F478504

General Info

Members Datasets Scaffolds Average Seq Length
740 289 711 560

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10012634|rootH1_100126349
Length 603
Sequence MHHGIPGCLLAPLQPPIPIILPRSFIFPIFLVINSTCMINLNLKTKAQHTFDAIVVGSGISGGWAAKELCEKGLKVLLLERGRQLEHIKDYTTATQAPWETPHRGRLTPAQKKEHPYLIRERVYSEFNESYWLKDTDSPYTEKKRFDWARADIVGGRSIMWGRGSLRLSDLDFEANAKEGVGIDWPIRYKDLAPWYDHVEAFAGISGQAEGLPHLPDGVFQPPMEMNCFEKEVKARIEKAFPERRMTIFRTANLTQPIGDRGKCQYRDRCARGCPFGAYFSSQSSTLPAAVKTGNLTLQTDAIVNSIIYDESKGKATGVCVIDKHTKAITEYFARIIFLNASTLGSTFVLMNSVSNRFPQGIGNDHGVLGHYLMDHHFHAGASGISEEFGDKYYYGQRPAGFYIPRFRNIGADKRSYRRGFGYTGYSSRTGWSRGIAELGIGGAFKDYLTEPGPWQMGLMGFGECLPYEENQVTLDHSIKDAWGQPVLQFNCEFKDNERQMRKDMDQDAAAMLEAAGLKNVTPFNRDSYPGMAIHEMGTARMGRDPRTSVLNEWNQVHTAKNIFVTDGACMTSSACQNPSLTYMALTARAADHAVKELKRQQL

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
11 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
12 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
13 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
14 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
15 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
16 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
17 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
259 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
260 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
261 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
289 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 0
Rhizoplane 1.49
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 5.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007451 3300001979 Bacteria 4450
2 JGI25154J39366_1000012 3300002738 Bacteria 287601
3 JGI25406J46586_10005453 3300003203 Bacteria 5899
4 rootH1_10015726 3300003316 Bacteria 11114
5 rootH1_10033153 3300003316 Bacteria 2179
6 rootH1_10077515 3300003316 Bacteria 6712
7 rootH2_10005324 3300003320 Bacteria 32959
8 rootH2_10009145 3300003320 Bacteria 43855
9 rootH2_10009745 3300003320 Bacteria 3229
10 rootH2_10012490 3300003320 Bacteria 41263
11 rootL2_10107065 3300003322 Bacteria 5848
12 rootL2_10174960 3300003322 Bacteria 6928
13 rootL2_10369576 3300003322 Bacteria 2887
14 rootH1_10000238 3300003323 Bacteria 3953
15 rootH1_10002552 3300003323 Bacteria 44831
16 rootH1_10002735 3300003323 Bacteria 11152
17 rootH1_10007412 3300003323 Bacteria 54111
18 rootH1_10012634 3300003323 Bacteria 10441
19 rootH1_10028939 3300003323 Bacteria 5416
20 JGI25160J50197_1000376 3300003354 Bacteria 29172
21 JGI25160J50197_1004764 3300003354 Bacteria 5792
22 JGI25160J50197_1006581 3300003354 Bacteria 4681
23 Ga0055528_1001024 3300003790 Bacteria 18512
24 Ga0055530_10001218 3300003791 Bacteria 19831
25 Ga0055531_10000357 3300003794 Bacteria 44649
26 Ga0055531_10000426 3300003794 Bacteria 40008
27 Ga0055531_10000559 3300003794 Bacteria 32705
28 Ga0065165_1000228 3300005262 Bacteria 98736
29 Ga0065165_1000639 3300005262 Bacteria 50701
30 Ga0065714_10082178 3300005288 Unclassified 2325
31 Ga0065704_10076316 3300005289 Bacteria 5168
32 Ga0065704_10113484 3300005289 Bacteria 1889
33 Ga0065712_10000416 3300005290 Bacteria 19580
34 Ga0065712_10070193 3300005290 Bacteria 6240
35 Ga0065715_10096001 3300005293 Bacteria 3963
36 Ga0065715_10110885 3300005293 Bacteria 2584
37 Ga0065715_10125582 3300005293 Bacteria 2127
38 Ga0070658_10002413 3300005327 Bacteria 15642
39 Ga0070676_10002150 3300005328 Bacteria 10035
40 Ga0070676_10004885 3300005328 Bacteria 7102
41 Ga0070676_10016966 3300005328 Bacteria 4026
42 Ga0070676_10036538 3300005328 Bacteria 2831
43 Ga0070683_100005706 3300005329 Bacteria 10399
44 Ga0070683_100005920 3300005329 Bacteria 10233
45 Ga0070683_100010034 3300005329 Bacteria 8123
46 Ga0070683_100023472 3300005329 Bacteria 5517
47 Ga0070683_100023539 3300005329 Bacteria 5509
48 Ga0070683_100037872 3300005329 Bacteria 4417
49 Ga0070690_100001727 3300005330 Bacteria 11537
50 Ga0070690_100008225 3300005330 Bacteria 6001
51 Ga0070690_100034686 3300005330 Bacteria 3162
52 Ga0070690_100043945 3300005330 Bacteria 2835
53 Ga0070690_100057098 3300005330 Bacteria 2505
54 Ga0070690_100091571 3300005330 Bacteria 2003
55 Ga0070670_100007329 3300005331 Bacteria 9362
56 Ga0070670_100112112 3300005331 Bacteria 2350
57 Ga0068869_100048943 3300005334 Bacteria 3059
58 Ga0068869_100064614 3300005334 Bacteria 2692
59 Ga0070666_10003057 3300005335 Bacteria 10158
60 Ga0070666_10007985 3300005335 Bacteria 6543
61 Ga0070680_100010880 3300005336 Bacteria 7027
62 Ga0070680_100067420 3300005336 Bacteria 2935
63 Ga0068868_100002272 3300005338 Bacteria 13287
64 Ga0068868_100033386 3300005338 Bacteria 3966
65 Ga0068868_100073887 3300005338 Bacteria 2723
66 Ga0068868_100077996 3300005338 Bacteria 2651
67 Ga0070689_100010729 3300005340 Bacteria 6541
68 Ga0070689_100015800 3300005340 Bacteria 5514
69 Ga0070689_100031342 3300005340 Bacteria 4040
70 Ga0070689_100113340 3300005340 Bacteria 2159
71 Ga0070687_100001730 3300005343 Bacteria 7852
72 Ga0070661_100000277 3300005344 Bacteria 41446
73 Ga0070661_100004928 3300005344 Bacteria 9190
74 Ga0070661_100005360 3300005344 Bacteria 8843
75 Ga0070661_100005947 3300005344 Bacteria 8402
76 Ga0070668_100032892 3300005347 Bacteria 3947
77 Ga0070668_100039649 3300005347 Bacteria 3601
78 Ga0070668_100044258 3300005347 Bacteria 3415
79 Ga0070669_100016316 3300005353 Bacteria 5299
80 Ga0070669_100022394 3300005353 Bacteria 4517
81 Ga0070669_100025108 3300005353 Bacteria 4279
82 Ga0070669_100110698 3300005353 Bacteria 2084
83 Ga0070675_100004866 3300005354 Bacteria 10250
84 Ga0070675_100012020 3300005354 Bacteria 6786
85 Ga0070675_100018198 3300005354 Bacteria 5591
86 Ga0070675_100163355 3300005354 Bacteria 1917
87 Ga0070671_100040595 3300005355 Bacteria 3866
88 Ga0070671_100164935 3300005355 Bacteria 1873
89 Ga0070673_100011320 3300005364 Bacteria 6083
90 Ga0070688_100015583 3300005365 Bacteria 4330
91 Ga0070688_100017477 3300005365 Bacteria 4117
92 Ga0070659_100005686 3300005366 Bacteria 8970
93 Ga0070659_100030512 3300005366 Bacteria 4172
94 Ga0070667_100017378 3300005367 Bacteria 5961
95 Ga0070667_100067050 3300005367 Bacteria 3050
96 Ga0070667_100087642 3300005367 Bacteria 2672
97 Ga0070701_10016630 3300005438 Bacteria 3425
98 Ga0070701_10022640 3300005438 Bacteria 3014
99 Ga0070705_100018376 3300005440 Bacteria 3664
100 Ga0070700_100076147 3300005441 Bacteria 2154
101 Ga0070694_100013111 3300005444 Bacteria 5171
102 Ga0070678_100019043 3300005456 Bacteria 4464
103 Ga0070678_100030744 3300005456 Bacteria 3695
104 Ga0070662_100001076 3300005457 Bacteria 16637
105 Ga0070662_100008148 3300005457 Bacteria 6828
106 Ga0070662_100009132 3300005457 Bacteria 6473
107 Ga0070662_100019703 3300005457 Bacteria 4583
108 Ga0070662_100020503 3300005457 Bacteria 4501
109 Ga0070681_10000071 3300005458 Bacteria 74708
110 Ga0070681_10001002 3300005458 Bacteria 23932
111 Ga0068867_100057109 3300005459 Bacteria 2890
112 Ga0068867_100070014 3300005459 Bacteria 2621
113 Ga0070685_10004063 3300005466 Bacteria 7390
114 Ga0070685_10006602 3300005466 Bacteria 5920
115 Ga0070685_10010649 3300005466 Bacteria 4785
116 Ga0070685_10011895 3300005466 Bacteria 4564
117 Ga0070698_100198590 3300005471 Bacteria 1942
118 Ga0070684_100000773 3300005535 Bacteria 22194
119 Ga0070684_100005238 3300005535 Bacteria 9921
120 Ga0070684_100011241 3300005535 Bacteria 7127
121 Ga0070684_100023998 3300005535 Bacteria 5110
122 Ga0070697_100034646 3300005536 Bacteria 4071
123 Ga0068853_100014216 3300005539 Bacteria 6513
124 Ga0068853_100016861 3300005539 Bacteria 6018
125 Ga0070672_100010953 3300005543 Bacteria 6309
126 Ga0070672_100016746 3300005543 Bacteria 5256
127 Ga0070686_100001850 3300005544 Bacteria 11804
128 Ga0070686_100014728 3300005544 Bacteria 4513
129 Ga0070695_100008303 3300005545 Bacteria 6162
130 Ga0070696_100001683 3300005546 Bacteria 14485
131 Ga0070696_100002552 3300005546 Bacteria 12068
132 Ga0070696_100100952 3300005546 Bacteria 2068
133 Ga0070665_100000008 3300005548 Bacteria 606341
134 Ga0070665_100013512 3300005548 Bacteria 8213
135 Ga0070665_100017804 3300005548 Bacteria 7133
136 Ga0070665_100028807 3300005548 Bacteria 5591
137 Ga0070665_100100081 3300005548 Bacteria 2903
138 Ga0070665_100117742 3300005548 Bacteria 2659
139 Ga0070665_100204701 3300005548 Bacteria 1974
140 Ga0070704_100034290 3300005549 Bacteria 3440
141 Ga0068855_100001185 3300005563 Bacteria 32417
142 Ga0068855_100029754 3300005563 Bacteria 6530
143 Ga0068855_100037991 3300005563 Bacteria 5723
144 Ga0068855_100042733 3300005563 Bacteria 5371
145 Ga0070664_100002918 3300005564 Bacteria 13840
146 Ga0070664_100007602 3300005564 Bacteria 8752
147 Ga0070664_100008983 3300005564 Bacteria 8104
148 Ga0070664_100017557 3300005564 Bacteria 5877
149 Ga0070664_100117651 3300005564 Bacteria 2324
150 Ga0068857_100000653 3300005577 Bacteria 25587
151 Ga0068857_100003006 3300005577 Bacteria 13919
152 Ga0068857_100003443 3300005577 Bacteria 13201
153 Ga0068857_100003525 3300005577 Bacteria 13080
154 Ga0068857_100007356 3300005577 Bacteria 9479
155 Ga0068857_100014247 3300005577 Bacteria 6927
156 Ga0068857_100017670 3300005577 Bacteria 6254
157 Ga0068857_100047826 3300005577 Bacteria 3798
158 Ga0068854_100006457 3300005578 Bacteria 7461
159 Ga0068854_100019492 3300005578 Bacteria 4573
160 Ga0068856_100058180 3300005614 Bacteria 3817
161 Ga0068856_100063625 3300005614 Bacteria 3645
162 Ga0070702_100036762 3300005615 Bacteria 2715
163 Ga0070702_100037336 3300005615 Bacteria 2698
164 Ga0068852_100001717 3300005616 Bacteria 14926
165 Ga0068852_100005907 3300005616 Bacteria 8803
166 Ga0068852_100017709 3300005616 Bacteria 5596
167 Ga0068852_100049772 3300005616 Bacteria 3587
168 Ga0068852_100128349 3300005616 Bacteria 2332
169 Ga0068859_100000041 3300005617 Bacteria 162415
170 Ga0068859_100008581 3300005617 Bacteria 10332
171 Ga0068859_100017056 3300005617 Bacteria 7290
172 Ga0068859_100047446 3300005617 Bacteria 4315
173 Ga0068859_100060022 3300005617 Bacteria 3832
174 Ga0068859_100077737 3300005617 Bacteria 3359
175 Ga0068859_100092494 3300005617 Bacteria 3075
176 Ga0068859_100120838 3300005617 Bacteria 2686
177 Ga0068859_100161312 3300005617 Bacteria 2321
178 Ga0068864_100002580 3300005618 Bacteria 14961
179 Ga0068864_100006856 3300005618 Bacteria 9333
180 Ga0068864_100007901 3300005618 Bacteria 8764
181 Ga0068864_100012222 3300005618 Bacteria 7095
182 Ga0068864_100017480 3300005618 Bacteria 5979
183 Ga0068864_100018951 3300005618 Bacteria 5753
184 Ga0068864_100139556 3300005618 Bacteria 2185
185 Ga0068866_10016136 3300005718 Bacteria 3333
186 Ga0068861_100001294 3300005719 Bacteria 15631
187 Ga0068861_100005205 3300005719 Bacteria 8766
188 Ga0068861_100010706 3300005719 Bacteria 6373
189 Ga0068861_100013638 3300005719 Bacteria 5691
190 Ga0068861_100030583 3300005719 Bacteria 3947
191 Ga0068861_100076092 3300005719 Bacteria 2615
192 Ga0068863_100002643 3300005841 Bacteria 17735
193 Ga0068863_100002686 3300005841 Bacteria 17578
194 Ga0068863_100003228 3300005841 Bacteria 16144
195 Ga0068863_100004291 3300005841 Bacteria 14036
196 Ga0068863_100034719 3300005841 Bacteria 4802
197 Ga0068863_100040447 3300005841 Bacteria 4433
198 Ga0068863_100044449 3300005841 Bacteria 4216
199 Ga0068863_100050945 3300005841 Bacteria 3924
200 Ga0068863_100073916 3300005841 Bacteria 3225
201 Ga0068863_100096651 3300005841 Bacteria 2804
202 Ga0068863_100171856 3300005841 Bacteria 2079
203 Ga0068858_100002496 3300005842 Bacteria 18565
204 Ga0068858_100036056 3300005842 Bacteria 4586
205 Ga0068858_100220340 3300005842 Bacteria 1797
206 Ga0068860_100000029 3300005843 Bacteria 259192
207 Ga0068860_100000447 3300005843 Bacteria 52095
208 Ga0068860_100005348 3300005843 Bacteria 13028
209 Ga0068860_100008154 3300005843 Bacteria 10428
210 Ga0068860_100009116 3300005843 Bacteria 9872
211 Ga0068860_100012595 3300005843 Bacteria 8324
212 Ga0068860_100031639 3300005843 Bacteria 5086
213 Ga0068860_100096919 3300005843 Bacteria 2811
214 Ga0068862_100005874 3300005844 Bacteria 10221
215 Ga0068862_100011334 3300005844 Bacteria 7360
216 Ga0068862_100014464 3300005844 Bacteria 6548
217 Ga0068862_100052186 3300005844 Bacteria 3497
218 Ga0068862_100111286 3300005844 Bacteria 2404
219 Ga0081455_10016284 3300005937 Bacteria 7183
220 Ga0081540_1009025 3300005983 Bacteria 6890
221 Ga0081539_10000075 3300005985 Bacteria 229419
222 Ga0081539_10004761 3300005985 Bacteria 14651
223 Ga0081539_10034692 3300005985 Bacteria 3044
224 Ga0075432_10002592 3300006058 Bacteria 6036
225 Ga0075367_10007875 3300006178 Bacteria 5484
226 Ga0075366_10000301 3300006195 Bacteria 22303
227 Ga0075366_10005936 3300006195 Bacteria 6643
228 Ga0097621_100000859 3300006237 Bacteria 21321
229 Ga0097621_100012064 3300006237 Bacteria 6394
230 Ga0097621_100013313 3300006237 Bacteria 6126
231 Ga0097621_100030359 3300006237 Bacteria 4278
232 Ga0097621_100038544 3300006237 Bacteria 3835
233 Ga0097621_100046232 3300006237 Bacteria 3521
234 Ga0097621_100114411 3300006237 Bacteria 2282
235 Ga0068871_100005674 3300006358 Bacteria 8757
236 Ga0068871_100005778 3300006358 Bacteria 8691
237 Ga0068871_100026227 3300006358 Bacteria 4545
238 Ga0068871_100029795 3300006358 Bacteria 4290
239 Ga0075428_100009441 3300006844 Bacteria 10828
240 Ga0075428_100012082 3300006844 Bacteria 9607
241 Ga0075428_100021993 3300006844 Bacteria 7060
242 Ga0075428_100117405 3300006844 Unclassified 2899
243 Ga0075428_100124285 3300006844 Bacteria 2808
244 Ga0075430_100001053 3300006846 Bacteria 21820
245 Ga0075430_100008299 3300006846 Bacteria 8772
246 Ga0075431_100011043 3300006847 Bacteria 9090
247 Ga0075431_100014396 3300006847 Bacteria 7999
248 Ga0075431_100094782 3300006847 Bacteria 3081
249 Ga0075431_100117422 3300006847 Unclassified 2745
250 Ga0075431_100197582 3300006847 Bacteria 2059
251 Ga0075434_100004685 3300006871 Bacteria 12358
252 Ga0075434_100007952 3300006871 Bacteria 9827
253 Ga0075429_100000243 3300006880 Bacteria 37582
254 Ga0075429_100044721 3300006880 Bacteria 3851
255 Ga0068865_100034633 3300006881 Bacteria 3389
256 Ga0097620_100000041 3300006931 Bacteria 162415
257 Ga0097620_100008581 3300006931 Bacteria 10332
258 Ga0097620_100017056 3300006931 Bacteria 7290
259 Ga0097620_100047446 3300006931 Bacteria 4315
260 Ga0097620_100060021 3300006931 Bacteria 3832
261 Ga0097620_100077735 3300006931 Bacteria 3359
262 Ga0097620_100092499 3300006931 Bacteria 3075
263 Ga0097620_100120828 3300006931 Bacteria 2686
264 Ga0097620_100161312 3300006931 Bacteria 2321
265 Ga0075435_100070656 3300007076 Bacteria 2850
266 Ga0105240_10000022 3300009093 Bacteria 387911
267 Ga0105240_10000083 3300009093 Bacteria 192934
268 Ga0105240_10000269 3300009093 Bacteria 102625
269 Ga0105240_10005775 3300009093 Bacteria 18352
270 Ga0105240_10006701 3300009093 Bacteria 16874
271 Ga0105240_10009858 3300009093 Bacteria 13484
272 Ga0105240_10021747 3300009093 Bacteria 8523
273 Ga0111539_10003619 3300009094 Bacteria 20357
274 Ga0111539_10019310 3300009094 Bacteria 8415
275 Ga0111539_10040488 3300009094 Bacteria 5610
276 Ga0111539_10089502 3300009094 Bacteria 3617
277 Ga0111539_10241437 3300009094 Bacteria 2103
278 Ga0105245_10070023 3300009098 Bacteria 3182
279 Ga0105245_10093422 3300009098 Bacteria 2771
280 Ga0105247_10027897 3300009101 Bacteria 3414
281 Ga0114129_10000308 3300009147 Bacteria 57015
282 Ga0114129_10001594 3300009147 Bacteria 30815
283 Ga0114129_10024341 3300009147 Bacteria 8578
284 Ga0114129_10046425 3300009147 Bacteria 6104
285 Ga0114129_10079503 3300009147 Bacteria 4560
286 Ga0114129_10287323 3300009147 Unclassified 2196
287 Ga0105243_10030569 3300009148 Bacteria 4148
288 Ga0105241_10011702 3300009174 Bacteria 6442
289 Ga0105241_10018994 3300009174 Bacteria 5066
290 Ga0105241_10020357 3300009174 Bacteria 4901
291 Ga0105241_10049452 3300009174 Bacteria 3202
292 Ga0105241_10090697 3300009174 Bacteria 2411
293 Ga0105241_10126991 3300009174 Bacteria 2061
294 Ga0105242_10002416 3300009176 Bacteria 14683
295 Ga0105242_10024568 3300009176 Bacteria 4760
296 Ga0105242_10027792 3300009176 Bacteria 4497
297 Ga0105237_10000171 3300009545 Bacteria 90778
298 Ga0105237_10000198 3300009545 Bacteria 85302
299 Ga0105237_10001507 3300009545 Bacteria 30622
300 Ga0105237_10003342 3300009545 Bacteria 19098
301 Ga0105237_10004821 3300009545 Bacteria 15494
302 Ga0105237_10008339 3300009545 Bacteria 11240
303 Ga0105237_10012320 3300009545 Bacteria 9009
304 Ga0105237_10035161 3300009545 Bacteria 5071
305 Ga0105237_10114932 3300009545 Bacteria 2684
306 Ga0105238_10007423 3300009551 Bacteria 10980
307 Ga0105238_10043938 3300009551 Bacteria 4520
308 Ga0105238_10194932 3300009551 Bacteria 2001
309 Ga0105249_10009844 3300009553 Bacteria 8378
310 Ga0105249_10014639 3300009553 Bacteria 6936
311 Ga0105249_10064315 3300009553 Bacteria 3372
312 Ga0105249_10162291 3300009553 Bacteria 2160
313 Ga0105239_10000609 3300010375 Bacteria 50949
314 Ga0105239_10002266 3300010375 Bacteria 24585
315 Ga0105239_10016827 3300010375 Bacteria 8082
316 Ga0105239_10077390 3300010375 Bacteria 3660
317 Ga0105239_10112386 3300010375 Bacteria 3020
318 Ga0105239_10165295 3300010375 Bacteria 2474
319 Ga0105246_10033596 3300011119 Bacteria 3411
320 Ga0105246_10064207 3300011119 Bacteria 2564
321 Ga0157373_10003763 3300013100 Bacteria 11475
322 Ga0157373_10048040 3300013100 Bacteria 3043
323 Ga0157370_10000132 3300013104 Bacteria 89678
324 Ga0157370_10003043 3300013104 Bacteria 19879
325 Ga0157370_10038907 3300013104 Unclassified 4599
326 Ga0157369_10000605 3300013105 Bacteria 46691
327 Ga0157374_10050474 3300013296 Bacteria 3867
328 Ga0157374_10063455 3300013296 Bacteria 3465
329 Ga0157378_10003189 3300013297 Bacteria 14572
330 Ga0157378_10041154 3300013297 Bacteria 4098
331 Ga0157378_10060998 3300013297 Bacteria 3365
332 Ga0157378_10108845 3300013297 Bacteria 2538
333 Ga0163162_10000038 3300013306 Bacteria 138065
334 Ga0163162_10000546 3300013306 Bacteria 34761
335 Ga0163162_10002051 3300013306 Bacteria 18927
336 Ga0163162_10006412 3300013306 Bacteria 11394
337 Ga0163162_10034203 3300013306 Bacteria 5056
338 Ga0163162_10037185 3300013306 Bacteria 4856
339 Ga0163162_10056064 3300013306 Bacteria 3969
340 Ga0163162_10069363 3300013306 Bacteria 3577
341 Ga0163162_10250748 3300013306 Bacteria 1902
342 Ga0157372_10000231 3300013307 Bacteria 62248
343 Ga0157372_10000894 3300013307 Bacteria 32388
344 Ga0157372_10060380 3300013307 Bacteria 4242
345 Ga0157372_10071598 3300013307 Bacteria 3904
346 Ga0157375_10009344 3300013308 Bacteria 8607
347 Ga0157375_10013323 3300013308 Bacteria 7314
348 Ga0157375_10031471 3300013308 Bacteria 5016
349 Ga0157375_10055146 3300013308 Bacteria 3918
350 Ga0157375_10071752 3300013308 Bacteria 3477
351 Ga0157375_10161838 3300013308 Bacteria 2380
352 Ga0157375_10175088 3300013308 Bacteria 2295
353 Ga0157375_10233366 3300013308 Bacteria 1999
354 Ga0157375_10262369 3300013308 Bacteria 1889
355 Ga0157375_10277080 3300013308 Bacteria 1840
356 Ga0163163_10006007 3300014325 Bacteria 10563
357 Ga0157380_10003457 3300014326 Bacteria 10843
358 Ga0157380_10020263 3300014326 Bacteria 4970
359 Ga0157380_10074202 3300014326 Bacteria 2761
360 Ga0157380_10104166 3300014326 Bacteria 2369
361 Ga0157380_10117699 3300014326 Bacteria 2245
362 Ga0182008_10000954 3300014497 Bacteria 20159
363 Ga0157377_10000700 3300014745 Bacteria 13815
364 Ga0157377_10001475 3300014745 Bacteria 10171
365 Ga0157377_10003779 3300014745 Bacteria 6872
366 Ga0157377_10051629 3300014745 Bacteria 2320
367 Ga0157379_10038215 3300014968 Bacteria 4283
368 Ga0157379_10045511 3300014968 Bacteria 3916
369 Ga0157376_10007058 3300014969 Bacteria 7973
370 Ga0157376_10031635 3300014969 Bacteria 4240
371 Ga0182006_1000418 3300015261 Bacteria 34080
372 Ga0163161_10035000 3300017792 Bacteria 3593
373 Ga0209436_101942 3300025208 Bacteria 6654
374 Ga0209646_1000009 3300025246 Bacteria 652154
375 Ga0209026_1000197 3300025250 Bacteria 84123
376 Ga0209673_1000016 3300025273 Bacteria 506202
377 Ga0209676_1000488 3300025292 Bacteria 64408
378 Ga0209564_1011183 3300025295 Bacteria 4046
379 Ga0209564_1011455 3300025295 Bacteria 3972
380 Ga0209758_1007200 3300025297 Bacteria 7661
381 Ga0209758_1012031 3300025297 Bacteria 4910
382 Ga0209050_1000124 3300025298 Bacteria 194022
383 Ga0209050_1002617 3300025298 Bacteria 14850
384 Ga0209050_1011007 3300025298 Bacteria 4362
385 Ga0207426_1000002 3300025302 Bacteria 1249660
386 Ga0207426_1000026 3300025302 Bacteria 515228
387 Ga0207426_1000052 3300025302 Bacteria 389825
388 Ga0207426_1000555 3300025302 Bacteria 51462
389 Ga0207426_1001572 3300025302 Bacteria 18424
390 Ga0207426_1001894 3300025302 Bacteria 15188
391 Ga0209257_1000007 3300025304 Bacteria 1564415
392 Ga0209257_1000013 3300025304 Bacteria 1047305
393 Ga0207682_10010484 3300025893 Bacteria 3633
394 Ga0207710_10001419 3300025900 Bacteria 11980
395 Ga0207688_10008017 3300025901 Bacteria 5747
396 Ga0207688_10017774 3300025901 Bacteria 3869
397 Ga0207680_10000029 3300025903 Bacteria 78814
398 Ga0207680_10002452 3300025903 Bacteria 8650
399 Ga0207680_10012885 3300025903 Bacteria 4274
400 Ga0207680_10059475 3300025903 Bacteria 2321
401 Ga0207647_10005456 3300025904 Bacteria 9319
402 Ga0207647_10015561 3300025904 Bacteria 5212
403 Ga0207645_10002232 3300025907 Bacteria 15424
404 Ga0207645_10008195 3300025907 Bacteria 7312
405 Ga0207645_10057490 3300025907 Bacteria 2483
406 Ga0207643_10004176 3300025908 Bacteria 7783
407 Ga0207643_10061544 3300025908 Bacteria 2144
408 Ga0207643_10068925 3300025908 Bacteria 2032
409 Ga0207705_10011117 3300025909 Bacteria 6527
410 Ga0207695_10000022 3300025913 Bacteria 659090
411 Ga0207695_10000127 3300025913 Bacteria 227338
412 Ga0207695_10000244 3300025913 Bacteria 141138
413 Ga0207695_10000686 3300025913 Bacteria 66411
414 Ga0207695_10017906 3300025913 Bacteria 8206
415 Ga0207695_10064801 3300025913 Bacteria 3760
416 Ga0207695_10071704 3300025913 Bacteria 3538
417 Ga0207671_10000254 3300025914 Bacteria 79974
418 Ga0207671_10001757 3300025914 Bacteria 24379
419 Ga0207671_10005220 3300025914 Bacteria 12075
420 Ga0207671_10007815 3300025914 Bacteria 9197
421 Ga0207671_10008072 3300025914 Bacteria 8993
422 Ga0207671_10008328 3300025914 Bacteria 8810
423 Ga0207671_10012425 3300025914 Bacteria 6846
424 Ga0207660_10047825 3300025917 Bacteria 3026
425 Ga0207662_10032319 3300025918 Bacteria 3045
426 Ga0207662_10043131 3300025918 Bacteria 2661
427 Ga0207657_10014264 3300025919 Bacteria 7768
428 Ga0207657_10053364 3300025919 Bacteria 3502
429 Ga0207649_10003070 3300025920 Bacteria 9169
430 Ga0207649_10011854 3300025920 Bacteria 4822
431 Ga0207681_10009868 3300025923 Bacteria 5841
432 Ga0207681_10018912 3300025923 Bacteria 4345
433 Ga0207650_10046953 3300025925 Bacteria 3181
434 Ga0207659_10003683 3300025926 Bacteria 9240
435 Ga0207659_10084408 3300025926 Bacteria 2357
436 Ga0207687_10036322 3300025927 Bacteria 3356
437 Ga0207690_10032235 3300025932 Bacteria 3361
438 Ga0207690_10039094 3300025932 Bacteria 3093
439 Ga0207706_10000494 3300025933 Bacteria 42203
440 Ga0207706_10008493 3300025933 Bacteria 9474
441 Ga0207706_10048298 3300025933 Bacteria 3764
442 Ga0207706_10051989 3300025933 Bacteria 3618
443 Ga0207706_10085264 3300025933 Bacteria 2777
444 Ga0207706_10156787 3300025933 Bacteria 2002
445 Ga0207706_10169891 3300025933 Bacteria 1916
446 Ga0207686_10000998 3300025934 Bacteria 16801
447 Ga0207686_10019648 3300025934 Bacteria 3846
448 Ga0207670_10003107 3300025936 Bacteria 8788
449 Ga0207670_10003276 3300025936 Bacteria 8578
450 Ga0207670_10004819 3300025936 Bacteria 7325
451 Ga0207670_10027340 3300025936 Bacteria 3605
452 Ga0207670_10071926 3300025936 Bacteria 2393
453 Ga0207691_10000914 3300025940 Bacteria 29268
454 Ga0207691_10020187 3300025940 Bacteria 6302
455 Ga0207691_10024267 3300025940 Bacteria 5703
456 Ga0207691_10030013 3300025940 Bacteria 5084
457 Ga0207689_10001749 3300025942 Bacteria 20508
458 Ga0207689_10002450 3300025942 Bacteria 17287
459 Ga0207689_10006705 3300025942 Bacteria 10156
460 Ga0207689_10007182 3300025942 Bacteria 9784
461 Ga0207689_10039516 3300025942 Bacteria 3906
462 Ga0207661_10000840 3300025944 Bacteria 20127
463 Ga0207661_10015790 3300025944 Bacteria 5562
464 Ga0207661_10029385 3300025944 Bacteria 4221
465 Ga0207679_10003308 3300025945 Bacteria 9948
466 Ga0207679_10007619 3300025945 Bacteria 6875
467 Ga0207679_10021110 3300025945 Bacteria 4407
468 Ga0207679_10028954 3300025945 Bacteria 3851
469 Ga0207679_10058235 3300025945 Bacteria 2861
470 Ga0207667_10000100 3300025949 Bacteria 138482
471 Ga0207667_10002398 3300025949 Bacteria 23465
472 Ga0207667_10005713 3300025949 Bacteria 15172
473 Ga0207667_10168859 3300025949 Bacteria 2249
474 Ga0207651_10045912 3300025960 Bacteria 2933
475 Ga0207651_10082060 3300025960 Bacteria 2326
476 Ga0207712_10002419 3300025961 Bacteria 12064
477 Ga0207712_10004337 3300025961 Bacteria 8961
478 Ga0207712_10020414 3300025961 Bacteria 4338
479 Ga0207712_10042677 3300025961 Bacteria 3125
480 Ga0207668_10010298 3300025972 Bacteria 5647
481 Ga0207658_10046192 3300025986 Bacteria 3179
482 Ga0207658_10047481 3300025986 Unclassified 3143
483 Ga0207658_10068107 3300025986 Bacteria 2684
484 Ga0207658_10076596 3300025986 Bacteria 2549
485 Ga0207658_10137665 3300025986 Bacteria 1971
486 Ga0207677_10015482 3300026023 Bacteria 4489
487 Ga0207677_10031065 3300026023 Bacteria 3418
488 Ga0207677_10041939 3300026023 Bacteria 3030
489 Ga0207677_10044267 3300026023 Bacteria 2964
490 Ga0207703_10000864 3300026035 Bacteria 29667
491 Ga0207703_10024730 3300026035 Bacteria 4726
492 Ga0207703_10060627 3300026035 Bacteria 3094
493 Ga0207703_10097039 3300026035 Bacteria 2490
494 Ga0207703_10101179 3300026035 Bacteria 2443
495 Ga0207639_10004235 3300026041 Bacteria 9670
496 Ga0207708_10009532 3300026075 Bacteria 7199
497 Ga0207708_10016241 3300026075 Bacteria 5594
498 Ga0207708_10058078 3300026075 Bacteria 2952
499 Ga0207708_10109139 3300026075 Bacteria 2147
500 Ga0207702_10014935 3300026078 Bacteria 6442
501 Ga0207702_10049621 3300026078 Bacteria 3542
502 Ga0207641_10000044 3300026088 Bacteria 183824
503 Ga0207641_10000637 3300026088 Bacteria 38255
504 Ga0207641_10001165 3300026088 Bacteria 26454
505 Ga0207641_10032020 3300026088 Bacteria 4364
506 Ga0207641_10033364 3300026088 Bacteria 4277
507 Ga0207641_10058264 3300026088 Bacteria 3287
508 Ga0207648_10002156 3300026089 Bacteria 21404
509 Ga0207648_10017045 3300026089 Bacteria 6621
510 Ga0207648_10040809 3300026089 Bacteria 4077
511 Ga0207648_10067175 3300026089 Bacteria 3126
512 Ga0207648_10069700 3300026089 Bacteria 3064
513 Ga0207648_10104438 3300026089 Bacteria 2485
514 Ga0207648_10106021 3300026089 Bacteria 2466
515 Ga0207676_10004478 3300026095 Bacteria 9877
516 Ga0207676_10012759 3300026095 Bacteria 6029
517 Ga0207676_10019563 3300026095 Bacteria 4941
518 Ga0207676_10020245 3300026095 Bacteria 4864
519 Ga0207676_10107257 3300026095 Bacteria 2329
520 Ga0207674_10001313 3300026116 Bacteria 32421
521 Ga0207674_10001764 3300026116 Bacteria 27663
522 Ga0207674_10003326 3300026116 Bacteria 19763
523 Ga0207674_10006323 3300026116 Bacteria 13959
524 Ga0207674_10008347 3300026116 Bacteria 11981
525 Ga0207674_10009319 3300026116 Bacteria 11241
526 Ga0207674_10114254 3300026116 Bacteria 2672
527 Ga0207675_100000051 3300026118 Bacteria 83288
528 Ga0207675_100002116 3300026118 Bacteria 19675
529 Ga0207675_100003210 3300026118 Bacteria 16031
530 Ga0207675_100003409 3300026118 Bacteria 15512
531 Ga0207675_100003772 3300026118 Bacteria 14760
532 Ga0207675_100003982 3300026118 Bacteria 14328
533 Ga0207675_100033955 3300026118 Bacteria 4754
534 Ga0207683_10017645 3300026121 Bacteria 6084
535 Ga0207683_10027125 3300026121 Bacteria 4950
536 Ga0207698_10001532 3300026142 Bacteria 13470
537 Ga0207698_10029155 3300026142 Bacteria 3948
538 Ga0207698_10049230 3300026142 Bacteria 3206
539 Ga0207698_10051247 3300026142 Bacteria 3155
540 Ga0207428_10013362 3300027907 Bacteria 7176
541 Ga0207428_10111494 3300027907 Bacteria 2105
542 Ga0268266_10000016 3300028379 Bacteria 629101
543 Ga0268266_10011305 3300028379 Bacteria 7770
544 Ga0268266_10018956 3300028379 Bacteria 5862
545 Ga0268266_10023629 3300028379 Bacteria 5232
546 Ga0268266_10107275 3300028379 Bacteria 2470
547 Ga0268266_10158612 3300028379 Bacteria 2045
548 Ga0268265_10018882 3300028380 Bacteria 4785
549 Ga0268265_10020040 3300028380 Bacteria 4661
550 Ga0268265_10020727 3300028380 Bacteria 4593
551 Ga0268265_10079730 3300028380 Bacteria 2580
552 Ga0268265_10086772 3300028380 Bacteria 2488
553 Ga0268265_10088484 3300028380 Bacteria 2467
554 Ga0268265_10160067 3300028380 Bacteria 1911
555 Ga0268264_10000072 3300028381 Bacteria 260791
556 Ga0268264_10000327 3300028381 Bacteria 75326
557 Ga0268264_10004249 3300028381 Bacteria 12226
558 Ga0268264_10007773 3300028381 Bacteria 8927
559 Ga0268264_10017550 3300028381 Bacteria 5861
560 Ga0268264_10098967 3300028381 Bacteria 2530
561 Ga0268264_10144900 3300028381 Bacteria 2122
562 Ga0268264_10168024 3300028381 Bacteria 1982
563 Ga0307515_10000012 3300028794 Bacteria 582232
564 Ga0307515_10001652 3300028794 Bacteria 49628
565 Ga0307515_10019786 3300028794 Bacteria 12078
566 Ga0265332_10000647 3300031238 Bacteria 22595
567 Ga0265327_10004167 3300031251 Bacteria 13044
568 Ga0265327_10023360 3300031251 Bacteria 3664
569 Ga0307513_10021988 3300031456 Bacteria 7512
570 Ga0307509_10021227 3300031507 Bacteria 7347
571 Ga0307408_100006344 3300031548 Bacteria 7848
572 Ga0307508_10005018 3300031616 Bacteria 12721
573 Ga0316575_10000740 3300031665 Bacteria 9794
574 Ga0265342_10031964 3300031712 Bacteria 3249
575 Ga0307516_10130496 3300031730 Bacteria 2293
576 Ga0307405_10035592 3300031731 Bacteria 2975
577 Ga0307413_10002877 3300031824 Bacteria 7101
578 Ga0307412_10011841 3300031911 Bacteria 5064
579 Ga0307409_100041559 3300031995 Bacteria 3435
580 Ga0307416_100066279 3300032002 Bacteria 2972
581 Ga0307414_10004512 3300032004 Bacteria 7569
582 Ga0307414_10025626 3300032004 Unclassified 3782
583 Ga0307414_10083559 3300032004 Bacteria 2345
584 Ga0373943_0016519 3300035170 Bacteria 3367
585 Ga0373931_0011261 3300035691 Bacteria 4320
586 Ga0373937_0021247 3300036401 Bacteria 5824
587 Ga0316584_0052706 3300036712 Bacteria 3043
588 Ga0395900_0021965 3300037418 Bacteria 6525
589 Ga0395905_0036008 3300037471 Bacteria 4648
590 Ga0395905_0247213 3300037471 Unclassified 1666
591 Ga0451577_0059330 3300042876 Bacteria 3411
592 Ga0451577_0114585 3300042876 Bacteria 2413
593 Ga0466972_0026806 3300044658 Bacteria 2855
594 Ga0466961_0011359 3300044693 Bacteria 5695
595 Ga0453684_0007730 3300044712 Bacteria 19633
596 Ga0453684_0008982 3300044712 Bacteria 17660
597 Ga0453684_0011736 3300044712 Bacteria 14608
598 Ga0453684_0161376 3300044712 Bacteria 2651
599 Ga0466957_0067096 3300044842 Bacteria 2213
600 Ga0466959_0003205 3300045049 Bacteria 10634
601 Ga0451576_0001902 3300045051 Bacteria 33495
602 Ga0451576_0003836 3300045051 Bacteria 20204
603 Ga0451576_0067534 3300045051 Bacteria 3722
604 Ga0466958_0028706 3300045836 Bacteria 3300
605 Ga0495603_0075626 3300046455 Bacteria 1977
606 Ga0495629_0007537 3300046459 Bacteria 8021
607 Ga0495638_0000004 3300046460 Bacteria 700795
608 Ga0495638_0000156 3300046460 Bacteria 107923
609 Ga0495582_0028223 3300046473 Bacteria 3080
610 Ga0495628_0033702 3300046516 Bacteria 4125
611 Ga0495648_0000348 3300046524 Bacteria 50841
612 Ga0495633_0000176 3300046558 Bacteria 83645
613 Ga0495668_0000024 3300046616 Bacteria 359469
614 Ga0495625_0120642 3300046660 Bacteria 1784
615 Ga0495661_0021927 3300046665 Bacteria 4157
616 Ga0495672_0022099 3300047320 Bacteria 4140
617 Ga0495672_0075408 3300047320 Bacteria 1897
618 Ga0495687_000004 3300047443 Bacteria 779298
619 Ga0495687_000144 3300047443 Bacteria 108217
620 Ga0495626_0002351 3300048091 Bacteria 13316
621 Ga0496104_0029345 3300048907 Bacteria 5101
622 Ga0496108_0122397 3300048911 Bacteria 2232
623 Ga0496109_0013211 3300048912 Bacteria 7148
624 Ga0496109_0028307 3300048912 Bacteria 5010
625 Ga0496109_0057224 3300048912 Bacteria 3559
626 Ga0496110_0028886 3300048913 Bacteria 4767
627 Ga0496112_0064120 3300048915 Bacteria 3625
628 Ga0496113_0003993 3300048916 Bacteria 8967
629 Ga0496113_0016974 3300048916 Bacteria 5041
630 Ga0496114_0092553 3300048917 Bacteria 2569
631 Ga0496115_0015939 3300048918 Bacteria 5713
632 Ga0496121_0000007 3300048924 Bacteria 942516
633 Ga0496122_0001437 3300048925 Bacteria 38528
634 Ga0496123_0003831 3300048926 Bacteria 16411
635 Ga0496125_0001731 3300048928 Bacteria 30348
636 Ga0501031_0009209 3300049568 Bacteria 6419
637 Ga0501032_0024121 3300049569 Bacteria 4201
638 Ga0501036_0043239 3300049572 Bacteria 3814
639 Ga0501037_0025030 3300049573 Bacteria 4412
640 Ga0501037_0042733 3300049573 Bacteria 3331
641 Ga0501038_0014745 3300049574 Bacteria 7120
642 Ga0501038_0056967 3300049574 Bacteria 3356
643 Ga0501042_0005729 3300049578 Bacteria 8024
644 Ga0501043_0022394 3300049579 Bacteria 4956
645 Ga0501046_0010927 3300049580 Bacteria 7783
646 Ga0501046_0029613 3300049580 Bacteria 4450
647 Ga0501047_0046305 3300049581 Bacteria 4204
648 Ga0501047_0161116 3300049581 Bacteria 2115
649 Ga0501070_0000444 3300049586 Bacteria 37674
650 Ga0501071_0034816 3300049587 Bacteria 3586
651 Ga0501073_0072869 3300049589 Bacteria 2392
652 Ga0501075_0075405 3300049591 Bacteria 2550
653 Ga0501236_000136 3300049670 Bacteria 7306
654 Ga0501242_000052 3300049674 Bacteria 7216
655 Ga0501243_000825 3300049675 Bacteria 4312
656 Ga0501259_001854 3300049688 Bacteria 3504
657 Ga0501079_0050855 3300049741 Bacteria 3198
658 Ga0501264_000168 3300049761 Bacteria 10594
659 Ga0501035_0008768 3300049822 Bacteria 9414
660 Ga0501035_0039542 3300049822 Bacteria 4268
661 Ga0501044_0005009 3300049823 Bacteria 14789
662 Ga0501044_0006015 3300049823 Bacteria 13405
663 Ga0501044_0006539 3300049823 Bacteria 12867
664 Ga0501044_0009683 3300049823 Bacteria 10482
665 nmdc:mga05p37_1200_c1 3300050507 Bacteria 29977
666 nmdc:mga05p37_123136_c1 3300050507 Bacteria 3185
667 nmdc:mga05p37_15857_c1 3300050507 Bacteria 9063
668 nmdc:mga05p37_49201_c1 3300050507 Bacteria 5185
669 nmdc:mga05p37_4977_c1 3300050507 Bacteria 15573
670 nmdc:mga09592_3115_c1 3300050508 Bacteria 13468
671 nmdc:mga09592_391_c1 3300050508 Bacteria 32150
672 nmdc:mga09592_41537_c1 3300050508 Bacteria 3867
673 nmdc:mga0qj67_25986_c1 3300050509 Bacteria 4530
674 nmdc:mga0qj67_6314_c1 3300050509 Bacteria 8700
675 nmdc:mga0qj67_905_c2 3300050509 Bacteria 9438
676 nmdc:mga06r32_111989_c1 3300050510 Unclassified 2686
677 nmdc:mga06r32_41909_c1 3300050510 Bacteria 4351
678 nmdc:mga06r32_8273_c2 3300050510 Bacteria 7321
679 nmdc:mga08y16_16388_c1 3300050511 Bacteria 7792
680 nmdc:mga08y16_198652_c1 3300050511 Bacteria 2078
681 nmdc:mga08y16_26164_c1 3300050511 Bacteria 6154
682 nmdc:mga08y16_33730_c1 3300050511 Bacteria 5376
683 nmdc:mga08y16_36100_c1 3300050511 Bacteria 5190
684 nmdc:mga08y16_92063_c1 3300050511 Bacteria 2287
685 nmdc:mga0n895_123396_c1 3300050512 Bacteria 2612
686 nmdc:mga0n895_4222_c1 3300050512 Bacteria 11745
687 nmdc:mga0n895_71823_c1 3300050512 Bacteria 3433
688 nmdc:mga08x19_2409_c1 3300050514 Bacteria 11345
689 nmdc:mga0a205_106816_c1 3300050515 Bacteria 2697
690 nmdc:mga0a205_17601_c1 3300050515 Bacteria 6705
691 Ga0500635_0000557 3300053080 Bacteria 9937
692 Ga0500644_0001758 3300053088 Bacteria 5608
693 Ga0500583_0000927 3300053092 Bacteria 8373
694 Ga0500557_002379 3300053105 Bacteria 3434
695 Ga0500595_000011 3300053119 Bacteria 268589
696 Ga0500618_000004 3300053125 Bacteria 293180
697 Ga0500652_005630 3300053131 Bacteria 3965
698 Ga0500559_0010370 3300053136 Bacteria 4004
699 Ga0500568_0007246 3300053139 Bacteria 5465
700 Ga0500604_0012502 3300053151 Bacteria 2292
701 Ga0500616_0000015 3300053153 Bacteria 633259
702 Ga0500616_0000082 3300053153 Bacteria 198665
703 Ga0500616_0009227 3300053153 Bacteria 6017
704 Ga0500616_0015760 3300053153 Bacteria 4315
705 Ga0500622_0000009 3300053156 Bacteria 419980
706 Ga0500622_0000096 3300053156 Bacteria 90621
707 Ga0500622_0003253 3300053156 Bacteria 11021
708 Ga0500622_0003329 3300053156 Bacteria 10843
709 Ga0500622_0012098 3300053156 Bacteria 4685
710 Ga0501082_0045483 3300060353 Bacteria 3786
711 Ga0530510_0052054 3300061734 Bacteria 2959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0024121 Ga0501032_0024121_535_1962 435
2 3300005548 Ga0070665_100204701 Ga0070665_1002047012 449
3 3300025298 Ga0209050_1011007 Ga0209050_10110073 450
4 3300053136 Ga0500559_0010370 Ga0500559_0010370_2444_3919 468
5 3300046660 Ga0495625_0120642 Ga0495625_0120642_46_1587 471
6 3300037471 Ga0395905_0247213 Ga0395905_0247213_19_1503 476
7 3300049674 Ga0501242_000052 Ga0501242_000052_3478_4968 478
8 3300005842 Ga0068858_100002496 Ga0068858_10000249613 492
9 3300026035 Ga0207703_10000864 Ga0207703_100008645 492
10 3300048928 Ga0496125_0001731 Ga0496125_0001731_22068_23753 492
11 3300028794 Ga0307515_10019786 Ga0307515_100197865 495
12 3300025893 Ga0207682_10010484 Ga0207682_100104842 505
13 3300006844 Ga0075428_100012082 Ga0075428_1000120825 509
14 3300006847 Ga0075431_100094782 Ga0075431_1000947823 509
15 3300050509 nmdc:mga0qj67_6314_c1 nmdc:mga0qj67_6314_c1_1898_3568 509
16 3300005841 Ga0068863_100040447 Ga0068863_1000404475 513
17 3300006237 Ga0097621_100012064 Ga0097621_1000120643 513
18 3300006358 Ga0068871_100026227 Ga0068871_1000262272 513
19 3300009176 Ga0105242_10002416 Ga0105242_100024163 513
20 3300014969 Ga0157376_10031635 Ga0157376_100316352 513
21 3300048091 Ga0495626_0002351 Ga0495626_0002351_8820_10559 514
22 3300003794 Ga0055531_10000559 Ga0055531_1000055919 515
23 3300025304 Ga0209257_1000007 Ga0209257_1000007518 515
24 3300006237 Ga0097621_100030359 Ga0097621_1000303593 518
25 3300009101 Ga0105247_10027897 Ga0105247_100278973 519
26 3300025903 Ga0207680_10002452 Ga0207680_100024529 519
27 3300047443 Ga0495687_000144 Ga0495687_000144_57475_59157 519
28 iso_pu_bacteria 2643221614 2644087882 520
29 iso_pu_bacteria 2643221661 2644345487 520
30 iso_pu_bacteria 2643221666 2644367238 520
31 3300003316 rootH1_10033153 rootH1_100331532 521
32 3300003320 rootH2_10009145 rootH2_100091454 521
33 3300049573 Ga0501037_0042733 Ga0501037_0042733_712_2409 521
34 3300049574 Ga0501038_0014745 Ga0501038_0014745_3921_5618 521
35 3300049586 Ga0501070_0000444 Ga0501070_0000444_14661_16358 521
36 3300049822 Ga0501035_0008768 Ga0501035_0008768_7661_9358 521
37 3300049823 Ga0501044_0005009 Ga0501044_0005009_6945_8642 521
38 3300005937 Ga0081455_10016284 Ga0081455_100162843 522
39 3300009553 Ga0105249_10014639 Ga0105249_100146392 522
40 3300010375 Ga0105239_10002266 Ga0105239_1000226620 522
41 3300013306 Ga0163162_10056064 Ga0163162_100560642 522
42 3300014326 Ga0157380_10117699 Ga0157380_101176992 522
43 3300014745 Ga0157377_10051629 Ga0157377_100516292 522
44 3300014968 Ga0157379_10045511 Ga0157379_100455113 522
45 3300025961 Ga0207712_10042677 Ga0207712_100426772 522
46 3300032004 Ga0307414_10004512 Ga0307414_100045127 522
47 3300049581 Ga0501047_0161116 Ga0501047_0161116_407_2089 522
48 3300049823 Ga0501044_0006015 Ga0501044_0006015_7511_9193 522
49 3300044693 Ga0466961_0011359 Ga0466961_0011359_2825_4510 524
50 3300044842 Ga0466957_0067096 Ga0466957_0067096_412_2097 524
51 3300045049 Ga0466959_0003205 Ga0466959_0003205_4010_5695 524
52 3300045836 Ga0466958_0028706 Ga0466958_0028706_1426_3111 524
53 3300049823 Ga0501044_0006539 Ga0501044_0006539_7531_9222 524
54 3300053153 Ga0500616_0009227 Ga0500616_0009227_2693_4393 524
55 3300005262 Ga0065165_1000639 Ga0065165_100063913 525
56 3300025292 Ga0209676_1000488 Ga0209676_100048828 525
57 3300028794 Ga0307515_10000012 Ga0307515_10000012469 525
58 3300005618 Ga0068864_100018951 Ga0068864_1000189512 526
59 3300026095 Ga0207676_10012759 Ga0207676_100127593 526
60 3300050508 nmdc:mga09592_3115_c1 nmdc:mga09592_3115_c1_2359_4026 526
61 3300006844 Ga0075428_100124285 Ga0075428_1001242853 527
62 3300009147 Ga0114129_10287323 Ga0114129_102873232 527
63 3300005290 Ga0065712_10070193 Ga0065712_100701934 528
64 3300005354 Ga0070675_100163355 Ga0070675_1001633552 528
65 3300005466 Ga0070685_10010649 Ga0070685_100106492 528
66 3300005841 Ga0068863_100004291 Ga0068863_1000042916 528
67 3300009553 Ga0105249_10009844 Ga0105249_100098445 528
68 3300017792 Ga0163161_10035000 Ga0163161_100350003 528
69 3300025961 Ga0207712_10004337 Ga0207712_100043373 528
70 3300026035 Ga0207703_10097039 Ga0207703_100970391 528
71 3300026088 Ga0207641_10001165 Ga0207641_100011656 528
72 3300026116 Ga0207674_10114254 Ga0207674_101142543 528
73 3300003316 rootH1_10077515 rootH1_100775154 529
74 3300005843 Ga0068860_100000447 Ga0068860_10000044734 529
75 3300005983 Ga0081540_1009025 Ga0081540_10090253 529
76 3300006058 Ga0075432_10002592 Ga0075432_100025921 529
77 3300013306 Ga0163162_10002051 Ga0163162_100020516 529
78 3300028381 Ga0268264_10000327 Ga0268264_1000032733 529
79 3300053125 Ga0500618_000004 Ga0500618_000004_267209_268924 529
80 3300005327 Ga0070658_10002413 Ga0070658_100024135 530
81 3300025908 Ga0207643_10061544 Ga0207643_100615441 530
82 3300025909 Ga0207705_10011117 Ga0207705_100111172 530
83 3300025919 Ga0207657_10053364 Ga0207657_100533643 530
84 3300005328 Ga0070676_10004885 Ga0070676_100048852 532
85 3300005329 Ga0070683_100005920 Ga0070683_1000059205 532
86 3300005329 Ga0070683_100037872 Ga0070683_1000378721 532
87 3300005330 Ga0070690_100001727 Ga0070690_1000017279 532
88 3300005330 Ga0070690_100043945 Ga0070690_1000439451 532
89 3300005330 Ga0070690_100057098 Ga0070690_1000570982 532
90 3300005334 Ga0068869_100048943 Ga0068869_1000489432 532
91 3300005338 Ga0068868_100002272 Ga0068868_10000227214 532
92 3300005338 Ga0068868_100073887 Ga0068868_1000738872 532
93 3300005338 Ga0068868_100077996 Ga0068868_1000779962 532
94 3300005340 Ga0070689_100015800 Ga0070689_1000158003 532
95 3300005344 Ga0070661_100000277 Ga0070661_10000027728 532
96 3300005355 Ga0070671_100040595 Ga0070671_1000405952 532
97 3300005365 Ga0070688_100017477 Ga0070688_1000174773 532
98 3300005367 Ga0070667_100017378 Ga0070667_1000173782 532
99 3300005438 Ga0070701_10016630 Ga0070701_100166303 532
100 3300005457 Ga0070662_100019703 Ga0070662_1000197032 532
101 3300005457 Ga0070662_100020503 Ga0070662_1000205032 532
102 3300005466 Ga0070685_10011895 Ga0070685_100118952 532
103 3300005535 Ga0070684_100000773 Ga0070684_1000007734 532
104 3300005539 Ga0068853_100014216 Ga0068853_1000142162 532
105 3300005548 Ga0070665_100100081 Ga0070665_1001000812 532
106 3300005564 Ga0070664_100008983 Ga0070664_1000089835 532
107 3300005577 Ga0068857_100003006 Ga0068857_1000030069 532
108 3300005577 Ga0068857_100014247 Ga0068857_1000142474 532
109 3300005615 Ga0070702_100036762 Ga0070702_1000367622 532
110 3300005616 Ga0068852_100049772 Ga0068852_1000497722 532
111 3300005616 Ga0068852_100128349 Ga0068852_1001283492 532
112 3300005617 Ga0068859_100017056 Ga0068859_1000170564 532
113 3300005618 Ga0068864_100002580 Ga0068864_1000025802 532
114 3300005719 Ga0068861_100001294 Ga0068861_1000012949 532
115 3300005719 Ga0068861_100010706 Ga0068861_1000107064 532
116 3300005841 Ga0068863_100044449 Ga0068863_1000444493 532
117 3300005842 Ga0068858_100220340 Ga0068858_1002203401 532
118 3300005843 Ga0068860_100031639 Ga0068860_1000316392 532
119 3300005844 Ga0068862_100111286 Ga0068862_1001112862 532
120 3300005985 Ga0081539_10004761 Ga0081539_100047614 532
121 3300006871 Ga0075434_100007952 Ga0075434_1000079524 532
122 3300006931 Ga0097620_100017056 Ga0097620_1000170563 532
123 3300013100 Ga0157373_10048040 Ga0157373_100480401 532
124 3300013296 Ga0157374_10063455 Ga0157374_100634552 532
125 3300013297 Ga0157378_10060998 Ga0157378_100609982 532
126 3300013306 Ga0163162_10034203 Ga0163162_100342034 532
127 3300013307 Ga0157372_10071598 Ga0157372_100715983 532
128 3300013308 Ga0157375_10013323 Ga0157375_100133232 532
129 3300013308 Ga0157375_10055146 Ga0157375_100551462 532
130 3300025302 Ga0207426_1000052 Ga0207426_1000052108 532
131 3300025903 Ga0207680_10059475 Ga0207680_100594751 532
132 3300025907 Ga0207645_10008195 Ga0207645_100081952 532
133 3300025920 Ga0207649_10003070 Ga0207649_100030707 532
134 3300025932 Ga0207690_10032235 Ga0207690_100322352 532
135 3300025933 Ga0207706_10048298 Ga0207706_100482982 532
136 3300025933 Ga0207706_10085264 Ga0207706_100852642 532
137 3300025933 Ga0207706_10156787 Ga0207706_101567871 532
138 3300025936 Ga0207670_10003107 Ga0207670_100031071 532
139 3300025936 Ga0207670_10071926 Ga0207670_100719262 532
140 3300025940 Ga0207691_10024267 Ga0207691_100242673 532
141 3300025942 Ga0207689_10001749 Ga0207689_1000174913 532
142 3300025944 Ga0207661_10000840 Ga0207661_100008404 532
143 3300025944 Ga0207661_10029385 Ga0207661_100293853 532
144 3300025945 Ga0207679_10021110 Ga0207679_100211102 532
145 3300025986 Ga0207658_10068107 Ga0207658_100681072 532
146 3300025986 Ga0207658_10076596 Ga0207658_100765962 532
147 3300026023 Ga0207677_10031065 Ga0207677_100310653 532
148 3300026023 Ga0207677_10041939 Ga0207677_100419392 532
149 3300026035 Ga0207703_10060627 Ga0207703_100606272 532
150 3300026041 Ga0207639_10004235 Ga0207639_100042356 532
151 3300026089 Ga0207648_10040809 Ga0207648_100408093 532
152 3300026089 Ga0207648_10069700 Ga0207648_100697002 532
153 3300026116 Ga0207674_10006323 Ga0207674_100063239 532
154 3300026118 Ga0207675_100003409 Ga0207675_10000340910 532
155 3300026118 Ga0207675_100003982 Ga0207675_1000039826 532
156 3300026142 Ga0207698_10029155 Ga0207698_100291552 532
157 3300028380 Ga0268265_10088484 Ga0268265_100884842 532
158 3300028381 Ga0268264_10144900 Ga0268264_101449002 532
159 3300036401 Ga0373937_0021247 Ga0373937_0021247_2823_4499 532
160 3300046516 Ga0495628_0033702 Ga0495628_0033702_2388_4064 532
161 3300046616 Ga0495668_0000024 Ga0495668_0000024_344323_346011 532
162 3300048913 Ga0496110_0028886 Ga0496110_0028886_1951_3627 532
163 3300049568 Ga0501031_0009209 Ga0501031_0009209_3278_4954 532
164 3300049572 Ga0501036_0043239 Ga0501036_0043239_1541_3217 532
165 3300049573 Ga0501037_0025030 Ga0501037_0025030_2356_4032 532
166 3300049574 Ga0501038_0056967 Ga0501038_0056967_90_1766 532
167 3300049579 Ga0501043_0022394 Ga0501043_0022394_1253_2929 532
168 3300049580 Ga0501046_0029613 Ga0501046_0029613_687_2363 532
169 3300049581 Ga0501047_0046305 Ga0501047_0046305_1488_3164 532
170 3300049822 Ga0501035_0039542 Ga0501035_0039542_1837_3513 532
171 3300049823 Ga0501044_0009683 Ga0501044_0009683_3550_5226 532
172 3300053119 Ga0500595_000011 Ga0500595_000011_210263_211936 532
173 3300005355 Ga0070671_100164935 Ga0070671_1001649351 533
174 3300025208 Ga0209436_101942 Ga0209436_1019425 533
175 3300025302 Ga0207426_1000555 Ga0207426_10005555 533
176 3300045051 Ga0451576_0001902 Ga0451576_0001902_7266_8960 533
177 3300003320 rootH2_10012490 rootH2_100124908 534
178 3300005617 Ga0068859_100161312 Ga0068859_1001613122 534
179 3300006237 Ga0097621_100000859 Ga0097621_1000008593 534
180 3300006237 Ga0097621_100038544 Ga0097621_1000385444 534
181 3300006358 Ga0068871_100005778 Ga0068871_1000057787 534
182 3300006880 Ga0075429_100044721 Ga0075429_1000447212 534
183 3300006881 Ga0068865_100034633 Ga0068865_1000346334 534
184 3300006931 Ga0097620_100161312 Ga0097620_1001613122 534
185 3300009093 Ga0105240_10000083 Ga0105240_10000083179 534
186 3300009094 Ga0111539_10241437 Ga0111539_102414372 534
187 3300009147 Ga0114129_10001594 Ga0114129_100015949 534
188 3300009147 Ga0114129_10024341 Ga0114129_100243412 534
189 3300009147 Ga0114129_10079503 Ga0114129_100795032 534
190 3300009174 Ga0105241_10011702 Ga0105241_100117024 534
191 3300009174 Ga0105241_10018994 Ga0105241_100189945 534
192 3300009176 Ga0105242_10027792 Ga0105242_100277924 534
193 3300009545 Ga0105237_10000198 Ga0105237_1000019823 534
194 3300009545 Ga0105237_10114932 Ga0105237_101149322 534
195 3300009551 Ga0105238_10043938 Ga0105238_100439382 534
196 3300010375 Ga0105239_10016827 Ga0105239_100168272 534
197 3300010375 Ga0105239_10165295 Ga0105239_101652952 534
198 3300013306 Ga0163162_10250748 Ga0163162_102507482 534
199 3300013308 Ga0157375_10175088 Ga0157375_101750882 534
200 3300014326 Ga0157380_10020263 Ga0157380_100202632 534
201 3300025913 Ga0207695_10000127 Ga0207695_10000127179 534
202 3300025914 Ga0207671_10000254 Ga0207671_1000025422 534
203 3300025919 Ga0207657_10014264 Ga0207657_100142643 534
204 3300025960 Ga0207651_10045912 Ga0207651_100459123 534
205 3300026023 Ga0207677_10044267 Ga0207677_100442672 534
206 3300026075 Ga0207708_10109139 Ga0207708_101091391 534
207 3300026089 Ga0207648_10067175 Ga0207648_100671753 534
208 3300028379 Ga0268266_10018956 Ga0268266_100189564 534
209 3300028379 Ga0268266_10158612 Ga0268266_101586121 534
210 3300031730 Ga0307516_10130496 Ga0307516_101304961 534
211 3300046455 Ga0495603_0075626 Ga0495603_0075626_157_1836 534
212 3300049578 Ga0501042_0005729 Ga0501042_0005729_1784_3466 534
213 3300049580 Ga0501046_0010927 Ga0501046_0010927_4733_6415 534
214 3300049587 Ga0501071_0034816 Ga0501071_0034816_480_2162 534
215 3300049589 Ga0501073_0072869 Ga0501073_0072869_60_1742 534
216 3300049591 Ga0501075_0075405 Ga0501075_0075405_766_2448 534
217 3300050507 nmdc:mga05p37_1200_c1 nmdc:mga05p37_1200_c1_22045_23751 534
218 3300050507 nmdc:mga05p37_123136_c1 nmdc:mga05p37_123136_c1_322_2004 534
219 3300050507 nmdc:mga05p37_15857_c1 nmdc:mga05p37_15857_c1_7007_8689 534
220 3300050507 nmdc:mga05p37_49201_c1 nmdc:mga05p37_49201_c1_77_1762 534
221 3300050508 nmdc:mga09592_41537_c1 nmdc:mga09592_41537_c1_878_2560 534
222 3300050511 nmdc:mga08y16_16388_c1 nmdc:mga08y16_16388_c1_4170_5852 534
223 3300050512 nmdc:mga0n895_4222_c1 nmdc:mga0n895_4222_c1_4071_5777 534
224 3300050512 nmdc:mga0n895_71823_c1 nmdc:mga0n895_71823_c1_1147_2853 534
225 3300050514 nmdc:mga08x19_2409_c1 nmdc:mga08x19_2409_c1_1867_3573 534
226 3300050515 nmdc:mga0a205_17601_c1 nmdc:mga0a205_17601_c1_415_2121 534
227 3300060353 Ga0501082_0045483 Ga0501082_0045483_1182_2864 534
228 3300061734 Ga0530510_0052054 Ga0530510_0052054_645_2327 534
229 iso_pu_bacteria 2894414249 2894415675 534
230 iso_pu_bacteria 2977232053 2977233122 534
231 3300003322 rootL2_10174960 rootL2_101749603 535
232 3300003794 Ga0055531_10000426 Ga0055531_1000042613 535
233 3300005289 Ga0065704_10076316 Ga0065704_100763163 535
234 3300005335 Ga0070666_10003057 Ga0070666_100030575 535
235 3300005347 Ga0070668_100032892 Ga0070668_1000328923 535
236 3300005577 Ga0068857_100003443 Ga0068857_1000034436 535
237 3300005578 Ga0068854_100006457 Ga0068854_1000064572 535
238 3300005614 Ga0068856_100063625 Ga0068856_1000636253 535
239 3300005616 Ga0068852_100005907 Ga0068852_1000059072 535
240 3300005843 Ga0068860_100005348 Ga0068860_1000053487 535
241 3300009093 Ga0105240_10000269 Ga0105240_1000026952 535
242 3300009093 Ga0105240_10006701 Ga0105240_100067018 535
243 3300009093 Ga0105240_10021747 Ga0105240_100217476 535
244 3300009174 Ga0105241_10090697 Ga0105241_100906972 535
245 3300009174 Ga0105241_10126991 Ga0105241_101269911 535
246 3300009545 Ga0105237_10000171 Ga0105237_1000017132 535
247 3300009545 Ga0105237_10001507 Ga0105237_1000150716 535
248 3300009545 Ga0105237_10004821 Ga0105237_1000482111 535
249 3300009545 Ga0105237_10008339 Ga0105237_100083398 535
250 3300009551 Ga0105238_10007423 Ga0105238_100074235 535
251 3300010375 Ga0105239_10000609 Ga0105239_100006093 535
252 3300013105 Ga0157369_10000605 Ga0157369_1000060512 535
253 3300013307 Ga0157372_10000894 Ga0157372_100008944 535
254 3300013308 Ga0157375_10233366 Ga0157375_102333662 535
255 3300025304 Ga0209257_1000007 Ga0209257_1000007481 535
256 3300025903 Ga0207680_10012885 Ga0207680_100128853 535
257 3300025904 Ga0207647_10015561 Ga0207647_100155613 535
258 3300025913 Ga0207695_10000244 Ga0207695_1000024464 535
259 3300025913 Ga0207695_10017906 Ga0207695_100179065 535
260 3300025913 Ga0207695_10064801 Ga0207695_100648013 535
261 3300025914 Ga0207671_10001757 Ga0207671_1000175718 535
262 3300025914 Ga0207671_10005220 Ga0207671_100052208 535
263 3300025914 Ga0207671_10007815 Ga0207671_100078155 535
264 3300025914 Ga0207671_10008072 Ga0207671_100080725 535
265 3300025949 Ga0207667_10002398 Ga0207667_100023986 535
266 3300026078 Ga0207702_10014935 Ga0207702_100149354 535
267 3300028381 Ga0268264_10004249 Ga0268264_100042491 535
268 3300028381 Ga0268264_10007773 Ga0268264_100077733 535
269 3300037418 Ga0395900_0021965 Ga0395900_0021965_1867_3558 535
270 3300037471 Ga0395905_0036008 Ga0395905_0036008_1205_2908 535
271 3300042876 Ga0451577_0114585 Ga0451577_0114585_699_2357 535
272 3300044658 Ga0466972_0026806 Ga0466972_0026806_445_2115 535
273 3300044712 Ga0453684_0011736 Ga0453684_0011736_8240_9898 535
274 3300044712 Ga0453684_0161376 Ga0453684_0161376_695_2362 535
275 3300047320 Ga0495672_0022099 Ga0495672_0022099_1508_3217 535
276 3300053156 Ga0500622_0003329 Ga0500622_0003329_2611_4296 535
277 iso_pu_bacteria 2919692658 2919695975 535
278 3300005329 Ga0070683_100023539 Ga0070683_1000235397 536
279 3300005536 Ga0070697_100034646 Ga0070697_1000346463 536
280 3300005545 Ga0070695_100008303 Ga0070695_1000083033 536
281 3300005546 Ga0070696_100001683 Ga0070696_1000016834 536
282 3300005549 Ga0070704_100034290 Ga0070704_1000342902 536
283 3300005563 Ga0068855_100037991 Ga0068855_1000379913 536
284 3300005577 Ga0068857_100017670 Ga0068857_1000176702 536
285 3300005578 Ga0068854_100019492 Ga0068854_1000194926 536
286 3300005616 Ga0068852_100001717 Ga0068852_1000017173 536
287 3300005841 Ga0068863_100073916 Ga0068863_1000739163 536
288 3300007076 Ga0075435_100070656 Ga0075435_1000706561 536
289 3300009093 Ga0105240_10009858 Ga0105240_100098585 536
290 3300009545 Ga0105237_10012320 Ga0105237_100123206 536
291 3300009551 Ga0105238_10194932 Ga0105238_101949322 536
292 3300013104 Ga0157370_10003043 Ga0157370_1000304311 536
293 3300013307 Ga0157372_10000231 Ga0157372_1000023112 536
294 3300013308 Ga0157375_10161838 Ga0157375_101618382 536
295 3300025904 Ga0207647_10005456 Ga0207647_1000545610 536
296 3300025914 Ga0207671_10012425 Ga0207671_100124253 536
297 3300025949 Ga0207667_10000100 Ga0207667_1000010013 536
298 3300026088 Ga0207641_10058264 Ga0207641_100582642 536
299 3300026116 Ga0207674_10009319 Ga0207674_100093198 536
300 3300026142 Ga0207698_10001532 Ga0207698_100015323 536
301 3300032004 Ga0307414_10025626 Ga0307414_100256261 536
302 3300044712 Ga0453684_0008982 Ga0453684_0008982_10137_11855 536
303 3300045051 Ga0451576_0003836 Ga0451576_0003836_14862_16580 536
304 3300049741 Ga0501079_0050855 Ga0501079_0050855_885_2570 536
305 3300050512 nmdc:mga0n895_123396_c1 nmdc:mga0n895_123396_c1_99_1784 536
306 3300050515 nmdc:mga0a205_106816_c1 nmdc:mga0a205_106816_c1_818_2503 536
307 3300053156 Ga0500622_0012098 Ga0500622_0012098_2227_3918 536
308 3300003203 JGI25406J46586_10005453 JGI25406J46586_100054535 537
309 3300005293 Ga0065715_10125582 Ga0065715_101255822 537
310 3300005329 Ga0070683_100010034 Ga0070683_1000100344 537
311 3300005330 Ga0070690_100008225 Ga0070690_1000082253 537
312 3300005336 Ga0070680_100010880 Ga0070680_1000108804 537
313 3300005340 Ga0070689_100031342 Ga0070689_1000313422 537
314 3300005353 Ga0070669_100025108 Ga0070669_1000251083 537
315 3300005365 Ga0070688_100015583 Ga0070688_1000155834 537
316 3300005438 Ga0070701_10022640 Ga0070701_100226403 537
317 3300005444 Ga0070694_100013111 Ga0070694_1000131113 537
318 3300005458 Ga0070681_10001002 Ga0070681_1000100218 537
319 3300005466 Ga0070685_10004063 Ga0070685_100040634 537
320 3300005471 Ga0070698_100198590 Ga0070698_1001985901 537
321 3300005535 Ga0070684_100011241 Ga0070684_1000112415 537
322 3300005546 Ga0070696_100002552 Ga0070696_1000025526 537
323 3300005546 Ga0070696_100100952 Ga0070696_1001009521 537
324 3300005617 Ga0068859_100077737 Ga0068859_1000777372 537
325 3300005617 Ga0068859_100092494 Ga0068859_1000924943 537
326 3300005618 Ga0068864_100139556 Ga0068864_1001395562 537
327 3300005841 Ga0068863_100002643 Ga0068863_1000026433 537
328 3300005841 Ga0068863_100050945 Ga0068863_1000509452 537
329 3300005985 Ga0081539_10000075 Ga0081539_1000007598 537
330 3300006931 Ga0097620_100077735 Ga0097620_1000777352 537
331 3300006931 Ga0097620_100092499 Ga0097620_1000924993 537
332 3300009176 Ga0105242_10024568 Ga0105242_100245682 537
333 3300013306 Ga0163162_10037185 Ga0163162_100371854 537
334 3300013306 Ga0163162_10069363 Ga0163162_100693634 537
335 3300013308 Ga0157375_10009344 Ga0157375_100093446 537
336 3300025923 Ga0207681_10018912 Ga0207681_100189123 537
337 3300025925 Ga0207650_10046953 Ga0207650_100469531 537
338 3300025934 Ga0207686_10000998 Ga0207686_1000099810 537
339 3300025934 Ga0207686_10019648 Ga0207686_100196481 537
340 3300025936 Ga0207670_10003276 Ga0207670_100032764 537
341 3300025936 Ga0207670_10004819 Ga0207670_100048192 537
342 3300025961 Ga0207712_10002419 Ga0207712_100024195 537
343 3300025961 Ga0207712_10020414 Ga0207712_100204142 537
344 3300025986 Ga0207658_10047481 Ga0207658_100474812 537
345 3300026075 Ga0207708_10058078 Ga0207708_100580782 537
346 3300026088 Ga0207641_10000637 Ga0207641_1000063715 537
347 3300026088 Ga0207641_10033364 Ga0207641_100333642 537
348 3300026095 Ga0207676_10107257 Ga0207676_101072572 537
349 3300026118 Ga0207675_100002116 Ga0207675_1000021168 537
350 3300028380 Ga0268265_10086772 Ga0268265_100867722 537
351 3300031238 Ga0265332_10000647 Ga0265332_100006472 537
352 3300035691 Ga0373931_0011261 Ga0373931_0011261_1354_3045 537
353 3300046459 Ga0495629_0007537 Ga0495629_0007537_6298_7989 537
354 3300048912 Ga0496109_0057224 Ga0496109_0057224_347_2038 537
355 3300048916 Ga0496113_0016974 Ga0496113_0016974_476_2167 537
356 3300050511 nmdc:mga08y16_198652_c1 nmdc:mga08y16_198652_c1_344_2032 537
357 iso_pu_bacteria 8055588893 8055589502 537
358 3300005293 Ga0065715_10110885 Ga0065715_101108852 538
359 3300005328 Ga0070676_10002150 Ga0070676_100021503 538
360 3300005328 Ga0070676_10036538 Ga0070676_100365382 538
361 3300005329 Ga0070683_100023472 Ga0070683_1000234722 538
362 3300005330 Ga0070690_100091571 Ga0070690_1000915711 538
363 3300005338 Ga0068868_100033386 Ga0068868_1000333862 538
364 3300005344 Ga0070661_100004928 Ga0070661_1000049285 538
365 3300005344 Ga0070661_100005360 Ga0070661_1000053605 538
366 3300005347 Ga0070668_100044258 Ga0070668_1000442582 538
367 3300005366 Ga0070659_100005686 Ga0070659_1000056862 538
368 3300005366 Ga0070659_100030512 Ga0070659_1000305122 538
369 3300005441 Ga0070700_100076147 Ga0070700_1000761471 538
370 3300005457 Ga0070662_100001076 Ga0070662_10000107611 538
371 3300005458 Ga0070681_10000071 Ga0070681_1000007136 538
372 3300005535 Ga0070684_100005238 Ga0070684_1000052385 538
373 3300005539 Ga0068853_100016861 Ga0068853_1000168614 538
374 3300005543 Ga0070672_100010953 Ga0070672_1000109533 538
375 3300005544 Ga0070686_100014728 Ga0070686_1000147282 538
376 3300005548 Ga0070665_100013512 Ga0070665_1000135129 538
377 3300005563 Ga0068855_100042733 Ga0068855_1000427333 538
378 3300005564 Ga0070664_100002918 Ga0070664_1000029187 538
379 3300005564 Ga0070664_100007602 Ga0070664_1000076025 538
380 3300005577 Ga0068857_100000653 Ga0068857_1000006536 538
381 3300005577 Ga0068857_100003525 Ga0068857_1000035257 538
382 3300005617 Ga0068859_100120838 Ga0068859_1001208383 538
383 3300005719 Ga0068861_100030583 Ga0068861_1000305833 538
384 3300005719 Ga0068861_100076092 Ga0068861_1000760922 538
385 3300005841 Ga0068863_100096651 Ga0068863_1000966511 538
386 3300005844 Ga0068862_100005874 Ga0068862_1000058746 538
387 3300006844 Ga0075428_100117405 Ga0075428_1001174053 538
388 3300006846 Ga0075430_100008299 Ga0075430_1000082991 538
389 3300006847 Ga0075431_100117422 Ga0075431_1001174223 538
390 3300006847 Ga0075431_100197582 Ga0075431_1001975822 538
391 3300006871 Ga0075434_100004685 Ga0075434_1000046858 538
392 3300006931 Ga0097620_100120828 Ga0097620_1001208283 538
393 3300009098 Ga0105245_10093422 Ga0105245_100934222 538
394 3300009147 Ga0114129_10046425 Ga0114129_100464252 538
395 3300013307 Ga0157372_10060380 Ga0157372_100603803 538
396 3300025298 Ga0209050_1002617 Ga0209050_10026174 538
397 3300025901 Ga0207688_10008017 Ga0207688_100080172 538
398 3300025907 Ga0207645_10002232 Ga0207645_100022323 538
399 3300025918 Ga0207662_10032319 Ga0207662_100323193 538
400 3300025920 Ga0207649_10011854 Ga0207649_100118543 538
401 3300025932 Ga0207690_10039094 Ga0207690_100390942 538
402 3300025933 Ga0207706_10000494 Ga0207706_1000049433 538
403 3300025936 Ga0207670_10027340 Ga0207670_100273402 538
404 3300025940 Ga0207691_10000914 Ga0207691_1000091420 538
405 3300025944 Ga0207661_10015790 Ga0207661_100157905 538
406 3300025945 Ga0207679_10003308 Ga0207679_100033085 538
407 3300025945 Ga0207679_10007619 Ga0207679_100076196 538
408 3300025949 Ga0207667_10168859 Ga0207667_101688592 538
409 3300026023 Ga0207677_10015482 Ga0207677_100154822 538
410 3300026035 Ga0207703_10101179 Ga0207703_101011792 538
411 3300026075 Ga0207708_10009532 Ga0207708_100095325 538
412 3300026089 Ga0207648_10106021 Ga0207648_101060213 538
413 3300026116 Ga0207674_10001313 Ga0207674_1000131314 538
414 3300026116 Ga0207674_10001764 Ga0207674_100017646 538
415 3300026118 Ga0207675_100003210 Ga0207675_10000321012 538
416 3300027907 Ga0207428_10111494 Ga0207428_101114942 538
417 3300028380 Ga0268265_10079730 Ga0268265_100797302 538
418 3300031456 Ga0307513_10021988 Ga0307513_100219885 538
419 3300031548 Ga0307408_100006344 Ga0307408_1000063444 538
420 3300031911 Ga0307412_10011841 Ga0307412_100118414 538
421 3300032002 Ga0307416_100066279 Ga0307416_1000662792 538
422 3300035170 Ga0373943_0016519 Ga0373943_0016519_1118_2827 538
423 3300046460 Ga0495638_0000156 Ga0495638_0000156_33360_35063 538
424 3300046473 Ga0495582_0028223 Ga0495582_0028223_826_2520 538
425 3300048924 Ga0496121_0000007 Ga0496121_0000007_149293_150969 538
426 3300050509 nmdc:mga0qj67_25986_c1 nmdc:mga0qj67_25986_c1_252_1946 538
427 3300050510 nmdc:mga06r32_111989_c1 nmdc:mga06r32_111989_c1_332_2035 538
428 3300050511 nmdc:mga08y16_26164_c1 nmdc:mga08y16_26164_c1_3469_5172 538
429 3300053153 Ga0500616_0000082 Ga0500616_0000082_182931_184634 538
430 iso_pu_bacteria 2738541283 2738757745 538
431 iso_pu_bacteria 2919186247 2919187297 538
432 iso_pu_bacteria 2939664404 2939665434 538
433 3300005288 Ga0065714_10082178 Ga0065714_100821782 539
434 3300005290 Ga0065712_10000416 Ga0065712_100004161 539
435 3300005293 Ga0065715_10096001 Ga0065715_100960013 539
436 3300005328 Ga0070676_10016966 Ga0070676_100169665 539
437 3300005330 Ga0070690_100034686 Ga0070690_1000346862 539
438 3300005331 Ga0070670_100007329 Ga0070670_1000073294 539
439 3300005336 Ga0070680_100067420 Ga0070680_1000674202 539
440 3300005340 Ga0070689_100010729 Ga0070689_1000107293 539
441 3300005343 Ga0070687_100001730 Ga0070687_1000017304 539
442 3300005344 Ga0070661_100005947 Ga0070661_1000059476 539
443 3300005353 Ga0070669_100022394 Ga0070669_1000223942 539
444 3300005354 Ga0070675_100004866 Ga0070675_1000048664 539
445 3300005354 Ga0070675_100012020 Ga0070675_1000120204 539
446 3300005367 Ga0070667_100087642 Ga0070667_1000876422 539
447 3300005440 Ga0070705_100018376 Ga0070705_1000183762 539
448 3300005456 Ga0070678_100030744 Ga0070678_1000307443 539
449 3300005457 Ga0070662_100009132 Ga0070662_1000091323 539
450 3300005466 Ga0070685_10006602 Ga0070685_100066023 539
451 3300005535 Ga0070684_100023998 Ga0070684_1000239984 539
452 3300005544 Ga0070686_100001850 Ga0070686_10000185010 539
453 3300005548 Ga0070665_100017804 Ga0070665_1000178042 539
454 3300005564 Ga0070664_100017557 Ga0070664_1000175576 539
455 3300005577 Ga0068857_100007356 Ga0068857_1000073565 539
456 3300005615 Ga0070702_100037336 Ga0070702_1000373362 539
457 3300005617 Ga0068859_100047446 Ga0068859_1000474463 539
458 3300005617 Ga0068859_100060022 Ga0068859_1000600224 539
459 3300005618 Ga0068864_100006856 Ga0068864_1000068564 539
460 3300005618 Ga0068864_100007901 Ga0068864_1000079012 539
461 3300005618 Ga0068864_100017480 Ga0068864_1000174803 539
462 3300005719 Ga0068861_100013638 Ga0068861_1000136384 539
463 3300005841 Ga0068863_100002686 Ga0068863_1000026867 539
464 3300005841 Ga0068863_100034719 Ga0068863_1000347192 539
465 3300005843 Ga0068860_100096919 Ga0068860_1000969192 539
466 3300005844 Ga0068862_100011334 Ga0068862_1000113346 539
467 3300005844 Ga0068862_100014464 Ga0068862_1000144643 539
468 3300006844 Ga0075428_100009441 Ga0075428_1000094414 539
469 3300006846 Ga0075430_100001053 Ga0075430_10000105314 539
470 3300006847 Ga0075431_100011043 Ga0075431_1000110439 539
471 3300006847 Ga0075431_100014396 Ga0075431_1000143967 539
472 3300006880 Ga0075429_100000243 Ga0075429_1000002437 539
473 3300006931 Ga0097620_100047446 Ga0097620_1000474463 539
474 3300006931 Ga0097620_100060021 Ga0097620_1000600214 539
475 3300009094 Ga0111539_10040488 Ga0111539_100404882 539
476 3300009098 Ga0105245_10070023 Ga0105245_100700232 539
477 3300009147 Ga0114129_10000308 Ga0114129_1000030848 539
478 3300009148 Ga0105243_10030569 Ga0105243_100305692 539
479 3300009553 Ga0105249_10064315 Ga0105249_100643153 539
480 3300009553 Ga0105249_10162291 Ga0105249_101622911 539
481 3300013308 Ga0157375_10277080 Ga0157375_102770802 539
482 3300014326 Ga0157380_10104166 Ga0157380_101041662 539
483 3300014968 Ga0157379_10038215 Ga0157379_100382154 539
484 3300025900 Ga0207710_10001419 Ga0207710_100014194 539
485 3300025901 Ga0207688_10017774 Ga0207688_100177742 539
486 3300025907 Ga0207645_10057490 Ga0207645_100574902 539
487 3300025908 Ga0207643_10004176 Ga0207643_100041762 539
488 3300025917 Ga0207660_10047825 Ga0207660_100478252 539
489 3300025918 Ga0207662_10043131 Ga0207662_100431313 539
490 3300025926 Ga0207659_10003683 Ga0207659_100036835 539
491 3300025926 Ga0207659_10084408 Ga0207659_100844081 539
492 3300025933 Ga0207706_10051989 Ga0207706_100519893 539
493 3300025933 Ga0207706_10169891 Ga0207706_101698911 539
494 3300025940 Ga0207691_10030013 Ga0207691_100300133 539
495 3300025942 Ga0207689_10007182 Ga0207689_100071826 539
496 3300025945 Ga0207679_10028954 Ga0207679_100289542 539
497 3300025960 Ga0207651_10082060 Ga0207651_100820601 539
498 3300025986 Ga0207658_10046192 Ga0207658_100461921 539
499 3300026075 Ga0207708_10016241 Ga0207708_100162413 539
500 3300026088 Ga0207641_10032020 Ga0207641_100320202 539
501 3300026089 Ga0207648_10017045 Ga0207648_100170453 539
502 3300026095 Ga0207676_10004478 Ga0207676_100044784 539
503 3300026095 Ga0207676_10019563 Ga0207676_100195632 539
504 3300026095 Ga0207676_10020245 Ga0207676_100202452 539
505 3300026116 Ga0207674_10008347 Ga0207674_100083478 539
506 3300026118 Ga0207675_100003772 Ga0207675_1000037729 539
507 3300026118 Ga0207675_100033955 Ga0207675_1000339552 539
508 3300026121 Ga0207683_10017645 Ga0207683_100176455 539
509 3300028379 Ga0268266_10011305 Ga0268266_100113052 539
510 3300028380 Ga0268265_10020040 Ga0268265_100200402 539
511 3300028380 Ga0268265_10020727 Ga0268265_100207273 539
512 3300048907 Ga0496104_0029345 Ga0496104_0029345_509_2191 539
513 3300048912 Ga0496109_0013211 Ga0496109_0013211_1724_3406 539
514 3300048916 Ga0496113_0003993 Ga0496113_0003993_3958_5640 539
515 3300050507 nmdc:mga05p37_4977_c1 nmdc:mga05p37_4977_c1_2561_4255 539
516 3300050508 nmdc:mga09592_391_c1 nmdc:mga09592_391_c1_27896_29590 539
517 3300050509 nmdc:mga0qj67_905_c2 nmdc:mga0qj67_905_c2_549_2243 539
518 3300050510 nmdc:mga06r32_8273_c2 nmdc:mga06r32_8273_c2_375_2069 539
519 3300050511 nmdc:mga08y16_92063_c1 nmdc:mga08y16_92063_c1_455_2149 539
520 3300005548 Ga0070665_100117742 Ga0070665_1001177422 540
521 3300005718 Ga0068866_10016136 Ga0068866_100161361 540
522 3300028380 Ga0268265_10160067 Ga0268265_101600671 540
523 3300036712 Ga0316584_0052706 Ga0316584_0052706_150_1871 540
524 3300046665 Ga0495661_0021927 Ga0495661_0021927_2161_3873 540
525 3300050510 nmdc:mga06r32_41909_c1 nmdc:mga06r32_41909_c1_305_2005 540
526 iso_pu_bacteria 2884791551 2884792077 540
527 iso_pu_bacteria 2929921140 2929924406 540
528 iso_pu_bacteria 8003151029 8003155366 540
529 3300006195 Ga0075366_10000301 Ga0075366_100003016 541
530 3300053080 Ga0500635_0000557 Ga0500635_0000557_3391_5103 541
531 iso_pu_bacteria 2818991460 2819678552 541
532 iso_pu_bacteria 2883068021 2883071972 541
533 iso_pu_bacteria 2884791551 2884794120 541
534 iso_pu_bacteria 2896109856 2896110748 541
535 iso_pu_bacteria 2896109856 2896111999 541
536 3300003323 rootH1_10012634 rootH1_100126349 542
537 3300003354 JGI25160J50197_1004764 JGI25160J50197_10047643 542
538 3300003354 JGI25160J50197_1006581 JGI25160J50197_10065812 542
539 3300003790 Ga0055528_1001024 Ga0055528_10010245 542
540 3300003791 Ga0055530_10001218 Ga0055530_1000121816 542
541 3300005262 Ga0065165_1000228 Ga0065165_100022849 542
542 3300005543 Ga0070672_100016746 Ga0070672_1000167463 542
543 3300005563 Ga0068855_100001185 Ga0068855_10000118514 542
544 3300005842 Ga0068858_100036056 Ga0068858_1000360562 542
545 3300006178 Ga0075367_10007875 Ga0075367_100078755 542
546 3300006844 Ga0075428_100021993 Ga0075428_1000219933 542
547 3300009093 Ga0105240_10000022 Ga0105240_1000002227 542
548 3300009094 Ga0111539_10019310 Ga0111539_100193103 542
549 3300009094 Ga0111539_10089502 Ga0111539_100895023 542
550 3300013104 Ga0157370_10000132 Ga0157370_1000013256 542
551 3300013297 Ga0157378_10108845 Ga0157378_101088452 542
552 3300014325 Ga0163163_10006007 Ga0163163_100060079 542
553 3300014497 Ga0182008_10000954 Ga0182008_100009545 542
554 3300014745 Ga0157377_10001475 Ga0157377_100014754 542
555 3300015261 Ga0182006_1000418 Ga0182006_100041816 542
556 3300025273 Ga0209673_1000016 Ga0209673_1000016163 542
557 3300025295 Ga0209564_1011183 Ga0209564_10111832 542
558 3300025295 Ga0209564_1011455 Ga0209564_10114552 542
559 3300025297 Ga0209758_1007200 Ga0209758_10072006 542
560 3300025297 Ga0209758_1012031 Ga0209758_10120312 542
561 3300025298 Ga0209050_1000124 Ga0209050_100012416 542
562 3300025302 Ga0207426_1001572 Ga0207426_10015729 542
563 3300025302 Ga0207426_1001894 Ga0207426_100189410 542
564 3300025913 Ga0207695_10000022 Ga0207695_10000022492 542
565 3300025913 Ga0207695_10071704 Ga0207695_100717043 542
566 3300025940 Ga0207691_10020187 Ga0207691_100201873 542
567 3300026035 Ga0207703_10024730 Ga0207703_100247301 542
568 3300028794 Ga0307515_10001652 Ga0307515_100016529 542
569 3300031251 Ga0265327_10023360 Ga0265327_100233603 542
570 3300046558 Ga0495633_0000176 Ga0495633_0000176_45642_47342 542
571 3300048912 Ga0496109_0028307 Ga0496109_0028307_594_2297 542
572 3300048925 Ga0496122_0001437 Ga0496122_0001437_24370_26061 542
573 3300048926 Ga0496123_0003831 Ga0496123_0003831_6553_8244 542
574 3300050511 nmdc:mga08y16_36100_c1 nmdc:mga08y16_36100_c1_3218_4909 542
575 3300053131 Ga0500652_005630 Ga0500652_005630_1267_2964 542
576 3300003316 rootH1_10015726 rootH1_100157266 543
577 3300003320 rootH2_10005324 rootH2_1000532436 543
578 3300003320 rootH2_10009745 rootH2_100097452 543
579 3300003322 rootL2_10107065 rootL2_101070652 543
580 3300003322 rootL2_10369576 rootL2_103695762 543
581 3300003323 rootH1_10000238 rootH1_100002382 543
582 3300003323 rootH1_10002552 rootH1_100025526 543
583 3300003323 rootH1_10002735 rootH1_100027358 543
584 3300003323 rootH1_10007412 rootH1_1000741233 543
585 3300003323 rootH1_10028939 rootH1_100289393 543
586 3300003354 JGI25160J50197_1000376 JGI25160J50197_100037611 543
587 3300005329 Ga0070683_100005706 Ga0070683_1000057062 543
588 3300005331 Ga0070670_100112112 Ga0070670_1001121121 543
589 3300005335 Ga0070666_10007985 Ga0070666_100079852 543
590 3300005340 Ga0070689_100113340 Ga0070689_1001133402 543
591 3300005353 Ga0070669_100016316 Ga0070669_1000163162 543
592 3300005354 Ga0070675_100018198 Ga0070675_1000181983 543
593 3300005364 Ga0070673_100011320 Ga0070673_1000113203 543
594 3300005367 Ga0070667_100067050 Ga0070667_1000670501 543
595 3300005457 Ga0070662_100008148 Ga0070662_1000081484 543
596 3300005459 Ga0068867_100057109 Ga0068867_1000571091 543
597 3300005548 Ga0070665_100000008 Ga0070665_100000008210 543
598 3300005563 Ga0068855_100029754 Ga0068855_1000297545 543
599 3300005564 Ga0070664_100117651 Ga0070664_1001176511 543
600 3300005577 Ga0068857_100047826 Ga0068857_1000478263 543
601 3300005614 Ga0068856_100058180 Ga0068856_1000581802 543
602 3300005616 Ga0068852_100017709 Ga0068852_1000177093 543
603 3300005617 Ga0068859_100000041 Ga0068859_100000041102 543
604 3300005617 Ga0068859_100008581 Ga0068859_1000085816 543
605 3300005618 Ga0068864_100012222 Ga0068864_1000122222 543
606 3300005719 Ga0068861_100005205 Ga0068861_1000052056 543
607 3300005841 Ga0068863_100003228 Ga0068863_1000032289 543
608 3300005841 Ga0068863_100171856 Ga0068863_1001718561 543
609 3300005843 Ga0068860_100000029 Ga0068860_10000002958 543
610 3300005843 Ga0068860_100008154 Ga0068860_10000815410 543
611 3300005843 Ga0068860_100009116 Ga0068860_10000911610 543
612 3300005843 Ga0068860_100012595 Ga0068860_1000125958 543
613 3300005844 Ga0068862_100052186 Ga0068862_1000521863 543
614 3300005985 Ga0081539_10034692 Ga0081539_100346921 543
615 3300006195 Ga0075366_10005936 Ga0075366_100059362 543
616 3300006237 Ga0097621_100013313 Ga0097621_1000133134 543
617 3300006237 Ga0097621_100046232 Ga0097621_1000462322 543
618 3300006358 Ga0068871_100005674 Ga0068871_1000056747 543
619 3300006931 Ga0097620_100000041 Ga0097620_10000004161 543
620 3300006931 Ga0097620_100008581 Ga0097620_1000085818 543
621 3300009093 Ga0105240_10005775 Ga0105240_100057752 543
622 3300009094 Ga0111539_10003619 Ga0111539_1000361911 543
623 3300009174 Ga0105241_10020357 Ga0105241_100203572 543
624 3300009174 Ga0105241_10049452 Ga0105241_100494522 543
625 3300009545 Ga0105237_10003342 Ga0105237_100033429 543
626 3300009545 Ga0105237_10035161 Ga0105237_100351613 543
627 3300010375 Ga0105239_10077390 Ga0105239_100773902 543
628 3300010375 Ga0105239_10112386 Ga0105239_101123862 543
629 3300011119 Ga0105246_10064207 Ga0105246_100642072 543
630 3300013104 Ga0157370_10038907 Ga0157370_100389073 543
631 3300013296 Ga0157374_10050474 Ga0157374_100504742 543
632 3300013297 Ga0157378_10003189 Ga0157378_1000318912 543
633 3300013297 Ga0157378_10041154 Ga0157378_100411542 543
634 3300013306 Ga0163162_10000038 Ga0163162_1000003837 543
635 3300013306 Ga0163162_10000546 Ga0163162_1000054626 543
636 3300013306 Ga0163162_10006412 Ga0163162_100064124 543
637 3300013308 Ga0157375_10071752 Ga0157375_100717522 543
638 3300013308 Ga0157375_10262369 Ga0157375_102623691 543
639 3300014326 Ga0157380_10003457 Ga0157380_100034574 543
640 3300014326 Ga0157380_10074202 Ga0157380_100742021 543
641 3300014745 Ga0157377_10000700 Ga0157377_1000070011 543
642 3300014745 Ga0157377_10003779 Ga0157377_100037792 543
643 3300014969 Ga0157376_10007058 Ga0157376_100070589 543
644 3300025302 Ga0207426_1000026 Ga0207426_1000026435 543
645 3300025903 Ga0207680_10000029 Ga0207680_1000002940 543
646 3300025908 Ga0207643_10068925 Ga0207643_100689251 543
647 3300025913 Ga0207695_10000686 Ga0207695_1000068616 543
648 3300025914 Ga0207671_10008328 Ga0207671_100083283 543
649 3300025923 Ga0207681_10009868 Ga0207681_100098683 543
650 3300025927 Ga0207687_10036322 Ga0207687_100363222 543
651 3300025933 Ga0207706_10008493 Ga0207706_100084939 543
652 3300025942 Ga0207689_10002450 Ga0207689_100024507 543
653 3300025942 Ga0207689_10039516 Ga0207689_100395162 543
654 3300025945 Ga0207679_10058235 Ga0207679_100582352 543
655 3300025949 Ga0207667_10005713 Ga0207667_1000571313 543
656 3300025972 Ga0207668_10010298 Ga0207668_100102984 543
657 3300025986 Ga0207658_10137665 Ga0207658_101376652 543
658 3300026078 Ga0207702_10049621 Ga0207702_100496212 543
659 3300026088 Ga0207641_10000044 Ga0207641_10000044114 543
660 3300026089 Ga0207648_10104438 Ga0207648_101044382 543
661 3300026116 Ga0207674_10003326 Ga0207674_100033267 543
662 3300026118 Ga0207675_100000051 Ga0207675_10000005153 543
663 3300026142 Ga0207698_10049230 Ga0207698_100492302 543
664 3300026142 Ga0207698_10051247 Ga0207698_100512472 543
665 3300027907 Ga0207428_10013362 Ga0207428_100133626 543
666 3300028379 Ga0268266_10000016 Ga0268266_10000016208 543
667 3300028379 Ga0268266_10107275 Ga0268266_101072752 543
668 3300028380 Ga0268265_10018882 Ga0268265_100188823 543
669 3300028381 Ga0268264_10000072 Ga0268264_1000007259 543
670 3300028381 Ga0268264_10017550 Ga0268264_100175501 543
671 3300028381 Ga0268264_10098967 Ga0268264_100989671 543
672 3300028381 Ga0268264_10168024 Ga0268264_101680242 543
673 3300031251 Ga0265327_10004167 Ga0265327_100041673 543
674 3300031507 Ga0307509_10021227 Ga0307509_100212272 543
675 3300031712 Ga0265342_10031964 Ga0265342_100319642 543
676 3300032004 Ga0307414_10083559 Ga0307414_100835592 543
677 3300046460 Ga0495638_0000004 Ga0495638_0000004_678571_680265 543
678 3300046524 Ga0495648_0000348 Ga0495648_0000348_4165_5865 543
679 3300047443 Ga0495687_000004 Ga0495687_000004_326379_328079 543
680 3300048915 Ga0496112_0064120 Ga0496112_0064120_1214_2929 543
681 3300048918 Ga0496115_0015939 Ga0496115_0015939_1395_3095 543
682 3300049670 Ga0501236_000136 Ga0501236_000136_288_1982 543
683 3300049675 Ga0501243_000825 Ga0501243_000825_401_2101 543
684 3300049688 Ga0501259_001854 Ga0501259_001854_1234_2934 543
685 3300049761 Ga0501264_000168 Ga0501264_000168_4514_6208 543
686 3300050511 nmdc:mga08y16_33730_c1 nmdc:mga08y16_33730_c1_1334_3028 543
687 3300053088 Ga0500644_0001758 Ga0500644_0001758_1229_2923 543
688 3300053092 Ga0500583_0000927 Ga0500583_0000927_3812_5512 543
689 3300053105 Ga0500557_002379 Ga0500557_002379_452_2146 543
690 3300053139 Ga0500568_0007246 Ga0500568_0007246_1204_2904 543
691 3300053151 Ga0500604_0012502 Ga0500604_0012502_423_2117 543
692 3300053153 Ga0500616_0000015 Ga0500616_0000015_150581_152275 543
693 3300053153 Ga0500616_0015760 Ga0500616_0015760_2323_4017 543
694 3300053156 Ga0500622_0000009 Ga0500622_0000009_413318_415012 543
695 3300053156 Ga0500622_0000096 Ga0500622_0000096_7531_9225 543
696 3300053156 Ga0500622_0003253 Ga0500622_0003253_2386_4080 543
697 iso_pu_bacteria 2896109856 2896110363 543
698 3300013100 Ga0157373_10003763 Ga0157373_100037637 544
699 3300025302 Ga0207426_1000002 Ga0207426_1000002913 544
700 3300048917 Ga0496114_0092553 Ga0496114_0092553_347_2050 544
701 iso_pu_bacteria 2884791551 2884792078 544
702 iso_pu_bacteria 2929177148 2929181941 544
703 iso_pu_bacteria 2929921140 2929924407 544
704 iso_pu_bacteria 2945977869 2945977879 544
705 iso_pu_bacteria 2946013367 2946016270 544
706 iso_pu_bacteria 8003151029 8003155365 544
707 3300005289 Ga0065704_10113484 Ga0065704_101134841 545
708 3300013308 Ga0157375_10031471 Ga0157375_100314715 545
709 3300031616 Ga0307508_10005018 Ga0307508_100050186 545
710 3300031665 Ga0316575_10000740 Ga0316575_100007405 545
711 3300047320 Ga0495672_0075408 Ga0495672_0075408_128_1852 545
712 3300031731 Ga0307405_10035592 Ga0307405_100355923 546
713 3300031824 Ga0307413_10002877 Ga0307413_100028775 546
714 3300031995 Ga0307409_100041559 Ga0307409_1000415592 546
715 3300042876 Ga0451577_0059330 Ga0451577_0059330_1426_3123 546
716 3300044712 Ga0453684_0007730 Ga0453684_0007730_1364_3061 546
717 3300045051 Ga0451576_0067534 Ga0451576_0067534_1188_2885 546
718 3300048911 Ga0496108_0122397 Ga0496108_0122397_478_2202 546
719 3300005334 Ga0068869_100064614 Ga0068869_1000646142 547
720 3300005347 Ga0070668_100039649 Ga0070668_1000396492 547
721 3300005353 Ga0070669_100110698 Ga0070669_1001106982 547
722 3300005456 Ga0070678_100019043 Ga0070678_1000190431 547
723 3300005459 Ga0068867_100070014 Ga0068867_1000700142 547
724 3300005548 Ga0070665_100028807 Ga0070665_1000288073 547
725 3300006237 Ga0097621_100114411 Ga0097621_1001144111 547
726 3300006358 Ga0068871_100029795 Ga0068871_1000297953 547
727 3300011119 Ga0105246_10033596 Ga0105246_100335962 547
728 3300025942 Ga0207689_10006705 Ga0207689_100067052 547
729 3300026089 Ga0207648_10002156 Ga0207648_1000215620 547
730 3300026121 Ga0207683_10027125 Ga0207683_100271253 547
731 3300028379 Ga0268266_10023629 Ga0268266_100236292 547
732 3300001979 JGI24740J21852_10007451 JGI24740J21852_100074512 548
733 3300002738 JGI25154J39366_1000012 JGI25154J39366_100001272 548
734 3300003354 JGI25160J50197_1004764 JGI25160J50197_10047642 548
735 3300003794 Ga0055531_10000357 Ga0055531_1000035726 548
736 3300025246 Ga0209646_1000009 Ga0209646_1000009202 548
737 3300025250 Ga0209026_1000197 Ga0209026_100019714 548
738 3300025297 Ga0209758_1007200 Ga0209758_10072007 548
739 3300025302 Ga0207426_1001572 Ga0207426_10015728 548
740 3300025304 Ga0209257_1000013 Ga0209257_1000013606 548

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

55

98

0.94

PF05199

GMC_oxred_C

GMC oxidoreductase

467

587

0.93

PF00732

GMC_oxred_N

GMC oxidoreductase

51

378

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bke-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodisulfide reductase core and mobile arm in conformational state 2, composite structure) 1 14 44
4yry-assembly2.cif.gz_D insights into flavin-based electron bifurcation via the nadh-dependent reduced ferredoxin-nadp oxidoreductase structure 0.9927 14 44
3f8d-assembly2.cif.gz_D structure of sulfolobus solfataricus thioredoxin reductase mutant c147a 0.9802 12 41
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9798 14 41
3f8r-assembly2.cif.gz_D crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9774 12 41
ID Description Score Start End Superfamily
4zn0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9854 11 43 3.50.50.60
3k30B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9839 14 44 3.40.50.720
2q7vB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9808 11 44 3.50.50.60
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9806 14 44 3.50.50.60
3f8dD01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9802 12 41 3.50.50.60
ID Description Score Start End GO Terms
AF-K1LUE5-F1-model_v4 Gluconate 2-dehydrogenase flavoprotein (EC 1.1.99.3) 0.9883 408 543 GO:0033717
AF-A0A4Q6A5P3-F1-model_v4 GMC family oxidoreductase 0.9865 9 308 GO:0016614
GO:0050660
AF-A0A426H6A0-F1-model_v4 deleted 0.9848 10 325
AF-A0A2T2YPS2-F1-model_v4 GMC family oxidoreductase 0.9812 23 548 GO:0016614
GO:0050660
AF-A0A3D1I3S0-F1-model_v4 deleted 0.9811 46 324

Feature Viewer

pLDDT pTM Quality
94.69 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map