F478446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 299 | 739 | 491 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100001083|Ga0070662_10000108317 |
| Length | 542 |
| Sequence | MKMQQGDTFPAASFFVEPGRRGTDGQWAGLPSGPKPNNAILLAMATTTRPSTSKQPASPAKTGSGLSRIKGSERDAVEGVSRVRSDVVLTFDDVLLTPRHSLVHPKDVTTTSRFTRGIPLNVPFASAAMDTVTESDMAXXXXRAGGIGVIHKNMSIDRQAAEVDRVKRSESGMILNPITLSPEGTLREAVALMRRFKISGVPIVNRDGQLVGIITNRDLQFERNLDRPLREAMTSKNLVTAPLGTTLDEAEAILGKHRIEKLPVVDEKGTLRGLITVKDIHKRRDFPNANKDQHGRLRVAAAIGASNFRDRARALVDAGVDVLVVDTAHGHSEGVLEATSIVRDMFPDVQLVAGNIAPGSICTTRVVTGVGVPQLTAIFDAVEGAGDVPVIADGGIKYSGDIVKALAAGAASVMMGSMLAGTEESPGESMLLEGRRFKMIRGMGSLAAMQDGSADRYFQEGEMSARKLVPEGIEGRVPFKGPVSDVLFQMVGGLRSGMGYVGCANIEQLRTESEFVRITSAGLRESHPHDVTITREAPNYSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 172 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 173 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 297 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 97.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10115330 | 3300003323 | Bacteria | 5217 |
| 2 | Ga0065704_10000251 | 3300005289 | Bacteria | 69899 |
| 3 | Ga0065704_10082553 | 3300005289 | Bacteria | 3579 |
| 4 | Ga0065707_10092569 | 3300005295 | Bacteria | 3751 |
| 5 | Ga0070658_10000047 | 3300005327 | Bacteria | 129483 |
| 6 | Ga0070658_10005468 | 3300005327 | Bacteria | 10303 |
| 7 | Ga0070658_10011659 | 3300005327 | Bacteria | 7049 |
| 8 | Ga0070658_10083059 | 3300005327 | Bacteria | 2633 |
| 9 | Ga0070676_10001172 | 3300005328 | Bacteria | 13129 |
| 10 | Ga0070676_10004316 | 3300005328 | Bacteria | 7469 |
| 11 | Ga0070676_10011173 | 3300005328 | Bacteria | 4879 |
| 12 | Ga0070683_100003778 | 3300005329 | Bacteria | 12361 |
| 13 | Ga0070683_100006226 | 3300005329 | Bacteria | 10008 |
| 14 | Ga0070683_100006465 | 3300005329 | Bacteria | 9836 |
| 15 | Ga0070683_100007195 | 3300005329 | Bacteria | 9385 |
| 16 | Ga0070683_100017278 | 3300005329 | Bacteria | 6375 |
| 17 | Ga0070683_100017780 | 3300005329 | Bacteria | 6282 |
| 18 | Ga0070683_100017906 | 3300005329 | Bacteria | 6262 |
| 19 | Ga0070683_100039807 | 3300005329 | Bacteria | 4317 |
| 20 | Ga0070683_100186461 | 3300005329 | Bacteria | 1969 |
| 21 | Ga0070690_100014715 | 3300005330 | Bacteria | 4647 |
| 22 | Ga0070670_100062618 | 3300005331 | Bacteria | 3193 |
| 23 | Ga0070670_100088062 | 3300005331 | Bacteria | 2669 |
| 24 | Ga0070677_10036695 | 3300005333 | Bacteria | 1908 |
| 25 | Ga0068869_100001479 | 3300005334 | Bacteria | 13914 |
| 26 | Ga0068869_100037987 | 3300005334 | Bacteria | 3427 |
| 27 | Ga0070680_100004841 | 3300005336 | Bacteria | 10139 |
| 28 | Ga0070680_100005076 | 3300005336 | Bacteria | 9931 |
| 29 | Ga0070680_100008998 | 3300005336 | Bacteria | 7657 |
| 30 | Ga0070680_100010389 | 3300005336 | Bacteria | 7177 |
| 31 | Ga0070680_100013243 | 3300005336 | Bacteria | 6421 |
| 32 | Ga0070680_100017623 | 3300005336 | Bacteria | 5633 |
| 33 | Ga0070680_100037373 | 3300005336 | Bacteria | 3923 |
| 34 | Ga0070680_100039287 | 3300005336 | Bacteria | 3830 |
| 35 | Ga0070680_100108761 | 3300005336 | Bacteria | 2306 |
| 36 | Ga0070680_100155218 | 3300005336 | Bacteria | 1923 |
| 37 | Ga0070682_100005004 | 3300005337 | Bacteria | 7366 |
| 38 | Ga0070682_100009731 | 3300005337 | Bacteria | 5443 |
| 39 | Ga0070682_100036763 | 3300005337 | Bacteria | 2994 |
| 40 | Ga0068868_100012394 | 3300005338 | Bacteria | 6232 |
| 41 | Ga0068868_100076407 | 3300005338 | Bacteria | 2678 |
| 42 | Ga0070660_100002151 | 3300005339 | Bacteria | 13596 |
| 43 | Ga0070660_100013004 | 3300005339 | Bacteria | 5957 |
| 44 | Ga0070660_100127725 | 3300005339 | Bacteria | 2032 |
| 45 | Ga0070689_100030654 | 3300005340 | Bacteria | 4083 |
| 46 | Ga0070691_10007806 | 3300005341 | Bacteria | 4898 |
| 47 | Ga0070687_100000549 | 3300005343 | Bacteria | 12572 |
| 48 | Ga0070687_100010099 | 3300005343 | Bacteria | 4066 |
| 49 | Ga0070661_100000331 | 3300005344 | Bacteria | 37971 |
| 50 | Ga0070661_100003958 | 3300005344 | Bacteria | 10188 |
| 51 | Ga0070661_100042448 | 3300005344 | Bacteria | 3319 |
| 52 | Ga0070668_100000182 | 3300005347 | Bacteria | 40680 |
| 53 | Ga0070669_100003393 | 3300005353 | Bacteria | 11462 |
| 54 | Ga0070669_100021469 | 3300005353 | Bacteria | 4614 |
| 55 | Ga0070669_100037086 | 3300005353 | Bacteria | 3535 |
| 56 | Ga0070675_100002184 | 3300005354 | Bacteria | 14502 |
| 57 | Ga0070675_100016435 | 3300005354 | Bacteria | 5873 |
| 58 | Ga0070674_100000605 | 3300005356 | Bacteria | 18132 |
| 59 | Ga0070674_100009667 | 3300005356 | Bacteria | 5786 |
| 60 | Ga0070674_100048685 | 3300005356 | Bacteria | 2910 |
| 61 | Ga0070673_100018937 | 3300005364 | Bacteria | 4934 |
| 62 | Ga0070673_100043692 | 3300005364 | Bacteria | 3464 |
| 63 | Ga0070673_100071563 | 3300005364 | Bacteria | 2787 |
| 64 | Ga0070688_100019639 | 3300005365 | Bacteria | 3917 |
| 65 | Ga0070659_100000100 | 3300005366 | Bacteria | 63786 |
| 66 | Ga0070659_100000927 | 3300005366 | Bacteria | 21513 |
| 67 | Ga0070659_100002500 | 3300005366 | Bacteria | 13057 |
| 68 | Ga0070659_100011745 | 3300005366 | Bacteria | 6482 |
| 69 | Ga0070659_100013618 | 3300005366 | Bacteria | 6060 |
| 70 | Ga0070659_100037062 | 3300005366 | Bacteria | 3802 |
| 71 | Ga0070659_100114982 | 3300005366 | Bacteria | 2174 |
| 72 | Ga0070667_100003736 | 3300005367 | Bacteria | 12923 |
| 73 | Ga0070667_100023342 | 3300005367 | Bacteria | 5131 |
| 74 | Ga0070709_10011304 | 3300005434 | Bacteria | 4971 |
| 75 | Ga0070714_100009543 | 3300005435 | Bacteria | 7635 |
| 76 | Ga0070714_100009617 | 3300005435 | Bacteria | 7609 |
| 77 | Ga0070714_100031774 | 3300005435 | Bacteria | 4407 |
| 78 | Ga0070711_100000962 | 3300005439 | Bacteria | 15267 |
| 79 | Ga0070705_100047597 | 3300005440 | Bacteria | 2480 |
| 80 | Ga0070694_100012174 | 3300005444 | Bacteria | 5344 |
| 81 | Ga0070708_100000045 | 3300005445 | Bacteria | 81076 |
| 82 | Ga0070708_100000788 | 3300005445 | Bacteria | 23894 |
| 83 | Ga0070708_100038954 | 3300005445 | Bacteria | 4156 |
| 84 | Ga0070708_100068887 | 3300005445 | Bacteria | 3181 |
| 85 | Ga0070662_100000596 | 3300005457 | Bacteria | 22019 |
| 86 | Ga0070662_100001083 | 3300005457 | Bacteria | 16611 |
| 87 | Ga0070662_100002883 | 3300005457 | Bacteria | 10669 |
| 88 | Ga0070662_100107955 | 3300005457 | Bacteria | 2116 |
| 89 | Ga0070681_10000473 | 3300005458 | Bacteria | 32789 |
| 90 | Ga0070681_10003552 | 3300005458 | Bacteria | 14625 |
| 91 | Ga0070681_10003870 | 3300005458 | Bacteria | 14086 |
| 92 | Ga0070681_10004476 | 3300005458 | Bacteria | 13323 |
| 93 | Ga0070681_10008927 | 3300005458 | Bacteria | 9853 |
| 94 | Ga0070681_10027309 | 3300005458 | Bacteria | 5738 |
| 95 | Ga0070681_10034461 | 3300005458 | Bacteria | 5083 |
| 96 | Ga0070681_10110061 | 3300005458 | Bacteria | 2695 |
| 97 | Ga0070681_10187652 | 3300005458 | Bacteria | 1987 |
| 98 | Ga0070685_10037465 | 3300005466 | Bacteria | 2747 |
| 99 | Ga0070706_100006172 | 3300005467 | Bacteria | 11337 |
| 100 | Ga0070707_100000955 | 3300005468 | Bacteria | 28664 |
| 101 | Ga0070707_100019620 | 3300005468 | Bacteria | 6372 |
| 102 | Ga0070707_100055557 | 3300005468 | Bacteria | 3796 |
| 103 | Ga0070698_100000535 | 3300005471 | Bacteria | 40564 |
| 104 | Ga0070698_100030948 | 3300005471 | Bacteria | 5550 |
| 105 | Ga0070698_100072240 | 3300005471 | Bacteria | 3459 |
| 106 | Ga0070698_100121428 | 3300005471 | Bacteria | 2573 |
| 107 | Ga0070699_100158927 | 3300005518 | Bacteria | 2000 |
| 108 | Ga0070699_100216923 | 3300005518 | Bacteria | 1704 |
| 109 | Ga0070679_100001192 | 3300005530 | Bacteria | 22842 |
| 110 | Ga0070679_100002731 | 3300005530 | Bacteria | 16073 |
| 111 | Ga0070679_100003029 | 3300005530 | Bacteria | 15347 |
| 112 | Ga0070679_100004557 | 3300005530 | Bacteria | 12796 |
| 113 | Ga0070679_100006728 | 3300005530 | Bacteria | 10720 |
| 114 | Ga0070679_100009679 | 3300005530 | Bacteria | 9117 |
| 115 | Ga0070679_100016156 | 3300005530 | Bacteria | 7192 |
| 116 | Ga0070679_100019454 | 3300005530 | Bacteria | 6601 |
| 117 | Ga0070679_100037856 | 3300005530 | Bacteria | 4793 |
| 118 | Ga0070679_100068102 | 3300005530 | Bacteria | 3551 |
| 119 | Ga0070679_100127335 | 3300005530 | Bacteria | 2528 |
| 120 | Ga0070679_100146456 | 3300005530 | Bacteria | 2339 |
| 121 | Ga0070679_100181669 | 3300005530 | Bacteria | 2076 |
| 122 | Ga0070684_100000255 | 3300005535 | Bacteria | 36870 |
| 123 | Ga0070684_100026387 | 3300005535 | Bacteria | 4893 |
| 124 | Ga0070684_100029652 | 3300005535 | Bacteria | 4639 |
| 125 | Ga0070684_100046227 | 3300005535 | Bacteria | 3772 |
| 126 | Ga0070684_100154688 | 3300005535 | Bacteria | 2079 |
| 127 | Ga0068853_100005516 | 3300005539 | Bacteria | 9918 |
| 128 | Ga0070672_100016273 | 3300005543 | Bacteria | 5321 |
| 129 | Ga0070686_100024875 | 3300005544 | Bacteria | 3594 |
| 130 | Ga0070695_100010556 | 3300005545 | Bacteria | 5517 |
| 131 | Ga0070695_100028288 | 3300005545 | Bacteria | 3478 |
| 132 | Ga0070695_100029087 | 3300005545 | Bacteria | 3432 |
| 133 | Ga0070695_100064466 | 3300005545 | Bacteria | 2384 |
| 134 | Ga0070695_100177326 | 3300005545 | Bacteria | 1507 |
| 135 | Ga0070696_100000113 | 3300005546 | Bacteria | 41571 |
| 136 | Ga0070693_100007102 | 3300005547 | Bacteria | 5458 |
| 137 | Ga0070693_100007872 | 3300005547 | Bacteria | 5226 |
| 138 | Ga0070693_100011143 | 3300005547 | Bacteria | 4525 |
| 139 | Ga0070665_100000399 | 3300005548 | Bacteria | 63817 |
| 140 | Ga0070704_100110884 | 3300005549 | Bacteria | 2087 |
| 141 | Ga0068855_100003992 | 3300005563 | Bacteria | 18023 |
| 142 | Ga0068855_100022823 | 3300005563 | Bacteria | 7499 |
| 143 | Ga0068855_100028001 | 3300005563 | Bacteria | 6741 |
| 144 | Ga0068855_100031885 | 3300005563 | Bacteria | 6291 |
| 145 | Ga0068855_100038801 | 3300005563 | Bacteria | 5657 |
| 146 | Ga0068855_100042147 | 3300005563 | Bacteria | 5409 |
| 147 | Ga0068855_100062029 | 3300005563 | Bacteria | 4366 |
| 148 | Ga0070664_100000990 | 3300005564 | Bacteria | 22227 |
| 149 | Ga0070664_100003425 | 3300005564 | Bacteria | 12811 |
| 150 | Ga0070664_100003696 | 3300005564 | Bacteria | 12333 |
| 151 | Ga0070664_100069625 | 3300005564 | Bacteria | 3011 |
| 152 | Ga0068857_100006087 | 3300005577 | Bacteria | 10303 |
| 153 | Ga0068857_100020444 | 3300005577 | Bacteria | 5823 |
| 154 | Ga0068857_100049820 | 3300005577 | Bacteria | 3716 |
| 155 | Ga0068857_100066504 | 3300005577 | Bacteria | 3207 |
| 156 | Ga0068856_100003727 | 3300005614 | Bacteria | 15284 |
| 157 | Ga0068856_100022892 | 3300005614 | Bacteria | 6076 |
| 158 | Ga0070702_100000366 | 3300005615 | Bacteria | 15805 |
| 159 | Ga0068852_100006987 | 3300005616 | Bacteria | 8214 |
| 160 | Ga0068852_100012815 | 3300005616 | Bacteria | 6389 |
| 161 | Ga0068852_100025942 | 3300005616 | Bacteria | 4756 |
| 162 | Ga0068852_100031878 | 3300005616 | Bacteria | 4357 |
| 163 | Ga0068859_100013810 | 3300005617 | Bacteria | 8097 |
| 164 | Ga0068859_100028872 | 3300005617 | Bacteria | 5563 |
| 165 | Ga0068859_100134064 | 3300005617 | Bacteria | 2548 |
| 166 | Ga0068864_100001549 | 3300005618 | Bacteria | 18963 |
| 167 | Ga0068864_100045010 | 3300005618 | Bacteria | 3785 |
| 168 | Ga0068866_10000381 | 3300005718 | Bacteria | 20863 |
| 169 | Ga0068866_10021583 | 3300005718 | Bacteria | 2968 |
| 170 | Ga0068861_100000159 | 3300005719 | Bacteria | 35347 |
| 171 | Ga0068861_100012359 | 3300005719 | Bacteria | 5953 |
| 172 | Ga0068851_10000042 | 3300005834 | Bacteria | 88904 |
| 173 | Ga0068851_10051371 | 3300005834 | Bacteria | 2095 |
| 174 | Ga0068870_10009478 | 3300005840 | Bacteria | 4432 |
| 175 | Ga0068863_100003160 | 3300005841 | Bacteria | 16273 |
| 176 | Ga0068863_100128205 | 3300005841 | Bacteria | 2421 |
| 177 | Ga0068858_100005316 | 3300005842 | Bacteria | 12622 |
| 178 | Ga0068860_100119338 | 3300005843 | Bacteria | 2525 |
| 179 | Ga0068862_100001333 | 3300005844 | Bacteria | 22917 |
| 180 | Ga0068862_100036850 | 3300005844 | Bacteria | 4145 |
| 181 | Ga0081539_10000174 | 3300005985 | Bacteria | 151265 |
| 182 | Ga0081539_10009701 | 3300005985 | Bacteria | 7972 |
| 183 | Ga0070717_10007977 | 3300006028 | Bacteria | 7885 |
| 184 | Ga0070712_100001803 | 3300006175 | Bacteria | 13084 |
| 185 | Ga0070712_100067208 | 3300006175 | Bacteria | 2550 |
| 186 | Ga0097621_100034285 | 3300006237 | Bacteria | 4048 |
| 187 | Ga0075430_100000568 | 3300006846 | Bacteria | 28042 |
| 188 | Ga0075430_100002373 | 3300006846 | Bacteria | 15637 |
| 189 | Ga0075430_100007578 | 3300006846 | Bacteria | 9172 |
| 190 | Ga0075430_100056456 | 3300006846 | Bacteria | 3301 |
| 191 | Ga0075430_100068805 | 3300006846 | Bacteria | 2970 |
| 192 | Ga0075431_100001735 | 3300006847 | Bacteria | 20509 |
| 193 | Ga0075431_100046401 | 3300006847 | Bacteria | 4480 |
| 194 | Ga0075433_10018833 | 3300006852 | Bacteria | 5745 |
| 195 | Ga0075434_100202041 | 3300006871 | Bacteria | 2007 |
| 196 | Ga0075429_100007625 | 3300006880 | Bacteria | 9398 |
| 197 | Ga0068865_100004459 | 3300006881 | Bacteria | 8443 |
| 198 | Ga0068865_100057701 | 3300006881 | Bacteria | 2709 |
| 199 | Ga0075436_100001419 | 3300006914 | Bacteria | 16275 |
| 200 | Ga0097620_100013811 | 3300006931 | Bacteria | 8097 |
| 201 | Ga0097620_100028872 | 3300006931 | Bacteria | 5563 |
| 202 | Ga0097620_100134063 | 3300006931 | Bacteria | 2548 |
| 203 | Ga0105240_10005639 | 3300009093 | Bacteria | 18584 |
| 204 | Ga0105240_10012038 | 3300009093 | Bacteria | 11991 |
| 205 | Ga0105240_10031972 | 3300009093 | Bacteria | 6816 |
| 206 | Ga0105240_10122645 | 3300009093 | Bacteria | 3127 |
| 207 | Ga0105240_10129986 | 3300009093 | Bacteria | 3022 |
| 208 | Ga0105240_10136438 | 3300009093 | Bacteria | 2938 |
| 209 | Ga0105240_10198875 | 3300009093 | Bacteria | 2350 |
| 210 | Ga0111539_10018419 | 3300009094 | Bacteria | 8650 |
| 211 | Ga0111539_10048865 | 3300009094 | Bacteria | 5049 |
| 212 | Ga0111539_10124865 | 3300009094 | Bacteria | 3016 |
| 213 | Ga0111539_10152236 | 3300009094 | Bacteria | 2707 |
| 214 | Ga0111539_10241863 | 3300009094 | Bacteria | 2101 |
| 215 | Ga0105245_10004656 | 3300009098 | Bacteria | 12124 |
| 216 | Ga0105245_10028512 | 3300009098 | Bacteria | 4926 |
| 217 | Ga0114129_10010360 | 3300009147 | Bacteria | 13295 |
| 218 | Ga0105241_10000296 | 3300009174 | Bacteria | 37208 |
| 219 | Ga0105241_10009823 | 3300009174 | Bacteria | 7032 |
| 220 | Ga0105242_10003851 | 3300009176 | Bacteria | 11669 |
| 221 | Ga0105242_10014450 | 3300009176 | Bacteria | 6118 |
| 222 | Ga0105242_10147146 | 3300009176 | Bacteria | 2050 |
| 223 | Ga0105248_10034311 | 3300009177 | Bacteria | 5672 |
| 224 | Ga0105237_10002557 | 3300009545 | Bacteria | 22478 |
| 225 | Ga0105237_10009074 | 3300009545 | Bacteria | 10686 |
| 226 | Ga0105238_10021425 | 3300009551 | Bacteria | 6583 |
| 227 | Ga0105249_10000061 | 3300009553 | Bacteria | 153313 |
| 228 | Ga0105249_10000251 | 3300009553 | Bacteria | 59080 |
| 229 | Ga0105249_10000572 | 3300009553 | Bacteria | 33735 |
| 230 | Ga0105249_10027811 | 3300009553 | Bacteria | 5103 |
| 231 | Ga0105239_10035253 | 3300010375 | Bacteria | 5495 |
| 232 | Ga0105239_10046185 | 3300010375 | Bacteria | 4772 |
| 233 | Ga0105246_10000522 | 3300011119 | Bacteria | 20988 |
| 234 | Ga0105246_10122408 | 3300011119 | Bacteria | 1930 |
| 235 | Ga0157373_10000069 | 3300013100 | Bacteria | 91687 |
| 236 | Ga0157373_10000634 | 3300013100 | Bacteria | 27559 |
| 237 | Ga0157373_10009825 | 3300013100 | Bacteria | 7053 |
| 238 | Ga0157373_10016451 | 3300013100 | Bacteria | 5394 |
| 239 | Ga0157373_10072212 | 3300013100 | Bacteria | 2436 |
| 240 | Ga0157371_10001005 | 3300013102 | Bacteria | 31122 |
| 241 | Ga0157371_10005499 | 3300013102 | Bacteria | 10664 |
| 242 | Ga0157371_10030300 | 3300013102 | Bacteria | 3903 |
| 243 | Ga0157371_10034702 | 3300013102 | Bacteria | 3617 |
| 244 | Ga0157370_10001850 | 3300013104 | Bacteria | 26088 |
| 245 | Ga0157370_10009110 | 3300013104 | Bacteria | 10648 |
| 246 | Ga0157370_10018303 | 3300013104 | Bacteria | 7046 |
| 247 | Ga0157370_10021084 | 3300013104 | Bacteria | 6497 |
| 248 | Ga0157370_10128779 | 3300013104 | Bacteria | 2362 |
| 249 | Ga0157369_10009566 | 3300013105 | Bacteria | 11087 |
| 250 | Ga0157369_10041660 | 3300013105 | Bacteria | 5012 |
| 251 | Ga0157369_10068959 | 3300013105 | Bacteria | 3799 |
| 252 | Ga0157369_10156786 | 3300013105 | Bacteria | 2404 |
| 253 | Ga0157369_10282407 | 3300013105 | Bacteria | 1729 |
| 254 | Ga0157374_10030377 | 3300013296 | Bacteria | 4905 |
| 255 | Ga0157374_10056699 | 3300013296 | Bacteria | 3658 |
| 256 | Ga0157378_10001106 | 3300013297 | Bacteria | 24548 |
| 257 | Ga0163162_10000718 | 3300013306 | Bacteria | 30727 |
| 258 | Ga0163162_10021283 | 3300013306 | Bacteria | 6384 |
| 259 | Ga0157372_10000462 | 3300013307 | Bacteria | 44685 |
| 260 | Ga0157372_10004316 | 3300013307 | Bacteria | 15198 |
| 261 | Ga0157372_10004800 | 3300013307 | Bacteria | 14362 |
| 262 | Ga0157372_10004905 | 3300013307 | Bacteria | 14221 |
| 263 | Ga0157372_10007168 | 3300013307 | Bacteria | 11865 |
| 264 | Ga0157372_10009706 | 3300013307 | Bacteria | 10234 |
| 265 | Ga0157372_10011953 | 3300013307 | Bacteria | 9249 |
| 266 | Ga0157372_10033524 | 3300013307 | Bacteria | 5642 |
| 267 | Ga0157372_10039293 | 3300013307 | Bacteria | 5222 |
| 268 | Ga0157372_10043164 | 3300013307 | Bacteria | 4991 |
| 269 | Ga0157372_10052660 | 3300013307 | Bacteria | 4533 |
| 270 | Ga0157372_10059189 | 3300013307 | Bacteria | 4284 |
| 271 | Ga0157372_10296199 | 3300013307 | Bacteria | 1881 |
| 272 | Ga0157375_10013585 | 3300013308 | Bacteria | 7252 |
| 273 | Ga0157375_10060624 | 3300013308 | Bacteria | 3753 |
| 274 | Ga0163163_10022786 | 3300014325 | Bacteria | 5935 |
| 275 | Ga0163163_10072742 | 3300014325 | Bacteria | 3427 |
| 276 | Ga0163163_10093096 | 3300014325 | Bacteria | 3030 |
| 277 | Ga0163163_10302315 | 3300014325 | Bacteria | 1652 |
| 278 | Ga0157380_10052386 | 3300014326 | Bacteria | 3232 |
| 279 | Ga0157380_10099246 | 3300014326 | Bacteria | 2421 |
| 280 | Ga0157380_10144727 | 3300014326 | Bacteria | 2047 |
| 281 | Ga0182008_10000200 | 3300014497 | Bacteria | 46936 |
| 282 | Ga0182008_10005125 | 3300014497 | Bacteria | 7521 |
| 283 | Ga0157377_10001101 | 3300014745 | Bacteria | 11422 |
| 284 | Ga0157377_10036782 | 3300014745 | Bacteria | 2695 |
| 285 | Ga0157376_10014136 | 3300014969 | Bacteria | 5979 |
| 286 | Ga0182006_1001502 | 3300015261 | Bacteria | 13967 |
| 287 | Ga0182006_1001978 | 3300015261 | Bacteria | 11606 |
| 288 | Ga0206353_10072611 | 3300020082 | Bacteria | 2203 |
| 289 | Ga0213876_10082548 | 3300021384 | Bacteria | 1700 |
| 290 | Ga0224712_10024797 | 3300022467 | Bacteria | 2100 |
| 291 | Ga0209026_1002502 | 3300025250 | Bacteria | 6830 |
| 292 | Ga0207697_10003842 | 3300025315 | Bacteria | 7329 |
| 293 | Ga0207656_10000176 | 3300025321 | Bacteria | 23119 |
| 294 | Ga0207642_10049506 | 3300025899 | Bacteria | 1889 |
| 295 | Ga0207680_10040035 | 3300025903 | Bacteria | 2724 |
| 296 | Ga0207699_10008236 | 3300025906 | Bacteria | 5133 |
| 297 | Ga0207699_10105072 | 3300025906 | Bacteria | 1800 |
| 298 | Ga0207645_10001472 | 3300025907 | Bacteria | 19240 |
| 299 | Ga0207645_10001749 | 3300025907 | Bacteria | 17617 |
| 300 | Ga0207645_10014184 | 3300025907 | Bacteria | 5338 |
| 301 | Ga0207645_10076105 | 3300025907 | Bacteria | 2149 |
| 302 | Ga0207643_10002930 | 3300025908 | Bacteria | 9211 |
| 303 | Ga0207643_10024224 | 3300025908 | Bacteria | 3349 |
| 304 | Ga0207705_10000052 | 3300025909 | Bacteria | 168319 |
| 305 | Ga0207705_10002060 | 3300025909 | Bacteria | 15635 |
| 306 | Ga0207705_10010105 | 3300025909 | Bacteria | 6871 |
| 307 | Ga0207705_10011492 | 3300025909 | Bacteria | 6403 |
| 308 | Ga0207705_10017850 | 3300025909 | Bacteria | 5074 |
| 309 | Ga0207684_10016420 | 3300025910 | Bacteria | 6356 |
| 310 | Ga0207654_10000519 | 3300025911 | Bacteria | 22137 |
| 311 | Ga0207654_10025846 | 3300025911 | Bacteria | 3173 |
| 312 | Ga0207654_10056097 | 3300025911 | Bacteria | 2284 |
| 313 | Ga0207707_10000423 | 3300025912 | Bacteria | 44206 |
| 314 | Ga0207707_10002786 | 3300025912 | Bacteria | 15596 |
| 315 | Ga0207707_10005244 | 3300025912 | Bacteria | 11358 |
| 316 | Ga0207707_10016185 | 3300025912 | Bacteria | 6506 |
| 317 | Ga0207707_10027874 | 3300025912 | Bacteria | 4938 |
| 318 | Ga0207707_10031879 | 3300025912 | Bacteria | 4614 |
| 319 | Ga0207707_10036704 | 3300025912 | Bacteria | 4284 |
| 320 | Ga0207707_10036988 | 3300025912 | Bacteria | 4265 |
| 321 | Ga0207707_10069146 | 3300025912 | Bacteria | 3078 |
| 322 | Ga0207695_10000228 | 3300025913 | Bacteria | 150118 |
| 323 | Ga0207695_10002260 | 3300025913 | Bacteria | 28830 |
| 324 | Ga0207695_10007739 | 3300025913 | Bacteria | 13612 |
| 325 | Ga0207695_10020940 | 3300025913 | Bacteria | 7473 |
| 326 | Ga0207695_10025474 | 3300025913 | Bacteria | 6620 |
| 327 | Ga0207695_10046486 | 3300025913 | Bacteria | 4602 |
| 328 | Ga0207671_10009085 | 3300025914 | Bacteria | 8352 |
| 329 | Ga0207671_10012340 | 3300025914 | Bacteria | 6876 |
| 330 | Ga0207693_10003926 | 3300025915 | Bacteria | 12660 |
| 331 | Ga0207663_10020208 | 3300025916 | Bacteria | 3768 |
| 332 | Ga0207660_10004363 | 3300025917 | Bacteria | 9223 |
| 333 | Ga0207660_10004590 | 3300025917 | Bacteria | 8999 |
| 334 | Ga0207660_10011400 | 3300025917 | Bacteria | 5783 |
| 335 | Ga0207660_10022179 | 3300025917 | Bacteria | 4277 |
| 336 | Ga0207660_10024837 | 3300025917 | Bacteria | 4060 |
| 337 | Ga0207660_10028354 | 3300025917 | Bacteria | 3829 |
| 338 | Ga0207660_10058005 | 3300025917 | Bacteria | 2775 |
| 339 | Ga0207660_10061568 | 3300025917 | Bacteria | 2701 |
| 340 | Ga0207660_10084435 | 3300025917 | Bacteria | 2340 |
| 341 | Ga0207662_10002391 | 3300025918 | Bacteria | 9414 |
| 342 | Ga0207662_10006744 | 3300025918 | Bacteria | 6210 |
| 343 | Ga0207662_10053993 | 3300025918 | Bacteria | 2394 |
| 344 | Ga0207657_10012334 | 3300025919 | Bacteria | 8442 |
| 345 | Ga0207657_10052851 | 3300025919 | Bacteria | 3524 |
| 346 | Ga0207657_10089345 | 3300025919 | Bacteria | 2574 |
| 347 | Ga0207657_10119649 | 3300025919 | Bacteria | 2167 |
| 348 | Ga0207649_10000977 | 3300025920 | Bacteria | 17727 |
| 349 | Ga0207649_10046601 | 3300025920 | Bacteria | 2664 |
| 350 | Ga0207652_10000636 | 3300025921 | Bacteria | 34690 |
| 351 | Ga0207652_10013395 | 3300025921 | Bacteria | 6638 |
| 352 | Ga0207652_10042995 | 3300025921 | Bacteria | 3847 |
| 353 | Ga0207652_10055836 | 3300025921 | Bacteria | 3398 |
| 354 | Ga0207652_10062110 | 3300025921 | Bacteria | 3228 |
| 355 | Ga0207652_10084147 | 3300025921 | Bacteria | 2786 |
| 356 | Ga0207652_10104959 | 3300025921 | Bacteria | 2500 |
| 357 | Ga0207652_10111016 | 3300025921 | Bacteria | 2431 |
| 358 | Ga0207646_10001505 | 3300025922 | Bacteria | 28666 |
| 359 | Ga0207646_10014532 | 3300025922 | Bacteria | 7472 |
| 360 | Ga0207646_10092391 | 3300025922 | Bacteria | 2709 |
| 361 | Ga0207681_10002613 | 3300025923 | Bacteria | 11407 |
| 362 | Ga0207681_10002918 | 3300025923 | Bacteria | 10789 |
| 363 | Ga0207681_10024834 | 3300025923 | Bacteria | 3848 |
| 364 | Ga0207694_10003260 | 3300025924 | Bacteria | 12930 |
| 365 | Ga0207650_10005032 | 3300025925 | Bacteria | 9023 |
| 366 | Ga0207659_10005657 | 3300025926 | Bacteria | 7604 |
| 367 | Ga0207659_10015665 | 3300025926 | Bacteria | 4919 |
| 368 | Ga0207700_10002118 | 3300025928 | Bacteria | 11339 |
| 369 | Ga0207700_10107713 | 3300025928 | Bacteria | 2236 |
| 370 | Ga0207700_10146869 | 3300025928 | Bacteria | 1944 |
| 371 | Ga0207664_10009782 | 3300025929 | Bacteria | 6746 |
| 372 | Ga0207690_10000609 | 3300025932 | Bacteria | 23117 |
| 373 | Ga0207690_10013013 | 3300025932 | Bacteria | 4990 |
| 374 | Ga0207690_10112282 | 3300025932 | Bacteria | 1965 |
| 375 | Ga0207706_10000015 | 3300025933 | Bacteria | 174140 |
| 376 | Ga0207706_10002211 | 3300025933 | Bacteria | 18979 |
| 377 | Ga0207709_10071646 | 3300025935 | Bacteria | 2202 |
| 378 | Ga0207704_10004757 | 3300025938 | Bacteria | 6230 |
| 379 | Ga0207704_10012345 | 3300025938 | Bacteria | 4241 |
| 380 | Ga0207691_10000840 | 3300025940 | Bacteria | 30601 |
| 381 | Ga0207691_10014192 | 3300025940 | Bacteria | 7601 |
| 382 | Ga0207711_10002798 | 3300025941 | Bacteria | 15336 |
| 383 | Ga0207689_10005150 | 3300025942 | Bacteria | 11745 |
| 384 | Ga0207689_10007205 | 3300025942 | Bacteria | 9770 |
| 385 | Ga0207689_10023712 | 3300025942 | Bacteria | 5147 |
| 386 | Ga0207661_10000472 | 3300025944 | Bacteria | 25990 |
| 387 | Ga0207661_10004037 | 3300025944 | Bacteria | 10256 |
| 388 | Ga0207661_10004340 | 3300025944 | Bacteria | 9927 |
| 389 | Ga0207661_10009167 | 3300025944 | Bacteria | 7096 |
| 390 | Ga0207661_10012610 | 3300025944 | Bacteria | 6151 |
| 391 | Ga0207661_10020685 | 3300025944 | Bacteria | 4924 |
| 392 | Ga0207661_10033947 | 3300025944 | Bacteria | 3963 |
| 393 | Ga0207661_10052768 | 3300025944 | Bacteria | 3250 |
| 394 | Ga0207661_10074879 | 3300025944 | Bacteria | 2776 |
| 395 | Ga0207661_10122373 | 3300025944 | Bacteria | 2217 |
| 396 | Ga0207679_10003434 | 3300025945 | Bacteria | 9776 |
| 397 | Ga0207667_10005189 | 3300025949 | Bacteria | 15905 |
| 398 | Ga0207667_10022814 | 3300025949 | Bacteria | 6903 |
| 399 | Ga0207667_10082568 | 3300025949 | Bacteria | 3328 |
| 400 | Ga0207667_10107699 | 3300025949 | Bacteria | 2875 |
| 401 | Ga0207667_10119480 | 3300025949 | Bacteria | 2716 |
| 402 | Ga0207651_10046823 | 3300025960 | Bacteria | 2911 |
| 403 | Ga0207712_10000144 | 3300025961 | Bacteria | 74254 |
| 404 | Ga0207712_10002363 | 3300025961 | Bacteria | 12229 |
| 405 | Ga0207712_10002544 | 3300025961 | Bacteria | 11722 |
| 406 | Ga0207712_10004478 | 3300025961 | Bacteria | 8822 |
| 407 | Ga0207668_10003462 | 3300025972 | Bacteria | 9261 |
| 408 | Ga0207668_10087489 | 3300025972 | Bacteria | 2279 |
| 409 | Ga0207640_10000931 | 3300025981 | Bacteria | 16362 |
| 410 | Ga0207640_10030753 | 3300025981 | Bacteria | 3310 |
| 411 | Ga0207658_10013897 | 3300025986 | Bacteria | 5509 |
| 412 | Ga0207658_10094189 | 3300025986 | Bacteria | 2330 |
| 413 | Ga0207677_10003526 | 3300026023 | Bacteria | 8290 |
| 414 | Ga0207703_10003749 | 3300026035 | Bacteria | 12648 |
| 415 | Ga0207703_10153607 | 3300026035 | Bacteria | 2009 |
| 416 | Ga0207639_10007445 | 3300026041 | Bacteria | 7466 |
| 417 | Ga0207639_10082849 | 3300026041 | Bacteria | 2544 |
| 418 | Ga0207678_10015292 | 3300026067 | Bacteria | 6750 |
| 419 | Ga0207678_10078502 | 3300026067 | Bacteria | 2827 |
| 420 | Ga0207708_10006826 | 3300026075 | Bacteria | 8441 |
| 421 | Ga0207708_10016424 | 3300026075 | Bacteria | 5567 |
| 422 | Ga0207702_10007494 | 3300026078 | Bacteria | 9303 |
| 423 | Ga0207702_10159909 | 3300026078 | Bacteria | 2056 |
| 424 | Ga0207641_10017047 | 3300026088 | Bacteria | 5944 |
| 425 | Ga0207648_10000010 | 3300026089 | Bacteria | 202461 |
| 426 | Ga0207648_10005675 | 3300026089 | Bacteria | 12524 |
| 427 | Ga0207648_10012817 | 3300026089 | Bacteria | 7832 |
| 428 | Ga0207676_10008097 | 3300026095 | Bacteria | 7469 |
| 429 | Ga0207674_10000528 | 3300026116 | Bacteria | 50247 |
| 430 | Ga0207674_10023628 | 3300026116 | Bacteria | 6581 |
| 431 | Ga0207674_10028280 | 3300026116 | Bacteria | 5918 |
| 432 | Ga0207674_10063525 | 3300026116 | Bacteria | 3727 |
| 433 | Ga0207675_100000030 | 3300026118 | Bacteria | 109178 |
| 434 | Ga0207675_100033324 | 3300026118 | Bacteria | 4800 |
| 435 | Ga0207698_10009309 | 3300026142 | Bacteria | 6255 |
| 436 | Ga0207698_10015879 | 3300026142 | Bacteria | 5060 |
| 437 | Ga0207698_10020236 | 3300026142 | Bacteria | 4576 |
| 438 | Ga0207698_10051996 | 3300026142 | Bacteria | 3136 |
| 439 | Ga0207698_10053717 | 3300026142 | Bacteria | 3095 |
| 440 | Ga0207698_10141636 | 3300026142 | Bacteria | 2073 |
| 441 | Ga0207698_10166252 | 3300026142 | Bacteria | 1936 |
| 442 | Ga0209968_1002434 | 3300027526 | Bacteria | 2810 |
| 443 | Ga0209998_10004984 | 3300027717 | Bacteria | 2791 |
| 444 | Ga0268265_10001535 | 3300028380 | Bacteria | 19204 |
| 445 | Ga0268265_10015921 | 3300028380 | Bacteria | 5157 |
| 446 | Ga0268264_10003591 | 3300028381 | Bacteria | 13351 |
| 447 | Ga0265332_10012632 | 3300031238 | Bacteria | 3744 |
| 448 | Ga0265327_10003773 | 3300031251 | Bacteria | 14057 |
| 449 | Ga0265316_10006843 | 3300031344 | Bacteria | 10824 |
| 450 | Ga0265316_10098584 | 3300031344 | Bacteria | 2224 |
| 451 | Ga0307408_100000629 | 3300031548 | Bacteria | 29827 |
| 452 | Ga0307408_100000729 | 3300031548 | Bacteria | 26641 |
| 453 | Ga0307408_100017279 | 3300031548 | Bacteria | 4826 |
| 454 | Ga0307408_100028608 | 3300031548 | Bacteria | 3853 |
| 455 | Ga0307408_100047441 | 3300031548 | Bacteria | 3077 |
| 456 | Ga0316579_10004878 | 3300031691 | Bacteria | 5366 |
| 457 | Ga0316579_10019736 | 3300031691 | Bacteria | 2982 |
| 458 | Ga0316576_10009153 | 3300031727 | Bacteria | 6380 |
| 459 | Ga0316576_10054774 | 3300031727 | Bacteria | 2909 |
| 460 | Ga0316576_10055572 | 3300031727 | Bacteria | 2890 |
| 461 | Ga0316576_10089054 | 3300031727 | Bacteria | 2298 |
| 462 | Ga0316578_10029457 | 3300031728 | Bacteria | 3116 |
| 463 | Ga0316578_10046552 | 3300031728 | Bacteria | 2528 |
| 464 | Ga0307405_10000745 | 3300031731 | Bacteria | 12673 |
| 465 | Ga0307405_10006048 | 3300031731 | Bacteria | 5918 |
| 466 | Ga0307405_10064648 | 3300031731 | Bacteria | 2326 |
| 467 | Ga0307405_10064762 | 3300031731 | Bacteria | 2324 |
| 468 | Ga0316577_10033763 | 3300031733 | Bacteria | 2859 |
| 469 | Ga0316577_10034188 | 3300031733 | Bacteria | 2841 |
| 470 | Ga0316577_10046400 | 3300031733 | Bacteria | 2427 |
| 471 | Ga0307413_10000344 | 3300031824 | Bacteria | 14717 |
| 472 | Ga0307413_10004295 | 3300031824 | Bacteria | 6177 |
| 473 | Ga0307410_10007833 | 3300031852 | Bacteria | 5879 |
| 474 | Ga0307410_10010966 | 3300031852 | Bacteria | 5162 |
| 475 | Ga0307410_10012534 | 3300031852 | Bacteria | 4910 |
| 476 | Ga0307406_10005718 | 3300031901 | Bacteria | 6809 |
| 477 | Ga0307406_10013715 | 3300031901 | Bacteria | 4649 |
| 478 | Ga0307406_10058696 | 3300031901 | Bacteria | 2474 |
| 479 | Ga0307406_10071466 | 3300031901 | Bacteria | 2274 |
| 480 | Ga0307407_10001055 | 3300031903 | Bacteria | 9543 |
| 481 | Ga0307407_10004507 | 3300031903 | Bacteria | 5926 |
| 482 | Ga0307407_10031289 | 3300031903 | Bacteria | 2880 |
| 483 | Ga0307407_10033144 | 3300031903 | Bacteria | 2815 |
| 484 | Ga0307407_10049258 | 3300031903 | Bacteria | 2403 |
| 485 | Ga0307407_10101376 | 3300031903 | Bacteria | 1787 |
| 486 | Ga0307412_10000009 | 3300031911 | Bacteria | 445987 |
| 487 | Ga0307412_10009550 | 3300031911 | Bacteria | 5570 |
| 488 | Ga0307412_10016126 | 3300031911 | Bacteria | 4443 |
| 489 | Ga0307412_10036303 | 3300031911 | Bacteria | 3156 |
| 490 | Ga0307412_10045006 | 3300031911 | Bacteria | 2882 |
| 491 | Ga0307409_100000357 | 3300031995 | Bacteria | 19077 |
| 492 | Ga0307409_100011126 | 3300031995 | Bacteria | 5648 |
| 493 | Ga0307409_100016802 | 3300031995 | Bacteria | 4856 |
| 494 | Ga0307409_100091311 | 3300031995 | Bacteria | 2495 |
| 495 | Ga0307409_100223277 | 3300031995 | Bacteria | 1702 |
| 496 | Ga0307416_100000344 | 3300032002 | Bacteria | 24038 |
| 497 | Ga0307416_100003078 | 3300032002 | Bacteria | 9757 |
| 498 | Ga0307416_100003262 | 3300032002 | Bacteria | 9495 |
| 499 | Ga0307416_100006153 | 3300032002 | Bacteria | 7480 |
| 500 | Ga0307416_100006883 | 3300032002 | Bacteria | 7158 |
| 501 | Ga0307416_100007260 | 3300032002 | Bacteria | 7024 |
| 502 | Ga0307416_100010390 | 3300032002 | Bacteria | 6145 |
| 503 | Ga0307416_100014672 | 3300032002 | Bacteria | 5382 |
| 504 | Ga0307416_100019118 | 3300032002 | Bacteria | 4849 |
| 505 | Ga0307416_100081892 | 3300032002 | Bacteria | 2731 |
| 506 | Ga0307416_100103190 | 3300032002 | Bacteria | 2489 |
| 507 | Ga0307416_100213981 | 3300032002 | Bacteria | 1841 |
| 508 | Ga0307416_100240338 | 3300032002 | Bacteria | 1754 |
| 509 | Ga0307414_10000078 | 3300032004 | Bacteria | 90911 |
| 510 | Ga0307414_10056051 | 3300032004 | Bacteria | 2762 |
| 511 | Ga0307414_10058579 | 3300032004 | Bacteria | 2714 |
| 512 | Ga0307414_10063539 | 3300032004 | Bacteria | 2624 |
| 513 | Ga0307414_10142145 | 3300032004 | Bacteria | 1880 |
| 514 | Ga0307411_10002232 | 3300032005 | Bacteria | 8446 |
| 515 | Ga0307411_10008269 | 3300032005 | Bacteria | 5374 |
| 516 | Ga0307411_10048402 | 3300032005 | Bacteria | 2755 |
| 517 | Ga0307411_10058549 | 3300032005 | Bacteria | 2550 |
| 518 | Ga0307415_100002295 | 3300032126 | Bacteria | 9487 |
| 519 | Ga0307415_100002668 | 3300032126 | Bacteria | 8904 |
| 520 | Ga0307415_100003986 | 3300032126 | Bacteria | 7601 |
| 521 | Ga0307415_100022058 | 3300032126 | Bacteria | 3924 |
| 522 | Ga0307415_100040120 | 3300032126 | Bacteria | 3099 |
| 523 | Ga0307415_100040391 | 3300032126 | Bacteria | 3090 |
| 524 | Ga0307415_100048847 | 3300032126 | Bacteria | 2857 |
| 525 | Ga0307415_100120425 | 3300032126 | Bacteria | 1967 |
| 526 | Ga0316580_10004290 | 3300032139 | Bacteria | 4125 |
| 527 | Ga0373934_0000529 | 3300035086 | Bacteria | 13485 |
| 528 | Ga0373934_0003665 | 3300035086 | Bacteria | 5646 |
| 529 | Ga0373934_0008669 | 3300035086 | Bacteria | 3794 |
| 530 | Ga0373944_0001436 | 3300035089 | Bacteria | 6008 |
| 531 | Ga0373941_0040149 | 3300035115 | Bacteria | 1442 |
| 532 | Ga0373945_0003065 | 3300035116 | Bacteria | 5256 |
| 533 | Ga0373954_0047768 | 3300035118 | Bacteria | 2004 |
| 534 | Ga0373943_0005557 | 3300035170 | Bacteria | 5661 |
| 535 | Ga0373946_0005410 | 3300035171 | Bacteria | 4603 |
| 536 | Ga0373955_0030457 | 3300035172 | Bacteria | 2817 |
| 537 | Ga0316574_0085756 | 3300035398 | Bacteria | 2004 |
| 538 | Ga0373924_0004195 | 3300035410 | Bacteria | 5021 |
| 539 | Ga0373935_0002946 | 3300035692 | Bacteria | 9805 |
| 540 | Ga0373927_0006522 | 3300035695 | Bacteria | 7948 |
| 541 | Ga0373927_0167275 | 3300035695 | Bacteria | 1441 |
| 542 | Ga0373933_0000033 | 3300035724 | Bacteria | 84415 |
| 543 | Ga0373933_0016367 | 3300035724 | Bacteria | 4145 |
| 544 | Ga0373947_0007580 | 3300035725 | Bacteria | 6280 |
| 545 | Ga0373947_0017785 | 3300035725 | Bacteria | 4089 |
| 546 | Ga0373937_0000158 | 3300036401 | Bacteria | 65505 |
| 547 | Ga0373937_0017625 | 3300036401 | Bacteria | 6369 |
| 548 | Ga0373937_0142648 | 3300036401 | Bacteria | 2241 |
| 549 | Ga0316584_0008704 | 3300036712 | Bacteria | 7006 |
| 550 | Ga0316584_0064326 | 3300036712 | Bacteria | 2746 |
| 551 | Ga0373925_0001104 | 3300037068 | Bacteria | 24089 |
| 552 | Ga0395899_0101203 | 3300037312 | Bacteria | 2080 |
| 553 | Ga0395900_0010889 | 3300037418 | Bacteria | 9299 |
| 554 | Ga0395900_0014902 | 3300037418 | Bacteria | 7921 |
| 555 | Ga0395905_0000023 | 3300037471 | Bacteria | 319640 |
| 556 | Ga0395905_0006399 | 3300037471 | Bacteria | 11860 |
| 557 | Ga0395901_0008806 | 3300038443 | Bacteria | 10212 |
| 558 | Ga0436365_0048646 | 3300039437 | Bacteria | 15042 |
| 559 | Ga0436365_0687141 | 3300039437 | Bacteria | 1977 |
| 560 | Ga0436365_0743102 | 3300039437 | Bacteria | 1681 |
| 561 | Ga0451855_1231084 | 3300041511 | Bacteria | 2472 |
| 562 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 563 | Ga0451577_0001689 | 3300042876 | Bacteria | 28478 |
| 564 | Ga0451577_0002841 | 3300042876 | Bacteria | 19923 |
| 565 | Ga0451577_0017019 | 3300042876 | Bacteria | 6723 |
| 566 | Ga0451577_0064730 | 3300042876 | Bacteria | 3260 |
| 567 | Ga0451577_0082408 | 3300042876 | Bacteria | 2869 |
| 568 | Ga0451577_0101001 | 3300042876 | Bacteria | 2577 |
| 569 | Ga0451577_0105694 | 3300042876 | Bacteria | 2516 |
| 570 | Ga0451577_0122443 | 3300042876 | Bacteria | 2330 |
| 571 | Ga0451577_0275736 | 3300042876 | Bacteria | 1523 |
| 572 | Ga0453683_0000072 | 3300044673 | Bacteria | 154688 |
| 573 | Ga0453683_0003129 | 3300044673 | Bacteria | 12359 |
| 574 | Ga0453683_0021427 | 3300044673 | Bacteria | 4127 |
| 575 | Ga0453683_0040223 | 3300044673 | Unclassified | 2936 |
| 576 | Ga0453683_0065200 | 3300044673 | Bacteria | 2277 |
| 577 | Ga0453683_0140678 | 3300044673 | Bacteria | 1523 |
| 578 | Ga0466966_0007566 | 3300044684 | Bacteria | 7197 |
| 579 | Ga0453684_0000091 | 3300044712 | Bacteria | 387720 |
| 580 | Ga0453684_0000330 | 3300044712 | Bacteria | 198124 |
| 581 | Ga0453684_0000792 | 3300044712 | Bacteria | 108377 |
| 582 | Ga0453684_0010910 | 3300044712 | Bacteria | 15374 |
| 583 | Ga0453684_0010913 | 3300044712 | Bacteria | 15372 |
| 584 | Ga0453684_0011356 | 3300044712 | Bacteria | 14962 |
| 585 | Ga0453684_0020471 | 3300044712 | Bacteria | 9974 |
| 586 | Ga0453684_0023474 | 3300044712 | Bacteria | 9077 |
| 587 | Ga0453684_0038874 | 3300044712 | Bacteria | 6493 |
| 588 | Ga0453684_0090744 | 3300044712 | Bacteria | 3774 |
| 589 | Ga0453684_0125513 | 3300044712 | Bacteria | 3090 |
| 590 | Ga0453684_0148230 | 3300044712 | Bacteria | 2792 |
| 591 | Ga0453684_0156818 | 3300044712 | Bacteria | 2698 |
| 592 | Ga0453684_0203347 | 3300044712 | Bacteria | 2307 |
| 593 | Ga0466959_0016100 | 3300045049 | Bacteria | 5457 |
| 594 | Ga0451576_0000280 | 3300045051 | Bacteria | 124909 |
| 595 | Ga0451576_0003878 | 3300045051 | Bacteria | 20025 |
| 596 | Ga0451576_0004992 | 3300045051 | Bacteria | 16884 |
| 597 | Ga0451576_0028814 | 3300045051 | Bacteria | 5946 |
| 598 | Ga0451576_0031139 | 3300045051 | Bacteria | 5690 |
| 599 | Ga0451576_0036406 | 3300045051 | Bacteria | 5217 |
| 600 | Ga0451576_0085109 | 3300045051 | Bacteria | 3289 |
| 601 | Ga0451576_0097164 | 3300045051 | Bacteria | 3063 |
| 602 | Ga0495603_0014410 | 3300046455 | Bacteria | 4783 |
| 603 | Ga0495629_0007207 | 3300046459 | Bacteria | 8189 |
| 604 | Ga0495629_0102417 | 3300046459 | Bacteria | 1997 |
| 605 | Ga0495638_0073531 | 3300046460 | Bacteria | 2086 |
| 606 | Ga0495651_0000572 | 3300046462 | Bacteria | 28583 |
| 607 | Ga0495651_0011099 | 3300046462 | Bacteria | 6928 |
| 608 | Ga0495651_0046841 | 3300046462 | Bacteria | 3346 |
| 609 | Ga0495653_0000173 | 3300046463 | Bacteria | 53365 |
| 610 | Ga0495580_0007212 | 3300046472 | Bacteria | 8943 |
| 611 | Ga0495580_0019243 | 3300046472 | Bacteria | 5073 |
| 612 | Ga0495580_0078402 | 3300046472 | Bacteria | 2304 |
| 613 | Ga0495582_0003154 | 3300046473 | Bacteria | 9254 |
| 614 | Ga0495582_0009665 | 3300046473 | Bacteria | 5311 |
| 615 | Ga0495639_0000744 | 3300046475 | Bacteria | 14908 |
| 616 | Ga0495639_0017510 | 3300046475 | Bacteria | 3113 |
| 617 | Ga0495664_0005674 | 3300046477 | Bacteria | 6867 |
| 618 | Ga0495594_0008848 | 3300046499 | Bacteria | 5191 |
| 619 | Ga0495594_0015731 | 3300046499 | Bacteria | 3978 |
| 620 | Ga0495594_0042180 | 3300046499 | Bacteria | 2499 |
| 621 | Ga0495608_0000418 | 3300046511 | Bacteria | 29615 |
| 622 | Ga0495628_0000467 | 3300046516 | Bacteria | 37087 |
| 623 | Ga0495628_0022744 | 3300046516 | Bacteria | 5148 |
| 624 | Ga0495628_0040012 | 3300046516 | Bacteria | 3748 |
| 625 | Ga0495652_0000658 | 3300046529 | Bacteria | 40060 |
| 626 | Ga0495652_0006330 | 3300046529 | Bacteria | 11027 |
| 627 | Ga0495665_0001000 | 3300046531 | Bacteria | 15013 |
| 628 | Ga0495640_0027288 | 3300046533 | Bacteria | 4119 |
| 629 | Ga0495586_0021334 | 3300046535 | Bacteria | 3451 |
| 630 | Ga0495587_0000247 | 3300046536 | Bacteria | 39646 |
| 631 | Ga0495587_0000661 | 3300046536 | Bacteria | 23100 |
| 632 | Ga0495587_0007799 | 3300046536 | Bacteria | 6915 |
| 633 | Ga0495587_0043772 | 3300046536 | Bacteria | 2665 |
| 634 | Ga0495645_0000210 | 3300046543 | Bacteria | 41882 |
| 635 | Ga0495645_0002859 | 3300046543 | Bacteria | 11715 |
| 636 | Ga0495645_0007825 | 3300046543 | Bacteria | 7437 |
| 637 | Ga0495667_0004689 | 3300046559 | Bacteria | 9242 |
| 638 | Ga0495667_0005920 | 3300046559 | Bacteria | 8276 |
| 639 | Ga0495667_0015531 | 3300046559 | Bacteria | 5147 |
| 640 | Ga0495667_0027601 | 3300046559 | Bacteria | 3823 |
| 641 | Ga0495635_0000157 | 3300046663 | Bacteria | 41636 |
| 642 | Ga0495588_0002120 | 3300046674 | Bacteria | 8511 |
| 643 | Ga0495657_0001969 | 3300046675 | Bacteria | 17508 |
| 644 | Ga0495599_0000065 | 3300046678 | Bacteria | 72906 |
| 645 | Ga0495599_0005612 | 3300046678 | Bacteria | 7525 |
| 646 | Ga0495623_0000014 | 3300046679 | Bacteria | 119814 |
| 647 | Ga0495623_0042696 | 3300046679 | Bacteria | 2888 |
| 648 | Ga0495623_0045531 | 3300046679 | Bacteria | 2786 |
| 649 | Ga0495646_0000129 | 3300046680 | Bacteria | 38041 |
| 650 | Ga0495658_0001890 | 3300046683 | Bacteria | 10699 |
| 651 | Ga0495613_0005422 | 3300046689 | Bacteria | 9584 |
| 652 | Ga0495613_0059959 | 3300046689 | Bacteria | 2788 |
| 653 | Ga0495600_0000105 | 3300046809 | Bacteria | 46401 |
| 654 | Ga0495581_0001999 | 3300047315 | Bacteria | 11446 |
| 655 | Ga0495581_0021028 | 3300047315 | Bacteria | 3785 |
| 656 | Ga0495604_0000359 | 3300047317 | Bacteria | 40820 |
| 657 | Ga0495604_0070638 | 3300047317 | Bacteria | 2643 |
| 658 | Ga0495674_0000362 | 3300047319 | Bacteria | 40383 |
| 659 | Ga0495674_0131027 | 3300047319 | Bacteria | 2112 |
| 660 | Ga0495674_0181705 | 3300047319 | Bacteria | 1751 |
| 661 | Ga0495672_0008695 | 3300047320 | Bacteria | 7451 |
| 662 | Ga0495680_0001244 | 3300047322 | Bacteria | 27949 |
| 663 | Ga0495680_0049696 | 3300047322 | Bacteria | 3283 |
| 664 | Ga0495675_0005375 | 3300047444 | Bacteria | 7806 |
| 665 | Ga0495675_0027318 | 3300047444 | Bacteria | 3636 |
| 666 | Ga0495684_0000288 | 3300047471 | Bacteria | 40827 |
| 667 | Ga0495684_0008178 | 3300047471 | Bacteria | 8094 |
| 668 | Ga0495684_0014722 | 3300047471 | Bacteria | 6021 |
| 669 | Ga0495684_0025843 | 3300047471 | Bacteria | 4512 |
| 670 | Ga0495593_0000112 | 3300047673 | Bacteria | 38250 |
| 671 | Ga0495602_0030788 | 3300048088 | Bacteria | 5085 |
| 672 | Ga0495602_0039271 | 3300048088 | Bacteria | 4362 |
| 673 | Ga0495602_0100569 | 3300048088 | Bacteria | 2374 |
| 674 | Ga0495602_0127718 | 3300048088 | Bacteria | 2033 |
| 675 | Ga0495614_0000021 | 3300048089 | Bacteria | 45062 |
| 676 | Ga0496101_0112044 | 3300048904 | Bacteria | 2055 |
| 677 | Ga0496104_0077132 | 3300048907 | Bacteria | 3175 |
| 678 | Ga0496108_0037075 | 3300048911 | Bacteria | 4060 |
| 679 | Ga0496112_0014418 | 3300048915 | Bacteria | 7331 |
| 680 | Ga0496112_0255399 | 3300048915 | Bacteria | 1703 |
| 681 | Ga0496113_0031174 | 3300048916 | Bacteria | 3867 |
| 682 | Ga0496114_0273660 | 3300048917 | Bacteria | 1488 |
| 683 | Ga0496122_0001073 | 3300048925 | Bacteria | 47498 |
| 684 | Ga0496123_0008196 | 3300048926 | Bacteria | 9636 |
| 685 | Ga0501031_0039396 | 3300049568 | Bacteria | 3083 |
| 686 | Ga0501033_0005356 | 3300049570 | Bacteria | 10166 |
| 687 | Ga0501033_0008106 | 3300049570 | Bacteria | 8140 |
| 688 | Ga0501034_0126368 | 3300049571 | Bacteria | 2542 |
| 689 | Ga0501038_0038193 | 3300049574 | Bacteria | 4206 |
| 690 | Ga0501039_0138424 | 3300049575 | Bacteria | 1912 |
| 691 | Ga0501042_0102925 | 3300049578 | Bacteria | 2054 |
| 692 | Ga0501046_0107457 | 3300049580 | Bacteria | 2135 |
| 693 | Ga0501047_0036917 | 3300049581 | Bacteria | 4723 |
| 694 | Ga0501047_0053591 | 3300049581 | Bacteria | 3901 |
| 695 | Ga0501048_0013752 | 3300049582 | Bacteria | 6004 |
| 696 | Ga0501068_0139121 | 3300049584 | Bacteria | 1521 |
| 697 | Ga0501070_0030086 | 3300049586 | Bacteria | 4549 |
| 698 | Ga0501070_0038186 | 3300049586 | Bacteria | 4007 |
| 699 | Ga0501074_0082164 | 3300049590 | Bacteria | 2311 |
| 700 | Ga0501074_0134044 | 3300049590 | Bacteria | 1772 |
| 701 | Ga0501075_0017633 | 3300049591 | Bacteria | 5156 |
| 702 | Ga0501076_0024265 | 3300049592 | Bacteria | 4685 |
| 703 | Ga0501077_0000408 | 3300049593 | Bacteria | 25947 |
| 704 | Ga0501079_0022318 | 3300049741 | Bacteria | 4853 |
| 705 | Ga0501080_0021290 | 3300049742 | Bacteria | 6002 |
| 706 | Ga0501080_0101363 | 3300049742 | Bacteria | 2671 |
| 707 | Ga0501080_0213659 | 3300049742 | Bacteria | 1767 |
| 708 | Ga0501081_0093226 | 3300049743 | Bacteria | 2120 |
| 709 | Ga0501083_0058981 | 3300049744 | Bacteria | 2568 |
| 710 | Ga0501270_004785 | 3300049767 | Bacteria | 1538 |
| 711 | Ga0501035_0157030 | 3300049822 | Bacteria | 1971 |
| 712 | Ga0501044_0007739 | 3300049823 | Bacteria | 11813 |
| 713 | Ga0501044_0088571 | 3300049823 | Bacteria | 3124 |
| 714 | Ga0501044_0217815 | 3300049823 | Bacteria | 1861 |
| 715 | nmdc:mga05p37_111337_c1 | 3300050507 | Bacteria | 3367 |
| 716 | nmdc:mga09592_24195_c1 | 3300050508 | Bacteria | 5021 |
| 717 | nmdc:mga09592_39448_c1 | 3300050508 | Bacteria | 3967 |
| 718 | nmdc:mga0qj67_5807_c1 | 3300050509 | Bacteria | 9032 |
| 719 | nmdc:mga0qj67_67633_c1 | 3300050509 | Bacteria | 2846 |
| 720 | nmdc:mga0qj67_91425_c1 | 3300050509 | Bacteria | 2446 |
| 721 | nmdc:mga06r32_35746_c1 | 3300050510 | Bacteria | 4688 |
| 722 | nmdc:mga06r32_39521_c1 | 3300050510 | Bacteria | 4477 |
| 723 | nmdc:mga06r32_49502_c1 | 3300050510 | Bacteria | 4018 |
| 724 | nmdc:mga06r32_9509_c1 | 3300050510 | Bacteria | 8777 |
| 725 | nmdc:mga08y16_80141_c1 | 3300050511 | Bacteria | 3404 |
| 726 | nmdc:mga0n895_180010_c1 | 3300050512 | Bacteria | 2145 |
| 727 | nmdc:mga0n895_188459_c1 | 3300050512 | Bacteria | 2094 |
| 728 | nmdc:mga08x19_1893_c1 | 3300050514 | Bacteria | 12819 |
| 729 | nmdc:mga0a205_13885_c1 | 3300050515 | Bacteria | 7509 |
| 730 | Ga0495601_0018561 | 3300053077 | Bacteria | 4235 |
| 731 | Ga0495601_0062695 | 3300053077 | Bacteria | 2362 |
| 732 | Ga0495612_0000144 | 3300053078 | Bacteria | 30143 |
| 733 | Ga0500635_0014106 | 3300053080 | Bacteria | 2334 |
| 734 | Ga0495595_0030712 | 3300053084 | Bacteria | 2411 |
| 735 | Ga0495595_0032185 | 3300053084 | Bacteria | 2361 |
| 736 | Ga0500651_0000139 | 3300053093 | Bacteria | 45700 |
| 737 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 738 | Ga0500622_0007717 | 3300053156 | Bacteria | 6077 |
| 739 | Ga0501082_0054647 | 3300060353 | Bacteria | 3442 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0064326 | Ga0316584_0064326_1449_2726 | 409 |
| 2 | 3300046536 | Ga0495587_0000247 | Ga0495587_0000247_22200_23510 | 416 |
| 3 | 3300035089 | Ga0373944_0001436 | Ga0373944_0001436_4654_5964 | 417 |
| 4 | 3300035116 | Ga0373945_0003065 | Ga0373945_0003065_3845_5155 | 417 |
| 5 | 3300035170 | Ga0373943_0005557 | Ga0373943_0005557_3872_5182 | 417 |
| 6 | 3300035171 | Ga0373946_0005410 | Ga0373946_0005410_104_1414 | 417 |
| 7 | 3300035692 | Ga0373935_0002946 | Ga0373935_0002946_7487_8797 | 417 |
| 8 | 3300035695 | Ga0373927_0006522 | Ga0373927_0006522_3682_4992 | 417 |
| 9 | 3300035725 | Ga0373947_0007580 | Ga0373947_0007580_2451_3761 | 417 |
| 10 | 3300037068 | Ga0373925_0001104 | Ga0373925_0001104_12466_13776 | 417 |
| 11 | 3300046455 | Ga0495603_0014410 | Ga0495603_0014410_313_1623 | 417 |
| 12 | 3300046459 | Ga0495629_0102417 | Ga0495629_0102417_42_1352 | 417 |
| 13 | 3300046472 | Ga0495580_0019243 | Ga0495580_0019243_665_1975 | 417 |
| 14 | 3300046473 | Ga0495582_0003154 | Ga0495582_0003154_2451_3761 | 417 |
| 15 | 3300046475 | Ga0495639_0000744 | Ga0495639_0000744_8215_9525 | 417 |
| 16 | 3300046531 | Ga0495665_0001000 | Ga0495665_0001000_6831_8141 | 417 |
| 17 | 3300046674 | Ga0495588_0002120 | Ga0495588_0002120_2372_3682 | 417 |
| 18 | 3300046683 | Ga0495658_0001890 | Ga0495658_0001890_3388_4698 | 417 |
| 19 | 3300046689 | Ga0495613_0005422 | Ga0495613_0005422_875_2185 | 417 |
| 20 | 3300047315 | Ga0495581_0001999 | Ga0495581_0001999_314_1624 | 417 |
| 21 | 3300047673 | Ga0495593_0000112 | Ga0495593_0000112_12570_13880 | 417 |
| 22 | 3300048089 | Ga0495614_0000021 | Ga0495614_0000021_33189_34499 | 417 |
| 23 | 3300035115 | Ga0373941_0040149 | Ga0373941_0040149_33_1340 | 418 |
| 24 | 3300046559 | Ga0495667_0015531 | Ga0495667_0015531_3089_4396 | 418 |
| 25 | 3300005336 | Ga0070680_100008998 | Ga0070680_1000089982 | 419 |
| 26 | 3300005458 | Ga0070681_10003552 | Ga0070681_100035528 | 419 |
| 27 | 3300005530 | Ga0070679_100001192 | Ga0070679_10000119213 | 419 |
| 28 | 3300009176 | Ga0105242_10003851 | Ga0105242_100038519 | 419 |
| 29 | 3300009177 | Ga0105248_10034311 | Ga0105248_100343112 | 419 |
| 30 | 3300025912 | Ga0207707_10036704 | Ga0207707_100367042 | 419 |
| 31 | 3300025917 | Ga0207660_10022179 | Ga0207660_100221794 | 419 |
| 32 | 3300025921 | Ga0207652_10000636 | Ga0207652_1000063623 | 419 |
| 33 | 3300048088 | Ga0495602_0127718 | Ga0495602_0127718_23_1333 | 419 |
| 34 | 3300042876 | Ga0451577_0275736 | Ga0451577_0275736_182_1507 | 420 |
| 35 | 3300047319 | Ga0495674_0181705 | Ga0495674_0181705_12_1385 | 432 |
| 36 | 3300013307 | Ga0157372_10000462 | Ga0157372_1000046217 | 433 |
| 37 | 3300005445 | Ga0070708_100000045 | Ga0070708_10000004556 | 437 |
| 38 | 3300047319 | Ga0495674_0131027 | Ga0495674_0131027_37_1404 | 437 |
| 39 | 3300005445 | Ga0070708_100000788 | Ga0070708_1000007887 | 438 |
| 40 | 3300005468 | Ga0070707_100000955 | Ga0070707_10000095527 | 438 |
| 41 | 3300005518 | Ga0070699_100216923 | Ga0070699_1002169231 | 438 |
| 42 | 3300025922 | Ga0207646_10001505 | Ga0207646_1000150510 | 438 |
| 43 | 3300031903 | Ga0307407_10049258 | Ga0307407_100492581 | 439 |
| 44 | 3300032002 | Ga0307416_100019118 | Ga0307416_1000191182 | 439 |
| 45 | 3300032005 | Ga0307411_10048402 | Ga0307411_100484022 | 439 |
| 46 | 3300032126 | Ga0307415_100040120 | Ga0307415_1000401203 | 439 |
| 47 | 3300044673 | Ga0453683_0065200 | Ga0453683_0065200_159_1616 | 439 |
| 48 | 3300009098 | Ga0105245_10004656 | Ga0105245_100046566 | 440 |
| 49 | 3300013100 | Ga0157373_10009825 | Ga0157373_100098256 | 440 |
| 50 | 3300013307 | Ga0157372_10296199 | Ga0157372_102961991 | 440 |
| 51 | 3300025920 | Ga0207649_10000977 | Ga0207649_100009776 | 440 |
| 52 | 3300035086 | Ga0373934_0008669 | Ga0373934_0008669_1268_2641 | 440 |
| 53 | 3300035172 | Ga0373955_0030457 | Ga0373955_0030457_1264_2637 | 440 |
| 54 | 3300046472 | Ga0495580_0078402 | Ga0495580_0078402_159_1532 | 440 |
| 55 | 3300046536 | Ga0495587_0007799 | Ga0495587_0007799_1018_2391 | 440 |
| 56 | 3300046543 | Ga0495645_0002859 | Ga0495645_0002859_5630_7003 | 440 |
| 57 | 3300046559 | Ga0495667_0004689 | Ga0495667_0004689_1929_3302 | 440 |
| 58 | 3300046679 | Ga0495623_0045531 | Ga0495623_0045531_776_2149 | 440 |
| 59 | 3300047444 | Ga0495675_0005375 | Ga0495675_0005375_2231_3604 | 440 |
| 60 | 3300048917 | Ga0496114_0273660 | Ga0496114_0273660_84_1457 | 440 |
| 61 | 3300053084 | Ga0495595_0032185 | Ga0495595_0032185_154_1527 | 440 |
| 62 | 3300031727 | Ga0316576_10089054 | Ga0316576_100890542 | 441 |
| 63 | 3300005577 | Ga0068857_100066504 | Ga0068857_1000665044 | 443 |
| 64 | 3300005329 | Ga0070683_100003778 | Ga0070683_10000377811 | 444 |
| 65 | 3300005457 | Ga0070662_100107955 | Ga0070662_1001079552 | 444 |
| 66 | 3300005458 | Ga0070681_10110061 | Ga0070681_101100611 | 444 |
| 67 | 3300005535 | Ga0070684_100000255 | Ga0070684_1000002552 | 444 |
| 68 | 3300005564 | Ga0070664_100003696 | Ga0070664_1000036967 | 444 |
| 69 | 3300005577 | Ga0068857_100006087 | Ga0068857_1000060873 | 444 |
| 70 | 3300025912 | Ga0207707_10069146 | Ga0207707_100691462 | 444 |
| 71 | 3300025921 | Ga0207652_10104959 | Ga0207652_101049591 | 444 |
| 72 | 3300025944 | Ga0207661_10004037 | Ga0207661_100040373 | 444 |
| 73 | 3300053125 | Ga0500618_000004 | Ga0500618_000004_181297_182769 | 444 |
| 74 | 3300005458 | Ga0070681_10027309 | Ga0070681_100273093 | 445 |
| 75 | 3300005547 | Ga0070693_100007872 | Ga0070693_1000078723 | 445 |
| 76 | 3300042876 | Ga0451577_0017019 | Ga0451577_0017019_4265_5722 | 445 |
| 77 | 3300049767 | Ga0501270_004785 | Ga0501270_004785_138_1526 | 445 |
| 78 | 3300035695 | Ga0373927_0167275 | Ga0373927_0167275_25_1419 | 446 |
| 79 | 3300005545 | Ga0070695_100064466 | Ga0070695_1000644661 | 447 |
| 80 | 3300025906 | Ga0207699_10105072 | Ga0207699_101050721 | 447 |
| 81 | 3300005842 | Ga0068858_100005316 | Ga0068858_1000053166 | 448 |
| 82 | 3300026035 | Ga0207703_10003749 | Ga0207703_100037496 | 448 |
| 83 | 3300027717 | Ga0209998_10004984 | Ga0209998_100049842 | 448 |
| 84 | 3300005468 | Ga0070707_100019620 | Ga0070707_1000196206 | 451 |
| 85 | 3300025922 | Ga0207646_10014532 | Ga0207646_100145326 | 451 |
| 86 | 3300031548 | Ga0307408_100047441 | Ga0307408_1000474412 | 451 |
| 87 | 3300005338 | Ga0068868_100076407 | Ga0068868_1000764072 | 452 |
| 88 | 3300049592 | Ga0501076_0024265 | Ga0501076_0024265_389_1846 | 452 |
| 89 | 3300049593 | Ga0501077_0000408 | Ga0501077_0000408_1725_3182 | 452 |
| 90 | 3300049741 | Ga0501079_0022318 | Ga0501079_0022318_580_2037 | 452 |
| 91 | 3300060353 | Ga0501082_0054647 | Ga0501082_0054647_569_2026 | 452 |
| 92 | 3300005336 | Ga0070680_100013243 | Ga0070680_1000132432 | 453 |
| 93 | 3300005458 | Ga0070681_10000473 | Ga0070681_1000047335 | 453 |
| 94 | 3300025899 | Ga0207642_10049506 | Ga0207642_100495062 | 453 |
| 95 | 3300025917 | Ga0207660_10011400 | Ga0207660_100114002 | 453 |
| 96 | 3300049742 | Ga0501080_0021290 | Ga0501080_0021290_3714_5177 | 454 |
| 97 | 3300005337 | Ga0070682_100009731 | Ga0070682_1000097312 | 455 |
| 98 | 3300005545 | Ga0070695_100028288 | Ga0070695_1000282882 | 455 |
| 99 | 3300005563 | Ga0068855_100003992 | Ga0068855_10000399220 | 455 |
| 100 | 3300009093 | Ga0105240_10129986 | Ga0105240_101299862 | 455 |
| 101 | 3300013307 | Ga0157372_10059189 | Ga0157372_100591891 | 455 |
| 102 | 3300027526 | Ga0209968_1002434 | Ga0209968_10024342 | 455 |
| 103 | 3300031728 | Ga0316578_10029457 | Ga0316578_100294572 | 455 |
| 104 | 3300045051 | Ga0451576_0004992 | Ga0451576_0004992_15061_16536 | 455 |
| 105 | 3300049584 | Ga0501068_0139121 | Ga0501068_0139121_16_1473 | 456 |
| 106 | 3300005328 | Ga0070676_10011173 | Ga0070676_100111732 | 457 |
| 107 | 3300025907 | Ga0207645_10014184 | Ga0207645_100141842 | 457 |
| 108 | 3300005467 | Ga0070706_100006172 | Ga0070706_1000061725 | 458 |
| 109 | 3300005471 | Ga0070698_100030948 | Ga0070698_1000309483 | 458 |
| 110 | 3300025910 | Ga0207684_10016420 | Ga0207684_100164205 | 458 |
| 111 | 3300005985 | Ga0081539_10000174 | Ga0081539_10000174106 | 459 |
| 112 | 3300006846 | Ga0075430_100007578 | Ga0075430_1000075782 | 459 |
| 113 | 3300009094 | Ga0111539_10241863 | Ga0111539_102418631 | 459 |
| 114 | 3300014326 | Ga0157380_10052386 | Ga0157380_100523861 | 459 |
| 115 | 3300025944 | Ga0207661_10052768 | Ga0207661_100527682 | 459 |
| 116 | 3300039437 | Ga0436365_0048646 | Ga0436365_0048646_4092_5528 | 459 |
| 117 | 3300047320 | Ga0495672_0008695 | Ga0495672_0008695_878_2314 | 459 |
| 118 | 3300050508 | nmdc:mga09592_39448_c1 | nmdc:mga09592_39448_c1_162_1619 | 459 |
| 119 | 3300005337 | Ga0070682_100036763 | Ga0070682_1000367632 | 460 |
| 120 | 3300005530 | Ga0070679_100016156 | Ga0070679_1000161566 | 460 |
| 121 | 3300009093 | Ga0105240_10122645 | Ga0105240_101226452 | 460 |
| 122 | 3300009098 | Ga0105245_10028512 | Ga0105245_100285122 | 460 |
| 123 | 3300009545 | Ga0105237_10002557 | Ga0105237_100025573 | 460 |
| 124 | 3300013296 | Ga0157374_10056699 | Ga0157374_100566992 | 460 |
| 125 | 3300025912 | Ga0207707_10016185 | Ga0207707_100161856 | 460 |
| 126 | 3300025913 | Ga0207695_10000228 | Ga0207695_100002282 | 460 |
| 127 | 3300025921 | Ga0207652_10042995 | Ga0207652_100429952 | 460 |
| 128 | 3300031731 | Ga0307405_10064762 | Ga0307405_100647621 | 460 |
| 129 | 3300031903 | Ga0307407_10001055 | Ga0307407_100010553 | 460 |
| 130 | 3300032002 | Ga0307416_100006153 | Ga0307416_1000061534 | 460 |
| 131 | 3300032002 | Ga0307416_100006883 | Ga0307416_1000068833 | 460 |
| 132 | 3300032005 | Ga0307411_10008269 | Ga0307411_100082693 | 460 |
| 133 | 3300032005 | Ga0307411_10058549 | Ga0307411_100585492 | 460 |
| 134 | 3300032126 | Ga0307415_100022058 | Ga0307415_1000220581 | 460 |
| 135 | 3300046462 | Ga0495651_0011099 | Ga0495651_0011099_1209_2756 | 460 |
| 136 | 3300046516 | Ga0495628_0040012 | Ga0495628_0040012_1306_2853 | 460 |
| 137 | 3300046533 | Ga0495640_0027288 | Ga0495640_0027288_569_2116 | 460 |
| 138 | 3300047322 | Ga0495680_0049696 | Ga0495680_0049696_1638_3092 | 460 |
| 139 | 3300047471 | Ga0495684_0014722 | Ga0495684_0014722_876_2330 | 460 |
| 140 | 3300005356 | Ga0070674_100048685 | Ga0070674_1000486852 | 462 |
| 141 | 3300005435 | Ga0070714_100009543 | Ga0070714_1000095432 | 462 |
| 142 | 3300005547 | Ga0070693_100011143 | Ga0070693_1000111433 | 462 |
| 143 | 3300006028 | Ga0070717_10007977 | Ga0070717_100079775 | 462 |
| 144 | 3300006175 | Ga0070712_100001803 | Ga0070712_10000180312 | 462 |
| 145 | 3300006881 | Ga0068865_100004459 | Ga0068865_1000044596 | 462 |
| 146 | 3300013307 | Ga0157372_10004316 | Ga0157372_100043164 | 462 |
| 147 | 3300025906 | Ga0207699_10008236 | Ga0207699_100082364 | 462 |
| 148 | 3300025918 | Ga0207662_10053993 | Ga0207662_100539932 | 462 |
| 149 | 3300025928 | Ga0207700_10002118 | Ga0207700_100021185 | 462 |
| 150 | 3300025929 | Ga0207664_10009782 | Ga0207664_100097822 | 462 |
| 151 | 3300025933 | Ga0207706_10002211 | Ga0207706_1000221114 | 462 |
| 152 | 3300026075 | Ga0207708_10006826 | Ga0207708_100068268 | 462 |
| 153 | 3300032139 | Ga0316580_10004290 | Ga0316580_100042903 | 462 |
| 154 | 3300046472 | Ga0495580_0007212 | Ga0495580_0007212_1884_3332 | 462 |
| 155 | 3300046475 | Ga0495639_0017510 | Ga0495639_0017510_491_1939 | 462 |
| 156 | 3300046499 | Ga0495594_0008848 | Ga0495594_0008848_1806_3254 | 462 |
| 157 | 3300047471 | Ga0495684_0025843 | Ga0495684_0025843_829_2277 | 462 |
| 158 | 3300005457 | Ga0070662_100001083 | Ga0070662_10000108317 | 463 |
| 159 | 3300005530 | Ga0070679_100037856 | Ga0070679_1000378564 | 463 |
| 160 | 3300005539 | Ga0068853_100005516 | Ga0068853_1000055164 | 463 |
| 161 | 3300005563 | Ga0068855_100022823 | Ga0068855_1000228231 | 463 |
| 162 | 3300006847 | Ga0075431_100001735 | Ga0075431_10000173515 | 463 |
| 163 | 3300006914 | Ga0075436_100001419 | Ga0075436_1000014198 | 463 |
| 164 | 3300009093 | Ga0105240_10031972 | Ga0105240_100319721 | 463 |
| 165 | 3300009094 | Ga0111539_10048865 | Ga0111539_100488651 | 463 |
| 166 | 3300009553 | Ga0105249_10000061 | Ga0105249_1000006116 | 463 |
| 167 | 3300009553 | Ga0105249_10027811 | Ga0105249_100278112 | 463 |
| 168 | 3300013100 | Ga0157373_10072212 | Ga0157373_100722122 | 463 |
| 169 | 3300013104 | Ga0157370_10021084 | Ga0157370_100210842 | 463 |
| 170 | 3300013308 | Ga0157375_10013585 | Ga0157375_100135853 | 463 |
| 171 | 3300014325 | Ga0163163_10072742 | Ga0163163_100727424 | 463 |
| 172 | 3300014497 | Ga0182008_10005125 | Ga0182008_100051253 | 463 |
| 173 | 3300020082 | Ga0206353_10072611 | Ga0206353_100726112 | 463 |
| 174 | 3300021384 | Ga0213876_10082548 | Ga0213876_100825482 | 463 |
| 175 | 3300025912 | Ga0207707_10005244 | Ga0207707_100052441 | 463 |
| 176 | 3300025913 | Ga0207695_10002260 | Ga0207695_1000226022 | 463 |
| 177 | 3300025913 | Ga0207695_10025474 | Ga0207695_100254744 | 463 |
| 178 | 3300025913 | Ga0207695_10046486 | Ga0207695_100464865 | 463 |
| 179 | 3300025917 | Ga0207660_10084435 | Ga0207660_100844352 | 463 |
| 180 | 3300025921 | Ga0207652_10055836 | Ga0207652_100558361 | 463 |
| 181 | 3300025961 | Ga0207712_10000144 | Ga0207712_1000014470 | 463 |
| 182 | 3300026041 | Ga0207639_10007445 | Ga0207639_100074453 | 463 |
| 183 | 3300026041 | Ga0207639_10082849 | Ga0207639_100828492 | 463 |
| 184 | 3300026067 | Ga0207678_10078502 | Ga0207678_100785023 | 463 |
| 185 | 3300026078 | Ga0207702_10159909 | Ga0207702_101599091 | 463 |
| 186 | 3300026142 | Ga0207698_10020236 | Ga0207698_100202361 | 463 |
| 187 | 3300026142 | Ga0207698_10166252 | Ga0207698_101662521 | 463 |
| 188 | 3300031691 | Ga0316579_10019736 | Ga0316579_100197362 | 463 |
| 189 | 3300031733 | Ga0316577_10033763 | Ga0316577_100337633 | 463 |
| 190 | 3300032126 | Ga0307415_100120425 | Ga0307415_1001204252 | 463 |
| 191 | 3300035086 | Ga0373934_0003665 | Ga0373934_0003665_3901_5349 | 463 |
| 192 | 3300035724 | Ga0373933_0016367 | Ga0373933_0016367_438_1886 | 463 |
| 193 | 3300036401 | Ga0373937_0142648 | Ga0373937_0142648_96_1544 | 463 |
| 194 | 3300039437 | Ga0436365_0687141 | Ga0436365_0687141_135_1583 | 463 |
| 195 | 3300039437 | Ga0436365_0743102 | Ga0436365_0743102_114_1562 | 463 |
| 196 | 3300046459 | Ga0495629_0007207 | Ga0495629_0007207_1154_2602 | 463 |
| 197 | 3300046462 | Ga0495651_0046841 | Ga0495651_0046841_888_2336 | 463 |
| 198 | 3300046473 | Ga0495582_0009665 | Ga0495582_0009665_272_1720 | 463 |
| 199 | 3300046477 | Ga0495664_0005674 | Ga0495664_0005674_4172_5620 | 463 |
| 200 | 3300046499 | Ga0495594_0015731 | Ga0495594_0015731_2305_3753 | 463 |
| 201 | 3300046516 | Ga0495628_0022744 | Ga0495628_0022744_3163_4611 | 463 |
| 202 | 3300046529 | Ga0495652_0006330 | Ga0495652_0006330_4435_5883 | 463 |
| 203 | 3300046536 | Ga0495587_0000661 | Ga0495587_0000661_16508_17956 | 463 |
| 204 | 3300046543 | Ga0495645_0007825 | Ga0495645_0007825_1202_2650 | 463 |
| 205 | 3300046559 | Ga0495667_0027601 | Ga0495667_0027601_1354_2802 | 463 |
| 206 | 3300046678 | Ga0495599_0005612 | Ga0495599_0005612_730_2178 | 463 |
| 207 | 3300047317 | Ga0495604_0070638 | Ga0495604_0070638_615_2063 | 463 |
| 208 | 3300047471 | Ga0495684_0008178 | Ga0495684_0008178_3928_5376 | 463 |
| 209 | 3300048088 | Ga0495602_0030788 | Ga0495602_0030788_1420_2967 | 463 |
| 210 | 3300048907 | Ga0496104_0077132 | Ga0496104_0077132_1241_2689 | 463 |
| 211 | 3300049743 | Ga0501081_0093226 | Ga0501081_0093226_29_1477 | 463 |
| 212 | 3300050510 | nmdc:mga06r32_35746_c1 | nmdc:mga06r32_35746_c1_212_1660 | 463 |
| 213 | 3300050511 | nmdc:mga08y16_80141_c1 | nmdc:mga08y16_80141_c1_168_1715 | 463 |
| 214 | 3300053077 | Ga0495601_0062695 | Ga0495601_0062695_83_1531 | 463 |
| 215 | 3300005530 | Ga0070679_100181669 | Ga0070679_1001816691 | 464 |
| 216 | 3300049570 | Ga0501033_0005356 | Ga0501033_0005356_660_2144 | 464 |
| 217 | 3300049574 | Ga0501038_0038193 | Ga0501038_0038193_722_2206 | 464 |
| 218 | 3300049823 | Ga0501044_0007739 | Ga0501044_0007739_9504_10988 | 464 |
| 219 | 3300005341 | Ga0070691_10007806 | Ga0070691_100078063 | 465 |
| 220 | 3300005343 | Ga0070687_100010099 | Ga0070687_1000100993 | 465 |
| 221 | 3300005344 | Ga0070661_100042448 | Ga0070661_1000424483 | 465 |
| 222 | 3300005353 | Ga0070669_100021469 | Ga0070669_1000214692 | 465 |
| 223 | 3300005354 | Ga0070675_100016435 | Ga0070675_1000164353 | 465 |
| 224 | 3300005439 | Ga0070711_100000962 | Ga0070711_10000096210 | 465 |
| 225 | 3300005466 | Ga0070685_10037465 | Ga0070685_100374652 | 465 |
| 226 | 3300005616 | Ga0068852_100012815 | Ga0068852_1000128155 | 465 |
| 227 | 3300005616 | Ga0068852_100031878 | Ga0068852_1000318782 | 465 |
| 228 | 3300005617 | Ga0068859_100028872 | Ga0068859_1000288723 | 465 |
| 229 | 3300005617 | Ga0068859_100134064 | Ga0068859_1001340642 | 465 |
| 230 | 3300005840 | Ga0068870_10009478 | Ga0068870_100094784 | 465 |
| 231 | 3300006871 | Ga0075434_100202041 | Ga0075434_1002020412 | 465 |
| 232 | 3300006931 | Ga0097620_100028872 | Ga0097620_1000288723 | 465 |
| 233 | 3300006931 | Ga0097620_100134063 | Ga0097620_1001340632 | 465 |
| 234 | 3300009174 | Ga0105241_10000296 | Ga0105241_1000029618 | 465 |
| 235 | 3300009176 | Ga0105242_10147146 | Ga0105242_101471461 | 465 |
| 236 | 3300013105 | Ga0157369_10041660 | Ga0157369_100416602 | 465 |
| 237 | 3300013105 | Ga0157369_10156786 | Ga0157369_101567862 | 465 |
| 238 | 3300013307 | Ga0157372_10039293 | Ga0157372_100392932 | 465 |
| 239 | 3300013308 | Ga0157375_10060624 | Ga0157375_100606241 | 465 |
| 240 | 3300014745 | Ga0157377_10036782 | Ga0157377_100367822 | 465 |
| 241 | 3300025908 | Ga0207643_10024224 | Ga0207643_100242242 | 465 |
| 242 | 3300025911 | Ga0207654_10000519 | Ga0207654_100005193 | 465 |
| 243 | 3300025916 | Ga0207663_10020208 | Ga0207663_100202082 | 465 |
| 244 | 3300025918 | Ga0207662_10002391 | Ga0207662_100023913 | 465 |
| 245 | 3300025919 | Ga0207657_10052851 | Ga0207657_100528513 | 465 |
| 246 | 3300025923 | Ga0207681_10024834 | Ga0207681_100248342 | 465 |
| 247 | 3300025926 | Ga0207659_10015665 | Ga0207659_100156654 | 465 |
| 248 | 3300025944 | Ga0207661_10074879 | Ga0207661_100748793 | 465 |
| 249 | 3300026116 | Ga0207674_10028280 | Ga0207674_100282801 | 465 |
| 250 | 3300026142 | Ga0207698_10015879 | Ga0207698_100158792 | 465 |
| 251 | 3300026142 | Ga0207698_10141636 | Ga0207698_101416362 | 465 |
| 252 | 3300031548 | Ga0307408_100028608 | Ga0307408_1000286083 | 465 |
| 253 | 3300032002 | Ga0307416_100003078 | Ga0307416_1000030782 | 465 |
| 254 | 3300035086 | Ga0373934_0000529 | Ga0373934_0000529_6724_8274 | 465 |
| 255 | 3300035118 | Ga0373954_0047768 | Ga0373954_0047768_80_1630 | 465 |
| 256 | 3300035410 | Ga0373924_0004195 | Ga0373924_0004195_1349_2899 | 465 |
| 257 | 3300035724 | Ga0373933_0000033 | Ga0373933_0000033_25976_27526 | 465 |
| 258 | 3300036401 | Ga0373937_0000158 | Ga0373937_0000158_30712_32262 | 465 |
| 259 | 3300044684 | Ga0466966_0007566 | Ga0466966_0007566_3465_4955 | 465 |
| 260 | 3300045049 | Ga0466959_0016100 | Ga0466959_0016100_2846_4336 | 465 |
| 261 | 3300046462 | Ga0495651_0000572 | Ga0495651_0000572_3174_4724 | 465 |
| 262 | 3300046463 | Ga0495653_0000173 | Ga0495653_0000173_29336_30886 | 465 |
| 263 | 3300046511 | Ga0495608_0000418 | Ga0495608_0000418_23898_25448 | 465 |
| 264 | 3300046516 | Ga0495628_0000467 | Ga0495628_0000467_24223_25773 | 465 |
| 265 | 3300046529 | Ga0495652_0000658 | Ga0495652_0000658_14638_16188 | 465 |
| 266 | 3300046543 | Ga0495645_0000210 | Ga0495645_0000210_5420_6970 | 465 |
| 267 | 3300046559 | Ga0495667_0005920 | Ga0495667_0005920_1458_3008 | 465 |
| 268 | 3300046663 | Ga0495635_0000157 | Ga0495635_0000157_25058_26608 | 465 |
| 269 | 3300046675 | Ga0495657_0001969 | Ga0495657_0001969_3747_5297 | 465 |
| 270 | 3300046678 | Ga0495599_0000065 | Ga0495599_0000065_64644_66194 | 465 |
| 271 | 3300046679 | Ga0495623_0000014 | Ga0495623_0000014_55590_57140 | 465 |
| 272 | 3300046680 | Ga0495646_0000129 | Ga0495646_0000129_29666_31216 | 465 |
| 273 | 3300046689 | Ga0495613_0059959 | Ga0495613_0059959_1128_2678 | 465 |
| 274 | 3300046809 | Ga0495600_0000105 | Ga0495600_0000105_23877_25427 | 465 |
| 275 | 3300047315 | Ga0495581_0021028 | Ga0495581_0021028_143_1693 | 465 |
| 276 | 3300047317 | Ga0495604_0000359 | Ga0495604_0000359_18318_19868 | 465 |
| 277 | 3300047319 | Ga0495674_0000362 | Ga0495674_0000362_10465_12015 | 465 |
| 278 | 3300047322 | Ga0495680_0001244 | Ga0495680_0001244_23485_25035 | 465 |
| 279 | 3300047444 | Ga0495675_0027318 | Ga0495675_0027318_1571_3121 | 465 |
| 280 | 3300047471 | Ga0495684_0000288 | Ga0495684_0000288_20960_22510 | 465 |
| 281 | 3300048088 | Ga0495602_0039271 | Ga0495602_0039271_852_2402 | 465 |
| 282 | 3300048915 | Ga0496112_0014418 | Ga0496112_0014418_3010_4473 | 465 |
| 283 | 3300048915 | Ga0496112_0255399 | Ga0496112_0255399_135_1598 | 465 |
| 284 | 3300049581 | Ga0501047_0036917 | Ga0501047_0036917_3087_4634 | 465 |
| 285 | 3300050512 | nmdc:mga0n895_180010_c1 | nmdc:mga0n895_180010_c1_230_1777 | 465 |
| 286 | 3300053077 | Ga0495601_0018561 | Ga0495601_0018561_1634_3184 | 465 |
| 287 | 3300053078 | Ga0495612_0000144 | Ga0495612_0000144_15811_17361 | 465 |
| 288 | 3300053084 | Ga0495595_0030712 | Ga0495595_0030712_164_1714 | 465 |
| 289 | 3300005328 | Ga0070676_10004316 | Ga0070676_100043163 | 466 |
| 290 | 3300005333 | Ga0070677_10036695 | Ga0070677_100366952 | 466 |
| 291 | 3300005336 | Ga0070680_100039287 | Ga0070680_1000392872 | 466 |
| 292 | 3300005353 | Ga0070669_100003393 | Ga0070669_1000033935 | 466 |
| 293 | 3300005356 | Ga0070674_100000605 | Ga0070674_1000006056 | 466 |
| 294 | 3300005444 | Ga0070694_100012174 | Ga0070694_1000121743 | 466 |
| 295 | 3300005445 | Ga0070708_100038954 | Ga0070708_1000389544 | 466 |
| 296 | 3300005445 | Ga0070708_100068887 | Ga0070708_1000688872 | 466 |
| 297 | 3300005457 | Ga0070662_100000596 | Ga0070662_1000005966 | 466 |
| 298 | 3300005468 | Ga0070707_100055557 | Ga0070707_1000555572 | 466 |
| 299 | 3300005530 | Ga0070679_100002731 | Ga0070679_1000027319 | 466 |
| 300 | 3300005544 | Ga0070686_100024875 | Ga0070686_1000248753 | 466 |
| 301 | 3300005545 | Ga0070695_100029087 | Ga0070695_1000290873 | 466 |
| 302 | 3300005545 | Ga0070695_100177326 | Ga0070695_1001773261 | 466 |
| 303 | 3300005563 | Ga0068855_100031885 | Ga0068855_1000318857 | 466 |
| 304 | 3300005577 | Ga0068857_100049820 | Ga0068857_1000498202 | 466 |
| 305 | 3300005618 | Ga0068864_100045010 | Ga0068864_1000450103 | 466 |
| 306 | 3300005718 | Ga0068866_10000381 | Ga0068866_1000038115 | 466 |
| 307 | 3300005719 | Ga0068861_100000159 | Ga0068861_1000001593 | 466 |
| 308 | 3300005719 | Ga0068861_100012359 | Ga0068861_1000123592 | 466 |
| 309 | 3300005844 | Ga0068862_100001333 | Ga0068862_10000133310 | 466 |
| 310 | 3300006175 | Ga0070712_100067208 | Ga0070712_1000672083 | 466 |
| 311 | 3300006846 | Ga0075430_100000568 | Ga0075430_10000056821 | 466 |
| 312 | 3300006846 | Ga0075430_100002373 | Ga0075430_1000023736 | 466 |
| 313 | 3300006852 | Ga0075433_10018833 | Ga0075433_100188336 | 466 |
| 314 | 3300006881 | Ga0068865_100057701 | Ga0068865_1000577012 | 466 |
| 315 | 3300009093 | Ga0105240_10005639 | Ga0105240_100056395 | 466 |
| 316 | 3300009093 | Ga0105240_10012038 | Ga0105240_100120384 | 466 |
| 317 | 3300009093 | Ga0105240_10136438 | Ga0105240_101364382 | 466 |
| 318 | 3300009093 | Ga0105240_10198875 | Ga0105240_101988752 | 466 |
| 319 | 3300009094 | Ga0111539_10018419 | Ga0111539_100184191 | 466 |
| 320 | 3300009094 | Ga0111539_10124865 | Ga0111539_101248652 | 466 |
| 321 | 3300009147 | Ga0114129_10010360 | Ga0114129_1001036011 | 466 |
| 322 | 3300009176 | Ga0105242_10014450 | Ga0105242_100144501 | 466 |
| 323 | 3300009553 | Ga0105249_10000251 | Ga0105249_1000025138 | 466 |
| 324 | 3300009553 | Ga0105249_10000572 | Ga0105249_1000057211 | 466 |
| 325 | 3300011119 | Ga0105246_10122408 | Ga0105246_101224081 | 466 |
| 326 | 3300013104 | Ga0157370_10009110 | Ga0157370_100091109 | 466 |
| 327 | 3300013105 | Ga0157369_10009566 | Ga0157369_100095668 | 466 |
| 328 | 3300013105 | Ga0157369_10068959 | Ga0157369_100689595 | 466 |
| 329 | 3300013105 | Ga0157369_10282407 | Ga0157369_102824071 | 466 |
| 330 | 3300013297 | Ga0157378_10001106 | Ga0157378_100011066 | 466 |
| 331 | 3300013306 | Ga0163162_10000718 | Ga0163162_1000071825 | 466 |
| 332 | 3300013306 | Ga0163162_10021283 | Ga0163162_100212832 | 466 |
| 333 | 3300013307 | Ga0157372_10007168 | Ga0157372_100071686 | 466 |
| 334 | 3300013307 | Ga0157372_10033524 | Ga0157372_100335245 | 466 |
| 335 | 3300014325 | Ga0163163_10302315 | Ga0163163_103023151 | 466 |
| 336 | 3300014326 | Ga0157380_10099246 | Ga0157380_100992462 | 466 |
| 337 | 3300025315 | Ga0207697_10003842 | Ga0207697_100038422 | 466 |
| 338 | 3300025903 | Ga0207680_10040035 | Ga0207680_100400352 | 466 |
| 339 | 3300025907 | Ga0207645_10001472 | Ga0207645_100014722 | 466 |
| 340 | 3300025907 | Ga0207645_10001749 | Ga0207645_100017495 | 466 |
| 341 | 3300025908 | Ga0207643_10002930 | Ga0207643_100029308 | 466 |
| 342 | 3300025911 | Ga0207654_10025846 | Ga0207654_100258462 | 466 |
| 343 | 3300025912 | Ga0207707_10002786 | Ga0207707_100027868 | 466 |
| 344 | 3300025912 | Ga0207707_10036988 | Ga0207707_100369884 | 466 |
| 345 | 3300025914 | Ga0207671_10012340 | Ga0207671_100123403 | 466 |
| 346 | 3300025915 | Ga0207693_10003926 | Ga0207693_100039268 | 466 |
| 347 | 3300025917 | Ga0207660_10058005 | Ga0207660_100580052 | 466 |
| 348 | 3300025917 | Ga0207660_10061568 | Ga0207660_100615682 | 466 |
| 349 | 3300025918 | Ga0207662_10006744 | Ga0207662_100067442 | 466 |
| 350 | 3300025919 | Ga0207657_10089345 | Ga0207657_100893452 | 466 |
| 351 | 3300025920 | Ga0207649_10046601 | Ga0207649_100466011 | 466 |
| 352 | 3300025921 | Ga0207652_10013395 | Ga0207652_100133957 | 466 |
| 353 | 3300025922 | Ga0207646_10092391 | Ga0207646_100923912 | 466 |
| 354 | 3300025923 | Ga0207681_10002613 | Ga0207681_100026135 | 466 |
| 355 | 3300025923 | Ga0207681_10002918 | Ga0207681_100029185 | 466 |
| 356 | 3300025926 | Ga0207659_10005657 | Ga0207659_100056577 | 466 |
| 357 | 3300025933 | Ga0207706_10000015 | Ga0207706_10000015115 | 466 |
| 358 | 3300025938 | Ga0207704_10004757 | Ga0207704_100047574 | 466 |
| 359 | 3300025941 | Ga0207711_10002798 | Ga0207711_1000279810 | 466 |
| 360 | 3300025942 | Ga0207689_10005150 | Ga0207689_100051503 | 466 |
| 361 | 3300025961 | Ga0207712_10002363 | Ga0207712_1000236313 | 466 |
| 362 | 3300025961 | Ga0207712_10002544 | Ga0207712_100025448 | 466 |
| 363 | 3300025961 | Ga0207712_10004478 | Ga0207712_100044783 | 466 |
| 364 | 3300025972 | Ga0207668_10003462 | Ga0207668_100034627 | 466 |
| 365 | 3300025972 | Ga0207668_10087489 | Ga0207668_100874891 | 466 |
| 366 | 3300025981 | Ga0207640_10000931 | Ga0207640_1000093110 | 466 |
| 367 | 3300025986 | Ga0207658_10094189 | Ga0207658_100941892 | 466 |
| 368 | 3300026067 | Ga0207678_10015292 | Ga0207678_100152927 | 466 |
| 369 | 3300026075 | Ga0207708_10016424 | Ga0207708_100164244 | 466 |
| 370 | 3300026089 | Ga0207648_10000010 | Ga0207648_10000010128 | 466 |
| 371 | 3300026089 | Ga0207648_10005675 | Ga0207648_100056758 | 466 |
| 372 | 3300026116 | Ga0207674_10063525 | Ga0207674_100635252 | 466 |
| 373 | 3300026118 | Ga0207675_100000030 | Ga0207675_10000003090 | 466 |
| 374 | 3300026142 | Ga0207698_10053717 | Ga0207698_100537172 | 466 |
| 375 | 3300028380 | Ga0268265_10001535 | Ga0268265_100015355 | 466 |
| 376 | 3300028381 | Ga0268264_10003591 | Ga0268264_100035919 | 466 |
| 377 | 3300031727 | Ga0316576_10054774 | Ga0316576_100547743 | 466 |
| 378 | 3300031733 | Ga0316577_10046400 | Ga0316577_100464002 | 466 |
| 379 | 3300031901 | Ga0307406_10013715 | Ga0307406_100137155 | 466 |
| 380 | 3300032002 | Ga0307416_100240338 | Ga0307416_1002403381 | 466 |
| 381 | 3300042876 | Ga0451577_0064730 | Ga0451577_0064730_1643_3100 | 466 |
| 382 | 3300045051 | Ga0451576_0031139 | Ga0451576_0031139_2844_4301 | 466 |
| 383 | 3300048904 | Ga0496101_0112044 | Ga0496101_0112044_485_1942 | 466 |
| 384 | 3300049586 | Ga0501070_0038186 | Ga0501070_0038186_1625_3082 | 466 |
| 385 | 3300049590 | Ga0501074_0134044 | Ga0501074_0134044_163_1632 | 466 |
| 386 | 3300049742 | Ga0501080_0101363 | Ga0501080_0101363_401_1858 | 466 |
| 387 | 3300049823 | Ga0501044_0217815 | Ga0501044_0217815_86_1600 | 466 |
| 388 | 3300050507 | nmdc:mga05p37_111337_c1 | nmdc:mga05p37_111337_c1_210_1700 | 466 |
| 389 | 3300050508 | nmdc:mga09592_24195_c1 | nmdc:mga09592_24195_c1_627_2114 | 466 |
| 390 | 3300050509 | nmdc:mga0qj67_5807_c1 | nmdc:mga0qj67_5807_c1_3742_5229 | 466 |
| 391 | 3300050510 | nmdc:mga06r32_49502_c1 | nmdc:mga06r32_49502_c1_922_2412 | 466 |
| 392 | 3300050512 | nmdc:mga0n895_188459_c1 | nmdc:mga0n895_188459_c1_83_1573 | 466 |
| 393 | 3300050514 | nmdc:mga08x19_1893_c1 | nmdc:mga08x19_1893_c1_5847_7334 | 466 |
| 394 | 3300050515 | nmdc:mga0a205_13885_c1 | nmdc:mga0a205_13885_c1_436_1926 | 466 |
| 395 | 3300005329 | Ga0070683_100017780 | Ga0070683_1000177804 | 467 |
| 396 | 3300005329 | Ga0070683_100017906 | Ga0070683_1000179063 | 467 |
| 397 | 3300005329 | Ga0070683_100186461 | Ga0070683_1001864611 | 467 |
| 398 | 3300005356 | Ga0070674_100009667 | Ga0070674_1000096672 | 467 |
| 399 | 3300005366 | Ga0070659_100037062 | Ga0070659_1000370623 | 467 |
| 400 | 3300005367 | Ga0070667_100023342 | Ga0070667_1000233421 | 467 |
| 401 | 3300005434 | Ga0070709_10011304 | Ga0070709_100113042 | 467 |
| 402 | 3300005471 | Ga0070698_100000535 | Ga0070698_10000053514 | 467 |
| 403 | 3300005535 | Ga0070684_100154688 | Ga0070684_1001546882 | 467 |
| 404 | 3300005546 | Ga0070696_100000113 | Ga0070696_10000011319 | 467 |
| 405 | 3300005564 | Ga0070664_100000990 | Ga0070664_10000099017 | 467 |
| 406 | 3300005564 | Ga0070664_100069625 | Ga0070664_1000696253 | 467 |
| 407 | 3300005577 | Ga0068857_100020444 | Ga0068857_1000204446 | 467 |
| 408 | 3300005616 | Ga0068852_100025942 | Ga0068852_1000259423 | 467 |
| 409 | 3300005843 | Ga0068860_100119338 | Ga0068860_1001193382 | 467 |
| 410 | 3300009094 | Ga0111539_10152236 | Ga0111539_101522362 | 467 |
| 411 | 3300013307 | Ga0157372_10004800 | Ga0157372_100048001 | 467 |
| 412 | 3300013307 | Ga0157372_10043164 | Ga0157372_100431642 | 467 |
| 413 | 3300014325 | Ga0163163_10093096 | Ga0163163_100930963 | 467 |
| 414 | 3300025907 | Ga0207645_10076105 | Ga0207645_100761052 | 467 |
| 415 | 3300025909 | Ga0207705_10010105 | Ga0207705_100101055 | 467 |
| 416 | 3300025909 | Ga0207705_10011492 | Ga0207705_100114922 | 467 |
| 417 | 3300025919 | Ga0207657_10119649 | Ga0207657_101196492 | 467 |
| 418 | 3300025932 | Ga0207690_10112282 | Ga0207690_101122821 | 467 |
| 419 | 3300025938 | Ga0207704_10012345 | Ga0207704_100123455 | 467 |
| 420 | 3300025940 | Ga0207691_10014192 | Ga0207691_100141922 | 467 |
| 421 | 3300025944 | Ga0207661_10012610 | Ga0207661_100126105 | 467 |
| 422 | 3300025944 | Ga0207661_10020685 | Ga0207661_100206853 | 467 |
| 423 | 3300025944 | Ga0207661_10033947 | Ga0207661_100339474 | 467 |
| 424 | 3300026089 | Ga0207648_10012817 | Ga0207648_100128172 | 467 |
| 425 | 3300026116 | Ga0207674_10023628 | Ga0207674_100236286 | 467 |
| 426 | 3300026142 | Ga0207698_10009309 | Ga0207698_100093092 | 467 |
| 427 | 3300031731 | Ga0307405_10006048 | Ga0307405_100060484 | 467 |
| 428 | 3300031824 | Ga0307413_10000344 | Ga0307413_1000034412 | 467 |
| 429 | 3300031901 | Ga0307406_10005718 | Ga0307406_100057182 | 467 |
| 430 | 3300031911 | Ga0307412_10009550 | Ga0307412_100095504 | 467 |
| 431 | 3300032002 | Ga0307416_100007260 | Ga0307416_1000072605 | 467 |
| 432 | 3300032002 | Ga0307416_100081892 | Ga0307416_1000818922 | 467 |
| 433 | 3300032004 | Ga0307414_10058579 | Ga0307414_100585793 | 467 |
| 434 | 3300032126 | Ga0307415_100003986 | Ga0307415_1000039864 | 467 |
| 435 | 3300032126 | Ga0307415_100040391 | Ga0307415_1000403912 | 467 |
| 436 | 3300036401 | Ga0373937_0017625 | Ga0373937_0017625_2310_3851 | 467 |
| 437 | 3300046536 | Ga0495587_0043772 | Ga0495587_0043772_1045_2595 | 467 |
| 438 | 3300046679 | Ga0495623_0042696 | Ga0495623_0042696_1153_2694 | 467 |
| 439 | 3300048088 | Ga0495602_0100569 | Ga0495602_0100569_604_2145 | 467 |
| 440 | 3300048911 | Ga0496108_0037075 | Ga0496108_0037075_199_1743 | 467 |
| 441 | 3300048916 | Ga0496113_0031174 | Ga0496113_0031174_1554_3098 | 467 |
| 442 | 3300049581 | Ga0501047_0053591 | Ga0501047_0053591_20_1579 | 467 |
| 443 | 3300049586 | Ga0501070_0030086 | Ga0501070_0030086_876_2435 | 467 |
| 444 | 3300005295 | Ga0065707_10092569 | Ga0065707_100925692 | 468 |
| 445 | 3300005327 | Ga0070658_10005468 | Ga0070658_100054684 | 468 |
| 446 | 3300005327 | Ga0070658_10011659 | Ga0070658_100116594 | 468 |
| 447 | 3300005327 | Ga0070658_10083059 | Ga0070658_100830593 | 468 |
| 448 | 3300005328 | Ga0070676_10001172 | Ga0070676_1000117213 | 468 |
| 449 | 3300005329 | Ga0070683_100006226 | Ga0070683_1000062264 | 468 |
| 450 | 3300005329 | Ga0070683_100006465 | Ga0070683_1000064655 | 468 |
| 451 | 3300005329 | Ga0070683_100007195 | Ga0070683_1000071958 | 468 |
| 452 | 3300005329 | Ga0070683_100017278 | Ga0070683_1000172782 | 468 |
| 453 | 3300005329 | Ga0070683_100039807 | Ga0070683_1000398072 | 468 |
| 454 | 3300005330 | Ga0070690_100014715 | Ga0070690_1000147155 | 468 |
| 455 | 3300005331 | Ga0070670_100062618 | Ga0070670_1000626182 | 468 |
| 456 | 3300005331 | Ga0070670_100088062 | Ga0070670_1000880622 | 468 |
| 457 | 3300005334 | Ga0068869_100001479 | Ga0068869_10000147911 | 468 |
| 458 | 3300005334 | Ga0068869_100037987 | Ga0068869_1000379874 | 468 |
| 459 | 3300005336 | Ga0070680_100004841 | Ga0070680_10000484111 | 468 |
| 460 | 3300005336 | Ga0070680_100005076 | Ga0070680_1000050767 | 468 |
| 461 | 3300005336 | Ga0070680_100010389 | Ga0070680_1000103897 | 468 |
| 462 | 3300005336 | Ga0070680_100017623 | Ga0070680_1000176231 | 468 |
| 463 | 3300005336 | Ga0070680_100037373 | Ga0070680_1000373732 | 468 |
| 464 | 3300005336 | Ga0070680_100108761 | Ga0070680_1001087611 | 468 |
| 465 | 3300005336 | Ga0070680_100155218 | Ga0070680_1001552182 | 468 |
| 466 | 3300005337 | Ga0070682_100005004 | Ga0070682_1000050044 | 468 |
| 467 | 3300005338 | Ga0068868_100012394 | Ga0068868_1000123945 | 468 |
| 468 | 3300005339 | Ga0070660_100002151 | Ga0070660_10000215115 | 468 |
| 469 | 3300005339 | Ga0070660_100013004 | Ga0070660_1000130042 | 468 |
| 470 | 3300005339 | Ga0070660_100127725 | Ga0070660_1001277252 | 468 |
| 471 | 3300005340 | Ga0070689_100030654 | Ga0070689_1000306543 | 468 |
| 472 | 3300005343 | Ga0070687_100000549 | Ga0070687_1000005492 | 468 |
| 473 | 3300005344 | Ga0070661_100000331 | Ga0070661_1000003313 | 468 |
| 474 | 3300005344 | Ga0070661_100003958 | Ga0070661_1000039584 | 468 |
| 475 | 3300005347 | Ga0070668_100000182 | Ga0070668_10000018235 | 468 |
| 476 | 3300005353 | Ga0070669_100037086 | Ga0070669_1000370862 | 468 |
| 477 | 3300005354 | Ga0070675_100002184 | Ga0070675_1000021849 | 468 |
| 478 | 3300005364 | Ga0070673_100018937 | Ga0070673_1000189372 | 468 |
| 479 | 3300005364 | Ga0070673_100043692 | Ga0070673_1000436922 | 468 |
| 480 | 3300005364 | Ga0070673_100071563 | Ga0070673_1000715632 | 468 |
| 481 | 3300005365 | Ga0070688_100019639 | Ga0070688_1000196393 | 468 |
| 482 | 3300005366 | Ga0070659_100000927 | Ga0070659_1000009278 | 468 |
| 483 | 3300005366 | Ga0070659_100002500 | Ga0070659_1000025007 | 468 |
| 484 | 3300005366 | Ga0070659_100011745 | Ga0070659_1000117454 | 468 |
| 485 | 3300005366 | Ga0070659_100013618 | Ga0070659_1000136184 | 468 |
| 486 | 3300005366 | Ga0070659_100114982 | Ga0070659_1001149822 | 468 |
| 487 | 3300005367 | Ga0070667_100003736 | Ga0070667_10000373610 | 468 |
| 488 | 3300005435 | Ga0070714_100009617 | Ga0070714_1000096178 | 468 |
| 489 | 3300005435 | Ga0070714_100031774 | Ga0070714_1000317743 | 468 |
| 490 | 3300005440 | Ga0070705_100047597 | Ga0070705_1000475972 | 468 |
| 491 | 3300005457 | Ga0070662_100002883 | Ga0070662_1000028837 | 468 |
| 492 | 3300005458 | Ga0070681_10003870 | Ga0070681_1000387015 | 468 |
| 493 | 3300005458 | Ga0070681_10008927 | Ga0070681_100089279 | 468 |
| 494 | 3300005458 | Ga0070681_10034461 | Ga0070681_100344614 | 468 |
| 495 | 3300005458 | Ga0070681_10187652 | Ga0070681_101876521 | 468 |
| 496 | 3300005471 | Ga0070698_100121428 | Ga0070698_1001214281 | 468 |
| 497 | 3300005530 | Ga0070679_100003029 | Ga0070679_10000302912 | 468 |
| 498 | 3300005530 | Ga0070679_100004557 | Ga0070679_1000045576 | 468 |
| 499 | 3300005530 | Ga0070679_100006728 | Ga0070679_1000067282 | 468 |
| 500 | 3300005530 | Ga0070679_100009679 | Ga0070679_1000096792 | 468 |
| 501 | 3300005530 | Ga0070679_100019454 | Ga0070679_1000194542 | 468 |
| 502 | 3300005530 | Ga0070679_100068102 | Ga0070679_1000681022 | 468 |
| 503 | 3300005535 | Ga0070684_100026387 | Ga0070684_1000263873 | 468 |
| 504 | 3300005535 | Ga0070684_100029652 | Ga0070684_1000296522 | 468 |
| 505 | 3300005535 | Ga0070684_100046227 | Ga0070684_1000462272 | 468 |
| 506 | 3300005543 | Ga0070672_100016273 | Ga0070672_1000162732 | 468 |
| 507 | 3300005545 | Ga0070695_100010556 | Ga0070695_1000105564 | 468 |
| 508 | 3300005547 | Ga0070693_100007102 | Ga0070693_1000071025 | 468 |
| 509 | 3300005548 | Ga0070665_100000399 | Ga0070665_10000039945 | 468 |
| 510 | 3300005563 | Ga0068855_100028001 | Ga0068855_1000280014 | 468 |
| 511 | 3300005563 | Ga0068855_100038801 | Ga0068855_1000388015 | 468 |
| 512 | 3300005563 | Ga0068855_100062029 | Ga0068855_1000620292 | 468 |
| 513 | 3300005564 | Ga0070664_100003425 | Ga0070664_10000342510 | 468 |
| 514 | 3300005614 | Ga0068856_100003727 | Ga0068856_10000372712 | 468 |
| 515 | 3300005614 | Ga0068856_100022892 | Ga0068856_1000228926 | 468 |
| 516 | 3300005615 | Ga0070702_100000366 | Ga0070702_10000036611 | 468 |
| 517 | 3300005616 | Ga0068852_100006987 | Ga0068852_1000069879 | 468 |
| 518 | 3300005617 | Ga0068859_100013810 | Ga0068859_1000138105 | 468 |
| 519 | 3300005618 | Ga0068864_100001549 | Ga0068864_10000154911 | 468 |
| 520 | 3300005718 | Ga0068866_10021583 | Ga0068866_100215833 | 468 |
| 521 | 3300005834 | Ga0068851_10051371 | Ga0068851_100513712 | 468 |
| 522 | 3300005841 | Ga0068863_100003160 | Ga0068863_10000316012 | 468 |
| 523 | 3300005841 | Ga0068863_100128205 | Ga0068863_1001282052 | 468 |
| 524 | 3300005844 | Ga0068862_100036850 | Ga0068862_1000368504 | 468 |
| 525 | 3300005985 | Ga0081539_10009701 | Ga0081539_100097016 | 468 |
| 526 | 3300006237 | Ga0097621_100034285 | Ga0097621_1000342852 | 468 |
| 527 | 3300006846 | Ga0075430_100056456 | Ga0075430_1000564563 | 468 |
| 528 | 3300006846 | Ga0075430_100068805 | Ga0075430_1000688052 | 468 |
| 529 | 3300006847 | Ga0075431_100046401 | Ga0075431_1000464013 | 468 |
| 530 | 3300006931 | Ga0097620_100013811 | Ga0097620_1000138115 | 468 |
| 531 | 3300009174 | Ga0105241_10009823 | Ga0105241_100098232 | 468 |
| 532 | 3300009551 | Ga0105238_10021425 | Ga0105238_100214252 | 468 |
| 533 | 3300010375 | Ga0105239_10035253 | Ga0105239_100352532 | 468 |
| 534 | 3300010375 | Ga0105239_10046185 | Ga0105239_100461852 | 468 |
| 535 | 3300011119 | Ga0105246_10000522 | Ga0105246_100005224 | 468 |
| 536 | 3300013100 | Ga0157373_10016451 | Ga0157373_100164512 | 468 |
| 537 | 3300013102 | Ga0157371_10030300 | Ga0157371_100303003 | 468 |
| 538 | 3300013102 | Ga0157371_10034702 | Ga0157371_100347022 | 468 |
| 539 | 3300013104 | Ga0157370_10128779 | Ga0157370_101287792 | 468 |
| 540 | 3300013296 | Ga0157374_10030377 | Ga0157374_100303772 | 468 |
| 541 | 3300013307 | Ga0157372_10004905 | Ga0157372_100049058 | 468 |
| 542 | 3300013307 | Ga0157372_10009706 | Ga0157372_100097067 | 468 |
| 543 | 3300013307 | Ga0157372_10052660 | Ga0157372_100526603 | 468 |
| 544 | 3300014325 | Ga0163163_10022786 | Ga0163163_100227865 | 468 |
| 545 | 3300014745 | Ga0157377_10001101 | Ga0157377_100011017 | 468 |
| 546 | 3300014969 | Ga0157376_10014136 | Ga0157376_100141362 | 468 |
| 547 | 3300022467 | Ga0224712_10024797 | Ga0224712_100247971 | 468 |
| 548 | 3300025909 | Ga0207705_10002060 | Ga0207705_1000206010 | 468 |
| 549 | 3300025909 | Ga0207705_10017850 | Ga0207705_100178503 | 468 |
| 550 | 3300025911 | Ga0207654_10056097 | Ga0207654_100560972 | 468 |
| 551 | 3300025912 | Ga0207707_10000423 | Ga0207707_100004236 | 468 |
| 552 | 3300025912 | Ga0207707_10027874 | Ga0207707_100278743 | 468 |
| 553 | 3300025912 | Ga0207707_10031879 | Ga0207707_100318792 | 468 |
| 554 | 3300025913 | Ga0207695_10007739 | Ga0207695_100077392 | 468 |
| 555 | 3300025913 | Ga0207695_10020940 | Ga0207695_100209402 | 468 |
| 556 | 3300025917 | Ga0207660_10004363 | Ga0207660_100043632 | 468 |
| 557 | 3300025917 | Ga0207660_10004590 | Ga0207660_100045901 | 468 |
| 558 | 3300025917 | Ga0207660_10024837 | Ga0207660_100248372 | 468 |
| 559 | 3300025919 | Ga0207657_10012334 | Ga0207657_100123349 | 468 |
| 560 | 3300025921 | Ga0207652_10062110 | Ga0207652_100621102 | 468 |
| 561 | 3300025921 | Ga0207652_10084147 | Ga0207652_100841472 | 468 |
| 562 | 3300025921 | Ga0207652_10111016 | Ga0207652_101110162 | 468 |
| 563 | 3300025924 | Ga0207694_10003260 | Ga0207694_100032607 | 468 |
| 564 | 3300025925 | Ga0207650_10005032 | Ga0207650_100050323 | 468 |
| 565 | 3300025928 | Ga0207700_10107713 | Ga0207700_101077132 | 468 |
| 566 | 3300025928 | Ga0207700_10146869 | Ga0207700_101468692 | 468 |
| 567 | 3300025932 | Ga0207690_10013013 | Ga0207690_100130132 | 468 |
| 568 | 3300025935 | Ga0207709_10071646 | Ga0207709_100716462 | 468 |
| 569 | 3300025940 | Ga0207691_10000840 | Ga0207691_1000084017 | 468 |
| 570 | 3300025942 | Ga0207689_10007205 | Ga0207689_100072052 | 468 |
| 571 | 3300025942 | Ga0207689_10023712 | Ga0207689_100237125 | 468 |
| 572 | 3300025944 | Ga0207661_10000472 | Ga0207661_1000047217 | 468 |
| 573 | 3300025944 | Ga0207661_10004340 | Ga0207661_100043402 | 468 |
| 574 | 3300025944 | Ga0207661_10009167 | Ga0207661_100091675 | 468 |
| 575 | 3300025944 | Ga0207661_10122373 | Ga0207661_101223732 | 468 |
| 576 | 3300025945 | Ga0207679_10003434 | Ga0207679_100034345 | 468 |
| 577 | 3300025949 | Ga0207667_10022814 | Ga0207667_100228145 | 468 |
| 578 | 3300025949 | Ga0207667_10082568 | Ga0207667_100825682 | 468 |
| 579 | 3300025949 | Ga0207667_10107699 | Ga0207667_101076992 | 468 |
| 580 | 3300025949 | Ga0207667_10119480 | Ga0207667_101194803 | 468 |
| 581 | 3300025960 | Ga0207651_10046823 | Ga0207651_100468232 | 468 |
| 582 | 3300025981 | Ga0207640_10030753 | Ga0207640_100307532 | 468 |
| 583 | 3300025986 | Ga0207658_10013897 | Ga0207658_100138972 | 468 |
| 584 | 3300026023 | Ga0207677_10003526 | Ga0207677_100035266 | 468 |
| 585 | 3300026035 | Ga0207703_10153607 | Ga0207703_101536072 | 468 |
| 586 | 3300026078 | Ga0207702_10007494 | Ga0207702_100074944 | 468 |
| 587 | 3300026088 | Ga0207641_10017047 | Ga0207641_100170472 | 468 |
| 588 | 3300026095 | Ga0207676_10008097 | Ga0207676_100080972 | 468 |
| 589 | 3300026116 | Ga0207674_10000528 | Ga0207674_100005287 | 468 |
| 590 | 3300026118 | Ga0207675_100033324 | Ga0207675_1000333244 | 468 |
| 591 | 3300026142 | Ga0207698_10051996 | Ga0207698_100519962 | 468 |
| 592 | 3300028380 | Ga0268265_10015921 | Ga0268265_100159214 | 468 |
| 593 | 3300031238 | Ga0265332_10012632 | Ga0265332_100126322 | 468 |
| 594 | 3300031548 | Ga0307408_100017279 | Ga0307408_1000172791 | 468 |
| 595 | 3300031731 | Ga0307405_10000745 | Ga0307405_100007455 | 468 |
| 596 | 3300031824 | Ga0307413_10004295 | Ga0307413_100042952 | 468 |
| 597 | 3300031852 | Ga0307410_10007833 | Ga0307410_100078332 | 468 |
| 598 | 3300031852 | Ga0307410_10012534 | Ga0307410_100125342 | 468 |
| 599 | 3300031901 | Ga0307406_10058696 | Ga0307406_100586962 | 468 |
| 600 | 3300031901 | Ga0307406_10071466 | Ga0307406_100714662 | 468 |
| 601 | 3300031903 | Ga0307407_10004507 | Ga0307407_100045073 | 468 |
| 602 | 3300031903 | Ga0307407_10031289 | Ga0307407_100312891 | 468 |
| 603 | 3300031903 | Ga0307407_10033144 | Ga0307407_100331442 | 468 |
| 604 | 3300031903 | Ga0307407_10101376 | Ga0307407_101013761 | 468 |
| 605 | 3300031911 | Ga0307412_10016126 | Ga0307412_100161263 | 468 |
| 606 | 3300031911 | Ga0307412_10036303 | Ga0307412_100363032 | 468 |
| 607 | 3300031911 | Ga0307412_10045006 | Ga0307412_100450062 | 468 |
| 608 | 3300031995 | Ga0307409_100000357 | Ga0307409_1000003576 | 468 |
| 609 | 3300031995 | Ga0307409_100011126 | Ga0307409_1000111263 | 468 |
| 610 | 3300031995 | Ga0307409_100016802 | Ga0307409_1000168022 | 468 |
| 611 | 3300031995 | Ga0307409_100091311 | Ga0307409_1000913112 | 468 |
| 612 | 3300032002 | Ga0307416_100003262 | Ga0307416_1000032622 | 468 |
| 613 | 3300032002 | Ga0307416_100010390 | Ga0307416_1000103902 | 468 |
| 614 | 3300032002 | Ga0307416_100014672 | Ga0307416_1000146723 | 468 |
| 615 | 3300032002 | Ga0307416_100103190 | Ga0307416_1001031901 | 468 |
| 616 | 3300032004 | Ga0307414_10056051 | Ga0307414_100560512 | 468 |
| 617 | 3300032004 | Ga0307414_10063539 | Ga0307414_100635392 | 468 |
| 618 | 3300032005 | Ga0307411_10002232 | Ga0307411_100022327 | 468 |
| 619 | 3300032126 | Ga0307415_100002295 | Ga0307415_1000022955 | 468 |
| 620 | 3300032126 | Ga0307415_100002668 | Ga0307415_1000026686 | 468 |
| 621 | 3300035725 | Ga0373947_0017785 | Ga0373947_0017785_1171_2724 | 468 |
| 622 | 3300042876 | Ga0451577_0000005 | Ga0451577_0000005_35838_37382 | 468 |
| 623 | 3300042876 | Ga0451577_0001689 | Ga0451577_0001689_1592_3055 | 468 |
| 624 | 3300042876 | Ga0451577_0082408 | Ga0451577_0082408_897_2360 | 468 |
| 625 | 3300042876 | Ga0451577_0101001 | Ga0451577_0101001_500_1963 | 468 |
| 626 | 3300044712 | Ga0453684_0000330 | Ga0453684_0000330_108506_109969 | 468 |
| 627 | 3300046499 | Ga0495594_0042180 | Ga0495594_0042180_827_2380 | 468 |
| 628 | 3300046535 | Ga0495586_0021334 | Ga0495586_0021334_162_1715 | 468 |
| 629 | 3300049568 | Ga0501031_0039396 | Ga0501031_0039396_78_1622 | 468 |
| 630 | 3300049575 | Ga0501039_0138424 | Ga0501039_0138424_135_1595 | 468 |
| 631 | 3300049578 | Ga0501042_0102925 | Ga0501042_0102925_229_1689 | 468 |
| 632 | 3300049580 | Ga0501046_0107457 | Ga0501046_0107457_570_2030 | 468 |
| 633 | 3300049582 | Ga0501048_0013752 | Ga0501048_0013752_4439_5899 | 468 |
| 634 | 3300049590 | Ga0501074_0082164 | Ga0501074_0082164_602_2062 | 468 |
| 635 | 3300049591 | Ga0501075_0017633 | Ga0501075_0017633_804_2348 | 468 |
| 636 | 3300049742 | Ga0501080_0213659 | Ga0501080_0213659_21_1565 | 468 |
| 637 | 3300049744 | Ga0501083_0058981 | Ga0501083_0058981_569_2029 | 468 |
| 638 | 3300049822 | Ga0501035_0157030 | Ga0501035_0157030_321_1865 | 468 |
| 639 | 3300050509 | nmdc:mga0qj67_67633_c1 | nmdc:mga0qj67_67633_c1_122_1672 | 468 |
| 640 | 3300050509 | nmdc:mga0qj67_91425_c1 | nmdc:mga0qj67_91425_c1_852_2402 | 468 |
| 641 | 3300050510 | nmdc:mga06r32_39521_c1 | nmdc:mga06r32_39521_c1_2423_3967 | 468 |
| 642 | 3300050510 | nmdc:mga06r32_9509_c1 | nmdc:mga06r32_9509_c1_6764_8314 | 468 |
| 643 | 3300005366 | Ga0070659_100000100 | Ga0070659_10000010045 | 469 |
| 644 | 3300005458 | Ga0070681_10004476 | Ga0070681_1000447614 | 469 |
| 645 | 3300005471 | Ga0070698_100072240 | Ga0070698_1000722402 | 469 |
| 646 | 3300005518 | Ga0070699_100158927 | Ga0070699_1001589271 | 469 |
| 647 | 3300005530 | Ga0070679_100127335 | Ga0070679_1001273352 | 469 |
| 648 | 3300005549 | Ga0070704_100110884 | Ga0070704_1001108842 | 469 |
| 649 | 3300006880 | Ga0075429_100007625 | Ga0075429_1000076251 | 469 |
| 650 | 3300013100 | Ga0157373_10000069 | Ga0157373_100000693 | 469 |
| 651 | 3300013307 | Ga0157372_10011953 | Ga0157372_100119533 | 469 |
| 652 | 3300025250 | Ga0209026_1002502 | Ga0209026_10025022 | 469 |
| 653 | 3300025917 | Ga0207660_10028354 | Ga0207660_100283543 | 469 |
| 654 | 3300025932 | Ga0207690_10000609 | Ga0207690_1000060919 | 469 |
| 655 | 3300031251 | Ga0265327_10003773 | Ga0265327_100037731 | 469 |
| 656 | 3300031731 | Ga0307405_10064648 | Ga0307405_100646482 | 469 |
| 657 | 3300031852 | Ga0307410_10010966 | Ga0307410_100109664 | 469 |
| 658 | 3300037312 | Ga0395899_0101203 | Ga0395899_0101203_466_2046 | 469 |
| 659 | 3300037418 | Ga0395900_0010889 | Ga0395900_0010889_4708_6288 | 469 |
| 660 | 3300037418 | Ga0395900_0014902 | Ga0395900_0014902_4191_5660 | 469 |
| 661 | 3300037471 | Ga0395905_0006399 | Ga0395905_0006399_2022_3602 | 469 |
| 662 | 3300038443 | Ga0395901_0008806 | Ga0395901_0008806_7311_8891 | 469 |
| 663 | 3300046460 | Ga0495638_0073531 | Ga0495638_0073531_150_1649 | 469 |
| 664 | 3300049570 | Ga0501033_0008106 | Ga0501033_0008106_566_2041 | 469 |
| 665 | 3300049571 | Ga0501034_0126368 | Ga0501034_0126368_698_2173 | 469 |
| 666 | 3300049823 | Ga0501044_0088571 | Ga0501044_0088571_1113_2588 | 469 |
| 667 | 3300005530 | Ga0070679_100146456 | Ga0070679_1001464562 | 470 |
| 668 | 3300009545 | Ga0105237_10009074 | Ga0105237_100090749 | 470 |
| 669 | 3300025914 | Ga0207671_10009085 | Ga0207671_100090852 | 470 |
| 670 | 3300031344 | Ga0265316_10098584 | Ga0265316_100985841 | 470 |
| 671 | 3300031548 | Ga0307408_100000629 | Ga0307408_10000062912 | 470 |
| 672 | 3300031548 | Ga0307408_100000729 | Ga0307408_1000007294 | 470 |
| 673 | 3300032002 | Ga0307416_100213981 | Ga0307416_1002139812 | 470 |
| 674 | 3300041511 | Ga0451855_1231084 | Ga0451855_1231084_665_2134 | 470 |
| 675 | 3300053080 | Ga0500635_0014106 | Ga0500635_0014106_199_1668 | 470 |
| 676 | 3300044673 | Ga0453683_0021427 | Ga0453683_0021427_622_2100 | 471 |
| 677 | 3300005289 | Ga0065704_10000251 | Ga0065704_100002514 | 472 |
| 678 | 3300013100 | Ga0157373_10000634 | Ga0157373_1000063414 | 472 |
| 679 | 3300013102 | Ga0157371_10005499 | Ga0157371_100054998 | 472 |
| 680 | 3300015261 | Ga0182006_1001502 | Ga0182006_10015024 | 472 |
| 681 | 3300031727 | Ga0316576_10055572 | Ga0316576_100555722 | 472 |
| 682 | 3300031911 | Ga0307412_10000009 | Ga0307412_10000009293 | 472 |
| 683 | 3300032002 | Ga0307416_100000344 | Ga0307416_10000034416 | 472 |
| 684 | 3300037471 | Ga0395905_0000023 | Ga0395905_0000023_100057_101526 | 472 |
| 685 | 3300042876 | Ga0451577_0105694 | Ga0451577_0105694_247_1728 | 472 |
| 686 | 3300044673 | Ga0453683_0000072 | Ga0453683_0000072_97923_99404 | 472 |
| 687 | 3300044673 | Ga0453683_0003129 | Ga0453683_0003129_8650_10131 | 472 |
| 688 | 3300044673 | Ga0453683_0040223 | Ga0453683_0040223_1393_2874 | 472 |
| 689 | 3300044673 | Ga0453683_0140678 | Ga0453683_0140678_32_1513 | 472 |
| 690 | 3300044712 | Ga0453684_0000091 | Ga0453684_0000091_146620_148101 | 472 |
| 691 | 3300044712 | Ga0453684_0010910 | Ga0453684_0010910_12310_13794 | 472 |
| 692 | 3300044712 | Ga0453684_0023474 | Ga0453684_0023474_4457_5923 | 472 |
| 693 | 3300044712 | Ga0453684_0038874 | Ga0453684_0038874_1453_2934 | 472 |
| 694 | 3300044712 | Ga0453684_0090744 | Ga0453684_0090744_1444_2925 | 472 |
| 695 | 3300044712 | Ga0453684_0148230 | Ga0453684_0148230_1094_2575 | 472 |
| 696 | 3300044712 | Ga0453684_0156818 | Ga0453684_0156818_351_1832 | 472 |
| 697 | 3300045051 | Ga0451576_0000280 | Ga0451576_0000280_68698_70179 | 472 |
| 698 | 3300045051 | Ga0451576_0003878 | Ga0451576_0003878_8034_9515 | 472 |
| 699 | 3300045051 | Ga0451576_0028814 | Ga0451576_0028814_74_1555 | 472 |
| 700 | 3300045051 | Ga0451576_0085109 | Ga0451576_0085109_898_2364 | 472 |
| 701 | 3300053093 | Ga0500651_0000139 | Ga0500651_0000139_12456_13988 | 472 |
| 702 | 3300053156 | Ga0500622_0007717 | Ga0500622_0007717_1034_2506 | 472 |
| 703 | 3300005289 | Ga0065704_10082553 | Ga0065704_100825532 | 473 |
| 704 | 3300005327 | Ga0070658_10000047 | Ga0070658_1000004761 | 473 |
| 705 | 3300005563 | Ga0068855_100042147 | Ga0068855_1000421472 | 473 |
| 706 | 3300005834 | Ga0068851_10000042 | Ga0068851_1000004266 | 473 |
| 707 | 3300013102 | Ga0157371_10001005 | Ga0157371_1000100515 | 473 |
| 708 | 3300013104 | Ga0157370_10001850 | Ga0157370_100018507 | 473 |
| 709 | 3300013104 | Ga0157370_10018303 | Ga0157370_100183033 | 473 |
| 710 | 3300014326 | Ga0157380_10144727 | Ga0157380_101447272 | 473 |
| 711 | 3300014497 | Ga0182008_10000200 | Ga0182008_1000020039 | 473 |
| 712 | 3300015261 | Ga0182006_1001978 | Ga0182006_10019789 | 473 |
| 713 | 3300025321 | Ga0207656_10000176 | Ga0207656_1000017622 | 473 |
| 714 | 3300025909 | Ga0207705_10000052 | Ga0207705_1000005261 | 473 |
| 715 | 3300025949 | Ga0207667_10005189 | Ga0207667_1000518911 | 473 |
| 716 | 3300031344 | Ga0265316_10006843 | Ga0265316_100068434 | 473 |
| 717 | 3300031691 | Ga0316579_10004878 | Ga0316579_100048783 | 473 |
| 718 | 3300031727 | Ga0316576_10009153 | Ga0316576_100091532 | 473 |
| 719 | 3300031728 | Ga0316578_10046552 | Ga0316578_100465522 | 473 |
| 720 | 3300031733 | Ga0316577_10034188 | Ga0316577_100341882 | 473 |
| 721 | 3300031995 | Ga0307409_100223277 | Ga0307409_1002232771 | 473 |
| 722 | 3300032004 | Ga0307414_10000078 | Ga0307414_100000788 | 473 |
| 723 | 3300032004 | Ga0307414_10142145 | Ga0307414_101421453 | 473 |
| 724 | 3300032126 | Ga0307415_100048847 | Ga0307415_1000488472 | 473 |
| 725 | 3300035398 | Ga0316574_0085756 | Ga0316574_0085756_192_1667 | 473 |
| 726 | 3300036712 | Ga0316584_0008704 | Ga0316584_0008704_1918_3387 | 473 |
| 727 | 3300042876 | Ga0451577_0002841 | Ga0451577_0002841_6265_7743 | 473 |
| 728 | 3300042876 | Ga0451577_0122443 | Ga0451577_0122443_810_2291 | 473 |
| 729 | 3300044712 | Ga0453684_0000792 | Ga0453684_0000792_95195_96673 | 473 |
| 730 | 3300044712 | Ga0453684_0010913 | Ga0453684_0010913_8877_10376 | 473 |
| 731 | 3300044712 | Ga0453684_0011356 | Ga0453684_0011356_8435_9910 | 473 |
| 732 | 3300044712 | Ga0453684_0020471 | Ga0453684_0020471_5639_7114 | 473 |
| 733 | 3300044712 | Ga0453684_0125513 | Ga0453684_0125513_962_2443 | 473 |
| 734 | 3300044712 | Ga0453684_0203347 | Ga0453684_0203347_771_2246 | 473 |
| 735 | 3300045051 | Ga0451576_0036406 | Ga0451576_0036406_2969_4444 | 473 |
| 736 | 3300045051 | Ga0451576_0097164 | Ga0451576_0097164_268_1746 | 473 |
| 737 | 3300048925 | Ga0496122_0001073 | Ga0496122_0001073_29942_31411 | 473 |
| 738 | 3300048926 | Ga0496123_0008196 | Ga0496123_0008196_575_2044 | 473 |
| 739 | 3300003323 | rootH1_10115330 | rootH1_101153305 | 475 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5g5r-assembly1.cif.gz_A | cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - apo form | 0.9336 | 98 | 215 |
| 1vrd-assembly1.cif.gz_A | crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution | 0.9163 | 12 | 452 |
| 3ffs-assembly1.cif.gz_B | the crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase | 0.9143 | 11 | 452 |
| 1vrd-assembly1.cif.gz_A | crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution | 0.9107 | 12 | 452 |
| 3khj-assembly2.cif.gz_E | c. parvum inosine monophosphate dehydrogenase bound by inhibitor c64 | 0.9106 | 11 | 453 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dqwB02 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9409 | 100 | 208 | 3.10.580.10 |
| af_P17115_194_318_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.91 | 98 | 208 | 3.10.580.10 |
| 2o16A00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9068 | 98 | 211 | 3.10.580.10 |
| af_Q8BGM7_334_480_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9052 | 98 | 208 | 3.10.580.10 |
| af_Q2FXM2_188_307_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9032 | 100 | 211 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A348TRI4-F1-model_v4 | IMP dehydrogenase (EC 1.1.1.205) | 0.966 | 103 | 232 |
GO:0003938
GO:0006183 |
| AF-A0A800M5P1-F1-model_v4 | CBS domain-containing protein | 0.9621 | 6 | 349 |
GO:0003938
GO:0006177 GO:0006183 GO:0046872 |
| AF-A0A2T2SI51-F1-model_v4 | Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) | 0.9612 | 7 | 376 |
GO:0003938
GO:0006177 GO:0006183 GO:0046872 |
| AF-A0A2E7FDG8-F1-model_v4 | IMP dehydrogenase (EC 1.1.1.205) | 0.9593 | 4 | 288 |
GO:0003938
GO:0006183 |
| AF-A0A6N9EZ52-F1-model_v4 | deleted | 0.9592 | 1 | 266 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar