F478492

General Info

Members Datasets Scaffolds Average Seq Length
739 251 1478 106

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_767677_c1|nmdc:mga0rr50_767677_c1_268_657
Length 129
Sequence LSQQILEGIFGRVREMDYAEVRKMSVNVTPLHDRVLVRRLEEKETAKGGIIIPDTAKEKPQEGEVMAIGAGKMEKGRRVPLDVKVGDRILFGKYTGNDISIDDQEYLILREDEILLKLSGMAKAVSGKK

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
83 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
84 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
122 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
155 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
156 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.96
Metatranscriptomes 12.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.43
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_767677_c1 3300050513 Bacteria 823
2 Ga0065704_10276480 3300005289 Bacteria 932
3 Ga0065715_10191425 3300005293 Bacteria 1413
4 Ga0068869_100330158 3300005334 Bacteria 1239
5 Ga0070680_101454346 3300005336 Unclassified 593
6 Ga0070682_100992407 3300005337 Bacteria 696
7 Ga0070660_101237603 3300005339 Bacteria 633
8 Ga0070689_101688833 3300005340 Unclassified 576
9 Ga0070691_10971178 3300005341 Bacteria 528
10 Ga0070687_100129656 3300005343 Bacteria 1454
11 Ga0070674_101154010 3300005356 Bacteria 686
12 Ga0070659_101361458 3300005366 Bacteria 630
13 Ga0070667_101082405 3300005367 Bacteria 749
14 Ga0070709_10017405 3300005434 Bacteria 4122
15 Ga0070709_10028219 3300005434 Bacteria 3346
16 Ga0070709_10096355 3300005434 Bacteria 1962
17 Ga0070709_10125464 3300005434 Bacteria 1746
18 Ga0070709_10446839 3300005434 Bacteria 973
19 Ga0070709_10938083 3300005434 Bacteria 686
20 Ga0070709_10947837 3300005434 Bacteria 683
21 Ga0070714_100686245 3300005435 Bacteria 987
22 Ga0070714_102514069 3300005435 Bacteria 500
23 Ga0070713_100015424 3300005436 Bacteria 5712
24 Ga0070713_100200350 3300005436 Bacteria 1802
25 Ga0070713_100210628 3300005436 Bacteria 1759
26 Ga0070713_100686766 3300005436 Bacteria 977
27 Ga0070713_101354096 3300005436 Bacteria 690
28 Ga0070713_101381388 3300005436 Bacteria 683
29 Ga0070710_10068999 3300005437 Bacteria 2033
30 Ga0070710_10089634 3300005437 Bacteria 1812
31 Ga0070710_10100415 3300005437 Bacteria 1722
32 Ga0070710_11323136 3300005437 Bacteria 536
33 Ga0070710_11422335 3300005437 Bacteria 519
34 Ga0070711_100009336 3300005439 Bacteria 6038
35 Ga0070711_100021952 3300005439 Bacteria 4132
36 Ga0070711_100305362 3300005439 Bacteria 1267
37 Ga0070711_100388568 3300005439 Bacteria 1130
38 Ga0070711_101092854 3300005439 Bacteria 687
39 Ga0070705_100916734 3300005440 Unclassified 706
40 Ga0070708_100029271 3300005445 Bacteria 4748
41 Ga0070708_100033585 3300005445 Bacteria 4457
42 Ga0070708_100171407 3300005445 Bacteria 2026
43 Ga0070708_100255852 3300005445 Bacteria 1645
44 Ga0070708_100262074 3300005445 Bacteria 1625
45 Ga0070708_100524113 3300005445 Bacteria 1118
46 Ga0070708_100662205 3300005445 Bacteria 983
47 Ga0070708_101533585 3300005445 Bacteria 621
48 Ga0068867_101924738 3300005459 Bacteria 558
49 Ga0070706_100079807 3300005467 Bacteria 3029
50 Ga0070706_100292478 3300005467 Bacteria 1520
51 Ga0070706_100359249 3300005467 Bacteria 1357
52 Ga0070706_100570928 3300005467 Bacteria 1052
53 Ga0070706_100849919 3300005467 Unclassified 844
54 Ga0070707_100000272 3300005468 Bacteria 51273
55 Ga0070707_100005954 3300005468 Bacteria 11376
56 Ga0070707_100043596 3300005468 Bacteria 4293
57 Ga0070707_100095547 3300005468 Bacteria 2878
58 Ga0070707_100096313 3300005468 Bacteria 2866
59 Ga0070707_100258919 3300005468 Bacteria 1693
60 Ga0070707_100711914 3300005468 Bacteria 967
61 Ga0070707_101404852 3300005468 Bacteria 665
62 Ga0070707_101828420 3300005468 Bacteria 575
63 Ga0070707_102273918 3300005468 Bacteria 509
64 Ga0070698_100048378 3300005471 Bacteria 4345
65 Ga0070698_100048956 3300005471 Bacteria 4317
66 Ga0070698_100103116 3300005471 Bacteria 2823
67 Ga0070698_101481793 3300005471 Unclassified 630
68 Ga0070699_100036817 3300005518 Bacteria 4233
69 Ga0070699_100110187 3300005518 Bacteria 2416
70 Ga0070699_100164368 3300005518 Bacteria 1965
71 Ga0070699_100343410 3300005518 Bacteria 1344
72 Ga0070699_100378989 3300005518 Bacteria 1277
73 Ga0070699_100580381 3300005518 Bacteria 1021
74 Ga0070699_100620155 3300005518 Unclassified 987
75 Ga0070699_100863279 3300005518 Bacteria 829
76 Ga0070699_100903030 3300005518 Bacteria 809
77 Ga0070699_101468978 3300005518 Bacteria 625
78 Ga0070699_101601184 3300005518 Unclassified 597
79 Ga0070697_100016359 3300005536 Bacteria 5832
80 Ga0070697_100098366 3300005536 Bacteria 2428
81 Ga0070697_100098743 3300005536 Bacteria 2423
82 Ga0070697_100124371 3300005536 Bacteria 2160
83 Ga0070697_100143092 3300005536 Bacteria 2012
84 Ga0070697_100145338 3300005536 Bacteria 1996
85 Ga0070697_100611857 3300005536 Bacteria 958
86 Ga0070697_100760484 3300005536 Bacteria 856
87 Ga0070697_101500052 3300005536 Bacteria 602
88 Ga0070697_101711113 3300005536 Bacteria 563
89 Ga0068853_100862390 3300005539 Bacteria 869
90 Ga0070686_100079701 3300005544 Bacteria 2165
91 Ga0070686_100190878 3300005544 Bacteria 1462
92 Ga0070695_100050684 3300005545 Bacteria 2662
93 Ga0070695_100077154 3300005545 Bacteria 2195
94 Ga0070696_100090703 3300005546 Bacteria 2175
95 Ga0070704_100230605 3300005549 Bacteria 1510
96 Ga0068855_101326213 3300005563 Bacteria 744
97 Ga0068856_101508057 3300005614 Bacteria 686
98 Ga0068859_100085487 3300005617 Bacteria 3200
99 Ga0068859_100908909 3300005617 Unclassified 965
100 Ga0068859_101209633 3300005617 Unclassified 832
101 Ga0068864_101059095 3300005618 Unclassified 806
102 Ga0068861_100436378 3300005719 Bacteria 1170
103 Ga0068863_100006891 3300005841 Bacteria 11135
104 Ga0068863_100356073 3300005841 Bacteria 1426
105 Ga0068858_100733297 3300005842 Bacteria 962
106 Ga0068860_100012866 3300005843 Bacteria 8224
107 Ga0068860_100022280 3300005843 Bacteria 6131
108 Ga0068860_100413553 3300005843 Bacteria 1336
109 Ga0068860_102543928 3300005843 Bacteria 531
110 Ga0068862_101647982 3300005844 Unclassified 649
111 Ga0070717_10290192 3300006028 Bacteria 1452
112 Ga0070717_10800130 3300006028 Bacteria 858
113 Ga0070717_10893568 3300006028 Bacteria 809
114 Ga0075432_10243147 3300006058 Bacteria 728
115 Ga0070715_10031039 3300006163 Bacteria 2166
116 Ga0070715_10126933 3300006163 Bacteria 1223
117 Ga0070715_10161014 3300006163 Bacteria 1109
118 Ga0070715_10515385 3300006163 Bacteria 687
119 Ga0070715_10527032 3300006163 Bacteria 681
120 Ga0070715_10560139 3300006163 Unclassified 664
121 Ga0070716_100023314 3300006173 Bacteria 3280
122 Ga0070716_100044936 3300006173 Bacteria 2477
123 Ga0070716_100056234 3300006173 Bacteria 2255
124 Ga0070716_100170233 3300006173 Bacteria 1421
125 Ga0070716_100297817 3300006173 Unclassified 1120
126 Ga0070716_100378590 3300006173 Bacteria 1011
127 Ga0070716_100562390 3300006173 Bacteria 852
128 Ga0070716_100908962 3300006173 Bacteria 690
129 Ga0070716_101192646 3300006173 Bacteria 611
130 Ga0070712_100036991 3300006175 Bacteria 3324
131 Ga0070712_100049811 3300006175 Bacteria 2910
132 Ga0070712_100259160 3300006175 Bacteria 1393
133 Ga0070712_100291274 3300006175 Bacteria 1318
134 Ga0070712_100382662 3300006175 Bacteria 1159
135 Ga0070712_101836551 3300006175 Bacteria 531
136 Ga0097621_100061799 3300006237 Bacteria 3073
137 Ga0097621_100417984 3300006237 Bacteria 1203
138 Ga0097621_100493670 3300006237 Unclassified 1108
139 Ga0097621_100793325 3300006237 Bacteria 877
140 Ga0097621_100913156 3300006237 Bacteria 818
141 Ga0068871_100000420 3300006358 Bacteria 29371
142 Ga0068871_100206890 3300006358 Bacteria 1696
143 Ga0068871_100704640 3300006358 Bacteria 925
144 Ga0075428_100500909 3300006844 Bacteria 1299
145 Ga0075434_100012780 3300006871 Bacteria 7969
146 Ga0075434_100136709 3300006871 Bacteria 2470
147 Ga0075434_100199449 3300006871 Bacteria 2021
148 Ga0075434_100756308 3300006871 Bacteria 989
149 Ga0075436_100022850 3300006914 Bacteria 4296
150 Ga0075436_100069860 3300006914 Bacteria 2427
151 Ga0075436_100109975 3300006914 Bacteria 1923
152 Ga0075436_100166283 3300006914 Bacteria 1556
153 Ga0075436_100442476 3300006914 Bacteria 946
154 Ga0075436_100635233 3300006914 Bacteria 788
155 Ga0097620_100085484 3300006931 Bacteria 3200
156 Ga0097620_100908957 3300006931 Unclassified 965
157 Ga0097620_101209527 3300006931 Unclassified 832
158 Ga0075435_100155092 3300007076 Bacteria 1927
159 Ga0075435_100441552 3300007076 Bacteria 1122
160 Ga0075435_100488884 3300007076 Bacteria 1063
161 Ga0075435_100880372 3300007076 Bacteria 781
162 Ga0099794_10003369 3300007265 Bacteria 6087
163 Ga0099794_10011981 3300007265 Bacteria 3728
164 Ga0099794_10051524 3300007265 Bacteria 1982
165 Ga0099794_10053799 3300007265 Bacteria 1942
166 Ga0099794_10069255 3300007265 Bacteria 1726
167 Ga0099794_10107866 3300007265 Bacteria 1393
168 Ga0099794_10363413 3300007265 Unclassified 754
169 Ga0099794_10366118 3300007265 Bacteria 751
170 Ga0099794_10645537 3300007265 Unclassified 562
171 Ga0099795_10010651 3300007788 Bacteria 2716
172 Ga0099795_10073653 3300007788 Bacteria 1293
173 Ga0099795_10136457 3300007788 Bacteria 994
174 Ga0099795_10322030 3300007788 Bacteria 685
175 Ga0105240_10061519 3300009093 Bacteria 4679
176 Ga0105240_10287386 3300009093 Bacteria 1887
177 Ga0105245_10127111 3300009098 Bacteria 2387
178 Ga0105245_10556875 3300009098 Bacteria 1169
179 Ga0105247_10253258 3300009101 Bacteria 1204
180 Ga0105247_10354715 3300009101 Bacteria 1032
181 Ga0105243_11945223 3300009148 Bacteria 622
182 Ga0105242_10133115 3300009176 Bacteria 2149
183 Ga0105242_10265593 3300009176 Bacteria 1552
184 Ga0105242_10783811 3300009176 Bacteria 942
185 Ga0105242_10868010 3300009176 Bacteria 899
186 Ga0105248_10008490 3300009177 Bacteria 11276
187 Ga0105248_10008673 3300009177 Bacteria 11171
188 Ga0105248_10688950 3300009177 Bacteria 1153
189 Ga0105248_11165374 3300009177 Bacteria 871
190 Ga0105237_10245972 3300009545 Bacteria 1790
191 Ga0105249_10286019 3300009553 Bacteria 1648
192 Ga0099796_10017824 3300010159 Bacteria 2121
193 Ga0099796_10018821 3300010159 Bacteria 2082
194 Ga0099796_10068692 3300010159 Bacteria 1274
195 Ga0099796_10237072 3300010159 Bacteria 753
196 Ga0105239_10066805 3300010375 Bacteria 3950
197 Ga0105239_10401880 3300010375 Bacteria 1550
198 Ga0157369_10871543 3300013105 Bacteria 924
199 Ga0157374_10022996 3300013296 Bacteria 5567
200 Ga0157374_10252944 3300013296 Bacteria 1734
201 Ga0157374_11529557 3300013296 Bacteria 691
202 Ga0157378_10003557 3300013297 Bacteria 13807
203 Ga0157378_10003574 3300013297 Bacteria 13763
204 Ga0157378_10005337 3300013297 Bacteria 11276
205 Ga0157378_10015014 3300013297 Bacteria 6781
206 Ga0157378_10867997 3300013297 Bacteria 932
207 Ga0157378_11009611 3300013297 Bacteria 866
208 Ga0163162_10024701 3300013306 Bacteria 5935
209 Ga0163162_10060074 3300013306 Bacteria 3835
210 Ga0163162_11856952 3300013306 Bacteria 689
211 Ga0163162_13272741 3300013306 Bacteria 519
212 Ga0157375_11495202 3300013308 Bacteria 797
213 Ga0157375_12644737 3300013308 Bacteria 600
214 Ga0163163_10522373 3300014325 Unclassified 1249
215 Ga0157379_10347010 3300014968 Bacteria 1358
216 Ga0157379_10573252 3300014968 Bacteria 1052
217 Ga0157376_10036066 3300014969 Bacteria 4003
218 Ga0184602_101813 3300019161 Bacteria 843
219 Ga0184602_109986 3300019161 Bacteria 1086
220 Ga0184602_118498 3300019161 Bacteria 754
221 Ga0184602_119558 3300019161 Bacteria 920
222 Ga0184598_106849 3300019182 Bacteria 2211
223 Ga0184601_115529 3300019183 Bacteria 887
224 Ga0184601_124842 3300019183 Bacteria 655
225 Ga0184599_129025 3300019188 Bacteria 2168
226 Ga0184599_129928 3300019188 Bacteria 1251
227 Ga0184599_141070 3300019188 Bacteria 1017
228 Ga0184599_148132 3300019188 Bacteria 573
229 Ga0184599_151674 3300019188 Unclassified 654
230 Ga0184600_102713 3300019190 Bacteria 670
231 Ga0184603_110579 3300019192 Bacteria 516
232 Ga0184603_130044 3300019192 Bacteria 702
233 Ga0184603_138242 3300019192 Bacteria 546
234 Ga0206349_1464016 3300020075 Bacteria 513
235 Ga0206349_1601330 3300020075 Bacteria 597
236 Ga0206350_10307447 3300020080 Bacteria 654
237 Ga0206350_10836049 3300020080 Bacteria 1187
238 Ga0224712_10183790 3300022467 Bacteria 943
239 Ga0224569_112299 3300022732 Bacteria 601
240 Ga0224571_111667 3300022734 Bacteria 614
241 Ga0224571_112399 3300022734 Bacteria 599
242 Ga0247552_100403 3300023536 Bacteria 1040
243 Ga0247555_100427 3300023539 Bacteria 1093
244 Ga0247555_101606 3300023539 Bacteria 709
245 Ga0247555_102332 3300023539 Bacteria 627
246 Ga0247555_103437 3300023539 Unclassified 559
247 Ga0247554_100011 3300023547 Bacteria 3232
248 Ga0247554_102301 3300023547 Bacteria 708
249 Ga0247553_100114 3300023672 Bacteria 2299
250 Ga0247553_100206 3300023672 Bacteria 1934
251 Ga0247553_100403 3300023672 Bacteria 1537
252 Ga0247553_107952 3300023672 Bacteria 583
253 Ga0247553_109608 3300023672 Bacteria 550
254 Ga0247553_110016 3300023672 Bacteria 542
255 Ga0247553_111476 3300023672 Bacteria 517
256 Ga0224572_1026861 3300024225 Bacteria 1103
257 Ga0228598_1000356 3300024227 Bacteria 9048
258 Ga0228598_1004718 3300024227 Bacteria 2879
259 Ga0207692_10113894 3300025898 Bacteria 1504
260 Ga0207692_10425993 3300025898 Bacteria 831
261 Ga0207692_10543421 3300025898 Bacteria 742
262 Ga0207642_10161045 3300025899 Bacteria 1205
263 Ga0207710_10208702 3300025900 Bacteria 966
264 Ga0207680_10161773 3300025903 Bacteria 1502
265 Ga0207680_10624282 3300025903 Unclassified 771
266 Ga0207685_10011326 3300025905 Bacteria 2677
267 Ga0207685_10125220 3300025905 Bacteria 1133
268 Ga0207685_10360775 3300025905 Bacteria 735
269 Ga0207699_10005224 3300025906 Bacteria 6212
270 Ga0207699_10013376 3300025906 Bacteria 4198
271 Ga0207699_10121982 3300025906 Bacteria 1687
272 Ga0207699_10247555 3300025906 Bacteria 1227
273 Ga0207699_10399284 3300025906 Bacteria 979
274 Ga0207699_10400405 3300025906 Bacteria 978
275 Ga0207699_10530583 3300025906 Bacteria 852
276 Ga0207699_10556647 3300025906 Bacteria 832
277 Ga0207699_10817563 3300025906 Bacteria 685
278 Ga0207684_10004887 3300025910 Bacteria 12513
279 Ga0207684_10064384 3300025910 Bacteria 3113
280 Ga0207684_10200367 3300025910 Bacteria 1722
281 Ga0207684_11579210 3300025910 Unclassified 532
282 Ga0207695_10118395 3300025913 Bacteria 2620
283 Ga0207695_10266607 3300025913 Bacteria 1609
284 Ga0207695_11180984 3300025913 Bacteria 645
285 Ga0207671_10303746 3300025914 Bacteria 1261
286 Ga0207671_11149905 3300025914 Unclassified 608
287 Ga0207693_10022429 3300025915 Bacteria 5017
288 Ga0207693_10046457 3300025915 Bacteria 3411
289 Ga0207693_10160035 3300025915 Bacteria 1771
290 Ga0207693_10249059 3300025915 Bacteria 1394
291 Ga0207693_10257234 3300025915 Bacteria 1369
292 Ga0207693_10312429 3300025915 Bacteria 1231
293 Ga0207693_10425287 3300025915 Bacteria 1038
294 Ga0207663_10059354 3300025916 Bacteria 2419
295 Ga0207663_10113843 3300025916 Bacteria 1840
296 Ga0207663_10233265 3300025916 Bacteria 1346
297 Ga0207663_10676196 3300025916 Bacteria 816
298 Ga0207663_10983396 3300025916 Bacteria 676
299 Ga0207663_11603858 3300025916 Bacteria 524
300 Ga0207662_10321534 3300025918 Bacteria 1033
301 Ga0207646_10000178 3300025922 Bacteria 86727
302 Ga0207646_10000294 3300025922 Bacteria 67765
303 Ga0207646_10000586 3300025922 Bacteria 47556
304 Ga0207646_10003595 3300025922 Bacteria 17377
305 Ga0207646_10025578 3300025922 Bacteria 5399
306 Ga0207646_10037311 3300025922 Bacteria 4382
307 Ga0207646_10048510 3300025922 Bacteria 3806
308 Ga0207646_10118018 3300025922 Bacteria 2383
309 Ga0207646_10325973 3300025922 Bacteria 1388
310 Ga0207646_10681563 3300025922 Bacteria 920
311 Ga0207646_11026022 3300025922 Bacteria 728
312 Ga0207687_10022876 3300025927 Bacteria 4162
313 Ga0207700_10019279 3300025928 Bacteria 4605
314 Ga0207700_10331731 3300025928 Bacteria 1321
315 Ga0207700_10487981 3300025928 Bacteria 1089
316 Ga0207700_11437584 3300025928 Bacteria 613
317 Ga0207664_10138556 3300025929 Bacteria 2055
318 Ga0207664_10847206 3300025929 Bacteria 822
319 Ga0207686_10164465 3300025934 Bacteria 1558
320 Ga0207704_10678063 3300025938 Bacteria 851
321 Ga0207665_10001621 3300025939 Bacteria 15162
322 Ga0207665_10014244 3300025939 Bacteria 5234
323 Ga0207665_10112692 3300025939 Bacteria 1913
324 Ga0207665_10113690 3300025939 Unclassified 1905
325 Ga0207665_10351358 3300025939 Bacteria 1113
326 Ga0207711_10022174 3300025941 Bacteria 5310
327 Ga0207711_10033842 3300025941 Bacteria 4326
328 Ga0207711_10950037 3300025941 Bacteria 798
329 Ga0207689_10378927 3300025942 Bacteria 1178
330 Ga0207689_10765190 3300025942 Bacteria 815
331 Ga0207712_10202114 3300025961 Bacteria 1576
332 Ga0207658_11360517 3300025986 Bacteria 649
333 Ga0207703_10236598 3300026035 Bacteria 1640
334 Ga0207639_10875698 3300026041 Bacteria 839
335 Ga0207641_10220634 3300026088 Bacteria 1758
336 Ga0207648_10199679 3300026089 Bacteria 1773
337 Ga0207676_11158195 3300026095 Unclassified 765
338 Ga0207675_100652270 3300026118 Bacteria 1059
339 Ga0209179_1032308 3300027512 Bacteria 1078
340 Ga0209179_1051000 3300027512 Bacteria 887
341 Ga0209588_1002814 3300027671 Bacteria 4765
342 Ga0209588_1002923 3300027671 Bacteria 4695
343 Ga0209588_1003849 3300027671 Bacteria 4190
344 Ga0209588_1020605 3300027671 Bacteria 2065
345 Ga0209588_1020889 3300027671 Bacteria 2051
346 Ga0209588_1026752 3300027671 Bacteria 1833
347 Ga0209588_1030581 3300027671 Bacteria 1721
348 Ga0209588_1033602 3300027671 Bacteria 1645
349 Ga0209588_1078247 3300027671 Bacteria 1068
350 Ga0209588_1081951 3300027671 Bacteria 1042
351 Ga0209588_1115245 3300027671 Bacteria 862
352 Ga0209588_1146915 3300027671 Bacteria 748
353 Ga0209588_1191683 3300027671 Bacteria 639
354 Ga0209588_1205382 3300027671 Bacteria 613
355 Ga0265358_100420 3300028010 Bacteria 1032
356 Ga0265357_1033625 3300028023 Archaea 591
357 Ga0268264_10034899 3300028381 Bacteria 4140
358 Ga0268264_10379713 3300028381 Bacteria 1353
359 Ga0268264_10484546 3300028381 Bacteria 1203
360 Ga0265337_1159370 3300028556 Bacteria 612
361 Ga0265319_1000770 3300028563 Bacteria 20820
362 Ga0265334_10118443 3300028573 Bacteria 948
363 Ga0265318_10000563 3300028577 Bacteria 26166
364 Ga0265338_10005291 3300028800 Bacteria 16896
365 Ga0265338_10197386 3300028800 Bacteria 1520
366 Ga0265762_1004977 3300030760 Bacteria 2380
367 Ga0265762_1017805 3300030760 Bacteria 1294
368 Ga0265762_1078758 3300030760 Bacteria 703
369 Ga0265775_100177 3300030762 Bacteria 2255
370 Ga0265775_109631 3300030762 Unclassified 599
371 Ga0265763_1008382 3300030763 Bacteria 922
372 Ga0265763_1044626 3300030763 Unclassified 543
373 Ga0265777_100311 3300030877 Bacteria 2107
374 Ga0265777_125538 3300030877 Bacteria 506
375 Ga0265770_1021038 3300030878 Unclassified 1034
376 Ga0265770_1095226 3300030878 Bacteria 599
377 Ga0265765_1012785 3300030879 Bacteria 955
378 Ga0265776_103756 3300030880 Bacteria 751
379 Ga0265776_108504 3300030880 Unclassified 584
380 Ga0265764_102006 3300030882 Bacteria 963
381 Ga0265764_114264 3300030882 Unclassified 537
382 Ga0265764_115678 3300030882 Unclassified 521
383 Ga0265761_100222 3300030889 Bacteria 2043
384 Ga0265773_1009701 3300031018 Bacteria 799
385 Ga0265779_104677 3300031043 Bacteria 735
386 Ga0265779_105704 3300031043 Bacteria 686
387 Ga0265760_10021891 3300031090 Bacteria 1850
388 Ga0265760_10038658 3300031090 Unclassified 1419
389 Ga0265760_10055534 3300031090 Bacteria 1197
390 Ga0265760_10143552 3300031090 Bacteria 779
391 Ga0265760_10297186 3300031090 Bacteria 571
392 Ga0265332_10058900 3300031238 Bacteria 1644
393 Ga0265332_10220435 3300031238 Bacteria 787
394 Ga0265328_10147904 3300031239 Bacteria 883
395 Ga0265320_10000328 3300031240 Bacteria 38910
396 Ga0265325_10002985 3300031241 Bacteria 11228
397 Ga0265325_10020600 3300031241 Bacteria 3634
398 Ga0265325_10115052 3300031241 Bacteria 1302
399 Ga0265329_10000518 3300031242 Bacteria 19897
400 Ga0265340_10009821 3300031247 Bacteria 5127
401 Ga0265340_10208132 3300031247 Bacteria 879
402 Ga0265339_10002459 3300031249 Bacteria 13260
403 Ga0265331_10000021 3300031250 Bacteria 242632
404 Ga0265331_10012455 3300031250 Bacteria 4607
405 Ga0265331_10042036 3300031250 Bacteria 2219
406 Ga0265316_10001865 3300031344 Bacteria 22179
407 Ga0265316_10020772 3300031344 Bacteria 5580
408 Ga0265316_10258193 3300031344 Bacteria 1278
409 Ga0265316_10726264 3300031344 Bacteria 699
410 Ga0265313_10000730 3300031595 Bacteria 33796
411 Ga0265313_10092339 3300031595 Bacteria 1356
412 Ga0265313_10138444 3300031595 Bacteria 1049
413 Ga0265314_10386125 3300031711 Bacteria 761
414 Ga0265342_10000032 3300031712 Bacteria 150633
415 Ga0265342_10165024 3300031712 Bacteria 1222
416 Ga0316577_10033544 3300031733 Bacteria 2868
417 Ga0316044_128059 3300031810 Bacteria 546
418 Ga0316045_127660 3300031815 Bacteria 505
419 Ga0316053_100043 3300032120 Bacteria 3768
420 Ga0316053_100152 3300032120 Bacteria 2490
421 Ga0316053_101188 3300032120 Bacteria 1341
422 Ga0316053_102566 3300032120 Bacteria 1037
423 Ga0316053_106946 3300032120 Bacteria 746
424 Ga0316053_112726 3300032120 Bacteria 605
425 Ga0316053_116456 3300032120 Unclassified 556
426 Ga0316593_10003452 3300032168 Bacteria 3922
427 Ga0316593_10046399 3300032168 Bacteria 1458
428 Ga0316593_10102791 3300032168 Bacteria 1015
429 Ga0316593_10220788 3300032168 Bacteria 704
430 Ga0316596_1013787 3300033541 Bacteria 1998
431 Ga0316596_1039663 3300033541 Bacteria 1235
432 Ga0316596_1139678 3300033541 Bacteria 663
433 Ga0316596_1163317 3300033541 Bacteria 614
434 Ga0316596_1232740 3300033541 Unclassified 517
435 Ga0316212_1019719 3300033547 Bacteria 947
436 Ga0373926_0003731 3300035083 Bacteria 4958
437 Ga0373926_0094768 3300035083 Bacteria 1112
438 Ga0373934_0001143 3300035086 Bacteria 9661
439 Ga0373934_0024497 3300035086 Bacteria 2333
440 Ga0373940_0285289 3300035088 Unclassified 565
441 Ga0373923_0062413 3300035111 Bacteria 1586
442 Ga0373923_0107938 3300035111 Bacteria 1233
443 Ga0373923_0197180 3300035111 Bacteria 930
444 Ga0373945_0138156 3300035116 Bacteria 981
445 Ga0373954_0000615 3300035118 Bacteria 13597
446 Ga0373954_0040865 3300035118 Bacteria 2161
447 Ga0373954_0234955 3300035118 Bacteria 902
448 Ga0373954_0280660 3300035118 Bacteria 821
449 Ga0373956_0021789 3300035119 Bacteria 2735
450 Ga0373956_0054593 3300035119 Bacteria 1800
451 Ga0373956_0268205 3300035119 Bacteria 812
452 Ga0373957_0030817 3300035120 Bacteria 1967
453 Ga0373957_0475247 3300035120 Unclassified 542
454 Ga0373943_0330565 3300035170 Unclassified 870
455 Ga0373943_0457118 3300035170 Bacteria 742
456 Ga0373943_0866920 3300035170 Bacteria 539
457 Ga0373946_0075004 3300035171 Bacteria 1469
458 Ga0373946_0283958 3300035171 Bacteria 815
459 Ga0373955_0030550 3300035172 Bacteria 2813
460 Ga0373955_0088708 3300035172 Bacteria 1759
461 Ga0373955_0092799 3300035172 Bacteria 1723
462 Ga0373955_0093827 3300035172 Bacteria 1714
463 Ga0373955_0636128 3300035172 Bacteria 654
464 Ga0373924_0067858 3300035410 Bacteria 1501
465 Ga0373924_0352915 3300035410 Bacteria 656
466 Ga0373924_0389574 3300035410 Bacteria 622
467 Ga0373931_0315729 3300035691 Bacteria 969
468 Ga0373935_0041693 3300035692 Bacteria 2884
469 Ga0373935_0738414 3300035692 Bacteria 725
470 Ga0373927_0001112 3300035695 Bacteria 20423
471 Ga0373927_0015777 3300035695 Bacteria 4984
472 Ga0373927_0024735 3300035695 Bacteria 3924
473 Ga0373933_0000875 3300035724 Bacteria 18404
474 Ga0373933_0002114 3300035724 Bacteria 11407
475 Ga0373933_0031390 3300035724 Bacteria 3082
476 Ga0373933_0115860 3300035724 Bacteria 1675
477 Ga0373947_0005049 3300035725 Bacteria 7729
478 Ga0373947_0014667 3300035725 Bacteria 4495
479 Ga0373947_0047927 3300035725 Unclassified 2562
480 Ga0373937_0000111 3300036401 Bacteria 77509
481 Ga0373937_0036370 3300036401 Bacteria 4486
482 Ga0373937_0037074 3300036401 Bacteria 4443
483 Ga0373937_0049212 3300036401 Bacteria 3860
484 Ga0373937_0251160 3300036401 Bacteria 1667
485 Ga0373937_0683963 3300036401 Bacteria 972
486 Ga0373937_0866235 3300036401 Bacteria 852
487 Ga0265778_001414 3300036457 Bacteria 2185
488 Ga0265778_001498 3300036457 Bacteria 2140
489 Ga0265778_002443 3300036457 Bacteria 1792
490 Ga0265778_011612 3300036457 Bacteria 1017
491 Ga0265778_017951 3300036457 Bacteria 857
492 Ga0265778_037308 3300036457 Bacteria 642
493 Ga0265778_043206 3300036457 Unclassified 604
494 Ga0265778_043795 3300036457 Bacteria 601
495 Ga0265778_056321 3300036457 Bacteria 545
496 Ga0373925_0000969 3300037068 Bacteria 26091
497 Ga0373925_0010535 3300037068 Bacteria 6706
498 Ga0373925_0202420 3300037068 Bacteria 1579
499 Ga0373925_0358024 3300037068 Bacteria 1186
500 Ga0373925_0811552 3300037068 Bacteria 771
501 Ga0373925_0957582 3300037068 Bacteria 705
502 Ga0395898_1609637 3300037466 Bacteria 574
503 Ga0436360_0908177 3300039438 Bacteria 630
504 Ga0451837_0411823 3300041494 Bacteria 745
505 Ga0451577_0035010 3300042876 Bacteria 4524
506 Ga0451577_0126378 3300042876 Bacteria 2291
507 Ga0451577_0128279 3300042876 Bacteria 2274
508 Ga0451577_1020154 3300042876 Bacteria 742
509 Ga0453683_0016428 3300044673 Bacteria 4774
510 Ga0453683_0023533 3300044673 Bacteria 3925
511 Ga0453683_0031301 3300044673 Bacteria 3361
512 Ga0453683_0034792 3300044673 Bacteria 3175
513 Ga0453683_0079728 3300044673 Bacteria 2051
514 Ga0453684_0019676 3300044712 Bacteria 10253
515 Ga0453684_0036842 3300044712 Bacteria 6731
516 Ga0453684_0185611 3300044712 Bacteria 2437
517 Ga0453684_0219978 3300044712 Bacteria 2200
518 Ga0453684_0258296 3300044712 Bacteria 1997
519 Ga0453684_0417182 3300044712 Bacteria 1500
520 Ga0451576_0286383 3300045051 Bacteria 1722
521 Ga0451576_0345957 3300045051 Bacteria 1557
522 Ga0451576_0630874 3300045051 Bacteria 1126
523 Ga0451576_0793267 3300045051 Bacteria 995
524 Ga0495592_0065622 3300046454 Bacteria 2657
525 Ga0495592_0069907 3300046454 Bacteria 2559
526 Ga0495592_0149700 3300046454 Bacteria 1615
527 Ga0495592_0618495 3300046454 Bacteria 659
528 Ga0495592_0906875 3300046454 Bacteria 518
529 Ga0495603_0079373 3300046455 Bacteria 1924
530 Ga0495603_0761200 3300046455 Unclassified 553
531 Ga0495629_0160387 3300046459 Bacteria 1562
532 Ga0495629_0460859 3300046459 Unclassified 860
533 Ga0495641_0038397 3300046461 Bacteria 2237
534 Ga0495641_0097217 3300046461 Bacteria 1314
535 Ga0495651_0001249 3300046462 Bacteria 19696
536 Ga0495651_0006995 3300046462 Bacteria 8629
537 Ga0495651_0020364 3300046462 Bacteria 5149
538 Ga0495651_0051316 3300046462 Bacteria 3180
539 Ga0495653_0003367 3300046463 Bacteria 12851
540 Ga0495653_0100464 3300046463 Bacteria 2097
541 Ga0495653_0424494 3300046463 Bacteria 841
542 Ga0495653_0646628 3300046463 Bacteria 646
543 Ga0495580_0021880 3300046472 Bacteria 4714
544 Ga0495580_0030085 3300046472 Bacteria 3935
545 Ga0495580_0104727 3300046472 Bacteria 1966
546 Ga0495580_0133139 3300046472 Bacteria 1724
547 Ga0495580_0293451 3300046472 Bacteria 1108
548 Ga0495580_0477452 3300046472 Bacteria 834
549 Ga0495580_0623003 3300046472 Bacteria 711
550 Ga0495580_0694607 3300046472 Bacteria 666
551 Ga0495582_0000417 3300046473 Bacteria 23244
552 Ga0495582_0013912 3300046473 Bacteria 4432
553 Ga0495582_0292645 3300046473 Bacteria 936
554 Ga0495582_0383786 3300046473 Bacteria 810
555 Ga0495582_0883491 3300046473 Bacteria 517
556 Ga0495639_0016004 3300046475 Bacteria 3253
557 Ga0495662_0072313 3300046476 Bacteria 1672
558 Ga0495664_0032941 3300046477 Bacteria 3044
559 Ga0495664_0482244 3300046477 Bacteria 741
560 Ga0495594_0001371 3300046499 Bacteria 12630
561 Ga0495594_0703614 3300046499 Bacteria 571
562 Ga0495608_0008749 3300046511 Bacteria 7082
563 Ga0495608_0017709 3300046511 Bacteria 4926
564 Ga0495608_0031575 3300046511 Bacteria 3581
565 Ga0495608_0049901 3300046511 Bacteria 2777
566 Ga0495608_0051140 3300046511 Bacteria 2739
567 Ga0495608_0358756 3300046511 Bacteria 896
568 Ga0495608_0627775 3300046511 Bacteria 643
569 Ga0495618_0136625 3300046514 Bacteria 1568
570 Ga0495618_0202541 3300046514 Bacteria 1256
571 Ga0495618_0370103 3300046514 Bacteria 880
572 Ga0495618_0909951 3300046514 Bacteria 507
573 Ga0495628_0000743 3300046516 Bacteria 30199
574 Ga0495628_0028733 3300046516 Bacteria 4516
575 Ga0495628_0260338 3300046516 Bacteria 1293
576 Ga0495628_0575975 3300046516 Bacteria 806
577 Ga0495630_0069333 3300046517 Bacteria 2652
578 Ga0495630_0069732 3300046517 Bacteria 2645
579 Ga0495630_0072095 3300046517 Bacteria 2600
580 Ga0495630_0087456 3300046517 Bacteria 2353
581 Ga0495630_0135687 3300046517 Bacteria 1870
582 Ga0495630_0257456 3300046517 Bacteria 1333
583 Ga0495630_0388104 3300046517 Bacteria 1069
584 Ga0495630_1109925 3300046517 Unclassified 599
585 Ga0495666_0052146 3300046526 Bacteria 1964
586 Ga0495666_0058665 3300046526 Unclassified 1841
587 Ga0495666_0146250 3300046526 Bacteria 1100
588 Ga0495652_0001695 3300046529 Bacteria 23794
589 Ga0495652_0017164 3300046529 Bacteria 6463
590 Ga0495652_0067961 3300046529 Bacteria 2986
591 Ga0495652_0241383 3300046529 Bacteria 1344
592 Ga0495665_0046239 3300046531 Bacteria 2311
593 Ga0495665_0069599 3300046531 Bacteria 1855
594 Ga0495665_0086535 3300046531 Bacteria 1647
595 Ga0495640_0020695 3300046533 Bacteria 4839
596 Ga0495640_0057124 3300046533 Bacteria 2664
597 Ga0495640_0124597 3300046533 Bacteria 1672
598 Ga0495640_0446378 3300046533 Bacteria 790
599 Ga0495640_0500219 3300046533 Bacteria 740
600 Ga0495586_0015627 3300046535 Bacteria 4039
601 Ga0495586_0063101 3300046535 Bacteria 2018
602 Ga0495586_0068860 3300046535 Bacteria 1931
603 Ga0495586_0442046 3300046535 Bacteria 749
604 Ga0495587_0001724 3300046536 Bacteria 14594
605 Ga0495587_0021839 3300046536 Bacteria 3948
606 Ga0495587_0049045 3300046536 Bacteria 2500
607 Ga0495587_0140117 3300046536 Bacteria 1381
608 Ga0495587_0184413 3300046536 Bacteria 1182
609 Ga0495645_0288528 3300046543 Bacteria 1076
610 Ga0495622_0192654 3300046557 Bacteria 911
611 Ga0495622_0353676 3300046557 Unclassified 636
612 Ga0495667_0026375 3300046559 Bacteria 3916
613 Ga0495667_0102488 3300046559 Bacteria 1851
614 Ga0495667_0143519 3300046559 Bacteria 1538
615 Ga0495667_0163686 3300046559 Bacteria 1430
616 Ga0495667_0212788 3300046559 Bacteria 1235
617 Ga0495667_0284840 3300046559 Bacteria 1049
618 Ga0495634_0036717 3300046642 Bacteria 3350
619 Ga0495634_0098085 3300046642 Bacteria 1896
620 Ga0495634_0169655 3300046642 Bacteria 1372
621 Ga0495635_0070732 3300046663 Bacteria 2392
622 Ga0495635_0310834 3300046663 Bacteria 1056
623 Ga0495635_0405154 3300046663 Bacteria 905
624 Ga0495657_0024181 3300046675 Bacteria 4331
625 Ga0495657_0038646 3300046675 Bacteria 3283
626 Ga0495657_0062883 3300046675 Bacteria 2450
627 Ga0495657_0245623 3300046675 Bacteria 1079
628 Ga0495657_0307158 3300046675 Bacteria 945
629 Ga0495657_0599797 3300046675 Bacteria 637
630 Ga0495599_0019261 3300046678 Bacteria 4255
631 Ga0495599_0462680 3300046678 Bacteria 750
632 Ga0495599_0563597 3300046678 Bacteria 666
633 Ga0495623_0014756 3300046679 Bacteria 5050
634 Ga0495623_0047674 3300046679 Bacteria 2720
635 Ga0495623_0049796 3300046679 Bacteria 2655
636 Ga0495623_0206376 3300046679 Bacteria 1127
637 Ga0495623_0563979 3300046679 Bacteria 595
638 Ga0495646_0023695 3300046680 Bacteria 3863
639 Ga0495646_0065301 3300046680 Bacteria 2155
640 Ga0495647_0030102 3300046681 Bacteria 2012
641 Ga0495658_0003500 3300046683 Bacteria 7768
642 Ga0495658_0825659 3300046683 Bacteria 593
643 Ga0495613_0036328 3300046689 Bacteria 3653
644 Ga0495613_0086104 3300046689 Bacteria 2279
645 Ga0495613_0098120 3300046689 Bacteria 2117
646 Ga0495613_0156725 3300046689 Bacteria 1622
647 Ga0495613_0320264 3300046689 Bacteria 1070
648 Ga0495613_0402210 3300046689 Bacteria 934
649 Ga0495613_0489902 3300046689 Bacteria 829
650 Ga0495624_0007287 3300046690 Bacteria 7769
651 Ga0495624_0114062 3300046690 Bacteria 1661
652 Ga0495600_0051251 3300046809 Bacteria 2694
653 Ga0495600_0075930 3300046809 Bacteria 2194
654 Ga0495600_0374723 3300046809 Bacteria 889
655 Ga0495600_0391389 3300046809 Unclassified 866
656 Ga0495600_0400261 3300046809 Bacteria 854
657 Ga0495604_0001483 3300047317 Bacteria 19340
658 Ga0495604_0011284 3300047317 Bacteria 7094
659 Ga0495604_0013619 3300047317 Bacteria 6486
660 Ga0495604_0021270 3300047317 Bacteria 5179
661 Ga0495604_0194816 3300047317 Bacteria 1410
662 Ga0495604_0294820 3300047317 Bacteria 1091
663 Ga0495604_0338990 3300047317 Bacteria 1001
664 Ga0495604_0558655 3300047317 Bacteria 737
665 Ga0495636_0194539 3300047318 Bacteria 924
666 Ga0495674_0006253 3300047319 Bacteria 11427
667 Ga0495674_0020173 3300047319 Bacteria 6174
668 Ga0495674_0052258 3300047319 Bacteria 3597
669 Ga0495674_0146301 3300047319 Bacteria 1983
670 Ga0495674_0227728 3300047319 Bacteria 1539
671 Ga0495674_0287272 3300047319 Bacteria 1346
672 Ga0495676_0013622 3300047321 Bacteria 7300
673 Ga0495676_0404491 3300047321 Bacteria 905
674 Ga0495676_0981365 3300047321 Bacteria 539
675 Ga0495680_0007841 3300047322 Bacteria 9747
676 Ga0495680_0011639 3300047322 Bacteria 7774
677 Ga0495680_0128200 3300047322 Bacteria 1867
678 Ga0495680_0205056 3300047322 Bacteria 1413
679 Ga0495680_0497386 3300047322 Bacteria 828
680 Ga0495675_0000077 3300047444 Bacteria 68982
681 Ga0495675_0001536 3300047444 Bacteria 13921
682 Ga0495675_0043555 3300047444 Bacteria 2860
683 Ga0495675_0185265 3300047444 Bacteria 1273
684 Ga0495675_0605955 3300047444 Bacteria 620
685 Ga0495684_0016559 3300047471 Bacteria 5679
686 Ga0495684_0064436 3300047471 Bacteria 2785
687 Ga0495684_0065814 3300047471 Bacteria 2755
688 Ga0495684_0076825 3300047471 Bacteria 2536
689 Ga0495684_0249388 3300047471 Bacteria 1292
690 Ga0495684_0425234 3300047471 Bacteria 928
691 Ga0495593_0019576 3300047673 Bacteria 3794
692 Ga0495593_0094834 3300047673 Bacteria 1535
693 Ga0495602_0000729 3300048088 Bacteria 31028
694 Ga0495602_0006628 3300048088 Bacteria 12141
695 Ga0495602_0217282 3300048088 Bacteria 1445
696 Ga0495602_0281748 3300048088 Bacteria 1224
697 Ga0495602_0767101 3300048088 Bacteria 650
698 Ga0495614_0036269 3300048089 Bacteria 2117
699 Ga0495614_0080431 3300048089 Bacteria 1411
700 Ga0496101_0440566 3300048904 Bacteria 1028
701 Ga0496102_0006239 3300048905 Bacteria 10163
702 Ga0496103_0115509 3300048906 Bacteria 1707
703 Ga0496103_0611214 3300048906 Unclassified 694
704 Ga0496105_0111730 3300048908 Bacteria 2255
705 Ga0496106_0026233 3300048909 Bacteria 4337
706 Ga0496106_0489173 3300048909 Bacteria 988
707 Ga0496106_0602613 3300048909 Bacteria 880
708 Ga0496107_0050472 3300048910 Bacteria 2999
709 Ga0496111_0558723 3300048914 Bacteria 840
710 Ga0496112_0250641 3300048915 Bacteria 1722
711 Ga0496112_0373504 3300048915 Bacteria 1367
712 Ga0496114_0021884 3300048917 Bacteria 5205
713 Ga0496115_0009629 3300048918 Bacteria 7189
714 Ga0496115_0017610 3300048918 Bacteria 5468
715 Ga0501047_1231471 3300049581 Bacteria 562
716 nmdc:mga0n895_234528_c1 3300050512 Unclassified 1862
717 nmdc:mga0n895_4741_c1 3300050512 Bacteria 11234
718 nmdc:mga0n895_6090_c1 3300050512 Bacteria 10181
719 nmdc:mga0rr50_134785_c1 3300050513 Bacteria 1981
720 nmdc:mga0rr50_166597_c1 3300050513 Bacteria 1792
721 nmdc:mga0rr50_1795761_c1 3300050513 Bacteria 516
722 nmdc:mga0rr50_592762_c1 3300050513 Bacteria 945
723 nmdc:mga0rr50_999505_c1 3300050513 Bacteria 713
724 nmdc:mga08x19_1104_c1 3300050514 Bacteria 16817
725 nmdc:mga08x19_115119_c1 3300050514 Bacteria 1797
726 nmdc:mga08x19_230586_c1 3300050514 Bacteria 1274
727 nmdc:mga08x19_55722_c1 3300050514 Bacteria 2549
728 nmdc:mga0a205_54282_c1 3300050515 Bacteria 3868
729 Ga0495601_0108137 3300053077 Bacteria 1799
730 Ga0495601_0265936 3300053077 Bacteria 1119
731 Ga0495601_0407327 3300053077 Bacteria 881
732 Ga0495612_0020586 3300053078 Bacteria 2644
733 Ga0495612_0201760 3300053078 Bacteria 878
734 Ga0495612_0268742 3300053078 Bacteria 761
735 Ga0495595_0431380 3300053084 Bacteria 669
736 Ga0495595_0447956 3300053084 Bacteria 656
737 Ga0495619_0084845 3300053085 Bacteria 2138
738 Ga0495619_1200804 3300053085 Bacteria 502
739 Ga0587101_119047 3300059623 Bacteria 544
740 nmdc:mga0rr50_767677_c1
741 Ga0065704_10276480
742 Ga0065715_10191425
743 Ga0068869_100330158
744 Ga0070680_101454346
745 Ga0070682_100992407
746 Ga0070660_101237603
747 Ga0070689_101688833
748 Ga0070691_10971178
749 Ga0070687_100129656
750 Ga0070674_101154010
751 Ga0070659_101361458
752 Ga0070667_101082405
753 Ga0070709_10017405
754 Ga0070709_10028219
755 Ga0070709_10096355
756 Ga0070709_10125464
757 Ga0070709_10446839
758 Ga0070709_10938083
759 Ga0070709_10947837
760 Ga0070714_100686245
761 Ga0070714_102514069
762 Ga0070713_100015424
763 Ga0070713_100200350
764 Ga0070713_100210628
765 Ga0070713_100686766
766 Ga0070713_101354096
767 Ga0070713_101381388
768 Ga0070710_10068999
769 Ga0070710_10089634
770 Ga0070710_10100415
771 Ga0070710_11323136
772 Ga0070710_11422335
773 Ga0070711_100009336
774 Ga0070711_100021952
775 Ga0070711_100305362
776 Ga0070711_100388568
777 Ga0070711_101092854
778 Ga0070705_100916734
779 Ga0070708_100029271
780 Ga0070708_100033585
781 Ga0070708_100171407
782 Ga0070708_100255852
783 Ga0070708_100262074
784 Ga0070708_100524113
785 Ga0070708_100662205
786 Ga0070708_101533585
787 Ga0068867_101924738
788 Ga0070706_100079807
789 Ga0070706_100292478
790 Ga0070706_100359249
791 Ga0070706_100570928
792 Ga0070706_100849919
793 Ga0070707_100000272
794 Ga0070707_100005954
795 Ga0070707_100043596
796 Ga0070707_100095547
797 Ga0070707_100096313
798 Ga0070707_100258919
799 Ga0070707_100711914
800 Ga0070707_101404852
801 Ga0070707_101828420
802 Ga0070707_102273918
803 Ga0070698_100048378
804 Ga0070698_100048956
805 Ga0070698_100103116
806 Ga0070698_101481793
807 Ga0070699_100036817
808 Ga0070699_100110187
809 Ga0070699_100164368
810 Ga0070699_100343410
811 Ga0070699_100378989
812 Ga0070699_100580381
813 Ga0070699_100620155
814 Ga0070699_100863279
815 Ga0070699_100903030
816 Ga0070699_101468978
817 Ga0070699_101601184
818 Ga0070697_100016359
819 Ga0070697_100098366
820 Ga0070697_100098743
821 Ga0070697_100124371
822 Ga0070697_100143092
823 Ga0070697_100145338
824 Ga0070697_100611857
825 Ga0070697_100760484
826 Ga0070697_101500052
827 Ga0070697_101711113
828 Ga0068853_100862390
829 Ga0070686_100079701
830 Ga0070686_100190878
831 Ga0070695_100050684
832 Ga0070695_100077154
833 Ga0070696_100090703
834 Ga0070704_100230605
835 Ga0068855_101326213
836 Ga0068856_101508057
837 Ga0068859_100085487
838 Ga0068859_100908909
839 Ga0068859_101209633
840 Ga0068864_101059095
841 Ga0068861_100436378
842 Ga0068863_100006891
843 Ga0068863_100356073
844 Ga0068858_100733297
845 Ga0068860_100012866
846 Ga0068860_100022280
847 Ga0068860_100413553
848 Ga0068860_102543928
849 Ga0068862_101647982
850 Ga0070717_10290192
851 Ga0070717_10800130
852 Ga0070717_10893568
853 Ga0075432_10243147
854 Ga0070715_10031039
855 Ga0070715_10126933
856 Ga0070715_10161014
857 Ga0070715_10515385
858 Ga0070715_10527032
859 Ga0070715_10560139
860 Ga0070716_100023314
861 Ga0070716_100044936
862 Ga0070716_100056234
863 Ga0070716_100170233
864 Ga0070716_100297817
865 Ga0070716_100378590
866 Ga0070716_100562390
867 Ga0070716_100908962
868 Ga0070716_101192646
869 Ga0070712_100036991
870 Ga0070712_100049811
871 Ga0070712_100259160
872 Ga0070712_100291274
873 Ga0070712_100382662
874 Ga0070712_101836551
875 Ga0097621_100061799
876 Ga0097621_100417984
877 Ga0097621_100493670
878 Ga0097621_100793325
879 Ga0097621_100913156
880 Ga0068871_100000420
881 Ga0068871_100206890
882 Ga0068871_100704640
883 Ga0075428_100500909
884 Ga0075434_100012780
885 Ga0075434_100136709
886 Ga0075434_100199449
887 Ga0075434_100756308
888 Ga0075436_100022850
889 Ga0075436_100069860
890 Ga0075436_100109975
891 Ga0075436_100166283
892 Ga0075436_100442476
893 Ga0075436_100635233
894 Ga0097620_100085484
895 Ga0097620_100908957
896 Ga0097620_101209527
897 Ga0075435_100155092
898 Ga0075435_100441552
899 Ga0075435_100488884
900 Ga0075435_100880372
901 Ga0099794_10003369
902 Ga0099794_10011981
903 Ga0099794_10051524
904 Ga0099794_10053799
905 Ga0099794_10069255
906 Ga0099794_10107866
907 Ga0099794_10363413
908 Ga0099794_10366118
909 Ga0099794_10645537
910 Ga0099795_10010651
911 Ga0099795_10073653
912 Ga0099795_10136457
913 Ga0099795_10322030
914 Ga0105240_10061519
915 Ga0105240_10287386
916 Ga0105245_10127111
917 Ga0105245_10556875
918 Ga0105247_10253258
919 Ga0105247_10354715
920 Ga0105243_11945223
921 Ga0105242_10133115
922 Ga0105242_10265593
923 Ga0105242_10783811
924 Ga0105242_10868010
925 Ga0105248_10008490
926 Ga0105248_10008673
927 Ga0105248_10688950
928 Ga0105248_11165374
929 Ga0105237_10245972
930 Ga0105249_10286019
931 Ga0099796_10017824
932 Ga0099796_10018821
933 Ga0099796_10068692
934 Ga0099796_10237072
935 Ga0105239_10066805
936 Ga0105239_10401880
937 Ga0157369_10871543
938 Ga0157374_10022996
939 Ga0157374_10252944
940 Ga0157374_11529557
941 Ga0157378_10003557
942 Ga0157378_10003574
943 Ga0157378_10005337
944 Ga0157378_10015014
945 Ga0157378_10867997
946 Ga0157378_11009611
947 Ga0163162_10024701
948 Ga0163162_10060074
949 Ga0163162_11856952
950 Ga0163162_13272741
951 Ga0157375_11495202
952 Ga0157375_12644737
953 Ga0163163_10522373
954 Ga0157379_10347010
955 Ga0157379_10573252
956 Ga0157376_10036066
957 Ga0184602_101813
958 Ga0184602_109986
959 Ga0184602_118498
960 Ga0184602_119558
961 Ga0184598_106849
962 Ga0184601_115529
963 Ga0184601_124842
964 Ga0184599_129025
965 Ga0184599_129928
966 Ga0184599_141070
967 Ga0184599_148132
968 Ga0184599_151674
969 Ga0184600_102713
970 Ga0184603_110579
971 Ga0184603_130044
972 Ga0184603_138242
973 Ga0206349_1464016
974 Ga0206349_1601330
975 Ga0206350_10307447
976 Ga0206350_10836049
977 Ga0224712_10183790
978 Ga0224569_112299
979 Ga0224571_111667
980 Ga0224571_112399
981 Ga0247552_100403
982 Ga0247555_100427
983 Ga0247555_101606
984 Ga0247555_102332
985 Ga0247555_103437
986 Ga0247554_100011
987 Ga0247554_102301
988 Ga0247553_100114
989 Ga0247553_100206
990 Ga0247553_100403
991 Ga0247553_107952
992 Ga0247553_109608
993 Ga0247553_110016
994 Ga0247553_111476
995 Ga0224572_1026861
996 Ga0228598_1000356
997 Ga0228598_1004718
998 Ga0207692_10113894
999 Ga0207692_10425993
1000 Ga0207692_10543421
1001 Ga0207642_10161045
1002 Ga0207710_10208702
1003 Ga0207680_10161773
1004 Ga0207680_10624282
1005 Ga0207685_10011326
1006 Ga0207685_10125220
1007 Ga0207685_10360775
1008 Ga0207699_10005224
1009 Ga0207699_10013376
1010 Ga0207699_10121982
1011 Ga0207699_10247555
1012 Ga0207699_10399284
1013 Ga0207699_10400405
1014 Ga0207699_10530583
1015 Ga0207699_10556647
1016 Ga0207699_10817563
1017 Ga0207684_10004887
1018 Ga0207684_10064384
1019 Ga0207684_10200367
1020 Ga0207684_11579210
1021 Ga0207695_10118395
1022 Ga0207695_10266607
1023 Ga0207695_11180984
1024 Ga0207671_10303746
1025 Ga0207671_11149905
1026 Ga0207693_10022429
1027 Ga0207693_10046457
1028 Ga0207693_10160035
1029 Ga0207693_10249059
1030 Ga0207693_10257234
1031 Ga0207693_10312429
1032 Ga0207693_10425287
1033 Ga0207663_10059354
1034 Ga0207663_10113843
1035 Ga0207663_10233265
1036 Ga0207663_10676196
1037 Ga0207663_10983396
1038 Ga0207663_11603858
1039 Ga0207662_10321534
1040 Ga0207646_10000178
1041 Ga0207646_10000294
1042 Ga0207646_10000586
1043 Ga0207646_10003595
1044 Ga0207646_10025578
1045 Ga0207646_10037311
1046 Ga0207646_10048510
1047 Ga0207646_10118018
1048 Ga0207646_10325973
1049 Ga0207646_10681563
1050 Ga0207646_11026022
1051 Ga0207687_10022876
1052 Ga0207700_10019279
1053 Ga0207700_10331731
1054 Ga0207700_10487981
1055 Ga0207700_11437584
1056 Ga0207664_10138556
1057 Ga0207664_10847206
1058 Ga0207686_10164465
1059 Ga0207704_10678063
1060 Ga0207665_10001621
1061 Ga0207665_10014244
1062 Ga0207665_10112692
1063 Ga0207665_10113690
1064 Ga0207665_10351358
1065 Ga0207711_10022174
1066 Ga0207711_10033842
1067 Ga0207711_10950037
1068 Ga0207689_10378927
1069 Ga0207689_10765190
1070 Ga0207712_10202114
1071 Ga0207658_11360517
1072 Ga0207703_10236598
1073 Ga0207639_10875698
1074 Ga0207641_10220634
1075 Ga0207648_10199679
1076 Ga0207676_11158195
1077 Ga0207675_100652270
1078 Ga0209179_1032308
1079 Ga0209179_1051000
1080 Ga0209588_1002814
1081 Ga0209588_1002923
1082 Ga0209588_1003849
1083 Ga0209588_1020605
1084 Ga0209588_1020889
1085 Ga0209588_1026752
1086 Ga0209588_1030581
1087 Ga0209588_1033602
1088 Ga0209588_1078247
1089 Ga0209588_1081951
1090 Ga0209588_1115245
1091 Ga0209588_1146915
1092 Ga0209588_1191683
1093 Ga0209588_1205382
1094 Ga0265358_100420
1095 Ga0265357_1033625
1096 Ga0268264_10034899
1097 Ga0268264_10379713
1098 Ga0268264_10484546
1099 Ga0265337_1159370
1100 Ga0265319_1000770
1101 Ga0265334_10118443
1102 Ga0265318_10000563
1103 Ga0265338_10005291
1104 Ga0265338_10197386
1105 Ga0265762_1004977
1106 Ga0265762_1017805
1107 Ga0265762_1078758
1108 Ga0265775_100177
1109 Ga0265775_109631
1110 Ga0265763_1008382
1111 Ga0265763_1044626
1112 Ga0265777_100311
1113 Ga0265777_125538
1114 Ga0265770_1021038
1115 Ga0265770_1095226
1116 Ga0265765_1012785
1117 Ga0265776_103756
1118 Ga0265776_108504
1119 Ga0265764_102006
1120 Ga0265764_114264
1121 Ga0265764_115678
1122 Ga0265761_100222
1123 Ga0265773_1009701
1124 Ga0265779_104677
1125 Ga0265779_105704
1126 Ga0265760_10021891
1127 Ga0265760_10038658
1128 Ga0265760_10055534
1129 Ga0265760_10143552
1130 Ga0265760_10297186
1131 Ga0265332_10058900
1132 Ga0265332_10220435
1133 Ga0265328_10147904
1134 Ga0265320_10000328
1135 Ga0265325_10002985
1136 Ga0265325_10020600
1137 Ga0265325_10115052
1138 Ga0265329_10000518
1139 Ga0265340_10009821
1140 Ga0265340_10208132
1141 Ga0265339_10002459
1142 Ga0265331_10000021
1143 Ga0265331_10012455
1144 Ga0265331_10042036
1145 Ga0265316_10001865
1146 Ga0265316_10020772
1147 Ga0265316_10258193
1148 Ga0265316_10726264
1149 Ga0265313_10000730
1150 Ga0265313_10092339
1151 Ga0265313_10138444
1152 Ga0265314_10386125
1153 Ga0265342_10000032
1154 Ga0265342_10165024
1155 Ga0316577_10033544
1156 Ga0316044_128059
1157 Ga0316045_127660
1158 Ga0316053_100043
1159 Ga0316053_100152
1160 Ga0316053_101188
1161 Ga0316053_102566
1162 Ga0316053_106946
1163 Ga0316053_112726
1164 Ga0316053_116456
1165 Ga0316593_10003452
1166 Ga0316593_10046399
1167 Ga0316593_10102791
1168 Ga0316593_10220788
1169 Ga0316596_1013787
1170 Ga0316596_1039663
1171 Ga0316596_1139678
1172 Ga0316596_1163317
1173 Ga0316596_1232740
1174 Ga0316212_1019719
1175 Ga0373926_0003731
1176 Ga0373926_0094768
1177 Ga0373934_0001143
1178 Ga0373934_0024497
1179 Ga0373940_0285289
1180 Ga0373923_0062413
1181 Ga0373923_0107938
1182 Ga0373923_0197180
1183 Ga0373945_0138156
1184 Ga0373954_0000615
1185 Ga0373954_0040865
1186 Ga0373954_0234955
1187 Ga0373954_0280660
1188 Ga0373956_0021789
1189 Ga0373956_0054593
1190 Ga0373956_0268205
1191 Ga0373957_0030817
1192 Ga0373957_0475247
1193 Ga0373943_0330565
1194 Ga0373943_0457118
1195 Ga0373943_0866920
1196 Ga0373946_0075004
1197 Ga0373946_0283958
1198 Ga0373955_0030550
1199 Ga0373955_0088708
1200 Ga0373955_0092799
1201 Ga0373955_0093827
1202 Ga0373955_0636128
1203 Ga0373924_0067858
1204 Ga0373924_0352915
1205 Ga0373924_0389574
1206 Ga0373931_0315729
1207 Ga0373935_0041693
1208 Ga0373935_0738414
1209 Ga0373927_0001112
1210 Ga0373927_0015777
1211 Ga0373927_0024735
1212 Ga0373933_0000875
1213 Ga0373933_0002114
1214 Ga0373933_0031390
1215 Ga0373933_0115860
1216 Ga0373947_0005049
1217 Ga0373947_0014667
1218 Ga0373947_0047927
1219 Ga0373937_0000111
1220 Ga0373937_0036370
1221 Ga0373937_0037074
1222 Ga0373937_0049212
1223 Ga0373937_0251160
1224 Ga0373937_0683963
1225 Ga0373937_0866235
1226 Ga0265778_001414
1227 Ga0265778_001498
1228 Ga0265778_002443
1229 Ga0265778_011612
1230 Ga0265778_017951
1231 Ga0265778_037308
1232 Ga0265778_043206
1233 Ga0265778_043795
1234 Ga0265778_056321
1235 Ga0373925_0000969
1236 Ga0373925_0010535
1237 Ga0373925_0202420
1238 Ga0373925_0358024
1239 Ga0373925_0811552
1240 Ga0373925_0957582
1241 Ga0395898_1609637
1242 Ga0436360_0908177
1243 Ga0451837_0411823
1244 Ga0451577_0035010
1245 Ga0451577_0126378
1246 Ga0451577_0128279
1247 Ga0451577_1020154
1248 Ga0453683_0016428
1249 Ga0453683_0023533
1250 Ga0453683_0031301
1251 Ga0453683_0034792
1252 Ga0453683_0079728
1253 Ga0453684_0019676
1254 Ga0453684_0036842
1255 Ga0453684_0185611
1256 Ga0453684_0219978
1257 Ga0453684_0258296
1258 Ga0453684_0417182
1259 Ga0451576_0286383
1260 Ga0451576_0345957
1261 Ga0451576_0630874
1262 Ga0451576_0793267
1263 Ga0495592_0065622
1264 Ga0495592_0069907
1265 Ga0495592_0149700
1266 Ga0495592_0618495
1267 Ga0495592_0906875
1268 Ga0495603_0079373
1269 Ga0495603_0761200
1270 Ga0495629_0160387
1271 Ga0495629_0460859
1272 Ga0495641_0038397
1273 Ga0495641_0097217
1274 Ga0495651_0001249
1275 Ga0495651_0006995
1276 Ga0495651_0020364
1277 Ga0495651_0051316
1278 Ga0495653_0003367
1279 Ga0495653_0100464
1280 Ga0495653_0424494
1281 Ga0495653_0646628
1282 Ga0495580_0021880
1283 Ga0495580_0030085
1284 Ga0495580_0104727
1285 Ga0495580_0133139
1286 Ga0495580_0293451
1287 Ga0495580_0477452
1288 Ga0495580_0623003
1289 Ga0495580_0694607
1290 Ga0495582_0000417
1291 Ga0495582_0013912
1292 Ga0495582_0292645
1293 Ga0495582_0383786
1294 Ga0495582_0883491
1295 Ga0495639_0016004
1296 Ga0495662_0072313
1297 Ga0495664_0032941
1298 Ga0495664_0482244
1299 Ga0495594_0001371
1300 Ga0495594_0703614
1301 Ga0495608_0008749
1302 Ga0495608_0017709
1303 Ga0495608_0031575
1304 Ga0495608_0049901
1305 Ga0495608_0051140
1306 Ga0495608_0358756
1307 Ga0495608_0627775
1308 Ga0495618_0136625
1309 Ga0495618_0202541
1310 Ga0495618_0370103
1311 Ga0495618_0909951
1312 Ga0495628_0000743
1313 Ga0495628_0028733
1314 Ga0495628_0260338
1315 Ga0495628_0575975
1316 Ga0495630_0069333
1317 Ga0495630_0069732
1318 Ga0495630_0072095
1319 Ga0495630_0087456
1320 Ga0495630_0135687
1321 Ga0495630_0257456
1322 Ga0495630_0388104
1323 Ga0495630_1109925
1324 Ga0495666_0052146
1325 Ga0495666_0058665
1326 Ga0495666_0146250
1327 Ga0495652_0001695
1328 Ga0495652_0017164
1329 Ga0495652_0067961
1330 Ga0495652_0241383
1331 Ga0495665_0046239
1332 Ga0495665_0069599
1333 Ga0495665_0086535
1334 Ga0495640_0020695
1335 Ga0495640_0057124
1336 Ga0495640_0124597
1337 Ga0495640_0446378
1338 Ga0495640_0500219
1339 Ga0495586_0015627
1340 Ga0495586_0063101
1341 Ga0495586_0068860
1342 Ga0495586_0442046
1343 Ga0495587_0001724
1344 Ga0495587_0021839
1345 Ga0495587_0049045
1346 Ga0495587_0140117
1347 Ga0495587_0184413
1348 Ga0495645_0288528
1349 Ga0495622_0192654
1350 Ga0495622_0353676
1351 Ga0495667_0026375
1352 Ga0495667_0102488
1353 Ga0495667_0143519
1354 Ga0495667_0163686
1355 Ga0495667_0212788
1356 Ga0495667_0284840
1357 Ga0495634_0036717
1358 Ga0495634_0098085
1359 Ga0495634_0169655
1360 Ga0495635_0070732
1361 Ga0495635_0310834
1362 Ga0495635_0405154
1363 Ga0495657_0024181
1364 Ga0495657_0038646
1365 Ga0495657_0062883
1366 Ga0495657_0245623
1367 Ga0495657_0307158
1368 Ga0495657_0599797
1369 Ga0495599_0019261
1370 Ga0495599_0462680
1371 Ga0495599_0563597
1372 Ga0495623_0014756
1373 Ga0495623_0047674
1374 Ga0495623_0049796
1375 Ga0495623_0206376
1376 Ga0495623_0563979
1377 Ga0495646_0023695
1378 Ga0495646_0065301
1379 Ga0495647_0030102
1380 Ga0495658_0003500
1381 Ga0495658_0825659
1382 Ga0495613_0036328
1383 Ga0495613_0086104
1384 Ga0495613_0098120
1385 Ga0495613_0156725
1386 Ga0495613_0320264
1387 Ga0495613_0402210
1388 Ga0495613_0489902
1389 Ga0495624_0007287
1390 Ga0495624_0114062
1391 Ga0495600_0051251
1392 Ga0495600_0075930
1393 Ga0495600_0374723
1394 Ga0495600_0391389
1395 Ga0495600_0400261
1396 Ga0495604_0001483
1397 Ga0495604_0011284
1398 Ga0495604_0013619
1399 Ga0495604_0021270
1400 Ga0495604_0194816
1401 Ga0495604_0294820
1402 Ga0495604_0338990
1403 Ga0495604_0558655
1404 Ga0495636_0194539
1405 Ga0495674_0006253
1406 Ga0495674_0020173
1407 Ga0495674_0052258
1408 Ga0495674_0146301
1409 Ga0495674_0227728
1410 Ga0495674_0287272
1411 Ga0495676_0013622
1412 Ga0495676_0404491
1413 Ga0495676_0981365
1414 Ga0495680_0007841
1415 Ga0495680_0011639
1416 Ga0495680_0128200
1417 Ga0495680_0205056
1418 Ga0495680_0497386
1419 Ga0495675_0000077
1420 Ga0495675_0001536
1421 Ga0495675_0043555
1422 Ga0495675_0185265
1423 Ga0495675_0605955
1424 Ga0495684_0016559
1425 Ga0495684_0064436
1426 Ga0495684_0065814
1427 Ga0495684_0076825
1428 Ga0495684_0249388
1429 Ga0495684_0425234
1430 Ga0495593_0019576
1431 Ga0495593_0094834
1432 Ga0495602_0000729
1433 Ga0495602_0006628
1434 Ga0495602_0217282
1435 Ga0495602_0281748
1436 Ga0495602_0767101
1437 Ga0495614_0036269
1438 Ga0495614_0080431
1439 Ga0496101_0440566
1440 Ga0496102_0006239
1441 Ga0496103_0115509
1442 Ga0496103_0611214
1443 Ga0496105_0111730
1444 Ga0496106_0026233
1445 Ga0496106_0489173
1446 Ga0496106_0602613
1447 Ga0496107_0050472
1448 Ga0496111_0558723
1449 Ga0496112_0250641
1450 Ga0496112_0373504
1451 Ga0496114_0021884
1452 Ga0496115_0009629
1453 Ga0496115_0017610
1454 Ga0501047_1231471
1455 nmdc:mga0n895_234528_c1
1456 nmdc:mga0n895_4741_c1
1457 nmdc:mga0n895_6090_c1
1458 nmdc:mga0rr50_134785_c1
1459 nmdc:mga0rr50_166597_c1
1460 nmdc:mga0rr50_1795761_c1
1461 nmdc:mga0rr50_592762_c1
1462 nmdc:mga0rr50_999505_c1
1463 nmdc:mga08x19_1104_c1
1464 nmdc:mga08x19_115119_c1
1465 nmdc:mga08x19_230586_c1
1466 nmdc:mga08x19_55722_c1
1467 nmdc:mga0a205_54282_c1
1468 Ga0495601_0108137
1469 Ga0495601_0265936
1470 Ga0495601_0407327
1471 Ga0495612_0020586
1472 Ga0495612_0201760
1473 Ga0495612_0268742
1474 Ga0495595_0431380
1475 Ga0495595_0447956
1476 Ga0495619_0084845
1477 Ga0495619_1200804
1478 Ga0587101_119047

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

27

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.9199 5 96
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9107 5 96
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.9069 5 96
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.8967 5 96
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.8877 5 96
ID Description Score Start End Superfamily
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9211 5 96 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9199 5 96 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8975 5 96 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8967 5 96 2.30.33.40
af_C0PKD9_55_155_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8187 5 96 2.30.33.40

Map