300006195 | Ga0075366_10005936 | Ga0075366_100059362 | 543 |
| 616 | 3300006237 | Ga0097621_100013313 | Ga0097621_1000133134 | 543 |
| 617 | 3300006237 | Ga0097621_100046232 | Ga0097621_1000462322 | 543 |
| 618 | 3300006358 | Ga0068871_100005674 | Ga0068871_1000056747 | 543 |
| 619 | 3300006931 | Ga0097620_100000041 | Ga0097620_10000004161 | 543 |
| 620 | 3300006931 | Ga0097620_100008581 | Ga0097620_1000085818 | 543 |
| 621 | 3300009093 | Ga0105240_10005775 | Ga0105240_100057752 | 543 |
| 622 | 3300009094 | Ga0111539_10003619 | Ga0111539_1000361911 | 543 |
| 623 | 3300009174 | Ga0105241_10020357 | Ga0105241_100203572 | 543 |
| 624 | 3300009174 | Ga0105241_10049452 | Ga0105241_100494522 | 543 |
| 625 | 3300009545 | Ga0105237_10003342 | Ga0105237_100033429 | 543 |
| 626 | 3300009545 | Ga0105237_10035161 | Ga0105237_100351613 | 543 |
| 627 | 3300010375 | Ga0105239_10077390 | Ga0105239_100773902 | 543 |
| 628 | 3300010375 | Ga0105239_10112386 | Ga0105239_101123862 | 543 |
| 629 | 3300011119 | Ga0105246_10064207 | Ga0105246_100642072 | 543 |
| 630 | 3300013104 | Ga0157370_10038907 | Ga0157370_100389073 | 543 |
| 631 | 3300013296 | Ga0157374_10050474 | Ga0157374_100504742 | 543 |
| 632 | 3300013297 | Ga0157378_10003189 | Ga0157378_1000318912 | 543 |
| 633 | 3300013297 | Ga0157378_10041154 | Ga0157378_100411542 | 543 |
| 634 | 3300013306 | Ga0163162_10000038 | Ga0163162_1000003837 | 543 |
| 635 | 3300013306 | Ga0163162_10000546 | Ga0163162_1000054626 | 543 |
| 636 | 3300013306 | Ga0163162_10006412 | Ga0163162_100064124 | 543 |
| 637 | 3300013308 | Ga0157375_10071752 | Ga0157375_100717522 | 543 |
| 638 | 3300013308 | Ga0157375_10262369 | Ga0157375_102623691 | 543 |
| 639 | 3300014326 | Ga0157380_10003457 | Ga0157380_100034574 | 543 |
| 640 | 3300014326 | Ga0157380_10074202 | Ga0157380_100742021 | 543 |
| 641 | 3300014745 | Ga0157377_10000700 | Ga0157377_1000070011 | 543 |
| 642 | 3300014745 | Ga0157377_10003779 | Ga0157377_100037792 | 543 |
| 643 | 3300014969 | Ga0157376_10007058 | Ga0157376_100070589 | 543 |
| 644 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026435 | 543 |
| 645 | 3300025903 | Ga0207680_10000029 | Ga0207680_1000002940 | 543 |
| 646 | 3300025908 | Ga0207643_10068925 | Ga0207643_100689251 | 543 |
| 647 | 3300025913 | Ga0207695_10000686 | Ga0207695_1000068616 | 543 |
| 648 | 3300025914 | Ga0207671_10008328 | Ga0207671_100083283 | 543 |
| 649 | 3300025923 | Ga0207681_10009868 | Ga0207681_100098683 | 543 |
| 650 | 3300025927 | Ga0207687_10036322 | Ga0207687_100363222 | 543 |
| 651 | 3300025933 | Ga0207706_10008493 | Ga0207706_100084939 | 543 |
| 652 | 3300025942 | Ga0207689_10002450 | Ga0207689_100024507 | 543 |
| 653 | 3300025942 | Ga0207689_10039516 | Ga0207689_100395162 | 543 |
| 654 | 3300025945 | Ga0207679_10058235 | Ga0207679_100582352 | 543 |
| 655 | 3300025949 | Ga0207667_10005713 | Ga0207667_1000571313 | 543 |
| 656 | 3300025972 | Ga0207668_10010298 | Ga0207668_100102984 | 543 |
| 657 | 3300025986 | Ga0207658_10137665 | Ga0207658_101376652 | 543 |
| 658 | 3300026078 | Ga0207702_10049621 | Ga0207702_100496212 | 543 |
| 659 | 3300026088 | Ga0207641_10000044 | Ga0207641_10000044114 | 543 |
| 660 | 3300026089 | Ga0207648_10104438 | Ga0207648_101044382 | 543 |
| 661 | 3300026116 | Ga0207674_10003326 | Ga0207674_100033267 | 543 |
| 662 | 3300026118 | Ga0207675_100000051 | Ga0207675_10000005153 | 543 |
| 663 | 3300026142 | Ga0207698_10049230 | Ga0207698_100492302 | 543 |
| 664 | 3300026142 | Ga0207698_10051247 | Ga0207698_100512472 | 543 |
| 665 | 3300027907 | Ga0207428_10013362 | Ga0207428_100133626 | 543 |
| 666 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016208 | 543 |
| 667 | 3300028379 | Ga0268266_10107275 | Ga0268266_101072752 | 543 |
| 668 | 3300028380 | Ga0268265_10018882 | Ga0268265_100188823 | 543 |
| 669 | 3300028381 | Ga0268264_10000072 | Ga0268264_1000007259 | 543 |
| 670 | 3300028381 | Ga0268264_10017550 | Ga0268264_100175501 | 543 |
| 671 | 3300028381 | Ga0268264_10098967 | Ga0268264_100989671 | 543 |
| 672 | 3300028381 | Ga0268264_10168024 | Ga0268264_101680242 | 543 |
| 673 | 3300031251 | Ga0265327_10004167 | Ga0265327_100041673 | 543 |
| 674 | 3300031507 | Ga0307509_10021227 | Ga0307509_100212272 | 543 |
| 675 | 3300031712 | Ga0265342_10031964 | Ga0265342_100319642 | 543 |
| 676 | 3300032004 | Ga0307414_10083559 | Ga0307414_100835592 | 543 |
| 677 | 3300046460 | Ga0495638_0000004 | Ga0495638_0000004_678571_680265 | 543 |
| 678 | 3300046524 | Ga0495648_0000348 | Ga0495648_0000348_4165_5865 | 543 |
| 679 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_326379_328079 | 543 |
| 680 | 3300048915 | Ga0496112_0064120 | Ga0496112_0064120_1214_2929 | 543 |
| 681 | 3300048918 | Ga0496115_0015939 | Ga0496115_0015939_1395_3095 | 543 |
| 682 | 3300049670 | Ga0501236_000136 | Ga0501236_000136_288_1982 | 543 |
| 683 | 3300049675 | Ga0501243_000825 | Ga0501243_000825_401_2101 | 543 |
| 684 | 3300049688 | Ga0501259_001854 | Ga0501259_001854_1234_2934 | 543 |
| 685 | 3300049761 | Ga0501264_000168 | Ga0501264_000168_4514_6208 | 543 |
| 686 | 3300050511 | nmdc:mga08y16_33730_c1 | nmdc:mga08y16_33730_c1_1334_3028 | 543 |
| 687 | 3300053088 | Ga0500644_0001758 | Ga0500644_0001758_1229_2923 | 543 |
| 688 | 3300053092 | Ga0500583_0000927 | Ga0500583_0000927_3812_5512 | 543 |
| 689 | 3300053105 | Ga0500557_002379 | Ga0500557_002379_452_2146 | 543 |
| 690 | 3300053139 | Ga0500568_0007246 | Ga0500568_0007246_1204_2904 | 543 |
| 691 | 3300053151 | Ga0500604_0012502 | Ga0500604_0012502_423_2117 | 543 |
| 692 | 3300053153 | Ga0500616_0000015 | Ga0500616_0000015_150581_152275 | 543 |
| 693 | 3300053153 | Ga0500616_0015760 | Ga0500616_0015760_2323_4017 | 543 |
| 694 | 3300053156 | Ga0500622_0000009 | Ga0500622_0000009_413318_415012 | 543 |
| 695 | 3300053156 | Ga0500622_0000096 | Ga0500622_0000096_7531_9225 | 543 |
| 696 | 3300053156 | Ga0500622_0003253 | Ga0500622_0003253_2386_4080 | 543 |
| 697 | iso_pu_bacteria | 2896109856 | 2896110363 | 543 |
| 698 | 3300013100 | Ga0157373_10003763 | Ga0157373_100037637 | 544 |
| 699 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002913 | 544 |
| 700 | 3300048917 | Ga0496114_0092553 | Ga0496114_0092553_347_2050 | 544 |
| 701 | iso_pu_bacteria | 2884791551 | 2884792078 | 544 |
| 702 | iso_pu_bacteria | 2929177148 | 2929181941 | 544 |
| 703 | iso_pu_bacteria | 2929921140 | 2929924407 | 544 |
| 704 | iso_pu_bacteria | 2945977869 | 2945977879 | 544 |
| 705 | iso_pu_bacteria | 2946013367 | 2946016270 | 544 |
| 706 | iso_pu_bacteria | 8003151029 | 8003155365 | 544 |
| 707 | 3300005289 | Ga0065704_10113484 | Ga0065704_101134841 | 545 |
| 708 | 3300013308 | Ga0157375_10031471 | Ga0157375_100314715 | 545 |
| 709 | 3300031616 | Ga0307508_10005018 | Ga0307508_100050186 | 545 |
| 710 | 3300031665 | Ga0316575_10000740 | Ga0316575_100007405 | 545 |
| 711 | 3300047320 | Ga0495672_0075408 | Ga0495672_0075408_128_1852 | 545 |
| 712 | 3300031731 | Ga0307405_10035592 | Ga0307405_100355923 | 546 |
| 713 | 3300031824 | Ga0307413_10002877 | Ga0307413_100028775 | 546 |
| 714 | 3300031995 | Ga0307409_100041559 | Ga0307409_1000415592 | 546 |
| 715 | 3300042876 | Ga0451577_0059330 | Ga0451577_0059330_1426_3123 | 546 |
| 716 | 3300044712 | Ga0453684_0007730 | Ga0453684_0007730_1364_3061 | 546 |
| 717 | 3300045051 | Ga0451576_0067534 | Ga0451576_0067534_1188_2885 | 546 |
| 718 | 3300048911 | Ga0496108_0122397 | Ga0496108_0122397_478_2202 | 546 |
| 719 | 3300005334 | Ga0068869_100064614 | Ga0068869_1000646142 | 547 |
| 720 | 3300005347 | Ga0070668_100039649 | Ga0070668_1000396492 | 547 |
| 721 | 3300005353 | Ga0070669_100110698 | Ga0070669_1001106982 | 547 |
| 722 | 3300005456 | Ga0070678_100019043 | Ga0070678_1000190431 | 547 |
| 723 | 3300005459 | Ga0068867_100070014 | Ga0068867_1000700142 | 547 |
| 724 | 3300005548 | Ga0070665_100028807 | Ga0070665_1000288073 | 547 |
| 725 | 3300006237 | Ga0097621_100114411 | Ga0097621_1001144111 | 547 |
| 726 | 3300006358 | Ga0068871_100029795 | Ga0068871_1000297953 | 547 |
| 727 | 3300011119 | Ga0105246_10033596 | Ga0105246_100335962 | 547 |
| 728 | 3300025942 | Ga0207689_10006705 | Ga0207689_100067052 | 547 |
| 729 | 3300026089 | Ga0207648_10002156 | Ga0207648_1000215620 | 547 |
| 730 | 3300026121 | Ga0207683_10027125 | Ga0207683_100271253 | 547 |
| 731 | 3300028379 | Ga0268266_10023629 | Ga0268266_100236292 | 547 |
| 732 | 3300001979 | JGI24740J21852_10007451 | JGI24740J21852_100074512 | 548 |
| 733 | 3300002738 | JGI25154J39366_1000012 | JGI25154J39366_100001272 | 548 |
| 734 | 3300003354 | JGI25160J50197_1004764 | JGI25160J50197_10047642 | 548 |
| 735 | 3300003794 | Ga0055531_10000357 | Ga0055531_1000035726 | 548 |
| 736 | 3300025246 | Ga0209646_1000009 | Ga0209646_1000009202 | 548 |
| 737 | 3300025250 | Ga0209026_1000197 | Ga0209026_100019714 | 548 |
| 738 | 3300025297 | Ga0209758_1007200 | Ga0209758_10072007 | 548 |
| 739 | 3300025302 | Ga0207426_1001572 | Ga0207426_10015728 | 548 |
| 740 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013606 | 548 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bke-assembly1.cif.gz_a | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodisulfide reductase core and mobile arm in conformational state 2, composite structure) | 1 | 14 | 44 |
| 4yry-assembly2.cif.gz_D | insights into flavin-based electron bifurcation via the nadh-dependent reduced ferredoxin-nadp oxidoreductase structure | 0.9927 | 14 | 44 |
| 3f8d-assembly2.cif.gz_D | structure of sulfolobus solfataricus thioredoxin reductase mutant c147a | 0.9802 | 12 | 41 |
| 3ado-assembly1.cif.gz_A | crystal structure of the rabbit l-gulonate 3-dehydrogenase | 0.9798 | 14 | 41 |
| 3f8r-assembly2.cif.gz_D | crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules | 0.9774 | 12 | 41 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zn0A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9854 | 11 | 43 | 3.50.50.60 |
| 3k30B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9839 | 14 | 44 | 3.40.50.720 |
| 2q7vB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9808 | 11 | 44 | 3.50.50.60 |
| af_Q2G041_6_109_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9806 | 14 | 44 | 3.50.50.60 |
| 3f8dD01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9802 | 12 | 41 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K1LUE5-F1-model_v4 | Gluconate 2-dehydrogenase flavoprotein (EC 1.1.99.3) | 0.9883 | 408 | 543 |
GO:0033717
|
| AF-A0A4Q6A5P3-F1-model_v4 | GMC family oxidoreductase | 0.9865 | 9 | 308 |
GO:0016614
GO:0050660 |
| AF-A0A426H6A0-F1-model_v4 | deleted | 0.9848 | 10 | 325 |
|
| AF-A0A2T2YPS2-F1-model_v4 | GMC family oxidoreductase | 0.9812 | 23 | 548 |
GO:0016614
GO:0050660 |
| AF-A0A3D1I3S0-F1-model_v4 | deleted | 0.9811 | 46 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar