F478492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 251 | 1478 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_767677_c1|nmdc:mga0rr50_767677_c1_268_657 |
| Length | 129 |
| Sequence | LSQQILEGIFGRVREMDYAEVRKMSVNVTPLHDRVLVRRLEEKETAKGGIIIPDTAKEKPQEGEVMAIGAGKMEKGRRVPLDVKVGDRILFGKYTGNDISIDDQEYLILREDEILLKLSGMAKAVSGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 83 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 84 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 89 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Metagenome | Rhizosphere |
| 122 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 154 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 155 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 156 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.96 |
| Metatranscriptomes | 12.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.03 |
| Rhizosphere | 97.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0rr50_767677_c1 | 3300050513 | Bacteria | 823 |
| 2 | Ga0065704_10276480 | 3300005289 | Bacteria | 932 |
| 3 | Ga0065715_10191425 | 3300005293 | Bacteria | 1413 |
| 4 | Ga0068869_100330158 | 3300005334 | Bacteria | 1239 |
| 5 | Ga0070680_101454346 | 3300005336 | Unclassified | 593 |
| 6 | Ga0070682_100992407 | 3300005337 | Bacteria | 696 |
| 7 | Ga0070660_101237603 | 3300005339 | Bacteria | 633 |
| 8 | Ga0070689_101688833 | 3300005340 | Unclassified | 576 |
| 9 | Ga0070691_10971178 | 3300005341 | Bacteria | 528 |
| 10 | Ga0070687_100129656 | 3300005343 | Bacteria | 1454 |
| 11 | Ga0070674_101154010 | 3300005356 | Bacteria | 686 |
| 12 | Ga0070659_101361458 | 3300005366 | Bacteria | 630 |
| 13 | Ga0070667_101082405 | 3300005367 | Bacteria | 749 |
| 14 | Ga0070709_10017405 | 3300005434 | Bacteria | 4122 |
| 15 | Ga0070709_10028219 | 3300005434 | Bacteria | 3346 |
| 16 | Ga0070709_10096355 | 3300005434 | Bacteria | 1962 |
| 17 | Ga0070709_10125464 | 3300005434 | Bacteria | 1746 |
| 18 | Ga0070709_10446839 | 3300005434 | Bacteria | 973 |
| 19 | Ga0070709_10938083 | 3300005434 | Bacteria | 686 |
| 20 | Ga0070709_10947837 | 3300005434 | Bacteria | 683 |
| 21 | Ga0070714_100686245 | 3300005435 | Bacteria | 987 |
| 22 | Ga0070714_102514069 | 3300005435 | Bacteria | 500 |
| 23 | Ga0070713_100015424 | 3300005436 | Bacteria | 5712 |
| 24 | Ga0070713_100200350 | 3300005436 | Bacteria | 1802 |
| 25 | Ga0070713_100210628 | 3300005436 | Bacteria | 1759 |
| 26 | Ga0070713_100686766 | 3300005436 | Bacteria | 977 |
| 27 | Ga0070713_101354096 | 3300005436 | Bacteria | 690 |
| 28 | Ga0070713_101381388 | 3300005436 | Bacteria | 683 |
| 29 | Ga0070710_10068999 | 3300005437 | Bacteria | 2033 |
| 30 | Ga0070710_10089634 | 3300005437 | Bacteria | 1812 |
| 31 | Ga0070710_10100415 | 3300005437 | Bacteria | 1722 |
| 32 | Ga0070710_11323136 | 3300005437 | Bacteria | 536 |
| 33 | Ga0070710_11422335 | 3300005437 | Bacteria | 519 |
| 34 | Ga0070711_100009336 | 3300005439 | Bacteria | 6038 |
| 35 | Ga0070711_100021952 | 3300005439 | Bacteria | 4132 |
| 36 | Ga0070711_100305362 | 3300005439 | Bacteria | 1267 |
| 37 | Ga0070711_100388568 | 3300005439 | Bacteria | 1130 |
| 38 | Ga0070711_101092854 | 3300005439 | Bacteria | 687 |
| 39 | Ga0070705_100916734 | 3300005440 | Unclassified | 706 |
| 40 | Ga0070708_100029271 | 3300005445 | Bacteria | 4748 |
| 41 | Ga0070708_100033585 | 3300005445 | Bacteria | 4457 |
| 42 | Ga0070708_100171407 | 3300005445 | Bacteria | 2026 |
| 43 | Ga0070708_100255852 | 3300005445 | Bacteria | 1645 |
| 44 | Ga0070708_100262074 | 3300005445 | Bacteria | 1625 |
| 45 | Ga0070708_100524113 | 3300005445 | Bacteria | 1118 |
| 46 | Ga0070708_100662205 | 3300005445 | Bacteria | 983 |
| 47 | Ga0070708_101533585 | 3300005445 | Bacteria | 621 |
| 48 | Ga0068867_101924738 | 3300005459 | Bacteria | 558 |
| 49 | Ga0070706_100079807 | 3300005467 | Bacteria | 3029 |
| 50 | Ga0070706_100292478 | 3300005467 | Bacteria | 1520 |
| 51 | Ga0070706_100359249 | 3300005467 | Bacteria | 1357 |
| 52 | Ga0070706_100570928 | 3300005467 | Bacteria | 1052 |
| 53 | Ga0070706_100849919 | 3300005467 | Unclassified | 844 |
| 54 | Ga0070707_100000272 | 3300005468 | Bacteria | 51273 |
| 55 | Ga0070707_100005954 | 3300005468 | Bacteria | 11376 |
| 56 | Ga0070707_100043596 | 3300005468 | Bacteria | 4293 |
| 57 | Ga0070707_100095547 | 3300005468 | Bacteria | 2878 |
| 58 | Ga0070707_100096313 | 3300005468 | Bacteria | 2866 |
| 59 | Ga0070707_100258919 | 3300005468 | Bacteria | 1693 |
| 60 | Ga0070707_100711914 | 3300005468 | Bacteria | 967 |
| 61 | Ga0070707_101404852 | 3300005468 | Bacteria | 665 |
| 62 | Ga0070707_101828420 | 3300005468 | Bacteria | 575 |
| 63 | Ga0070707_102273918 | 3300005468 | Bacteria | 509 |
| 64 | Ga0070698_100048378 | 3300005471 | Bacteria | 4345 |
| 65 | Ga0070698_100048956 | 3300005471 | Bacteria | 4317 |
| 66 | Ga0070698_100103116 | 3300005471 | Bacteria | 2823 |
| 67 | Ga0070698_101481793 | 3300005471 | Unclassified | 630 |
| 68 | Ga0070699_100036817 | 3300005518 | Bacteria | 4233 |
| 69 | Ga0070699_100110187 | 3300005518 | Bacteria | 2416 |
| 70 | Ga0070699_100164368 | 3300005518 | Bacteria | 1965 |
| 71 | Ga0070699_100343410 | 3300005518 | Bacteria | 1344 |
| 72 | Ga0070699_100378989 | 3300005518 | Bacteria | 1277 |
| 73 | Ga0070699_100580381 | 3300005518 | Bacteria | 1021 |
| 74 | Ga0070699_100620155 | 3300005518 | Unclassified | 987 |
| 75 | Ga0070699_100863279 | 3300005518 | Bacteria | 829 |
| 76 | Ga0070699_100903030 | 3300005518 | Bacteria | 809 |
| 77 | Ga0070699_101468978 | 3300005518 | Bacteria | 625 |
| 78 | Ga0070699_101601184 | 3300005518 | Unclassified | 597 |
| 79 | Ga0070697_100016359 | 3300005536 | Bacteria | 5832 |
| 80 | Ga0070697_100098366 | 3300005536 | Bacteria | 2428 |
| 81 | Ga0070697_100098743 | 3300005536 | Bacteria | 2423 |
| 82 | Ga0070697_100124371 | 3300005536 | Bacteria | 2160 |
| 83 | Ga0070697_100143092 | 3300005536 | Bacteria | 2012 |
| 84 | Ga0070697_100145338 | 3300005536 | Bacteria | 1996 |
| 85 | Ga0070697_100611857 | 3300005536 | Bacteria | 958 |
| 86 | Ga0070697_100760484 | 3300005536 | Bacteria | 856 |
| 87 | Ga0070697_101500052 | 3300005536 | Bacteria | 602 |
| 88 | Ga0070697_101711113 | 3300005536 | Bacteria | 563 |
| 89 | Ga0068853_100862390 | 3300005539 | Bacteria | 869 |
| 90 | Ga0070686_100079701 | 3300005544 | Bacteria | 2165 |
| 91 | Ga0070686_100190878 | 3300005544 | Bacteria | 1462 |
| 92 | Ga0070695_100050684 | 3300005545 | Bacteria | 2662 |
| 93 | Ga0070695_100077154 | 3300005545 | Bacteria | 2195 |
| 94 | Ga0070696_100090703 | 3300005546 | Bacteria | 2175 |
| 95 | Ga0070704_100230605 | 3300005549 | Bacteria | 1510 |
| 96 | Ga0068855_101326213 | 3300005563 | Bacteria | 744 |
| 97 | Ga0068856_101508057 | 3300005614 | Bacteria | 686 |
| 98 | Ga0068859_100085487 | 3300005617 | Bacteria | 3200 |
| 99 | Ga0068859_100908909 | 3300005617 | Unclassified | 965 |
| 100 | Ga0068859_101209633 | 3300005617 | Unclassified | 832 |
| 101 | Ga0068864_101059095 | 3300005618 | Unclassified | 806 |
| 102 | Ga0068861_100436378 | 3300005719 | Bacteria | 1170 |
| 103 | Ga0068863_100006891 | 3300005841 | Bacteria | 11135 |
| 104 | Ga0068863_100356073 | 3300005841 | Bacteria | 1426 |
| 105 | Ga0068858_100733297 | 3300005842 | Bacteria | 962 |
| 106 | Ga0068860_100012866 | 3300005843 | Bacteria | 8224 |
| 107 | Ga0068860_100022280 | 3300005843 | Bacteria | 6131 |
| 108 | Ga0068860_100413553 | 3300005843 | Bacteria | 1336 |
| 109 | Ga0068860_102543928 | 3300005843 | Bacteria | 531 |
| 110 | Ga0068862_101647982 | 3300005844 | Unclassified | 649 |
| 111 | Ga0070717_10290192 | 3300006028 | Bacteria | 1452 |
| 112 | Ga0070717_10800130 | 3300006028 | Bacteria | 858 |
| 113 | Ga0070717_10893568 | 3300006028 | Bacteria | 809 |
| 114 | Ga0075432_10243147 | 3300006058 | Bacteria | 728 |
| 115 | Ga0070715_10031039 | 3300006163 | Bacteria | 2166 |
| 116 | Ga0070715_10126933 | 3300006163 | Bacteria | 1223 |
| 117 | Ga0070715_10161014 | 3300006163 | Bacteria | 1109 |
| 118 | Ga0070715_10515385 | 3300006163 | Bacteria | 687 |
| 119 | Ga0070715_10527032 | 3300006163 | Bacteria | 681 |
| 120 | Ga0070715_10560139 | 3300006163 | Unclassified | 664 |
| 121 | Ga0070716_100023314 | 3300006173 | Bacteria | 3280 |
| 122 | Ga0070716_100044936 | 3300006173 | Bacteria | 2477 |
| 123 | Ga0070716_100056234 | 3300006173 | Bacteria | 2255 |
| 124 | Ga0070716_100170233 | 3300006173 | Bacteria | 1421 |
| 125 | Ga0070716_100297817 | 3300006173 | Unclassified | 1120 |
| 126 | Ga0070716_100378590 | 3300006173 | Bacteria | 1011 |
| 127 | Ga0070716_100562390 | 3300006173 | Bacteria | 852 |
| 128 | Ga0070716_100908962 | 3300006173 | Bacteria | 690 |
| 129 | Ga0070716_101192646 | 3300006173 | Bacteria | 611 |
| 130 | Ga0070712_100036991 | 3300006175 | Bacteria | 3324 |
| 131 | Ga0070712_100049811 | 3300006175 | Bacteria | 2910 |
| 132 | Ga0070712_100259160 | 3300006175 | Bacteria | 1393 |
| 133 | Ga0070712_100291274 | 3300006175 | Bacteria | 1318 |
| 134 | Ga0070712_100382662 | 3300006175 | Bacteria | 1159 |
| 135 | Ga0070712_101836551 | 3300006175 | Bacteria | 531 |
| 136 | Ga0097621_100061799 | 3300006237 | Bacteria | 3073 |
| 137 | Ga0097621_100417984 | 3300006237 | Bacteria | 1203 |
| 138 | Ga0097621_100493670 | 3300006237 | Unclassified | 1108 |
| 139 | Ga0097621_100793325 | 3300006237 | Bacteria | 877 |
| 140 | Ga0097621_100913156 | 3300006237 | Bacteria | 818 |
| 141 | Ga0068871_100000420 | 3300006358 | Bacteria | 29371 |
| 142 | Ga0068871_100206890 | 3300006358 | Bacteria | 1696 |
| 143 | Ga0068871_100704640 | 3300006358 | Bacteria | 925 |
| 144 | Ga0075428_100500909 | 3300006844 | Bacteria | 1299 |
| 145 | Ga0075434_100012780 | 3300006871 | Bacteria | 7969 |
| 146 | Ga0075434_100136709 | 3300006871 | Bacteria | 2470 |
| 147 | Ga0075434_100199449 | 3300006871 | Bacteria | 2021 |
| 148 | Ga0075434_100756308 | 3300006871 | Bacteria | 989 |
| 149 | Ga0075436_100022850 | 3300006914 | Bacteria | 4296 |
| 150 | Ga0075436_100069860 | 3300006914 | Bacteria | 2427 |
| 151 | Ga0075436_100109975 | 3300006914 | Bacteria | 1923 |
| 152 | Ga0075436_100166283 | 3300006914 | Bacteria | 1556 |
| 153 | Ga0075436_100442476 | 3300006914 | Bacteria | 946 |
| 154 | Ga0075436_100635233 | 3300006914 | Bacteria | 788 |
| 155 | Ga0097620_100085484 | 3300006931 | Bacteria | 3200 |
| 156 | Ga0097620_100908957 | 3300006931 | Unclassified | 965 |
| 157 | Ga0097620_101209527 | 3300006931 | Unclassified | 832 |
| 158 | Ga0075435_100155092 | 3300007076 | Bacteria | 1927 |
| 159 | Ga0075435_100441552 | 3300007076 | Bacteria | 1122 |
| 160 | Ga0075435_100488884 | 3300007076 | Bacteria | 1063 |
| 161 | Ga0075435_100880372 | 3300007076 | Bacteria | 781 |
| 162 | Ga0099794_10003369 | 3300007265 | Bacteria | 6087 |
| 163 | Ga0099794_10011981 | 3300007265 | Bacteria | 3728 |
| 164 | Ga0099794_10051524 | 3300007265 | Bacteria | 1982 |
| 165 | Ga0099794_10053799 | 3300007265 | Bacteria | 1942 |
| 166 | Ga0099794_10069255 | 3300007265 | Bacteria | 1726 |
| 167 | Ga0099794_10107866 | 3300007265 | Bacteria | 1393 |
| 168 | Ga0099794_10363413 | 3300007265 | Unclassified | 754 |
| 169 | Ga0099794_10366118 | 3300007265 | Bacteria | 751 |
| 170 | Ga0099794_10645537 | 3300007265 | Unclassified | 562 |
| 171 | Ga0099795_10010651 | 3300007788 | Bacteria | 2716 |
| 172 | Ga0099795_10073653 | 3300007788 | Bacteria | 1293 |
| 173 | Ga0099795_10136457 | 3300007788 | Bacteria | 994 |
| 174 | Ga0099795_10322030 | 3300007788 | Bacteria | 685 |
| 175 | Ga0105240_10061519 | 3300009093 | Bacteria | 4679 |
| 176 | Ga0105240_10287386 | 3300009093 | Bacteria | 1887 |
| 177 | Ga0105245_10127111 | 3300009098 | Bacteria | 2387 |
| 178 | Ga0105245_10556875 | 3300009098 | Bacteria | 1169 |
| 179 | Ga0105247_10253258 | 3300009101 | Bacteria | 1204 |
| 180 | Ga0105247_10354715 | 3300009101 | Bacteria | 1032 |
| 181 | Ga0105243_11945223 | 3300009148 | Bacteria | 622 |
| 182 | Ga0105242_10133115 | 3300009176 | Bacteria | 2149 |
| 183 | Ga0105242_10265593 | 3300009176 | Bacteria | 1552 |
| 184 | Ga0105242_10783811 | 3300009176 | Bacteria | 942 |
| 185 | Ga0105242_10868010 | 3300009176 | Bacteria | 899 |
| 186 | Ga0105248_10008490 | 3300009177 | Bacteria | 11276 |
| 187 | Ga0105248_10008673 | 3300009177 | Bacteria | 11171 |
| 188 | Ga0105248_10688950 | 3300009177 | Bacteria | 1153 |
| 189 | Ga0105248_11165374 | 3300009177 | Bacteria | 871 |
| 190 | Ga0105237_10245972 | 3300009545 | Bacteria | 1790 |
| 191 | Ga0105249_10286019 | 3300009553 | Bacteria | 1648 |
| 192 | Ga0099796_10017824 | 3300010159 | Bacteria | 2121 |
| 193 | Ga0099796_10018821 | 3300010159 | Bacteria | 2082 |
| 194 | Ga0099796_10068692 | 3300010159 | Bacteria | 1274 |
| 195 | Ga0099796_10237072 | 3300010159 | Bacteria | 753 |
| 196 | Ga0105239_10066805 | 3300010375 | Bacteria | 3950 |
| 197 | Ga0105239_10401880 | 3300010375 | Bacteria | 1550 |
| 198 | Ga0157369_10871543 | 3300013105 | Bacteria | 924 |
| 199 | Ga0157374_10022996 | 3300013296 | Bacteria | 5567 |
| 200 | Ga0157374_10252944 | 3300013296 | Bacteria | 1734 |
| 201 | Ga0157374_11529557 | 3300013296 | Bacteria | 691 |
| 202 | Ga0157378_10003557 | 3300013297 | Bacteria | 13807 |
| 203 | Ga0157378_10003574 | 3300013297 | Bacteria | 13763 |
| 204 | Ga0157378_10005337 | 3300013297 | Bacteria | 11276 |
| 205 | Ga0157378_10015014 | 3300013297 | Bacteria | 6781 |
| 206 | Ga0157378_10867997 | 3300013297 | Bacteria | 932 |
| 207 | Ga0157378_11009611 | 3300013297 | Bacteria | 866 |
| 208 | Ga0163162_10024701 | 3300013306 | Bacteria | 5935 |
| 209 | Ga0163162_10060074 | 3300013306 | Bacteria | 3835 |
| 210 | Ga0163162_11856952 | 3300013306 | Bacteria | 689 |
| 211 | Ga0163162_13272741 | 3300013306 | Bacteria | 519 |
| 212 | Ga0157375_11495202 | 3300013308 | Bacteria | 797 |
| 213 | Ga0157375_12644737 | 3300013308 | Bacteria | 600 |
| 214 | Ga0163163_10522373 | 3300014325 | Unclassified | 1249 |
| 215 | Ga0157379_10347010 | 3300014968 | Bacteria | 1358 |
| 216 | Ga0157379_10573252 | 3300014968 | Bacteria | 1052 |
| 217 | Ga0157376_10036066 | 3300014969 | Bacteria | 4003 |
| 218 | Ga0184602_101813 | 3300019161 | Bacteria | 843 |
| 219 | Ga0184602_109986 | 3300019161 | Bacteria | 1086 |
| 220 | Ga0184602_118498 | 3300019161 | Bacteria | 754 |
| 221 | Ga0184602_119558 | 3300019161 | Bacteria | 920 |
| 222 | Ga0184598_106849 | 3300019182 | Bacteria | 2211 |
| 223 | Ga0184601_115529 | 3300019183 | Bacteria | 887 |
| 224 | Ga0184601_124842 | 3300019183 | Bacteria | 655 |
| 225 | Ga0184599_129025 | 3300019188 | Bacteria | 2168 |
| 226 | Ga0184599_129928 | 3300019188 | Bacteria | 1251 |
| 227 | Ga0184599_141070 | 3300019188 | Bacteria | 1017 |
| 228 | Ga0184599_148132 | 3300019188 | Bacteria | 573 |
| 229 | Ga0184599_151674 | 3300019188 | Unclassified | 654 |
| 230 | Ga0184600_102713 | 3300019190 | Bacteria | 670 |
| 231 | Ga0184603_110579 | 3300019192 | Bacteria | 516 |
| 232 | Ga0184603_130044 | 3300019192 | Bacteria | 702 |
| 233 | Ga0184603_138242 | 3300019192 | Bacteria | 546 |
| 234 | Ga0206349_1464016 | 3300020075 | Bacteria | 513 |
| 235 | Ga0206349_1601330 | 3300020075 | Bacteria | 597 |
| 236 | Ga0206350_10307447 | 3300020080 | Bacteria | 654 |
| 237 | Ga0206350_10836049 | 3300020080 | Bacteria | 1187 |
| 238 | Ga0224712_10183790 | 3300022467 | Bacteria | 943 |
| 239 | Ga0224569_112299 | 3300022732 | Bacteria | 601 |
| 240 | Ga0224571_111667 | 3300022734 | Bacteria | 614 |
| 241 | Ga0224571_112399 | 3300022734 | Bacteria | 599 |
| 242 | Ga0247552_100403 | 3300023536 | Bacteria | 1040 |
| 243 | Ga0247555_100427 | 3300023539 | Bacteria | 1093 |
| 244 | Ga0247555_101606 | 3300023539 | Bacteria | 709 |
| 245 | Ga0247555_102332 | 3300023539 | Bacteria | 627 |
| 246 | Ga0247555_103437 | 3300023539 | Unclassified | 559 |
| 247 | Ga0247554_100011 | 3300023547 | Bacteria | 3232 |
| 248 | Ga0247554_102301 | 3300023547 | Bacteria | 708 |
| 249 | Ga0247553_100114 | 3300023672 | Bacteria | 2299 |
| 250 | Ga0247553_100206 | 3300023672 | Bacteria | 1934 |
| 251 | Ga0247553_100403 | 3300023672 | Bacteria | 1537 |
| 252 | Ga0247553_107952 | 3300023672 | Bacteria | 583 |
| 253 | Ga0247553_109608 | 3300023672 | Bacteria | 550 |
| 254 | Ga0247553_110016 | 3300023672 | Bacteria | 542 |
| 255 | Ga0247553_111476 | 3300023672 | Bacteria | 517 |
| 256 | Ga0224572_1026861 | 3300024225 | Bacteria | 1103 |
| 257 | Ga0228598_1000356 | 3300024227 | Bacteria | 9048 |
| 258 | Ga0228598_1004718 | 3300024227 | Bacteria | 2879 |
| 259 | Ga0207692_10113894 | 3300025898 | Bacteria | 1504 |
| 260 | Ga0207692_10425993 | 3300025898 | Bacteria | 831 |
| 261 | Ga0207692_10543421 | 3300025898 | Bacteria | 742 |
| 262 | Ga0207642_10161045 | 3300025899 | Bacteria | 1205 |
| 263 | Ga0207710_10208702 | 3300025900 | Bacteria | 966 |
| 264 | Ga0207680_10161773 | 3300025903 | Bacteria | 1502 |
| 265 | Ga0207680_10624282 | 3300025903 | Unclassified | 771 |
| 266 | Ga0207685_10011326 | 3300025905 | Bacteria | 2677 |
| 267 | Ga0207685_10125220 | 3300025905 | Bacteria | 1133 |
| 268 | Ga0207685_10360775 | 3300025905 | Bacteria | 735 |
| 269 | Ga0207699_10005224 | 3300025906 | Bacteria | 6212 |
| 270 | Ga0207699_10013376 | 3300025906 | Bacteria | 4198 |
| 271 | Ga0207699_10121982 | 3300025906 | Bacteria | 1687 |
| 272 | Ga0207699_10247555 | 3300025906 | Bacteria | 1227 |
| 273 | Ga0207699_10399284 | 3300025906 | Bacteria | 979 |
| 274 | Ga0207699_10400405 | 3300025906 | Bacteria | 978 |
| 275 | Ga0207699_10530583 | 3300025906 | Bacteria | 852 |
| 276 | Ga0207699_10556647 | 3300025906 | Bacteria | 832 |
| 277 | Ga0207699_10817563 | 3300025906 | Bacteria | 685 |
| 278 | Ga0207684_10004887 | 3300025910 | Bacteria | 12513 |
| 279 | Ga0207684_10064384 | 3300025910 | Bacteria | 3113 |
| 280 | Ga0207684_10200367 | 3300025910 | Bacteria | 1722 |
| 281 | Ga0207684_11579210 | 3300025910 | Unclassified | 532 |
| 282 | Ga0207695_10118395 | 3300025913 | Bacteria | 2620 |
| 283 | Ga0207695_10266607 | 3300025913 | Bacteria | 1609 |
| 284 | Ga0207695_11180984 | 3300025913 | Bacteria | 645 |
| 285 | Ga0207671_10303746 | 3300025914 | Bacteria | 1261 |
| 286 | Ga0207671_11149905 | 3300025914 | Unclassified | 608 |
| 287 | Ga0207693_10022429 | 3300025915 | Bacteria | 5017 |
| 288 | Ga0207693_10046457 | 3300025915 | Bacteria | 3411 |
| 289 | Ga0207693_10160035 | 3300025915 | Bacteria | 1771 |
| 290 | Ga0207693_10249059 | 3300025915 | Bacteria | 1394 |
| 291 | Ga0207693_10257234 | 3300025915 | Bacteria | 1369 |
| 292 | Ga0207693_10312429 | 3300025915 | Bacteria | 1231 |
| 293 | Ga0207693_10425287 | 3300025915 | Bacteria | 1038 |
| 294 | Ga0207663_10059354 | 3300025916 | Bacteria | 2419 |
| 295 | Ga0207663_10113843 | 3300025916 | Bacteria | 1840 |
| 296 | Ga0207663_10233265 | 3300025916 | Bacteria | 1346 |
| 297 | Ga0207663_10676196 | 3300025916 | Bacteria | 816 |
| 298 | Ga0207663_10983396 | 3300025916 | Bacteria | 676 |
| 299 | Ga0207663_11603858 | 3300025916 | Bacteria | 524 |
| 300 | Ga0207662_10321534 | 3300025918 | Bacteria | 1033 |
| 301 | Ga0207646_10000178 | 3300025922 | Bacteria | 86727 |
| 302 | Ga0207646_10000294 | 3300025922 | Bacteria | 67765 |
| 303 | Ga0207646_10000586 | 3300025922 | Bacteria | 47556 |
| 304 | Ga0207646_10003595 | 3300025922 | Bacteria | 17377 |
| 305 | Ga0207646_10025578 | 3300025922 | Bacteria | 5399 |
| 306 | Ga0207646_10037311 | 3300025922 | Bacteria | 4382 |
| 307 | Ga0207646_10048510 | 3300025922 | Bacteria | 3806 |
| 308 | Ga0207646_10118018 | 3300025922 | Bacteria | 2383 |
| 309 | Ga0207646_10325973 | 3300025922 | Bacteria | 1388 |
| 310 | Ga0207646_10681563 | 3300025922 | Bacteria | 920 |
| 311 | Ga0207646_11026022 | 3300025922 | Bacteria | 728 |
| 312 | Ga0207687_10022876 | 3300025927 | Bacteria | 4162 |
| 313 | Ga0207700_10019279 | 3300025928 | Bacteria | 4605 |
| 314 | Ga0207700_10331731 | 3300025928 | Bacteria | 1321 |
| 315 | Ga0207700_10487981 | 3300025928 | Bacteria | 1089 |
| 316 | Ga0207700_11437584 | 3300025928 | Bacteria | 613 |
| 317 | Ga0207664_10138556 | 3300025929 | Bacteria | 2055 |
| 318 | Ga0207664_10847206 | 3300025929 | Bacteria | 822 |
| 319 | Ga0207686_10164465 | 3300025934 | Bacteria | 1558 |
| 320 | Ga0207704_10678063 | 3300025938 | Bacteria | 851 |
| 321 | Ga0207665_10001621 | 3300025939 | Bacteria | 15162 |
| 322 | Ga0207665_10014244 | 3300025939 | Bacteria | 5234 |
| 323 | Ga0207665_10112692 | 3300025939 | Bacteria | 1913 |
| 324 | Ga0207665_10113690 | 3300025939 | Unclassified | 1905 |
| 325 | Ga0207665_10351358 | 3300025939 | Bacteria | 1113 |
| 326 | Ga0207711_10022174 | 3300025941 | Bacteria | 5310 |
| 327 | Ga0207711_10033842 | 3300025941 | Bacteria | 4326 |
| 328 | Ga0207711_10950037 | 3300025941 | Bacteria | 798 |
| 329 | Ga0207689_10378927 | 3300025942 | Bacteria | 1178 |
| 330 | Ga0207689_10765190 | 3300025942 | Bacteria | 815 |
| 331 | Ga0207712_10202114 | 3300025961 | Bacteria | 1576 |
| 332 | Ga0207658_11360517 | 3300025986 | Bacteria | 649 |
| 333 | Ga0207703_10236598 | 3300026035 | Bacteria | 1640 |
| 334 | Ga0207639_10875698 | 3300026041 | Bacteria | 839 |
| 335 | Ga0207641_10220634 | 3300026088 | Bacteria | 1758 |
| 336 | Ga0207648_10199679 | 3300026089 | Bacteria | 1773 |
| 337 | Ga0207676_11158195 | 3300026095 | Unclassified | 765 |
| 338 | Ga0207675_100652270 | 3300026118 | Bacteria | 1059 |
| 339 | Ga0209179_1032308 | 3300027512 | Bacteria | 1078 |
| 340 | Ga0209179_1051000 | 3300027512 | Bacteria | 887 |
| 341 | Ga0209588_1002814 | 3300027671 | Bacteria | 4765 |
| 342 | Ga0209588_1002923 | 3300027671 | Bacteria | 4695 |
| 343 | Ga0209588_1003849 | 3300027671 | Bacteria | 4190 |
| 344 | Ga0209588_1020605 | 3300027671 | Bacteria | 2065 |
| 345 | Ga0209588_1020889 | 3300027671 | Bacteria | 2051 |
| 346 | Ga0209588_1026752 | 3300027671 | Bacteria | 1833 |
| 347 | Ga0209588_1030581 | 3300027671 | Bacteria | 1721 |
| 348 | Ga0209588_1033602 | 3300027671 | Bacteria | 1645 |
| 349 | Ga0209588_1078247 | 3300027671 | Bacteria | 1068 |
| 350 | Ga0209588_1081951 | 3300027671 | Bacteria | 1042 |
| 351 | Ga0209588_1115245 | 3300027671 | Bacteria | 862 |
| 352 | Ga0209588_1146915 | 3300027671 | Bacteria | 748 |
| 353 | Ga0209588_1191683 | 3300027671 | Bacteria | 639 |
| 354 | Ga0209588_1205382 | 3300027671 | Bacteria | 613 |
| 355 | Ga0265358_100420 | 3300028010 | Bacteria | 1032 |
| 356 | Ga0265357_1033625 | 3300028023 | Archaea | 591 |
| 357 | Ga0268264_10034899 | 3300028381 | Bacteria | 4140 |
| 358 | Ga0268264_10379713 | 3300028381 | Bacteria | 1353 |
| 359 | Ga0268264_10484546 | 3300028381 | Bacteria | 1203 |
| 360 | Ga0265337_1159370 | 3300028556 | Bacteria | 612 |
| 361 | Ga0265319_1000770 | 3300028563 | Bacteria | 20820 |
| 362 | Ga0265334_10118443 | 3300028573 | Bacteria | 948 |
| 363 | Ga0265318_10000563 | 3300028577 | Bacteria | 26166 |
| 364 | Ga0265338_10005291 | 3300028800 | Bacteria | 16896 |
| 365 | Ga0265338_10197386 | 3300028800 | Bacteria | 1520 |
| 366 | Ga0265762_1004977 | 3300030760 | Bacteria | 2380 |
| 367 | Ga0265762_1017805 | 3300030760 | Bacteria | 1294 |
| 368 | Ga0265762_1078758 | 3300030760 | Bacteria | 703 |
| 369 | Ga0265775_100177 | 3300030762 | Bacteria | 2255 |
| 370 | Ga0265775_109631 | 3300030762 | Unclassified | 599 |
| 371 | Ga0265763_1008382 | 3300030763 | Bacteria | 922 |
| 372 | Ga0265763_1044626 | 3300030763 | Unclassified | 543 |
| 373 | Ga0265777_100311 | 3300030877 | Bacteria | 2107 |
| 374 | Ga0265777_125538 | 3300030877 | Bacteria | 506 |
| 375 | Ga0265770_1021038 | 3300030878 | Unclassified | 1034 |
| 376 | Ga0265770_1095226 | 3300030878 | Bacteria | 599 |
| 377 | Ga0265765_1012785 | 3300030879 | Bacteria | 955 |
| 378 | Ga0265776_103756 | 3300030880 | Bacteria | 751 |
| 379 | Ga0265776_108504 | 3300030880 | Unclassified | 584 |
| 380 | Ga0265764_102006 | 3300030882 | Bacteria | 963 |
| 381 | Ga0265764_114264 | 3300030882 | Unclassified | 537 |
| 382 | Ga0265764_115678 | 3300030882 | Unclassified | 521 |
| 383 | Ga0265761_100222 | 3300030889 | Bacteria | 2043 |
| 384 | Ga0265773_1009701 | 3300031018 | Bacteria | 799 |
| 385 | Ga0265779_104677 | 3300031043 | Bacteria | 735 |
| 386 | Ga0265779_105704 | 3300031043 | Bacteria | 686 |
| 387 | Ga0265760_10021891 | 3300031090 | Bacteria | 1850 |
| 388 | Ga0265760_10038658 | 3300031090 | Unclassified | 1419 |
| 389 | Ga0265760_10055534 | 3300031090 | Bacteria | 1197 |
| 390 | Ga0265760_10143552 | 3300031090 | Bacteria | 779 |
| 391 | Ga0265760_10297186 | 3300031090 | Bacteria | 571 |
| 392 | Ga0265332_10058900 | 3300031238 | Bacteria | 1644 |
| 393 | Ga0265332_10220435 | 3300031238 | Bacteria | 787 |
| 394 | Ga0265328_10147904 | 3300031239 | Bacteria | 883 |
| 395 | Ga0265320_10000328 | 3300031240 | Bacteria | 38910 |
| 396 | Ga0265325_10002985 | 3300031241 | Bacteria | 11228 |
| 397 | Ga0265325_10020600 | 3300031241 | Bacteria | 3634 |
| 398 | Ga0265325_10115052 | 3300031241 | Bacteria | 1302 |
| 399 | Ga0265329_10000518 | 3300031242 | Bacteria | 19897 |
| 400 | Ga0265340_10009821 | 3300031247 | Bacteria | 5127 |
| 401 | Ga0265340_10208132 | 3300031247 | Bacteria | 879 |
| 402 | Ga0265339_10002459 | 3300031249 | Bacteria | 13260 |
| 403 | Ga0265331_10000021 | 3300031250 | Bacteria | 242632 |
| 404 | Ga0265331_10012455 | 3300031250 | Bacteria | 4607 |
| 405 | Ga0265331_10042036 | 3300031250 | Bacteria | 2219 |
| 406 | Ga0265316_10001865 | 3300031344 | Bacteria | 22179 |
| 407 | Ga0265316_10020772 | 3300031344 | Bacteria | 5580 |
| 408 | Ga0265316_10258193 | 3300031344 | Bacteria | 1278 |
| 409 | Ga0265316_10726264 | 3300031344 | Bacteria | 699 |
| 410 | Ga0265313_10000730 | 3300031595 | Bacteria | 33796 |
| 411 | Ga0265313_10092339 | 3300031595 | Bacteria | 1356 |
| 412 | Ga0265313_10138444 | 3300031595 | Bacteria | 1049 |
| 413 | Ga0265314_10386125 | 3300031711 | Bacteria | 761 |
| 414 | Ga0265342_10000032 | 3300031712 | Bacteria | 150633 |
| 415 | Ga0265342_10165024 | 3300031712 | Bacteria | 1222 |
| 416 | Ga0316577_10033544 | 3300031733 | Bacteria | 2868 |
| 417 | Ga0316044_128059 | 3300031810 | Bacteria | 546 |
| 418 | Ga0316045_127660 | 3300031815 | Bacteria | 505 |
| 419 | Ga0316053_100043 | 3300032120 | Bacteria | 3768 |
| 420 | Ga0316053_100152 | 3300032120 | Bacteria | 2490 |
| 421 | Ga0316053_101188 | 3300032120 | Bacteria | 1341 |
| 422 | Ga0316053_102566 | 3300032120 | Bacteria | 1037 |
| 423 | Ga0316053_106946 | 3300032120 | Bacteria | 746 |
| 424 | Ga0316053_112726 | 3300032120 | Bacteria | 605 |
| 425 | Ga0316053_116456 | 3300032120 | Unclassified | 556 |
| 426 | Ga0316593_10003452 | 3300032168 | Bacteria | 3922 |
| 427 | Ga0316593_10046399 | 3300032168 | Bacteria | 1458 |
| 428 | Ga0316593_10102791 | 3300032168 | Bacteria | 1015 |
| 429 | Ga0316593_10220788 | 3300032168 | Bacteria | 704 |
| 430 | Ga0316596_1013787 | 3300033541 | Bacteria | 1998 |
| 431 | Ga0316596_1039663 | 3300033541 | Bacteria | 1235 |
| 432 | Ga0316596_1139678 | 3300033541 | Bacteria | 663 |
| 433 | Ga0316596_1163317 | 3300033541 | Bacteria | 614 |
| 434 | Ga0316596_1232740 | 3300033541 | Unclassified | 517 |
| 435 | Ga0316212_1019719 | 3300033547 | Bacteria | 947 |
| 436 | Ga0373926_0003731 | 3300035083 | Bacteria | 4958 |
| 437 | Ga0373926_0094768 | 3300035083 | Bacteria | 1112 |
| 438 | Ga0373934_0001143 | 3300035086 | Bacteria | 9661 |
| 439 | Ga0373934_0024497 | 3300035086 | Bacteria | 2333 |
| 440 | Ga0373940_0285289 | 3300035088 | Unclassified | 565 |
| 441 | Ga0373923_0062413 | 3300035111 | Bacteria | 1586 |
| 442 | Ga0373923_0107938 | 3300035111 | Bacteria | 1233 |
| 443 | Ga0373923_0197180 | 3300035111 | Bacteria | 930 |
| 444 | Ga0373945_0138156 | 3300035116 | Bacteria | 981 |
| 445 | Ga0373954_0000615 | 3300035118 | Bacteria | 13597 |
| 446 | Ga0373954_0040865 | 3300035118 | Bacteria | 2161 |
| 447 | Ga0373954_0234955 | 3300035118 | Bacteria | 902 |
| 448 | Ga0373954_0280660 | 3300035118 | Bacteria | 821 |
| 449 | Ga0373956_0021789 | 3300035119 | Bacteria | 2735 |
| 450 | Ga0373956_0054593 | 3300035119 | Bacteria | 1800 |
| 451 | Ga0373956_0268205 | 3300035119 | Bacteria | 812 |
| 452 | Ga0373957_0030817 | 3300035120 | Bacteria | 1967 |
| 453 | Ga0373957_0475247 | 3300035120 | Unclassified | 542 |
| 454 | Ga0373943_0330565 | 3300035170 | Unclassified | 870 |
| 455 | Ga0373943_0457118 | 3300035170 | Bacteria | 742 |
| 456 | Ga0373943_0866920 | 3300035170 | Bacteria | 539 |
| 457 | Ga0373946_0075004 | 3300035171 | Bacteria | 1469 |
| 458 | Ga0373946_0283958 | 3300035171 | Bacteria | 815 |
| 459 | Ga0373955_0030550 | 3300035172 | Bacteria | 2813 |
| 460 | Ga0373955_0088708 | 3300035172 | Bacteria | 1759 |
| 461 | Ga0373955_0092799 | 3300035172 | Bacteria | 1723 |
| 462 | Ga0373955_0093827 | 3300035172 | Bacteria | 1714 |
| 463 | Ga0373955_0636128 | 3300035172 | Bacteria | 654 |
| 464 | Ga0373924_0067858 | 3300035410 | Bacteria | 1501 |
| 465 | Ga0373924_0352915 | 3300035410 | Bacteria | 656 |
| 466 | Ga0373924_0389574 | 3300035410 | Bacteria | 622 |
| 467 | Ga0373931_0315729 | 3300035691 | Bacteria | 969 |
| 468 | Ga0373935_0041693 | 3300035692 | Bacteria | 2884 |
| 469 | Ga0373935_0738414 | 3300035692 | Bacteria | 725 |
| 470 | Ga0373927_0001112 | 3300035695 | Bacteria | 20423 |
| 471 | Ga0373927_0015777 | 3300035695 | Bacteria | 4984 |
| 472 | Ga0373927_0024735 | 3300035695 | Bacteria | 3924 |
| 473 | Ga0373933_0000875 | 3300035724 | Bacteria | 18404 |
| 474 | Ga0373933_0002114 | 3300035724 | Bacteria | 11407 |
| 475 | Ga0373933_0031390 | 3300035724 | Bacteria | 3082 |
| 476 | Ga0373933_0115860 | 3300035724 | Bacteria | 1675 |
| 477 | Ga0373947_0005049 | 3300035725 | Bacteria | 7729 |
| 478 | Ga0373947_0014667 | 3300035725 | Bacteria | 4495 |
| 479 | Ga0373947_0047927 | 3300035725 | Unclassified | 2562 |
| 480 | Ga0373937_0000111 | 3300036401 | Bacteria | 77509 |
| 481 | Ga0373937_0036370 | 3300036401 | Bacteria | 4486 |
| 482 | Ga0373937_0037074 | 3300036401 | Bacteria | 4443 |
| 483 | Ga0373937_0049212 | 3300036401 | Bacteria | 3860 |
| 484 | Ga0373937_0251160 | 3300036401 | Bacteria | 1667 |
| 485 | Ga0373937_0683963 | 3300036401 | Bacteria | 972 |
| 486 | Ga0373937_0866235 | 3300036401 | Bacteria | 852 |
| 487 | Ga0265778_001414 | 3300036457 | Bacteria | 2185 |
| 488 | Ga0265778_001498 | 3300036457 | Bacteria | 2140 |
| 489 | Ga0265778_002443 | 3300036457 | Bacteria | 1792 |
| 490 | Ga0265778_011612 | 3300036457 | Bacteria | 1017 |
| 491 | Ga0265778_017951 | 3300036457 | Bacteria | 857 |
| 492 | Ga0265778_037308 | 3300036457 | Bacteria | 642 |
| 493 | Ga0265778_043206 | 3300036457 | Unclassified | 604 |
| 494 | Ga0265778_043795 | 3300036457 | Bacteria | 601 |
| 495 | Ga0265778_056321 | 3300036457 | Bacteria | 545 |
| 496 | Ga0373925_0000969 | 3300037068 | Bacteria | 26091 |
| 497 | Ga0373925_0010535 | 3300037068 | Bacteria | 6706 |
| 498 | Ga0373925_0202420 | 3300037068 | Bacteria | 1579 |
| 499 | Ga0373925_0358024 | 3300037068 | Bacteria | 1186 |
| 500 | Ga0373925_0811552 | 3300037068 | Bacteria | 771 |
| 501 | Ga0373925_0957582 | 3300037068 | Bacteria | 705 |
| 502 | Ga0395898_1609637 | 3300037466 | Bacteria | 574 |
| 503 | Ga0436360_0908177 | 3300039438 | Bacteria | 630 |
| 504 | Ga0451837_0411823 | 3300041494 | Bacteria | 745 |
| 505 | Ga0451577_0035010 | 3300042876 | Bacteria | 4524 |
| 506 | Ga0451577_0126378 | 3300042876 | Bacteria | 2291 |
| 507 | Ga0451577_0128279 | 3300042876 | Bacteria | 2274 |
| 508 | Ga0451577_1020154 | 3300042876 | Bacteria | 742 |
| 509 | Ga0453683_0016428 | 3300044673 | Bacteria | 4774 |
| 510 | Ga0453683_0023533 | 3300044673 | Bacteria | 3925 |
| 511 | Ga0453683_0031301 | 3300044673 | Bacteria | 3361 |
| 512 | Ga0453683_0034792 | 3300044673 | Bacteria | 3175 |
| 513 | Ga0453683_0079728 | 3300044673 | Bacteria | 2051 |
| 514 | Ga0453684_0019676 | 3300044712 | Bacteria | 10253 |
| 515 | Ga0453684_0036842 | 3300044712 | Bacteria | 6731 |
| 516 | Ga0453684_0185611 | 3300044712 | Bacteria | 2437 |
| 517 | Ga0453684_0219978 | 3300044712 | Bacteria | 2200 |
| 518 | Ga0453684_0258296 | 3300044712 | Bacteria | 1997 |
| 519 | Ga0453684_0417182 | 3300044712 | Bacteria | 1500 |
| 520 | Ga0451576_0286383 | 3300045051 | Bacteria | 1722 |
| 521 | Ga0451576_0345957 | 3300045051 | Bacteria | 1557 |
| 522 | Ga0451576_0630874 | 3300045051 | Bacteria | 1126 |
| 523 | Ga0451576_0793267 | 3300045051 | Bacteria | 995 |
| 524 | Ga0495592_0065622 | 3300046454 | Bacteria | 2657 |
| 525 | Ga0495592_0069907 | 3300046454 | Bacteria | 2559 |
| 526 | Ga0495592_0149700 | 3300046454 | Bacteria | 1615 |
| 527 | Ga0495592_0618495 | 3300046454 | Bacteria | 659 |
| 528 | Ga0495592_0906875 | 3300046454 | Bacteria | 518 |
| 529 | Ga0495603_0079373 | 3300046455 | Bacteria | 1924 |
| 530 | Ga0495603_0761200 | 3300046455 | Unclassified | 553 |
| 531 | Ga0495629_0160387 | 3300046459 | Bacteria | 1562 |
| 532 | Ga0495629_0460859 | 3300046459 | Unclassified | 860 |
| 533 | Ga0495641_0038397 | 3300046461 | Bacteria | 2237 |
| 534 | Ga0495641_0097217 | 3300046461 | Bacteria | 1314 |
| 535 | Ga0495651_0001249 | 3300046462 | Bacteria | 19696 |
| 536 | Ga0495651_0006995 | 3300046462 | Bacteria | 8629 |
| 537 | Ga0495651_0020364 | 3300046462 | Bacteria | 5149 |
| 538 | Ga0495651_0051316 | 3300046462 | Bacteria | 3180 |
| 539 | Ga0495653_0003367 | 3300046463 | Bacteria | 12851 |
| 540 | Ga0495653_0100464 | 3300046463 | Bacteria | 2097 |
| 541 | Ga0495653_0424494 | 3300046463 | Bacteria | 841 |
| 542 | Ga0495653_0646628 | 3300046463 | Bacteria | 646 |
| 543 | Ga0495580_0021880 | 3300046472 | Bacteria | 4714 |
| 544 | Ga0495580_0030085 | 3300046472 | Bacteria | 3935 |
| 545 | Ga0495580_0104727 | 3300046472 | Bacteria | 1966 |
| 546 | Ga0495580_0133139 | 3300046472 | Bacteria | 1724 |
| 547 | Ga0495580_0293451 | 3300046472 | Bacteria | 1108 |
| 548 | Ga0495580_0477452 | 3300046472 | Bacteria | 834 |
| 549 | Ga0495580_0623003 | 3300046472 | Bacteria | 711 |
| 550 | Ga0495580_0694607 | 3300046472 | Bacteria | 666 |
| 551 | Ga0495582_0000417 | 3300046473 | Bacteria | 23244 |
| 552 | Ga0495582_0013912 | 3300046473 | Bacteria | 4432 |
| 553 | Ga0495582_0292645 | 3300046473 | Bacteria | 936 |
| 554 | Ga0495582_0383786 | 3300046473 | Bacteria | 810 |
| 555 | Ga0495582_0883491 | 3300046473 | Bacteria | 517 |
| 556 | Ga0495639_0016004 | 3300046475 | Bacteria | 3253 |
| 557 | Ga0495662_0072313 | 3300046476 | Bacteria | 1672 |
| 558 | Ga0495664_0032941 | 3300046477 | Bacteria | 3044 |
| 559 | Ga0495664_0482244 | 3300046477 | Bacteria | 741 |
| 560 | Ga0495594_0001371 | 3300046499 | Bacteria | 12630 |
| 561 | Ga0495594_0703614 | 3300046499 | Bacteria | 571 |
| 562 | Ga0495608_0008749 | 3300046511 | Bacteria | 7082 |
| 563 | Ga0495608_0017709 | 3300046511 | Bacteria | 4926 |
| 564 | Ga0495608_0031575 | 3300046511 | Bacteria | 3581 |
| 565 | Ga0495608_0049901 | 3300046511 | Bacteria | 2777 |
| 566 | Ga0495608_0051140 | 3300046511 | Bacteria | 2739 |
| 567 | Ga0495608_0358756 | 3300046511 | Bacteria | 896 |
| 568 | Ga0495608_0627775 | 3300046511 | Bacteria | 643 |
| 569 | Ga0495618_0136625 | 3300046514 | Bacteria | 1568 |
| 570 | Ga0495618_0202541 | 3300046514 | Bacteria | 1256 |
| 571 | Ga0495618_0370103 | 3300046514 | Bacteria | 880 |
| 572 | Ga0495618_0909951 | 3300046514 | Bacteria | 507 |
| 573 | Ga0495628_0000743 | 3300046516 | Bacteria | 30199 |
| 574 | Ga0495628_0028733 | 3300046516 | Bacteria | 4516 |
| 575 | Ga0495628_0260338 | 3300046516 | Bacteria | 1293 |
| 576 | Ga0495628_0575975 | 3300046516 | Bacteria | 806 |
| 577 | Ga0495630_0069333 | 3300046517 | Bacteria | 2652 |
| 578 | Ga0495630_0069732 | 3300046517 | Bacteria | 2645 |
| 579 | Ga0495630_0072095 | 3300046517 | Bacteria | 2600 |
| 580 | Ga0495630_0087456 | 3300046517 | Bacteria | 2353 |
| 581 | Ga0495630_0135687 | 3300046517 | Bacteria | 1870 |
| 582 | Ga0495630_0257456 | 3300046517 | Bacteria | 1333 |
| 583 | Ga0495630_0388104 | 3300046517 | Bacteria | 1069 |
| 584 | Ga0495630_1109925 | 3300046517 | Unclassified | 599 |
| 585 | Ga0495666_0052146 | 3300046526 | Bacteria | 1964 |
| 586 | Ga0495666_0058665 | 3300046526 | Unclassified | 1841 |
| 587 | Ga0495666_0146250 | 3300046526 | Bacteria | 1100 |
| 588 | Ga0495652_0001695 | 3300046529 | Bacteria | 23794 |
| 589 | Ga0495652_0017164 | 3300046529 | Bacteria | 6463 |
| 590 | Ga0495652_0067961 | 3300046529 | Bacteria | 2986 |
| 591 | Ga0495652_0241383 | 3300046529 | Bacteria | 1344 |
| 592 | Ga0495665_0046239 | 3300046531 | Bacteria | 2311 |
| 593 | Ga0495665_0069599 | 3300046531 | Bacteria | 1855 |
| 594 | Ga0495665_0086535 | 3300046531 | Bacteria | 1647 |
| 595 | Ga0495640_0020695 | 3300046533 | Bacteria | 4839 |
| 596 | Ga0495640_0057124 | 3300046533 | Bacteria | 2664 |
| 597 | Ga0495640_0124597 | 3300046533 | Bacteria | 1672 |
| 598 | Ga0495640_0446378 | 3300046533 | Bacteria | 790 |
| 599 | Ga0495640_0500219 | 3300046533 | Bacteria | 740 |
| 600 | Ga0495586_0015627 | 3300046535 | Bacteria | 4039 |
| 601 | Ga0495586_0063101 | 3300046535 | Bacteria | 2018 |
| 602 | Ga0495586_0068860 | 3300046535 | Bacteria | 1931 |
| 603 | Ga0495586_0442046 | 3300046535 | Bacteria | 749 |
| 604 | Ga0495587_0001724 | 3300046536 | Bacteria | 14594 |
| 605 | Ga0495587_0021839 | 3300046536 | Bacteria | 3948 |
| 606 | Ga0495587_0049045 | 3300046536 | Bacteria | 2500 |
| 607 | Ga0495587_0140117 | 3300046536 | Bacteria | 1381 |
| 608 | Ga0495587_0184413 | 3300046536 | Bacteria | 1182 |
| 609 | Ga0495645_0288528 | 3300046543 | Bacteria | 1076 |
| 610 | Ga0495622_0192654 | 3300046557 | Bacteria | 911 |
| 611 | Ga0495622_0353676 | 3300046557 | Unclassified | 636 |
| 612 | Ga0495667_0026375 | 3300046559 | Bacteria | 3916 |
| 613 | Ga0495667_0102488 | 3300046559 | Bacteria | 1851 |
| 614 | Ga0495667_0143519 | 3300046559 | Bacteria | 1538 |
| 615 | Ga0495667_0163686 | 3300046559 | Bacteria | 1430 |
| 616 | Ga0495667_0212788 | 3300046559 | Bacteria | 1235 |
| 617 | Ga0495667_0284840 | 3300046559 | Bacteria | 1049 |
| 618 | Ga0495634_0036717 | 3300046642 | Bacteria | 3350 |
| 619 | Ga0495634_0098085 | 3300046642 | Bacteria | 1896 |
| 620 | Ga0495634_0169655 | 3300046642 | Bacteria | 1372 |
| 621 | Ga0495635_0070732 | 3300046663 | Bacteria | 2392 |
| 622 | Ga0495635_0310834 | 3300046663 | Bacteria | 1056 |
| 623 | Ga0495635_0405154 | 3300046663 | Bacteria | 905 |
| 624 | Ga0495657_0024181 | 3300046675 | Bacteria | 4331 |
| 625 | Ga0495657_0038646 | 3300046675 | Bacteria | 3283 |
| 626 | Ga0495657_0062883 | 3300046675 | Bacteria | 2450 |
| 627 | Ga0495657_0245623 | 3300046675 | Bacteria | 1079 |
| 628 | Ga0495657_0307158 | 3300046675 | Bacteria | 945 |
| 629 | Ga0495657_0599797 | 3300046675 | Bacteria | 637 |
| 630 | Ga0495599_0019261 | 3300046678 | Bacteria | 4255 |
| 631 | Ga0495599_0462680 | 3300046678 | Bacteria | 750 |
| 632 | Ga0495599_0563597 | 3300046678 | Bacteria | 666 |
| 633 | Ga0495623_0014756 | 3300046679 | Bacteria | 5050 |
| 634 | Ga0495623_0047674 | 3300046679 | Bacteria | 2720 |
| 635 | Ga0495623_0049796 | 3300046679 | Bacteria | 2655 |
| 636 | Ga0495623_0206376 | 3300046679 | Bacteria | 1127 |
| 637 | Ga0495623_0563979 | 3300046679 | Bacteria | 595 |
| 638 | Ga0495646_0023695 | 3300046680 | Bacteria | 3863 |
| 639 | Ga0495646_0065301 | 3300046680 | Bacteria | 2155 |
| 640 | Ga0495647_0030102 | 3300046681 | Bacteria | 2012 |
| 641 | Ga0495658_0003500 | 3300046683 | Bacteria | 7768 |
| 642 | Ga0495658_0825659 | 3300046683 | Bacteria | 593 |
| 643 | Ga0495613_0036328 | 3300046689 | Bacteria | 3653 |
| 644 | Ga0495613_0086104 | 3300046689 | Bacteria | 2279 |
| 645 | Ga0495613_0098120 | 3300046689 | Bacteria | 2117 |
| 646 | Ga0495613_0156725 | 3300046689 | Bacteria | 1622 |
| 647 | Ga0495613_0320264 | 3300046689 | Bacteria | 1070 |
| 648 | Ga0495613_0402210 | 3300046689 | Bacteria | 934 |
| 649 | Ga0495613_0489902 | 3300046689 | Bacteria | 829 |
| 650 | Ga0495624_0007287 | 3300046690 | Bacteria | 7769 |
| 651 | Ga0495624_0114062 | 3300046690 | Bacteria | 1661 |
| 652 | Ga0495600_0051251 | 3300046809 | Bacteria | 2694 |
| 653 | Ga0495600_0075930 | 3300046809 | Bacteria | 2194 |
| 654 | Ga0495600_0374723 | 3300046809 | Bacteria | 889 |
| 655 | Ga0495600_0391389 | 3300046809 | Unclassified | 866 |
| 656 | Ga0495600_0400261 | 3300046809 | Bacteria | 854 |
| 657 | Ga0495604_0001483 | 3300047317 | Bacteria | 19340 |
| 658 | Ga0495604_0011284 | 3300047317 | Bacteria | 7094 |
| 659 | Ga0495604_0013619 | 3300047317 | Bacteria | 6486 |
| 660 | Ga0495604_0021270 | 3300047317 | Bacteria | 5179 |
| 661 | Ga0495604_0194816 | 3300047317 | Bacteria | 1410 |
| 662 | Ga0495604_0294820 | 3300047317 | Bacteria | 1091 |
| 663 | Ga0495604_0338990 | 3300047317 | Bacteria | 1001 |
| 664 | Ga0495604_0558655 | 3300047317 | Bacteria | 737 |
| 665 | Ga0495636_0194539 | 3300047318 | Bacteria | 924 |
| 666 | Ga0495674_0006253 | 3300047319 | Bacteria | 11427 |
| 667 | Ga0495674_0020173 | 3300047319 | Bacteria | 6174 |
| 668 | Ga0495674_0052258 | 3300047319 | Bacteria | 3597 |
| 669 | Ga0495674_0146301 | 3300047319 | Bacteria | 1983 |
| 670 | Ga0495674_0227728 | 3300047319 | Bacteria | 1539 |
| 671 | Ga0495674_0287272 | 3300047319 | Bacteria | 1346 |
| 672 | Ga0495676_0013622 | 3300047321 | Bacteria | 7300 |
| 673 | Ga0495676_0404491 | 3300047321 | Bacteria | 905 |
| 674 | Ga0495676_0981365 | 3300047321 | Bacteria | 539 |
| 675 | Ga0495680_0007841 | 3300047322 | Bacteria | 9747 |
| 676 | Ga0495680_0011639 | 3300047322 | Bacteria | 7774 |
| 677 | Ga0495680_0128200 | 3300047322 | Bacteria | 1867 |
| 678 | Ga0495680_0205056 | 3300047322 | Bacteria | 1413 |
| 679 | Ga0495680_0497386 | 3300047322 | Bacteria | 828 |
| 680 | Ga0495675_0000077 | 3300047444 | Bacteria | 68982 |
| 681 | Ga0495675_0001536 | 3300047444 | Bacteria | 13921 |
| 682 | Ga0495675_0043555 | 3300047444 | Bacteria | 2860 |
| 683 | Ga0495675_0185265 | 3300047444 | Bacteria | 1273 |
| 684 | Ga0495675_0605955 | 3300047444 | Bacteria | 620 |
| 685 | Ga0495684_0016559 | 3300047471 | Bacteria | 5679 |
| 686 | Ga0495684_0064436 | 3300047471 | Bacteria | 2785 |
| 687 | Ga0495684_0065814 | 3300047471 | Bacteria | 2755 |
| 688 | Ga0495684_0076825 | 3300047471 | Bacteria | 2536 |
| 689 | Ga0495684_0249388 | 3300047471 | Bacteria | 1292 |
| 690 | Ga0495684_0425234 | 3300047471 | Bacteria | 928 |
| 691 | Ga0495593_0019576 | 3300047673 | Bacteria | 3794 |
| 692 | Ga0495593_0094834 | 3300047673 | Bacteria | 1535 |
| 693 | Ga0495602_0000729 | 3300048088 | Bacteria | 31028 |
| 694 | Ga0495602_0006628 | 3300048088 | Bacteria | 12141 |
| 695 | Ga0495602_0217282 | 3300048088 | Bacteria | 1445 |
| 696 | Ga0495602_0281748 | 3300048088 | Bacteria | 1224 |
| 697 | Ga0495602_0767101 | 3300048088 | Bacteria | 650 |
| 698 | Ga0495614_0036269 | 3300048089 | Bacteria | 2117 |
| 699 | Ga0495614_0080431 | 3300048089 | Bacteria | 1411 |
| 700 | Ga0496101_0440566 | 3300048904 | Bacteria | 1028 |
| 701 | Ga0496102_0006239 | 3300048905 | Bacteria | 10163 |
| 702 | Ga0496103_0115509 | 3300048906 | Bacteria | 1707 |
| 703 | Ga0496103_0611214 | 3300048906 | Unclassified | 694 |
| 704 | Ga0496105_0111730 | 3300048908 | Bacteria | 2255 |
| 705 | Ga0496106_0026233 | 3300048909 | Bacteria | 4337 |
| 706 | Ga0496106_0489173 | 3300048909 | Bacteria | 988 |
| 707 | Ga0496106_0602613 | 3300048909 | Bacteria | 880 |
| 708 | Ga0496107_0050472 | 3300048910 | Bacteria | 2999 |
| 709 | Ga0496111_0558723 | 3300048914 | Bacteria | 840 |
| 710 | Ga0496112_0250641 | 3300048915 | Bacteria | 1722 |
| 711 | Ga0496112_0373504 | 3300048915 | Bacteria | 1367 |
| 712 | Ga0496114_0021884 | 3300048917 | Bacteria | 5205 |
| 713 | Ga0496115_0009629 | 3300048918 | Bacteria | 7189 |
| 714 | Ga0496115_0017610 | 3300048918 | Bacteria | 5468 |
| 715 | Ga0501047_1231471 | 3300049581 | Bacteria | 562 |
| 716 | nmdc:mga0n895_234528_c1 | 3300050512 | Unclassified | 1862 |
| 717 | nmdc:mga0n895_4741_c1 | 3300050512 | Bacteria | 11234 |
| 718 | nmdc:mga0n895_6090_c1 | 3300050512 | Bacteria | 10181 |
| 719 | nmdc:mga0rr50_134785_c1 | 3300050513 | Bacteria | 1981 |
| 720 | nmdc:mga0rr50_166597_c1 | 3300050513 | Bacteria | 1792 |
| 721 | nmdc:mga0rr50_1795761_c1 | 3300050513 | Bacteria | 516 |
| 722 | nmdc:mga0rr50_592762_c1 | 3300050513 | Bacteria | 945 |
| 723 | nmdc:mga0rr50_999505_c1 | 3300050513 | Bacteria | 713 |
| 724 | nmdc:mga08x19_1104_c1 | 3300050514 | Bacteria | 16817 |
| 725 | nmdc:mga08x19_115119_c1 | 3300050514 | Bacteria | 1797 |
| 726 | nmdc:mga08x19_230586_c1 | 3300050514 | Bacteria | 1274 |
| 727 | nmdc:mga08x19_55722_c1 | 3300050514 | Bacteria | 2549 |
| 728 | nmdc:mga0a205_54282_c1 | 3300050515 | Bacteria | 3868 |
| 729 | Ga0495601_0108137 | 3300053077 | Bacteria | 1799 |
| 730 | Ga0495601_0265936 | 3300053077 | Bacteria | 1119 |
| 731 | Ga0495601_0407327 | 3300053077 | Bacteria | 881 |
| 732 | Ga0495612_0020586 | 3300053078 | Bacteria | 2644 |
| 733 | Ga0495612_0201760 | 3300053078 | Bacteria | 878 |
| 734 | Ga0495612_0268742 | 3300053078 | Bacteria | 761 |
| 735 | Ga0495595_0431380 | 3300053084 | Bacteria | 669 |
| 736 | Ga0495595_0447956 | 3300053084 | Bacteria | 656 |
| 737 | Ga0495619_0084845 | 3300053085 | Bacteria | 2138 |
| 738 | Ga0495619_1200804 | 3300053085 | Bacteria | 502 |
| 739 | Ga0587101_119047 | 3300059623 | Bacteria | 544 |
| 740 | nmdc:mga0rr50_767677_c1 | |||
| 741 | Ga0065704_10276480 | |||
| 742 | Ga0065715_10191425 | |||
| 743 | Ga0068869_100330158 | |||
| 744 | Ga0070680_101454346 | |||
| 745 | Ga0070682_100992407 | |||
| 746 | Ga0070660_101237603 | |||
| 747 | Ga0070689_101688833 | |||
| 748 | Ga0070691_10971178 | |||
| 749 | Ga0070687_100129656 | |||
| 750 | Ga0070674_101154010 | |||
| 751 | Ga0070659_101361458 | |||
| 752 | Ga0070667_101082405 | |||
| 753 | Ga0070709_10017405 | |||
| 754 | Ga0070709_10028219 | |||
| 755 | Ga0070709_10096355 | |||
| 756 | Ga0070709_10125464 | |||
| 757 | Ga0070709_10446839 | |||
| 758 | Ga0070709_10938083 | |||
| 759 | Ga0070709_10947837 | |||
| 760 | Ga0070714_100686245 | |||
| 761 | Ga0070714_102514069 | |||
| 762 | Ga0070713_100015424 | |||
| 763 | Ga0070713_100200350 | |||
| 764 | Ga0070713_100210628 | |||
| 765 | Ga0070713_100686766 | |||
| 766 | Ga0070713_101354096 | |||
| 767 | Ga0070713_101381388 | |||
| 768 | Ga0070710_10068999 | |||
| 769 | Ga0070710_10089634 | |||
| 770 | Ga0070710_10100415 | |||
| 771 | Ga0070710_11323136 | |||
| 772 | Ga0070710_11422335 | |||
| 773 | Ga0070711_100009336 | |||
| 774 | Ga0070711_100021952 | |||
| 775 | Ga0070711_100305362 | |||
| 776 | Ga0070711_100388568 | |||
| 777 | Ga0070711_101092854 | |||
| 778 | Ga0070705_100916734 | |||
| 779 | Ga0070708_100029271 | |||
| 780 | Ga0070708_100033585 | |||
| 781 | Ga0070708_100171407 | |||
| 782 | Ga0070708_100255852 | |||
| 783 | Ga0070708_100262074 | |||
| 784 | Ga0070708_100524113 | |||
| 785 | Ga0070708_100662205 | |||
| 786 | Ga0070708_101533585 | |||
| 787 | Ga0068867_101924738 | |||
| 788 | Ga0070706_100079807 | |||
| 789 | Ga0070706_100292478 | |||
| 790 | Ga0070706_100359249 | |||
| 791 | Ga0070706_100570928 | |||
| 792 | Ga0070706_100849919 | |||
| 793 | Ga0070707_100000272 | |||
| 794 | Ga0070707_100005954 | |||
| 795 | Ga0070707_100043596 | |||
| 796 | Ga0070707_100095547 | |||
| 797 | Ga0070707_100096313 | |||
| 798 | Ga0070707_100258919 | |||
| 799 | Ga0070707_100711914 | |||
| 800 | Ga0070707_101404852 | |||
| 801 | Ga0070707_101828420 | |||
| 802 | Ga0070707_102273918 | |||
| 803 | Ga0070698_100048378 | |||
| 804 | Ga0070698_100048956 | |||
| 805 | Ga0070698_100103116 | |||
| 806 | Ga0070698_101481793 | |||
| 807 | Ga0070699_100036817 | |||
| 808 | Ga0070699_100110187 | |||
| 809 | Ga0070699_100164368 | |||
| 810 | Ga0070699_100343410 | |||
| 811 | Ga0070699_100378989 | |||
| 812 | Ga0070699_100580381 | |||
| 813 | Ga0070699_100620155 | |||
| 814 | Ga0070699_100863279 | |||
| 815 | Ga0070699_100903030 | |||
| 816 | Ga0070699_101468978 | |||
| 817 | Ga0070699_101601184 | |||
| 818 | Ga0070697_100016359 | |||
| 819 | Ga0070697_100098366 | |||
| 820 | Ga0070697_100098743 | |||
| 821 | Ga0070697_100124371 | |||
| 822 | Ga0070697_100143092 | |||
| 823 | Ga0070697_100145338 | |||
| 824 | Ga0070697_100611857 | |||
| 825 | Ga0070697_100760484 | |||
| 826 | Ga0070697_101500052 | |||
| 827 | Ga0070697_101711113 | |||
| 828 | Ga0068853_100862390 | |||
| 829 | Ga0070686_100079701 | |||
| 830 | Ga0070686_100190878 | |||
| 831 | Ga0070695_100050684 | |||
| 832 | Ga0070695_100077154 | |||
| 833 | Ga0070696_100090703 | |||
| 834 | Ga0070704_100230605 | |||
| 835 | Ga0068855_101326213 | |||
| 836 | Ga0068856_101508057 | |||
| 837 | Ga0068859_100085487 | |||
| 838 | Ga0068859_100908909 | |||
| 839 | Ga0068859_101209633 | |||
| 840 | Ga0068864_101059095 | |||
| 841 | Ga0068861_100436378 | |||
| 842 | Ga0068863_100006891 | |||
| 843 | Ga0068863_100356073 | |||
| 844 | Ga0068858_100733297 | |||
| 845 | Ga0068860_100012866 | |||
| 846 | Ga0068860_100022280 | |||
| 847 | Ga0068860_100413553 | |||
| 848 | Ga0068860_102543928 | |||
| 849 | Ga0068862_101647982 | |||
| 850 | Ga0070717_10290192 | |||
| 851 | Ga0070717_10800130 | |||
| 852 | Ga0070717_10893568 | |||
| 853 | Ga0075432_10243147 | |||
| 854 | Ga0070715_10031039 | |||
| 855 | Ga0070715_10126933 | |||
| 856 | Ga0070715_10161014 | |||
| 857 | Ga0070715_10515385 | |||
| 858 | Ga0070715_10527032 | |||
| 859 | Ga0070715_10560139 | |||
| 860 | Ga0070716_100023314 | |||
| 861 | Ga0070716_100044936 | |||
| 862 | Ga0070716_100056234 | |||
| 863 | Ga0070716_100170233 | |||
| 864 | Ga0070716_100297817 | |||
| 865 | Ga0070716_100378590 | |||
| 866 | Ga0070716_100562390 | |||
| 867 | Ga0070716_100908962 | |||
| 868 | Ga0070716_101192646 | |||
| 869 | Ga0070712_100036991 | |||
| 870 | Ga0070712_100049811 | |||
| 871 | Ga0070712_100259160 | |||
| 872 | Ga0070712_100291274 | |||
| 873 | Ga0070712_100382662 | |||
| 874 | Ga0070712_101836551 | |||
| 875 | Ga0097621_100061799 | |||
| 876 | Ga0097621_100417984 | |||
| 877 | Ga0097621_100493670 | |||
| 878 | Ga0097621_100793325 | |||
| 879 | Ga0097621_100913156 | |||
| 880 | Ga0068871_100000420 | |||
| 881 | Ga0068871_100206890 | |||
| 882 | Ga0068871_100704640 | |||
| 883 | Ga0075428_100500909 | |||
| 884 | Ga0075434_100012780 | |||
| 885 | Ga0075434_100136709 | |||
| 886 | Ga0075434_100199449 | |||
| 887 | Ga0075434_100756308 | |||
| 888 | Ga0075436_100022850 | |||
| 889 | Ga0075436_100069860 | |||
| 890 | Ga0075436_100109975 | |||
| 891 | Ga0075436_100166283 | |||
| 892 | Ga0075436_100442476 | |||
| 893 | Ga0075436_100635233 | |||
| 894 | Ga0097620_100085484 | |||
| 895 | Ga0097620_100908957 | |||
| 896 | Ga0097620_101209527 | |||
| 897 | Ga0075435_100155092 | |||
| 898 | Ga0075435_100441552 | |||
| 899 | Ga0075435_100488884 | |||
| 900 | Ga0075435_100880372 | |||
| 901 | Ga0099794_10003369 | |||
| 902 | Ga0099794_10011981 | |||
| 903 | Ga0099794_10051524 | |||
| 904 | Ga0099794_10053799 | |||
| 905 | Ga0099794_10069255 | |||
| 906 | Ga0099794_10107866 | |||
| 907 | Ga0099794_10363413 | |||
| 908 | Ga0099794_10366118 | |||
| 909 | Ga0099794_10645537 | |||
| 910 | Ga0099795_10010651 | |||
| 911 | Ga0099795_10073653 | |||
| 912 | Ga0099795_10136457 | |||
| 913 | Ga0099795_10322030 | |||
| 914 | Ga0105240_10061519 | |||
| 915 | Ga0105240_10287386 | |||
| 916 | Ga0105245_10127111 | |||
| 917 | Ga0105245_10556875 | |||
| 918 | Ga0105247_10253258 | |||
| 919 | Ga0105247_10354715 | |||
| 920 | Ga0105243_11945223 | |||
| 921 | Ga0105242_10133115 | |||
| 922 | Ga0105242_10265593 | |||
| 923 | Ga0105242_10783811 | |||
| 924 | Ga0105242_10868010 | |||
| 925 | Ga0105248_10008490 | |||
| 926 | Ga0105248_10008673 | |||
| 927 | Ga0105248_10688950 | |||
| 928 | Ga0105248_11165374 | |||
| 929 | Ga0105237_10245972 | |||
| 930 | Ga0105249_10286019 | |||
| 931 | Ga0099796_10017824 | |||
| 932 | Ga0099796_10018821 | |||
| 933 | Ga0099796_10068692 | |||
| 934 | Ga0099796_10237072 | |||
| 935 | Ga0105239_10066805 | |||
| 936 | Ga0105239_10401880 | |||
| 937 | Ga0157369_10871543 | |||
| 938 | Ga0157374_10022996 | |||
| 939 | Ga0157374_10252944 | |||
| 940 | Ga0157374_11529557 | |||
| 941 | Ga0157378_10003557 | |||
| 942 | Ga0157378_10003574 | |||
| 943 | Ga0157378_10005337 | |||
| 944 | Ga0157378_10015014 | |||
| 945 | Ga0157378_10867997 | |||
| 946 | Ga0157378_11009611 | |||
| 947 | Ga0163162_10024701 | |||
| 948 | Ga0163162_10060074 | |||
| 949 | Ga0163162_11856952 | |||
| 950 | Ga0163162_13272741 | |||
| 951 | Ga0157375_11495202 | |||
| 952 | Ga0157375_12644737 | |||
| 953 | Ga0163163_10522373 | |||
| 954 | Ga0157379_10347010 | |||
| 955 | Ga0157379_10573252 | |||
| 956 | Ga0157376_10036066 | |||
| 957 | Ga0184602_101813 | |||
| 958 | Ga0184602_109986 | |||
| 959 | Ga0184602_118498 | |||
| 960 | Ga0184602_119558 | |||
| 961 | Ga0184598_106849 | |||
| 962 | Ga0184601_115529 | |||
| 963 | Ga0184601_124842 | |||
| 964 | Ga0184599_129025 | |||
| 965 | Ga0184599_129928 | |||
| 966 | Ga0184599_141070 | |||
| 967 | Ga0184599_148132 | |||
| 968 | Ga0184599_151674 | |||
| 969 | Ga0184600_102713 | |||
| 970 | Ga0184603_110579 | |||
| 971 | Ga0184603_130044 | |||
| 972 | Ga0184603_138242 | |||
| 973 | Ga0206349_1464016 | |||
| 974 | Ga0206349_1601330 | |||
| 975 | Ga0206350_10307447 | |||
| 976 | Ga0206350_10836049 | |||
| 977 | Ga0224712_10183790 | |||
| 978 | Ga0224569_112299 | |||
| 979 | Ga0224571_111667 | |||
| 980 | Ga0224571_112399 | |||
| 981 | Ga0247552_100403 | |||
| 982 | Ga0247555_100427 | |||
| 983 | Ga0247555_101606 | |||
| 984 | Ga0247555_102332 | |||
| 985 | Ga0247555_103437 | |||
| 986 | Ga0247554_100011 | |||
| 987 | Ga0247554_102301 | |||
| 988 | Ga0247553_100114 | |||
| 989 | Ga0247553_100206 | |||
| 990 | Ga0247553_100403 | |||
| 991 | Ga0247553_107952 | |||
| 992 | Ga0247553_109608 | |||
| 993 | Ga0247553_110016 | |||
| 994 | Ga0247553_111476 | |||
| 995 | Ga0224572_1026861 | |||
| 996 | Ga0228598_1000356 | |||
| 997 | Ga0228598_1004718 | |||
| 998 | Ga0207692_10113894 | |||
| 999 | Ga0207692_10425993 | |||
| 1000 | Ga0207692_10543421 | |||
| 1001 | Ga0207642_10161045 | |||
| 1002 | Ga0207710_10208702 | |||
| 1003 | Ga0207680_10161773 | |||
| 1004 | Ga0207680_10624282 | |||
| 1005 | Ga0207685_10011326 | |||
| 1006 | Ga0207685_10125220 | |||
| 1007 | Ga0207685_10360775 | |||
| 1008 | Ga0207699_10005224 | |||
| 1009 | Ga0207699_10013376 | |||
| 1010 | Ga0207699_10121982 | |||
| 1011 | Ga0207699_10247555 | |||
| 1012 | Ga0207699_10399284 | |||
| 1013 | Ga0207699_10400405 | |||
| 1014 | Ga0207699_10530583 | |||
| 1015 | Ga0207699_10556647 | |||
| 1016 | Ga0207699_10817563 | |||
| 1017 | Ga0207684_10004887 | |||
| 1018 | Ga0207684_10064384 | |||
| 1019 | Ga0207684_10200367 | |||
| 1020 | Ga0207684_11579210 | |||
| 1021 | Ga0207695_10118395 | |||
| 1022 | Ga0207695_10266607 | |||
| 1023 | Ga0207695_11180984 | |||
| 1024 | Ga0207671_10303746 | |||
| 1025 | Ga0207671_11149905 | |||
| 1026 | Ga0207693_10022429 | |||
| 1027 | Ga0207693_10046457 | |||
| 1028 | Ga0207693_10160035 | |||
| 1029 | Ga0207693_10249059 | |||
| 1030 | Ga0207693_10257234 | |||
| 1031 | Ga0207693_10312429 | |||
| 1032 | Ga0207693_10425287 | |||
| 1033 | Ga0207663_10059354 | |||
| 1034 | Ga0207663_10113843 | |||
| 1035 | Ga0207663_10233265 | |||
| 1036 | Ga0207663_10676196 | |||
| 1037 | Ga0207663_10983396 | |||
| 1038 | Ga0207663_11603858 | |||
| 1039 | Ga0207662_10321534 | |||
| 1040 | Ga0207646_10000178 | |||
| 1041 | Ga0207646_10000294 | |||
| 1042 | Ga0207646_10000586 | |||
| 1043 | Ga0207646_10003595 | |||
| 1044 | Ga0207646_10025578 | |||
| 1045 | Ga0207646_10037311 | |||
| 1046 | Ga0207646_10048510 | |||
| 1047 | Ga0207646_10118018 | |||
| 1048 | Ga0207646_10325973 | |||
| 1049 | Ga0207646_10681563 | |||
| 1050 | Ga0207646_11026022 | |||
| 1051 | Ga0207687_10022876 | |||
| 1052 | Ga0207700_10019279 | |||
| 1053 | Ga0207700_10331731 | |||
| 1054 | Ga0207700_10487981 | |||
| 1055 | Ga0207700_11437584 | |||
| 1056 | Ga0207664_10138556 | |||
| 1057 | Ga0207664_10847206 | |||
| 1058 | Ga0207686_10164465 | |||
| 1059 | Ga0207704_10678063 | |||
| 1060 | Ga0207665_10001621 | |||
| 1061 | Ga0207665_10014244 | |||
| 1062 | Ga0207665_10112692 | |||
| 1063 | Ga0207665_10113690 | |||
| 1064 | Ga0207665_10351358 | |||
| 1065 | Ga0207711_10022174 | |||
| 1066 | Ga0207711_10033842 | |||
| 1067 | Ga0207711_10950037 | |||
| 1068 | Ga0207689_10378927 | |||
| 1069 | Ga0207689_10765190 | |||
| 1070 | Ga0207712_10202114 | |||
| 1071 | Ga0207658_11360517 | |||
| 1072 | Ga0207703_10236598 | |||
| 1073 | Ga0207639_10875698 | |||
| 1074 | Ga0207641_10220634 | |||
| 1075 | Ga0207648_10199679 | |||
| 1076 | Ga0207676_11158195 | |||
| 1077 | Ga0207675_100652270 | |||
| 1078 | Ga0209179_1032308 | |||
| 1079 | Ga0209179_1051000 | |||
| 1080 | Ga0209588_1002814 | |||
| 1081 | Ga0209588_1002923 | |||
| 1082 | Ga0209588_1003849 | |||
| 1083 | Ga0209588_1020605 | |||
| 1084 | Ga0209588_1020889 | |||
| 1085 | Ga0209588_1026752 | |||
| 1086 | Ga0209588_1030581 | |||
| 1087 | Ga0209588_1033602 | |||
| 1088 | Ga0209588_1078247 | |||
| 1089 | Ga0209588_1081951 | |||
| 1090 | Ga0209588_1115245 | |||
| 1091 | Ga0209588_1146915 | |||
| 1092 | Ga0209588_1191683 | |||
| 1093 | Ga0209588_1205382 | |||
| 1094 | Ga0265358_100420 | |||
| 1095 | Ga0265357_1033625 | |||
| 1096 | Ga0268264_10034899 | |||
| 1097 | Ga0268264_10379713 | |||
| 1098 | Ga0268264_10484546 | |||
| 1099 | Ga0265337_1159370 | |||
| 1100 | Ga0265319_1000770 | |||
| 1101 | Ga0265334_10118443 | |||
| 1102 | Ga0265318_10000563 | |||
| 1103 | Ga0265338_10005291 | |||
| 1104 | Ga0265338_10197386 | |||
| 1105 | Ga0265762_1004977 | |||
| 1106 | Ga0265762_1017805 | |||
| 1107 | Ga0265762_1078758 | |||
| 1108 | Ga0265775_100177 | |||
| 1109 | Ga0265775_109631 | |||
| 1110 | Ga0265763_1008382 | |||
| 1111 | Ga0265763_1044626 | |||
| 1112 | Ga0265777_100311 | |||
| 1113 | Ga0265777_125538 | |||
| 1114 | Ga0265770_1021038 | |||
| 1115 | Ga0265770_1095226 | |||
| 1116 | Ga0265765_1012785 | |||
| 1117 | Ga0265776_103756 | |||
| 1118 | Ga0265776_108504 | |||
| 1119 | Ga0265764_102006 | |||
| 1120 | Ga0265764_114264 | |||
| 1121 | Ga0265764_115678 | |||
| 1122 | Ga0265761_100222 | |||
| 1123 | Ga0265773_1009701 | |||
| 1124 | Ga0265779_104677 | |||
| 1125 | Ga0265779_105704 | |||
| 1126 | Ga0265760_10021891 | |||
| 1127 | Ga0265760_10038658 | |||
| 1128 | Ga0265760_10055534 | |||
| 1129 | Ga0265760_10143552 | |||
| 1130 | Ga0265760_10297186 | |||
| 1131 | Ga0265332_10058900 | |||
| 1132 | Ga0265332_10220435 | |||
| 1133 | Ga0265328_10147904 | |||
| 1134 | Ga0265320_10000328 | |||
| 1135 | Ga0265325_10002985 | |||
| 1136 | Ga0265325_10020600 | |||
| 1137 | Ga0265325_10115052 | |||
| 1138 | Ga0265329_10000518 | |||
| 1139 | Ga0265340_10009821 | |||
| 1140 | Ga0265340_10208132 | |||
| 1141 | Ga0265339_10002459 | |||
| 1142 | Ga0265331_10000021 | |||
| 1143 | Ga0265331_10012455 | |||
| 1144 | Ga0265331_10042036 | |||
| 1145 | Ga0265316_10001865 | |||
| 1146 | Ga0265316_10020772 | |||
| 1147 | Ga0265316_10258193 | |||
| 1148 | Ga0265316_10726264 | |||
| 1149 | Ga0265313_10000730 | |||
| 1150 | Ga0265313_10092339 | |||
| 1151 | Ga0265313_10138444 | |||
| 1152 | Ga0265314_10386125 | |||
| 1153 | Ga0265342_10000032 | |||
| 1154 | Ga0265342_10165024 | |||
| 1155 | Ga0316577_10033544 | |||
| 1156 | Ga0316044_128059 | |||
| 1157 | Ga0316045_127660 | |||
| 1158 | Ga0316053_100043 | |||
| 1159 | Ga0316053_100152 | |||
| 1160 | Ga0316053_101188 | |||
| 1161 | Ga0316053_102566 | |||
| 1162 | Ga0316053_106946 | |||
| 1163 | Ga0316053_112726 | |||
| 1164 | Ga0316053_116456 | |||
| 1165 | Ga0316593_10003452 | |||
| 1166 | Ga0316593_10046399 | |||
| 1167 | Ga0316593_10102791 | |||
| 1168 | Ga0316593_10220788 | |||
| 1169 | Ga0316596_1013787 | |||
| 1170 | Ga0316596_1039663 | |||
| 1171 | Ga0316596_1139678 | |||
| 1172 | Ga0316596_1163317 | |||
| 1173 | Ga0316596_1232740 | |||
| 1174 | Ga0316212_1019719 | |||
| 1175 | Ga0373926_0003731 | |||
| 1176 | Ga0373926_0094768 | |||
| 1177 | Ga0373934_0001143 | |||
| 1178 | Ga0373934_0024497 | |||
| 1179 | Ga0373940_0285289 | |||
| 1180 | Ga0373923_0062413 | |||
| 1181 | Ga0373923_0107938 | |||
| 1182 | Ga0373923_0197180 | |||
| 1183 | Ga0373945_0138156 | |||
| 1184 | Ga0373954_0000615 | |||
| 1185 | Ga0373954_0040865 | |||
| 1186 | Ga0373954_0234955 | |||
| 1187 | Ga0373954_0280660 | |||
| 1188 | Ga0373956_0021789 | |||
| 1189 | Ga0373956_0054593 | |||
| 1190 | Ga0373956_0268205 | |||
| 1191 | Ga0373957_0030817 | |||
| 1192 | Ga0373957_0475247 | |||
| 1193 | Ga0373943_0330565 | |||
| 1194 | Ga0373943_0457118 | |||
| 1195 | Ga0373943_0866920 | |||
| 1196 | Ga0373946_0075004 | |||
| 1197 | Ga0373946_0283958 | |||
| 1198 | Ga0373955_0030550 | |||
| 1199 | Ga0373955_0088708 | |||
| 1200 | Ga0373955_0092799 | |||
| 1201 | Ga0373955_0093827 | |||
| 1202 | Ga0373955_0636128 | |||
| 1203 | Ga0373924_0067858 | |||
| 1204 | Ga0373924_0352915 | |||
| 1205 | Ga0373924_0389574 | |||
| 1206 | Ga0373931_0315729 | |||
| 1207 | Ga0373935_0041693 | |||
| 1208 | Ga0373935_0738414 | |||
| 1209 | Ga0373927_0001112 | |||
| 1210 | Ga0373927_0015777 | |||
| 1211 | Ga0373927_0024735 | |||
| 1212 | Ga0373933_0000875 | |||
| 1213 | Ga0373933_0002114 | |||
| 1214 | Ga0373933_0031390 | |||
| 1215 | Ga0373933_0115860 | |||
| 1216 | Ga0373947_0005049 | |||
| 1217 | Ga0373947_0014667 | |||
| 1218 | Ga0373947_0047927 | |||
| 1219 | Ga0373937_0000111 | |||
| 1220 | Ga0373937_0036370 | |||
| 1221 | Ga0373937_0037074 | |||
| 1222 | Ga0373937_0049212 | |||
| 1223 | Ga0373937_0251160 | |||
| 1224 | Ga0373937_0683963 | |||
| 1225 | Ga0373937_0866235 | |||
| 1226 | Ga0265778_001414 | |||
| 1227 | Ga0265778_001498 | |||
| 1228 | Ga0265778_002443 | |||
| 1229 | Ga0265778_011612 | |||
| 1230 | Ga0265778_017951 | |||
| 1231 | Ga0265778_037308 | |||
| 1232 | Ga0265778_043206 | |||
| 1233 | Ga0265778_043795 | |||
| 1234 | Ga0265778_056321 | |||
| 1235 | Ga0373925_0000969 | |||
| 1236 | Ga0373925_0010535 | |||
| 1237 | Ga0373925_0202420 | |||
| 1238 | Ga0373925_0358024 | |||
| 1239 | Ga0373925_0811552 | |||
| 1240 | Ga0373925_0957582 | |||
| 1241 | Ga0395898_1609637 | |||
| 1242 | Ga0436360_0908177 | |||
| 1243 | Ga0451837_0411823 | |||
| 1244 | Ga0451577_0035010 | |||
| 1245 | Ga0451577_0126378 | |||
| 1246 | Ga0451577_0128279 | |||
| 1247 | Ga0451577_1020154 | |||
| 1248 | Ga0453683_0016428 | |||
| 1249 | Ga0453683_0023533 | |||
| 1250 | Ga0453683_0031301 | |||
| 1251 | Ga0453683_0034792 | |||
| 1252 | Ga0453683_0079728 | |||
| 1253 | Ga0453684_0019676 | |||
| 1254 | Ga0453684_0036842 | |||
| 1255 | Ga0453684_0185611 | |||
| 1256 | Ga0453684_0219978 | |||
| 1257 | Ga0453684_0258296 | |||
| 1258 | Ga0453684_0417182 | |||
| 1259 | Ga0451576_0286383 | |||
| 1260 | Ga0451576_0345957 | |||
| 1261 | Ga0451576_0630874 | |||
| 1262 | Ga0451576_0793267 | |||
| 1263 | Ga0495592_0065622 | |||
| 1264 | Ga0495592_0069907 | |||
| 1265 | Ga0495592_0149700 | |||
| 1266 | Ga0495592_0618495 | |||
| 1267 | Ga0495592_0906875 | |||
| 1268 | Ga0495603_0079373 | |||
| 1269 | Ga0495603_0761200 | |||
| 1270 | Ga0495629_0160387 | |||
| 1271 | Ga0495629_0460859 | |||
| 1272 | Ga0495641_0038397 | |||
| 1273 | Ga0495641_0097217 | |||
| 1274 | Ga0495651_0001249 | |||
| 1275 | Ga0495651_0006995 | |||
| 1276 | Ga0495651_0020364 | |||
| 1277 | Ga0495651_0051316 | |||
| 1278 | Ga0495653_0003367 | |||
| 1279 | Ga0495653_0100464 | |||
| 1280 | Ga0495653_0424494 | |||
| 1281 | Ga0495653_0646628 | |||
| 1282 | Ga0495580_0021880 | |||
| 1283 | Ga0495580_0030085 | |||
| 1284 | Ga0495580_0104727 | |||
| 1285 | Ga0495580_0133139 | |||
| 1286 | Ga0495580_0293451 | |||
| 1287 | Ga0495580_0477452 | |||
| 1288 | Ga0495580_0623003 | |||
| 1289 | Ga0495580_0694607 | |||
| 1290 | Ga0495582_0000417 | |||
| 1291 | Ga0495582_0013912 | |||
| 1292 | Ga0495582_0292645 | |||
| 1293 | Ga0495582_0383786 | |||
| 1294 | Ga0495582_0883491 | |||
| 1295 | Ga0495639_0016004 | |||
| 1296 | Ga0495662_0072313 | |||
| 1297 | Ga0495664_0032941 | |||
| 1298 | Ga0495664_0482244 | |||
| 1299 | Ga0495594_0001371 | |||
| 1300 | Ga0495594_0703614 | |||
| 1301 | Ga0495608_0008749 | |||
| 1302 | Ga0495608_0017709 | |||
| 1303 | Ga0495608_0031575 | |||
| 1304 | Ga0495608_0049901 | |||
| 1305 | Ga0495608_0051140 | |||
| 1306 | Ga0495608_0358756 | |||
| 1307 | Ga0495608_0627775 | |||
| 1308 | Ga0495618_0136625 | |||
| 1309 | Ga0495618_0202541 | |||
| 1310 | Ga0495618_0370103 | |||
| 1311 | Ga0495618_0909951 | |||
| 1312 | Ga0495628_0000743 | |||
| 1313 | Ga0495628_0028733 | |||
| 1314 | Ga0495628_0260338 | |||
| 1315 | Ga0495628_0575975 | |||
| 1316 | Ga0495630_0069333 | |||
| 1317 | Ga0495630_0069732 | |||
| 1318 | Ga0495630_0072095 | |||
| 1319 | Ga0495630_0087456 | |||
| 1320 | Ga0495630_0135687 | |||
| 1321 | Ga0495630_0257456 | |||
| 1322 | Ga0495630_0388104 | |||
| 1323 | Ga0495630_1109925 | |||
| 1324 | Ga0495666_0052146 | |||
| 1325 | Ga0495666_0058665 | |||
| 1326 | Ga0495666_0146250 | |||
| 1327 | Ga0495652_0001695 | |||
| 1328 | Ga0495652_0017164 | |||
| 1329 | Ga0495652_0067961 | |||
| 1330 | Ga0495652_0241383 | |||
| 1331 | Ga0495665_0046239 | |||
| 1332 | Ga0495665_0069599 | |||
| 1333 | Ga0495665_0086535 | |||
| 1334 | Ga0495640_0020695 | |||
| 1335 | Ga0495640_0057124 | |||
| 1336 | Ga0495640_0124597 | |||
| 1337 | Ga0495640_0446378 | |||
| 1338 | Ga0495640_0500219 | |||
| 1339 | Ga0495586_0015627 | |||
| 1340 | Ga0495586_0063101 | |||
| 1341 | Ga0495586_0068860 | |||
| 1342 | Ga0495586_0442046 | |||
| 1343 | Ga0495587_0001724 | |||
| 1344 | Ga0495587_0021839 | |||
| 1345 | Ga0495587_0049045 | |||
| 1346 | Ga0495587_0140117 | |||
| 1347 | Ga0495587_0184413 | |||
| 1348 | Ga0495645_0288528 | |||
| 1349 | Ga0495622_0192654 | |||
| 1350 | Ga0495622_0353676 | |||
| 1351 | Ga0495667_0026375 | |||
| 1352 | Ga0495667_0102488 | |||
| 1353 | Ga0495667_0143519 | |||
| 1354 | Ga0495667_0163686 | |||
| 1355 | Ga0495667_0212788 | |||
| 1356 | Ga0495667_0284840 | |||
| 1357 | Ga0495634_0036717 | |||
| 1358 | Ga0495634_0098085 | |||
| 1359 | Ga0495634_0169655 | |||
| 1360 | Ga0495635_0070732 | |||
| 1361 | Ga0495635_0310834 | |||
| 1362 | Ga0495635_0405154 | |||
| 1363 | Ga0495657_0024181 | |||
| 1364 | Ga0495657_0038646 | |||
| 1365 | Ga0495657_0062883 | |||
| 1366 | Ga0495657_0245623 | |||
| 1367 | Ga0495657_0307158 | |||
| 1368 | Ga0495657_0599797 | |||
| 1369 | Ga0495599_0019261 | |||
| 1370 | Ga0495599_0462680 | |||
| 1371 | Ga0495599_0563597 | |||
| 1372 | Ga0495623_0014756 | |||
| 1373 | Ga0495623_0047674 | |||
| 1374 | Ga0495623_0049796 | |||
| 1375 | Ga0495623_0206376 | |||
| 1376 | Ga0495623_0563979 | |||
| 1377 | Ga0495646_0023695 | |||
| 1378 | Ga0495646_0065301 | |||
| 1379 | Ga0495647_0030102 | |||
| 1380 | Ga0495658_0003500 | |||
| 1381 | Ga0495658_0825659 | |||
| 1382 | Ga0495613_0036328 | |||
| 1383 | Ga0495613_0086104 | |||
| 1384 | Ga0495613_0098120 | |||
| 1385 | Ga0495613_0156725 | |||
| 1386 | Ga0495613_0320264 | |||
| 1387 | Ga0495613_0402210 | |||
| 1388 | Ga0495613_0489902 | |||
| 1389 | Ga0495624_0007287 | |||
| 1390 | Ga0495624_0114062 | |||
| 1391 | Ga0495600_0051251 | |||
| 1392 | Ga0495600_0075930 | |||
| 1393 | Ga0495600_0374723 | |||
| 1394 | Ga0495600_0391389 | |||
| 1395 | Ga0495600_0400261 | |||
| 1396 | Ga0495604_0001483 | |||
| 1397 | Ga0495604_0011284 | |||
| 1398 | Ga0495604_0013619 | |||
| 1399 | Ga0495604_0021270 | |||
| 1400 | Ga0495604_0194816 | |||
| 1401 | Ga0495604_0294820 | |||
| 1402 | Ga0495604_0338990 | |||
| 1403 | Ga0495604_0558655 | |||
| 1404 | Ga0495636_0194539 | |||
| 1405 | Ga0495674_0006253 | |||
| 1406 | Ga0495674_0020173 | |||
| 1407 | Ga0495674_0052258 | |||
| 1408 | Ga0495674_0146301 | |||
| 1409 | Ga0495674_0227728 | |||
| 1410 | Ga0495674_0287272 | |||
| 1411 | Ga0495676_0013622 | |||
| 1412 | Ga0495676_0404491 | |||
| 1413 | Ga0495676_0981365 | |||
| 1414 | Ga0495680_0007841 | |||
| 1415 | Ga0495680_0011639 | |||
| 1416 | Ga0495680_0128200 | |||
| 1417 | Ga0495680_0205056 | |||
| 1418 | Ga0495680_0497386 | |||
| 1419 | Ga0495675_0000077 | |||
| 1420 | Ga0495675_0001536 | |||
| 1421 | Ga0495675_0043555 | |||
| 1422 | Ga0495675_0185265 | |||
| 1423 | Ga0495675_0605955 | |||
| 1424 | Ga0495684_0016559 | |||
| 1425 | Ga0495684_0064436 | |||
| 1426 | Ga0495684_0065814 | |||
| 1427 | Ga0495684_0076825 | |||
| 1428 | Ga0495684_0249388 | |||
| 1429 | Ga0495684_0425234 | |||
| 1430 | Ga0495593_0019576 | |||
| 1431 | Ga0495593_0094834 | |||
| 1432 | Ga0495602_0000729 | |||
| 1433 | Ga0495602_0006628 | |||
| 1434 | Ga0495602_0217282 | |||
| 1435 | Ga0495602_0281748 | |||
| 1436 | Ga0495602_0767101 | |||
| 1437 | Ga0495614_0036269 | |||
| 1438 | Ga0495614_0080431 | |||
| 1439 | Ga0496101_0440566 | |||
| 1440 | Ga0496102_0006239 | |||
| 1441 | Ga0496103_0115509 | |||
| 1442 | Ga0496103_0611214 | |||
| 1443 | Ga0496105_0111730 | |||
| 1444 | Ga0496106_0026233 | |||
| 1445 | Ga0496106_0489173 | |||
| 1446 | Ga0496106_0602613 | |||
| 1447 | Ga0496107_0050472 | |||
| 1448 | Ga0496111_0558723 | |||
| 1449 | Ga0496112_0250641 | |||
| 1450 | Ga0496112_0373504 | |||
| 1451 | Ga0496114_0021884 | |||
| 1452 | Ga0496115_0009629 | |||
| 1453 | Ga0496115_0017610 | |||
| 1454 | Ga0501047_1231471 | |||
| 1455 | nmdc:mga0n895_234528_c1 | |||
| 1456 | nmdc:mga0n895_4741_c1 | |||
| 1457 | nmdc:mga0n895_6090_c1 | |||
| 1458 | nmdc:mga0rr50_134785_c1 | |||
| 1459 | nmdc:mga0rr50_166597_c1 | |||
| 1460 | nmdc:mga0rr50_1795761_c1 | |||
| 1461 | nmdc:mga0rr50_592762_c1 | |||
| 1462 | nmdc:mga0rr50_999505_c1 | |||
| 1463 | nmdc:mga08x19_1104_c1 | |||
| 1464 | nmdc:mga08x19_115119_c1 | |||
| 1465 | nmdc:mga08x19_230586_c1 | |||
| 1466 | nmdc:mga08x19_55722_c1 | |||
| 1467 | nmdc:mga0a205_54282_c1 | |||
| 1468 | Ga0495601_0108137 | |||
| 1469 | Ga0495601_0265936 | |||
| 1470 | Ga0495601_0407327 | |||
| 1471 | Ga0495612_0020586 | |||
| 1472 | Ga0495612_0201760 | |||
| 1473 | Ga0495612_0268742 | |||
| 1474 | Ga0495595_0431380 | |||
| 1475 | Ga0495595_0447956 | |||
| 1476 | Ga0495619_0084845 | |||
| 1477 | Ga0495619_1200804 | |||
| 1478 | Ga0587101_119047 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.9199 | 5 | 96 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9107 | 5 | 96 |
| 1wnr-assembly1.cif.gz_G | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9069 | 5 | 96 |
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.8967 | 5 | 96 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8877 | 5 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9211 | 5 | 96 | 2.30.33.40 |
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9199 | 5 | 96 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8975 | 5 | 96 | 2.30.33.40 |
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8967 | 5 | 96 | 2.30.33.40 |
| af_C0PKD9_55_155_2.30.33.40 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8187 | 5 | 96 | 2.30.33.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E4HK73-F1-model_v4 | 10 kDa chaperonin | 0.9641 | 3 | 97 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A6I4YWY0-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9578 | 3 | 96 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A0G1W4N5-F1-model_v4 | 10 kDa chaperonin | 0.9539 | 34 | 96 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-F0Y075-F1-model_v4 | 10 kDa chaperonin | 0.9373 | 5 | 92 |
GO:0005524
GO:0005739 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A7X8RDF5-F1-model_v4 | 10 kDa chaperonin | 0.9294 | 32 | 96 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |