F478446

General Info

Members Datasets Scaffolds Average Seq Length
739 299 739 491

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100001083|Ga0070662_10000108317
Length 542
Sequence MKMQQGDTFPAASFFVEPGRRGTDGQWAGLPSGPKPNNAILLAMATTTRPSTSKQPASPAKTGSGLSRIKGSERDAVEGVSRVRSDVVLTFDDVLLTPRHSLVHPKDVTTTSRFTRGIPLNVPFASAAMDTVTESDMAXXXXRAGGIGVIHKNMSIDRQAAEVDRVKRSESGMILNPITLSPEGTLREAVALMRRFKISGVPIVNRDGQLVGIITNRDLQFERNLDRPLREAMTSKNLVTAPLGTTLDEAEAILGKHRIEKLPVVDEKGTLRGLITVKDIHKRRDFPNANKDQHGRLRVAAAIGASNFRDRARALVDAGVDVLVVDTAHGHSEGVLEATSIVRDMFPDVQLVAGNIAPGSICTTRVVTGVGVPQLTAIFDAVEGAGDVPVIADGGIKYSGDIVKALAAGAASVMMGSMLAGTEESPGESMLLEGRRFKMIRGMGSLAAMQDGSADRYFQEGEMSARKLVPEGIEGRVPFKGPVSDVLFQMVGGLRSGMGYVGCANIEQLRTESEFVRITSAGLRESHPHDVTITREAPNYSL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 0.95
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10115330 3300003323 Bacteria 5217
2 Ga0065704_10000251 3300005289 Bacteria 69899
3 Ga0065704_10082553 3300005289 Bacteria 3579
4 Ga0065707_10092569 3300005295 Bacteria 3751
5 Ga0070658_10000047 3300005327 Bacteria 129483
6 Ga0070658_10005468 3300005327 Bacteria 10303
7 Ga0070658_10011659 3300005327 Bacteria 7049
8 Ga0070658_10083059 3300005327 Bacteria 2633
9 Ga0070676_10001172 3300005328 Bacteria 13129
10 Ga0070676_10004316 3300005328 Bacteria 7469
11 Ga0070676_10011173 3300005328 Bacteria 4879
12 Ga0070683_100003778 3300005329 Bacteria 12361
13 Ga0070683_100006226 3300005329 Bacteria 10008
14 Ga0070683_100006465 3300005329 Bacteria 9836
15 Ga0070683_100007195 3300005329 Bacteria 9385
16 Ga0070683_100017278 3300005329 Bacteria 6375
17 Ga0070683_100017780 3300005329 Bacteria 6282
18 Ga0070683_100017906 3300005329 Bacteria 6262
19 Ga0070683_100039807 3300005329 Bacteria 4317
20 Ga0070683_100186461 3300005329 Bacteria 1969
21 Ga0070690_100014715 3300005330 Bacteria 4647
22 Ga0070670_100062618 3300005331 Bacteria 3193
23 Ga0070670_100088062 3300005331 Bacteria 2669
24 Ga0070677_10036695 3300005333 Bacteria 1908
25 Ga0068869_100001479 3300005334 Bacteria 13914
26 Ga0068869_100037987 3300005334 Bacteria 3427
27 Ga0070680_100004841 3300005336 Bacteria 10139
28 Ga0070680_100005076 3300005336 Bacteria 9931
29 Ga0070680_100008998 3300005336 Bacteria 7657
30 Ga0070680_100010389 3300005336 Bacteria 7177
31 Ga0070680_100013243 3300005336 Bacteria 6421
32 Ga0070680_100017623 3300005336 Bacteria 5633
33 Ga0070680_100037373 3300005336 Bacteria 3923
34 Ga0070680_100039287 3300005336 Bacteria 3830
35 Ga0070680_100108761 3300005336 Bacteria 2306
36 Ga0070680_100155218 3300005336 Bacteria 1923
37 Ga0070682_100005004 3300005337 Bacteria 7366
38 Ga0070682_100009731 3300005337 Bacteria 5443
39 Ga0070682_100036763 3300005337 Bacteria 2994
40 Ga0068868_100012394 3300005338 Bacteria 6232
41 Ga0068868_100076407 3300005338 Bacteria 2678
42 Ga0070660_100002151 3300005339 Bacteria 13596
43 Ga0070660_100013004 3300005339 Bacteria 5957
44 Ga0070660_100127725 3300005339 Bacteria 2032
45 Ga0070689_100030654 3300005340 Bacteria 4083
46 Ga0070691_10007806 3300005341 Bacteria 4898
47 Ga0070687_100000549 3300005343 Bacteria 12572
48 Ga0070687_100010099 3300005343 Bacteria 4066
49 Ga0070661_100000331 3300005344 Bacteria 37971
50 Ga0070661_100003958 3300005344 Bacteria 10188
51 Ga0070661_100042448 3300005344 Bacteria 3319
52 Ga0070668_100000182 3300005347 Bacteria 40680
53 Ga0070669_100003393 3300005353 Bacteria 11462
54 Ga0070669_100021469 3300005353 Bacteria 4614
55 Ga0070669_100037086 3300005353 Bacteria 3535
56 Ga0070675_100002184 3300005354 Bacteria 14502
57 Ga0070675_100016435 3300005354 Bacteria 5873
58 Ga0070674_100000605 3300005356 Bacteria 18132
59 Ga0070674_100009667 3300005356 Bacteria 5786
60 Ga0070674_100048685 3300005356 Bacteria 2910
61 Ga0070673_100018937 3300005364 Bacteria 4934
62 Ga0070673_100043692 3300005364 Bacteria 3464
63 Ga0070673_100071563 3300005364 Bacteria 2787
64 Ga0070688_100019639 3300005365 Bacteria 3917
65 Ga0070659_100000100 3300005366 Bacteria 63786
66 Ga0070659_100000927 3300005366 Bacteria 21513
67 Ga0070659_100002500 3300005366 Bacteria 13057
68 Ga0070659_100011745 3300005366 Bacteria 6482
69 Ga0070659_100013618 3300005366 Bacteria 6060
70 Ga0070659_100037062 3300005366 Bacteria 3802
71 Ga0070659_100114982 3300005366 Bacteria 2174
72 Ga0070667_100003736 3300005367 Bacteria 12923
73 Ga0070667_100023342 3300005367 Bacteria 5131
74 Ga0070709_10011304 3300005434 Bacteria 4971
75 Ga0070714_100009543 3300005435 Bacteria 7635
76 Ga0070714_100009617 3300005435 Bacteria 7609
77 Ga0070714_100031774 3300005435 Bacteria 4407
78 Ga0070711_100000962 3300005439 Bacteria 15267
79 Ga0070705_100047597 3300005440 Bacteria 2480
80 Ga0070694_100012174 3300005444 Bacteria 5344
81 Ga0070708_100000045 3300005445 Bacteria 81076
82 Ga0070708_100000788 3300005445 Bacteria 23894
83 Ga0070708_100038954 3300005445 Bacteria 4156
84 Ga0070708_100068887 3300005445 Bacteria 3181
85 Ga0070662_100000596 3300005457 Bacteria 22019
86 Ga0070662_100001083 3300005457 Bacteria 16611
87 Ga0070662_100002883 3300005457 Bacteria 10669
88 Ga0070662_100107955 3300005457 Bacteria 2116
89 Ga0070681_10000473 3300005458 Bacteria 32789
90 Ga0070681_10003552 3300005458 Bacteria 14625
91 Ga0070681_10003870 3300005458 Bacteria 14086
92 Ga0070681_10004476 3300005458 Bacteria 13323
93 Ga0070681_10008927 3300005458 Bacteria 9853
94 Ga0070681_10027309 3300005458 Bacteria 5738
95 Ga0070681_10034461 3300005458 Bacteria 5083
96 Ga0070681_10110061 3300005458 Bacteria 2695
97 Ga0070681_10187652 3300005458 Bacteria 1987
98 Ga0070685_10037465 3300005466 Bacteria 2747
99 Ga0070706_100006172 3300005467 Bacteria 11337
100 Ga0070707_100000955 3300005468 Bacteria 28664
101 Ga0070707_100019620 3300005468 Bacteria 6372
102 Ga0070707_100055557 3300005468 Bacteria 3796
103 Ga0070698_100000535 3300005471 Bacteria 40564
104 Ga0070698_100030948 3300005471 Bacteria 5550
105 Ga0070698_100072240 3300005471 Bacteria 3459
106 Ga0070698_100121428 3300005471 Bacteria 2573
107 Ga0070699_100158927 3300005518 Bacteria 2000
108 Ga0070699_100216923 3300005518 Bacteria 1704
109 Ga0070679_100001192 3300005530 Bacteria 22842
110 Ga0070679_100002731 3300005530 Bacteria 16073
111 Ga0070679_100003029 3300005530 Bacteria 15347
112 Ga0070679_100004557 3300005530 Bacteria 12796
113 Ga0070679_100006728 3300005530 Bacteria 10720
114 Ga0070679_100009679 3300005530 Bacteria 9117
115 Ga0070679_100016156 3300005530 Bacteria 7192
116 Ga0070679_100019454 3300005530 Bacteria 6601
117 Ga0070679_100037856 3300005530 Bacteria 4793
118 Ga0070679_100068102 3300005530 Bacteria 3551
119 Ga0070679_100127335 3300005530 Bacteria 2528
120 Ga0070679_100146456 3300005530 Bacteria 2339
121 Ga0070679_100181669 3300005530 Bacteria 2076
122 Ga0070684_100000255 3300005535 Bacteria 36870
123 Ga0070684_100026387 3300005535 Bacteria 4893
124 Ga0070684_100029652 3300005535 Bacteria 4639
125 Ga0070684_100046227 3300005535 Bacteria 3772
126 Ga0070684_100154688 3300005535 Bacteria 2079
127 Ga0068853_100005516 3300005539 Bacteria 9918
128 Ga0070672_100016273 3300005543 Bacteria 5321
129 Ga0070686_100024875 3300005544 Bacteria 3594
130 Ga0070695_100010556 3300005545 Bacteria 5517
131 Ga0070695_100028288 3300005545 Bacteria 3478
132 Ga0070695_100029087 3300005545 Bacteria 3432
133 Ga0070695_100064466 3300005545 Bacteria 2384
134 Ga0070695_100177326 3300005545 Bacteria 1507
135 Ga0070696_100000113 3300005546 Bacteria 41571
136 Ga0070693_100007102 3300005547 Bacteria 5458
137 Ga0070693_100007872 3300005547 Bacteria 5226
138 Ga0070693_100011143 3300005547 Bacteria 4525
139 Ga0070665_100000399 3300005548 Bacteria 63817
140 Ga0070704_100110884 3300005549 Bacteria 2087
141 Ga0068855_100003992 3300005563 Bacteria 18023
142 Ga0068855_100022823 3300005563 Bacteria 7499
143 Ga0068855_100028001 3300005563 Bacteria 6741
144 Ga0068855_100031885 3300005563 Bacteria 6291
145 Ga0068855_100038801 3300005563 Bacteria 5657
146 Ga0068855_100042147 3300005563 Bacteria 5409
147 Ga0068855_100062029 3300005563 Bacteria 4366
148 Ga0070664_100000990 3300005564 Bacteria 22227
149 Ga0070664_100003425 3300005564 Bacteria 12811
150 Ga0070664_100003696 3300005564 Bacteria 12333
151 Ga0070664_100069625 3300005564 Bacteria 3011
152 Ga0068857_100006087 3300005577 Bacteria 10303
153 Ga0068857_100020444 3300005577 Bacteria 5823
154 Ga0068857_100049820 3300005577 Bacteria 3716
155 Ga0068857_100066504 3300005577 Bacteria 3207
156 Ga0068856_100003727 3300005614 Bacteria 15284
157 Ga0068856_100022892 3300005614 Bacteria 6076
158 Ga0070702_100000366 3300005615 Bacteria 15805
159 Ga0068852_100006987 3300005616 Bacteria 8214
160 Ga0068852_100012815 3300005616 Bacteria 6389
161 Ga0068852_100025942 3300005616 Bacteria 4756
162 Ga0068852_100031878 3300005616 Bacteria 4357
163 Ga0068859_100013810 3300005617 Bacteria 8097
164 Ga0068859_100028872 3300005617 Bacteria 5563
165 Ga0068859_100134064 3300005617 Bacteria 2548
166 Ga0068864_100001549 3300005618 Bacteria 18963
167 Ga0068864_100045010 3300005618 Bacteria 3785
168 Ga0068866_10000381 3300005718 Bacteria 20863
169 Ga0068866_10021583 3300005718 Bacteria 2968
170 Ga0068861_100000159 3300005719 Bacteria 35347
171 Ga0068861_100012359 3300005719 Bacteria 5953
172 Ga0068851_10000042 3300005834 Bacteria 88904
173 Ga0068851_10051371 3300005834 Bacteria 2095
174 Ga0068870_10009478 3300005840 Bacteria 4432
175 Ga0068863_100003160 3300005841 Bacteria 16273
176 Ga0068863_100128205 3300005841 Bacteria 2421
177 Ga0068858_100005316 3300005842 Bacteria 12622
178 Ga0068860_100119338 3300005843 Bacteria 2525
179 Ga0068862_100001333 3300005844 Bacteria 22917
180 Ga0068862_100036850 3300005844 Bacteria 4145
181 Ga0081539_10000174 3300005985 Bacteria 151265
182 Ga0081539_10009701 3300005985 Bacteria 7972
183 Ga0070717_10007977 3300006028 Bacteria 7885
184 Ga0070712_100001803 3300006175 Bacteria 13084
185 Ga0070712_100067208 3300006175 Bacteria 2550
186 Ga0097621_100034285 3300006237 Bacteria 4048
187 Ga0075430_100000568 3300006846 Bacteria 28042
188 Ga0075430_100002373 3300006846 Bacteria 15637
189 Ga0075430_100007578 3300006846 Bacteria 9172
190 Ga0075430_100056456 3300006846 Bacteria 3301
191 Ga0075430_100068805 3300006846 Bacteria 2970
192 Ga0075431_100001735 3300006847 Bacteria 20509
193 Ga0075431_100046401 3300006847 Bacteria 4480
194 Ga0075433_10018833 3300006852 Bacteria 5745
195 Ga0075434_100202041 3300006871 Bacteria 2007
196 Ga0075429_100007625 3300006880 Bacteria 9398
197 Ga0068865_100004459 3300006881 Bacteria 8443
198 Ga0068865_100057701 3300006881 Bacteria 2709
199 Ga0075436_100001419 3300006914 Bacteria 16275
200 Ga0097620_100013811 3300006931 Bacteria 8097
201 Ga0097620_100028872 3300006931 Bacteria 5563
202 Ga0097620_100134063 3300006931 Bacteria 2548
203 Ga0105240_10005639 3300009093 Bacteria 18584
204 Ga0105240_10012038 3300009093 Bacteria 11991
205 Ga0105240_10031972 3300009093 Bacteria 6816
206 Ga0105240_10122645 3300009093 Bacteria 3127
207 Ga0105240_10129986 3300009093 Bacteria 3022
208 Ga0105240_10136438 3300009093 Bacteria 2938
209 Ga0105240_10198875 3300009093 Bacteria 2350
210 Ga0111539_10018419 3300009094 Bacteria 8650
211 Ga0111539_10048865 3300009094 Bacteria 5049
212 Ga0111539_10124865 3300009094 Bacteria 3016
213 Ga0111539_10152236 3300009094 Bacteria 2707
214 Ga0111539_10241863 3300009094 Bacteria 2101
215 Ga0105245_10004656 3300009098 Bacteria 12124
216 Ga0105245_10028512 3300009098 Bacteria 4926
217 Ga0114129_10010360 3300009147 Bacteria 13295
218 Ga0105241_10000296 3300009174 Bacteria 37208
219 Ga0105241_10009823 3300009174 Bacteria 7032
220 Ga0105242_10003851 3300009176 Bacteria 11669
221 Ga0105242_10014450 3300009176 Bacteria 6118
222 Ga0105242_10147146 3300009176 Bacteria 2050
223 Ga0105248_10034311 3300009177 Bacteria 5672
224 Ga0105237_10002557 3300009545 Bacteria 22478
225 Ga0105237_10009074 3300009545 Bacteria 10686
226 Ga0105238_10021425 3300009551 Bacteria 6583
227 Ga0105249_10000061 3300009553 Bacteria 153313
228 Ga0105249_10000251 3300009553 Bacteria 59080
229 Ga0105249_10000572 3300009553 Bacteria 33735
230 Ga0105249_10027811 3300009553 Bacteria 5103
231 Ga0105239_10035253 3300010375 Bacteria 5495
232 Ga0105239_10046185 3300010375 Bacteria 4772
233 Ga0105246_10000522 3300011119 Bacteria 20988
234 Ga0105246_10122408 3300011119 Bacteria 1930
235 Ga0157373_10000069 3300013100 Bacteria 91687
236 Ga0157373_10000634 3300013100 Bacteria 27559
237 Ga0157373_10009825 3300013100 Bacteria 7053
238 Ga0157373_10016451 3300013100 Bacteria 5394
239 Ga0157373_10072212 3300013100 Bacteria 2436
240 Ga0157371_10001005 3300013102 Bacteria 31122
241 Ga0157371_10005499 3300013102 Bacteria 10664
242 Ga0157371_10030300 3300013102 Bacteria 3903
243 Ga0157371_10034702 3300013102 Bacteria 3617
244 Ga0157370_10001850 3300013104 Bacteria 26088
245 Ga0157370_10009110 3300013104 Bacteria 10648
246 Ga0157370_10018303 3300013104 Bacteria 7046
247 Ga0157370_10021084 3300013104 Bacteria 6497
248 Ga0157370_10128779 3300013104 Bacteria 2362
249 Ga0157369_10009566 3300013105 Bacteria 11087
250 Ga0157369_10041660 3300013105 Bacteria 5012
251 Ga0157369_10068959 3300013105 Bacteria 3799
252 Ga0157369_10156786 3300013105 Bacteria 2404
253 Ga0157369_10282407 3300013105 Bacteria 1729
254 Ga0157374_10030377 3300013296 Bacteria 4905
255 Ga0157374_10056699 3300013296 Bacteria 3658
256 Ga0157378_10001106 3300013297 Bacteria 24548
257 Ga0163162_10000718 3300013306 Bacteria 30727
258 Ga0163162_10021283 3300013306 Bacteria 6384
259 Ga0157372_10000462 3300013307 Bacteria 44685
260 Ga0157372_10004316 3300013307 Bacteria 15198
261 Ga0157372_10004800 3300013307 Bacteria 14362
262 Ga0157372_10004905 3300013307 Bacteria 14221
263 Ga0157372_10007168 3300013307 Bacteria 11865
264 Ga0157372_10009706 3300013307 Bacteria 10234
265 Ga0157372_10011953 3300013307 Bacteria 9249
266 Ga0157372_10033524 3300013307 Bacteria 5642
267 Ga0157372_10039293 3300013307 Bacteria 5222
268 Ga0157372_10043164 3300013307 Bacteria 4991
269 Ga0157372_10052660 3300013307 Bacteria 4533
270 Ga0157372_10059189 3300013307 Bacteria 4284
271 Ga0157372_10296199 3300013307 Bacteria 1881
272 Ga0157375_10013585 3300013308 Bacteria 7252
273 Ga0157375_10060624 3300013308 Bacteria 3753
274 Ga0163163_10022786 3300014325 Bacteria 5935
275 Ga0163163_10072742 3300014325 Bacteria 3427
276 Ga0163163_10093096 3300014325 Bacteria 3030
277 Ga0163163_10302315 3300014325 Bacteria 1652
278 Ga0157380_10052386 3300014326 Bacteria 3232
279 Ga0157380_10099246 3300014326 Bacteria 2421
280 Ga0157380_10144727 3300014326 Bacteria 2047
281 Ga0182008_10000200 3300014497 Bacteria 46936
282 Ga0182008_10005125 3300014497 Bacteria 7521
283 Ga0157377_10001101 3300014745 Bacteria 11422
284 Ga0157377_10036782 3300014745 Bacteria 2695
285 Ga0157376_10014136 3300014969 Bacteria 5979
286 Ga0182006_1001502 3300015261 Bacteria 13967
287 Ga0182006_1001978 3300015261 Bacteria 11606
288 Ga0206353_10072611 3300020082 Bacteria 2203
289 Ga0213876_10082548 3300021384 Bacteria 1700
290 Ga0224712_10024797 3300022467 Bacteria 2100
291 Ga0209026_1002502 3300025250 Bacteria 6830
292 Ga0207697_10003842 3300025315 Bacteria 7329
293 Ga0207656_10000176 3300025321 Bacteria 23119
294 Ga0207642_10049506 3300025899 Bacteria 1889
295 Ga0207680_10040035 3300025903 Bacteria 2724
296 Ga0207699_10008236 3300025906 Bacteria 5133
297 Ga0207699_10105072 3300025906 Bacteria 1800
298 Ga0207645_10001472 3300025907 Bacteria 19240
299 Ga0207645_10001749 3300025907 Bacteria 17617
300 Ga0207645_10014184 3300025907 Bacteria 5338
301 Ga0207645_10076105 3300025907 Bacteria 2149
302 Ga0207643_10002930 3300025908 Bacteria 9211
303 Ga0207643_10024224 3300025908 Bacteria 3349
304 Ga0207705_10000052 3300025909 Bacteria 168319
305 Ga0207705_10002060 3300025909 Bacteria 15635
306 Ga0207705_10010105 3300025909 Bacteria 6871
307 Ga0207705_10011492 3300025909 Bacteria 6403
308 Ga0207705_10017850 3300025909 Bacteria 5074
309 Ga0207684_10016420 3300025910 Bacteria 6356
310 Ga0207654_10000519 3300025911 Bacteria 22137
311 Ga0207654_10025846 3300025911 Bacteria 3173
312 Ga0207654_10056097 3300025911 Bacteria 2284
313 Ga0207707_10000423 3300025912 Bacteria 44206
314 Ga0207707_10002786 3300025912 Bacteria 15596
315 Ga0207707_10005244 3300025912 Bacteria 11358
316 Ga0207707_10016185 3300025912 Bacteria 6506
317 Ga0207707_10027874 3300025912 Bacteria 4938
318 Ga0207707_10031879 3300025912 Bacteria 4614
319 Ga0207707_10036704 3300025912 Bacteria 4284
320 Ga0207707_10036988 3300025912 Bacteria 4265
321 Ga0207707_10069146 3300025912 Bacteria 3078
322 Ga0207695_10000228 3300025913 Bacteria 150118
323 Ga0207695_10002260 3300025913 Bacteria 28830
324 Ga0207695_10007739 3300025913 Bacteria 13612
325 Ga0207695_10020940 3300025913 Bacteria 7473
326 Ga0207695_10025474 3300025913 Bacteria 6620
327 Ga0207695_10046486 3300025913 Bacteria 4602
328 Ga0207671_10009085 3300025914 Bacteria 8352
329 Ga0207671_10012340 3300025914 Bacteria 6876
330 Ga0207693_10003926 3300025915 Bacteria 12660
331 Ga0207663_10020208 3300025916 Bacteria 3768
332 Ga0207660_10004363 3300025917 Bacteria 9223
333 Ga0207660_10004590 3300025917 Bacteria 8999
334 Ga0207660_10011400 3300025917 Bacteria 5783
335 Ga0207660_10022179 3300025917 Bacteria 4277
336 Ga0207660_10024837 3300025917 Bacteria 4060
337 Ga0207660_10028354 3300025917 Bacteria 3829
338 Ga0207660_10058005 3300025917 Bacteria 2775
339 Ga0207660_10061568 3300025917 Bacteria 2701
340 Ga0207660_10084435 3300025917 Bacteria 2340
341 Ga0207662_10002391 3300025918 Bacteria 9414
342 Ga0207662_10006744 3300025918 Bacteria 6210
343 Ga0207662_10053993 3300025918 Bacteria 2394
344 Ga0207657_10012334 3300025919 Bacteria 8442
345 Ga0207657_10052851 3300025919 Bacteria 3524
346 Ga0207657_10089345 3300025919 Bacteria 2574
347 Ga0207657_10119649 3300025919 Bacteria 2167
348 Ga0207649_10000977 3300025920 Bacteria 17727
349 Ga0207649_10046601 3300025920 Bacteria 2664
350 Ga0207652_10000636 3300025921 Bacteria 34690
351 Ga0207652_10013395 3300025921 Bacteria 6638
352 Ga0207652_10042995 3300025921 Bacteria 3847
353 Ga0207652_10055836 3300025921 Bacteria 3398
354 Ga0207652_10062110 3300025921 Bacteria 3228
355 Ga0207652_10084147 3300025921 Bacteria 2786
356 Ga0207652_10104959 3300025921 Bacteria 2500
357 Ga0207652_10111016 3300025921 Bacteria 2431
358 Ga0207646_10001505 3300025922 Bacteria 28666
359 Ga0207646_10014532 3300025922 Bacteria 7472
360 Ga0207646_10092391 3300025922 Bacteria 2709
361 Ga0207681_10002613 3300025923 Bacteria 11407
362 Ga0207681_10002918 3300025923 Bacteria 10789
363 Ga0207681_10024834 3300025923 Bacteria 3848
364 Ga0207694_10003260 3300025924 Bacteria 12930
365 Ga0207650_10005032 3300025925 Bacteria 9023
366 Ga0207659_10005657 3300025926 Bacteria 7604
367 Ga0207659_10015665 3300025926 Bacteria 4919
368 Ga0207700_10002118 3300025928 Bacteria 11339
369 Ga0207700_10107713 3300025928 Bacteria 2236
370 Ga0207700_10146869 3300025928 Bacteria 1944
371 Ga0207664_10009782 3300025929 Bacteria 6746
372 Ga0207690_10000609 3300025932 Bacteria 23117
373 Ga0207690_10013013 3300025932 Bacteria 4990
374 Ga0207690_10112282 3300025932 Bacteria 1965
375 Ga0207706_10000015 3300025933 Bacteria 174140
376 Ga0207706_10002211 3300025933 Bacteria 18979
377 Ga0207709_10071646 3300025935 Bacteria 2202
378 Ga0207704_10004757 3300025938 Bacteria 6230
379 Ga0207704_10012345 3300025938 Bacteria 4241
380 Ga0207691_10000840 3300025940 Bacteria 30601
381 Ga0207691_10014192 3300025940 Bacteria 7601
382 Ga0207711_10002798 3300025941 Bacteria 15336
383 Ga0207689_10005150 3300025942 Bacteria 11745
384 Ga0207689_10007205 3300025942 Bacteria 9770
385 Ga0207689_10023712 3300025942 Bacteria 5147
386 Ga0207661_10000472 3300025944 Bacteria 25990
387 Ga0207661_10004037 3300025944 Bacteria 10256
388 Ga0207661_10004340 3300025944 Bacteria 9927
389 Ga0207661_10009167 3300025944 Bacteria 7096
390 Ga0207661_10012610 3300025944 Bacteria 6151
391 Ga0207661_10020685 3300025944 Bacteria 4924
392 Ga0207661_10033947 3300025944 Bacteria 3963
393 Ga0207661_10052768 3300025944 Bacteria 3250
394 Ga0207661_10074879 3300025944 Bacteria 2776
395 Ga0207661_10122373 3300025944 Bacteria 2217
396 Ga0207679_10003434 3300025945 Bacteria 9776
397 Ga0207667_10005189 3300025949 Bacteria 15905
398 Ga0207667_10022814 3300025949 Bacteria 6903
399 Ga0207667_10082568 3300025949 Bacteria 3328
400 Ga0207667_10107699 3300025949 Bacteria 2875
401 Ga0207667_10119480 3300025949 Bacteria 2716
402 Ga0207651_10046823 3300025960 Bacteria 2911
403 Ga0207712_10000144 3300025961 Bacteria 74254
404 Ga0207712_10002363 3300025961 Bacteria 12229
405 Ga0207712_10002544 3300025961 Bacteria 11722
406 Ga0207712_10004478 3300025961 Bacteria 8822
407 Ga0207668_10003462 3300025972 Bacteria 9261
408 Ga0207668_10087489 3300025972 Bacteria 2279
409 Ga0207640_10000931 3300025981 Bacteria 16362
410 Ga0207640_10030753 3300025981 Bacteria 3310
411 Ga0207658_10013897 3300025986 Bacteria 5509
412 Ga0207658_10094189 3300025986 Bacteria 2330
413 Ga0207677_10003526 3300026023 Bacteria 8290
414 Ga0207703_10003749 3300026035 Bacteria 12648
415 Ga0207703_10153607 3300026035 Bacteria 2009
416 Ga0207639_10007445 3300026041 Bacteria 7466
417 Ga0207639_10082849 3300026041 Bacteria 2544
418 Ga0207678_10015292 3300026067 Bacteria 6750
419 Ga0207678_10078502 3300026067 Bacteria 2827
420 Ga0207708_10006826 3300026075 Bacteria 8441
421 Ga0207708_10016424 3300026075 Bacteria 5567
422 Ga0207702_10007494 3300026078 Bacteria 9303
423 Ga0207702_10159909 3300026078 Bacteria 2056
424 Ga0207641_10017047 3300026088 Bacteria 5944
425 Ga0207648_10000010 3300026089 Bacteria 202461
426 Ga0207648_10005675 3300026089 Bacteria 12524
427 Ga0207648_10012817 3300026089 Bacteria 7832
428 Ga0207676_10008097 3300026095 Bacteria 7469
429 Ga0207674_10000528 3300026116 Bacteria 50247
430 Ga0207674_10023628 3300026116 Bacteria 6581
431 Ga0207674_10028280 3300026116 Bacteria 5918
432 Ga0207674_10063525 3300026116 Bacteria 3727
433 Ga0207675_100000030 3300026118 Bacteria 109178
434 Ga0207675_100033324 3300026118 Bacteria 4800
435 Ga0207698_10009309 3300026142 Bacteria 6255
436 Ga0207698_10015879 3300026142 Bacteria 5060
437 Ga0207698_10020236 3300026142 Bacteria 4576
438 Ga0207698_10051996 3300026142 Bacteria 3136
439 Ga0207698_10053717 3300026142 Bacteria 3095
440 Ga0207698_10141636 3300026142 Bacteria 2073
441 Ga0207698_10166252 3300026142 Bacteria 1936
442 Ga0209968_1002434 3300027526 Bacteria 2810
443 Ga0209998_10004984 3300027717 Bacteria 2791
444 Ga0268265_10001535 3300028380 Bacteria 19204
445 Ga0268265_10015921 3300028380 Bacteria 5157
446 Ga0268264_10003591 3300028381 Bacteria 13351
447 Ga0265332_10012632 3300031238 Bacteria 3744
448 Ga0265327_10003773 3300031251 Bacteria 14057
449 Ga0265316_10006843 3300031344 Bacteria 10824
450 Ga0265316_10098584 3300031344 Bacteria 2224
451 Ga0307408_100000629 3300031548 Bacteria 29827
452 Ga0307408_100000729 3300031548 Bacteria 26641
453 Ga0307408_100017279 3300031548 Bacteria 4826
454 Ga0307408_100028608 3300031548 Bacteria 3853
455 Ga0307408_100047441 3300031548 Bacteria 3077
456 Ga0316579_10004878 3300031691 Bacteria 5366
457 Ga0316579_10019736 3300031691 Bacteria 2982
458 Ga0316576_10009153 3300031727 Bacteria 6380
459 Ga0316576_10054774 3300031727 Bacteria 2909
460 Ga0316576_10055572 3300031727 Bacteria 2890
461 Ga0316576_10089054 3300031727 Bacteria 2298
462 Ga0316578_10029457 3300031728 Bacteria 3116
463 Ga0316578_10046552 3300031728 Bacteria 2528
464 Ga0307405_10000745 3300031731 Bacteria 12673
465 Ga0307405_10006048 3300031731 Bacteria 5918
466 Ga0307405_10064648 3300031731 Bacteria 2326
467 Ga0307405_10064762 3300031731 Bacteria 2324
468 Ga0316577_10033763 3300031733 Bacteria 2859
469 Ga0316577_10034188 3300031733 Bacteria 2841
470 Ga0316577_10046400 3300031733 Bacteria 2427
471 Ga0307413_10000344 3300031824 Bacteria 14717
472 Ga0307413_10004295 3300031824 Bacteria 6177
473 Ga0307410_10007833 3300031852 Bacteria 5879
474 Ga0307410_10010966 3300031852 Bacteria 5162
475 Ga0307410_10012534 3300031852 Bacteria 4910
476 Ga0307406_10005718 3300031901 Bacteria 6809
477 Ga0307406_10013715 3300031901 Bacteria 4649
478 Ga0307406_10058696 3300031901 Bacteria 2474
479 Ga0307406_10071466 3300031901 Bacteria 2274
480 Ga0307407_10001055 3300031903 Bacteria 9543
481 Ga0307407_10004507 3300031903 Bacteria 5926
482 Ga0307407_10031289 3300031903 Bacteria 2880
483 Ga0307407_10033144 3300031903 Bacteria 2815
484 Ga0307407_10049258 3300031903 Bacteria 2403
485 Ga0307407_10101376 3300031903 Bacteria 1787
486 Ga0307412_10000009 3300031911 Bacteria 445987
487 Ga0307412_10009550 3300031911 Bacteria 5570
488 Ga0307412_10016126 3300031911 Bacteria 4443
489 Ga0307412_10036303 3300031911 Bacteria 3156
490 Ga0307412_10045006 3300031911 Bacteria 2882
491 Ga0307409_100000357 3300031995 Bacteria 19077
492 Ga0307409_100011126 3300031995 Bacteria 5648
493 Ga0307409_100016802 3300031995 Bacteria 4856
494 Ga0307409_100091311 3300031995 Bacteria 2495
495 Ga0307409_100223277 3300031995 Bacteria 1702
496 Ga0307416_100000344 3300032002 Bacteria 24038
497 Ga0307416_100003078 3300032002 Bacteria 9757
498 Ga0307416_100003262 3300032002 Bacteria 9495
499 Ga0307416_100006153 3300032002 Bacteria 7480
500 Ga0307416_100006883 3300032002 Bacteria 7158
501 Ga0307416_100007260 3300032002 Bacteria 7024
502 Ga0307416_100010390 3300032002 Bacteria 6145
503 Ga0307416_100014672 3300032002 Bacteria 5382
504 Ga0307416_100019118 3300032002 Bacteria 4849
505 Ga0307416_100081892 3300032002 Bacteria 2731
506 Ga0307416_100103190 3300032002 Bacteria 2489
507 Ga0307416_100213981 3300032002 Bacteria 1841
508 Ga0307416_100240338 3300032002 Bacteria 1754
509 Ga0307414_10000078 3300032004 Bacteria 90911
510 Ga0307414_10056051 3300032004 Bacteria 2762
511 Ga0307414_10058579 3300032004 Bacteria 2714
512 Ga0307414_10063539 3300032004 Bacteria 2624
513 Ga0307414_10142145 3300032004 Bacteria 1880
514 Ga0307411_10002232 3300032005 Bacteria 8446
515 Ga0307411_10008269 3300032005 Bacteria 5374
516 Ga0307411_10048402 3300032005 Bacteria 2755
517 Ga0307411_10058549 3300032005 Bacteria 2550
518 Ga0307415_100002295 3300032126 Bacteria 9487
519 Ga0307415_100002668 3300032126 Bacteria 8904
520 Ga0307415_100003986 3300032126 Bacteria 7601
521 Ga0307415_100022058 3300032126 Bacteria 3924
522 Ga0307415_100040120 3300032126 Bacteria 3099
523 Ga0307415_100040391 3300032126 Bacteria 3090
524 Ga0307415_100048847 3300032126 Bacteria 2857
525 Ga0307415_100120425 3300032126 Bacteria 1967
526 Ga0316580_10004290 3300032139 Bacteria 4125
527 Ga0373934_0000529 3300035086 Bacteria 13485
528 Ga0373934_0003665 3300035086 Bacteria 5646
529 Ga0373934_0008669 3300035086 Bacteria 3794
530 Ga0373944_0001436 3300035089 Bacteria 6008
531 Ga0373941_0040149 3300035115 Bacteria 1442
532 Ga0373945_0003065 3300035116 Bacteria 5256
533 Ga0373954_0047768 3300035118 Bacteria 2004
534 Ga0373943_0005557 3300035170 Bacteria 5661
535 Ga0373946_0005410 3300035171 Bacteria 4603
536 Ga0373955_0030457 3300035172 Bacteria 2817
537 Ga0316574_0085756 3300035398 Bacteria 2004
538 Ga0373924_0004195 3300035410 Bacteria 5021
539 Ga0373935_0002946 3300035692 Bacteria 9805
540 Ga0373927_0006522 3300035695 Bacteria 7948
541 Ga0373927_0167275 3300035695 Bacteria 1441
542 Ga0373933_0000033 3300035724 Bacteria 84415
543 Ga0373933_0016367 3300035724 Bacteria 4145
544 Ga0373947_0007580 3300035725 Bacteria 6280
545 Ga0373947_0017785 3300035725 Bacteria 4089
546 Ga0373937_0000158 3300036401 Bacteria 65505
547 Ga0373937_0017625 3300036401 Bacteria 6369
548 Ga0373937_0142648 3300036401 Bacteria 2241
549 Ga0316584_0008704 3300036712 Bacteria 7006
550 Ga0316584_0064326 3300036712 Bacteria 2746
551 Ga0373925_0001104 3300037068 Bacteria 24089
552 Ga0395899_0101203 3300037312 Bacteria 2080
553 Ga0395900_0010889 3300037418 Bacteria 9299
554 Ga0395900_0014902 3300037418 Bacteria 7921
555 Ga0395905_0000023 3300037471 Bacteria 319640
556 Ga0395905_0006399 3300037471 Bacteria 11860
557 Ga0395901_0008806 3300038443 Bacteria 10212
558 Ga0436365_0048646 3300039437 Bacteria 15042
559 Ga0436365_0687141 3300039437 Bacteria 1977
560 Ga0436365_0743102 3300039437 Bacteria 1681
561 Ga0451855_1231084 3300041511 Bacteria 2472
562 Ga0451577_0000005 3300042876 Bacteria 712599
563 Ga0451577_0001689 3300042876 Bacteria 28478
564 Ga0451577_0002841 3300042876 Bacteria 19923
565 Ga0451577_0017019 3300042876 Bacteria 6723
566 Ga0451577_0064730 3300042876 Bacteria 3260
567 Ga0451577_0082408 3300042876 Bacteria 2869
568 Ga0451577_0101001 3300042876 Bacteria 2577
569 Ga0451577_0105694 3300042876 Bacteria 2516
570 Ga0451577_0122443 3300042876 Bacteria 2330
571 Ga0451577_0275736 3300042876 Bacteria 1523
572 Ga0453683_0000072 3300044673 Bacteria 154688
573 Ga0453683_0003129 3300044673 Bacteria 12359
574 Ga0453683_0021427 3300044673 Bacteria 4127
575 Ga0453683_0040223 3300044673 Unclassified 2936
576 Ga0453683_0065200 3300044673 Bacteria 2277
577 Ga0453683_0140678 3300044673 Bacteria 1523
578 Ga0466966_0007566 3300044684 Bacteria 7197
579 Ga0453684_0000091 3300044712 Bacteria 387720
580 Ga0453684_0000330 3300044712 Bacteria 198124
581 Ga0453684_0000792 3300044712 Bacteria 108377
582 Ga0453684_0010910 3300044712 Bacteria 15374
583 Ga0453684_0010913 3300044712 Bacteria 15372
584 Ga0453684_0011356 3300044712 Bacteria 14962
585 Ga0453684_0020471 3300044712 Bacteria 9974
586 Ga0453684_0023474 3300044712 Bacteria 9077
587 Ga0453684_0038874 3300044712 Bacteria 6493
588 Ga0453684_0090744 3300044712 Bacteria 3774
589 Ga0453684_0125513 3300044712 Bacteria 3090
590 Ga0453684_0148230 3300044712 Bacteria 2792
591 Ga0453684_0156818 3300044712 Bacteria 2698
592 Ga0453684_0203347 3300044712 Bacteria 2307
593 Ga0466959_0016100 3300045049 Bacteria 5457
594 Ga0451576_0000280 3300045051 Bacteria 124909
595 Ga0451576_0003878 3300045051 Bacteria 20025
596 Ga0451576_0004992 3300045051 Bacteria 16884
597 Ga0451576_0028814 3300045051 Bacteria 5946
598 Ga0451576_0031139 3300045051 Bacteria 5690
599 Ga0451576_0036406 3300045051 Bacteria 5217
600 Ga0451576_0085109 3300045051 Bacteria 3289
601 Ga0451576_0097164 3300045051 Bacteria 3063
602 Ga0495603_0014410 3300046455 Bacteria 4783
603 Ga0495629_0007207 3300046459 Bacteria 8189
604 Ga0495629_0102417 3300046459 Bacteria 1997
605 Ga0495638_0073531 3300046460 Bacteria 2086
606 Ga0495651_0000572 3300046462 Bacteria 28583
607 Ga0495651_0011099 3300046462 Bacteria 6928
608 Ga0495651_0046841 3300046462 Bacteria 3346
609 Ga0495653_0000173 3300046463 Bacteria 53365
610 Ga0495580_0007212 3300046472 Bacteria 8943
611 Ga0495580_0019243 3300046472 Bacteria 5073
612 Ga0495580_0078402 3300046472 Bacteria 2304
613 Ga0495582_0003154 3300046473 Bacteria 9254
614 Ga0495582_0009665 3300046473 Bacteria 5311
615 Ga0495639_0000744 3300046475 Bacteria 14908
616 Ga0495639_0017510 3300046475 Bacteria 3113
617 Ga0495664_0005674 3300046477 Bacteria 6867
618 Ga0495594_0008848 3300046499 Bacteria 5191
619 Ga0495594_0015731 3300046499 Bacteria 3978
620 Ga0495594_0042180 3300046499 Bacteria 2499
621 Ga0495608_0000418 3300046511 Bacteria 29615
622 Ga0495628_0000467 3300046516 Bacteria 37087
623 Ga0495628_0022744 3300046516 Bacteria 5148
624 Ga0495628_0040012 3300046516 Bacteria 3748
625 Ga0495652_0000658 3300046529 Bacteria 40060
626 Ga0495652_0006330 3300046529 Bacteria 11027
627 Ga0495665_0001000 3300046531 Bacteria 15013
628 Ga0495640_0027288 3300046533 Bacteria 4119
629 Ga0495586_0021334 3300046535 Bacteria 3451
630 Ga0495587_0000247 3300046536 Bacteria 39646
631 Ga0495587_0000661 3300046536 Bacteria 23100
632 Ga0495587_0007799 3300046536 Bacteria 6915
633 Ga0495587_0043772 3300046536 Bacteria 2665
634 Ga0495645_0000210 3300046543 Bacteria 41882
635 Ga0495645_0002859 3300046543 Bacteria 11715
636 Ga0495645_0007825 3300046543 Bacteria 7437
637 Ga0495667_0004689 3300046559 Bacteria 9242
638 Ga0495667_0005920 3300046559 Bacteria 8276
639 Ga0495667_0015531 3300046559 Bacteria 5147
640 Ga0495667_0027601 3300046559 Bacteria 3823
641 Ga0495635_0000157 3300046663 Bacteria 41636
642 Ga0495588_0002120 3300046674 Bacteria 8511
643 Ga0495657_0001969 3300046675 Bacteria 17508
644 Ga0495599_0000065 3300046678 Bacteria 72906
645 Ga0495599_0005612 3300046678 Bacteria 7525
646 Ga0495623_0000014 3300046679 Bacteria 119814
647 Ga0495623_0042696 3300046679 Bacteria 2888
648 Ga0495623_0045531 3300046679 Bacteria 2786
649 Ga0495646_0000129 3300046680 Bacteria 38041
650 Ga0495658_0001890 3300046683 Bacteria 10699
651 Ga0495613_0005422 3300046689 Bacteria 9584
652 Ga0495613_0059959 3300046689 Bacteria 2788
653 Ga0495600_0000105 3300046809 Bacteria 46401
654 Ga0495581_0001999 3300047315 Bacteria 11446
655 Ga0495581_0021028 3300047315 Bacteria 3785
656 Ga0495604_0000359 3300047317 Bacteria 40820
657 Ga0495604_0070638 3300047317 Bacteria 2643
658 Ga0495674_0000362 3300047319 Bacteria 40383
659 Ga0495674_0131027 3300047319 Bacteria 2112
660 Ga0495674_0181705 3300047319 Bacteria 1751
661 Ga0495672_0008695 3300047320 Bacteria 7451
662 Ga0495680_0001244 3300047322 Bacteria 27949
663 Ga0495680_0049696 3300047322 Bacteria 3283
664 Ga0495675_0005375 3300047444 Bacteria 7806
665 Ga0495675_0027318 3300047444 Bacteria 3636
666 Ga0495684_0000288 3300047471 Bacteria 40827
667 Ga0495684_0008178 3300047471 Bacteria 8094
668 Ga0495684_0014722 3300047471 Bacteria 6021
669 Ga0495684_0025843 3300047471 Bacteria 4512
670 Ga0495593_0000112 3300047673 Bacteria 38250
671 Ga0495602_0030788 3300048088 Bacteria 5085
672 Ga0495602_0039271 3300048088 Bacteria 4362
673 Ga0495602_0100569 3300048088 Bacteria 2374
674 Ga0495602_0127718 3300048088 Bacteria 2033
675 Ga0495614_0000021 3300048089 Bacteria 45062
676 Ga0496101_0112044 3300048904 Bacteria 2055
677 Ga0496104_0077132 3300048907 Bacteria 3175
678 Ga0496108_0037075 3300048911 Bacteria 4060
679 Ga0496112_0014418 3300048915 Bacteria 7331
680 Ga0496112_0255399 3300048915 Bacteria 1703
681 Ga0496113_0031174 3300048916 Bacteria 3867
682 Ga0496114_0273660 3300048917 Bacteria 1488
683 Ga0496122_0001073 3300048925 Bacteria 47498
684 Ga0496123_0008196 3300048926 Bacteria 9636
685 Ga0501031_0039396 3300049568 Bacteria 3083
686 Ga0501033_0005356 3300049570 Bacteria 10166
687 Ga0501033_0008106 3300049570 Bacteria 8140
688 Ga0501034_0126368 3300049571 Bacteria 2542
689 Ga0501038_0038193 3300049574 Bacteria 4206
690 Ga0501039_0138424 3300049575 Bacteria 1912
691 Ga0501042_0102925 3300049578 Bacteria 2054
692 Ga0501046_0107457 3300049580 Bacteria 2135
693 Ga0501047_0036917 3300049581 Bacteria 4723
694 Ga0501047_0053591 3300049581 Bacteria 3901
695 Ga0501048_0013752 3300049582 Bacteria 6004
696 Ga0501068_0139121 3300049584 Bacteria 1521
697 Ga0501070_0030086 3300049586 Bacteria 4549
698 Ga0501070_0038186 3300049586 Bacteria 4007
699 Ga0501074_0082164 3300049590 Bacteria 2311
700 Ga0501074_0134044 3300049590 Bacteria 1772
701 Ga0501075_0017633 3300049591 Bacteria 5156
702 Ga0501076_0024265 3300049592 Bacteria 4685
703 Ga0501077_0000408 3300049593 Bacteria 25947
704 Ga0501079_0022318 3300049741 Bacteria 4853
705 Ga0501080_0021290 3300049742 Bacteria 6002
706 Ga0501080_0101363 3300049742 Bacteria 2671
707 Ga0501080_0213659 3300049742 Bacteria 1767
708 Ga0501081_0093226 3300049743 Bacteria 2120
709 Ga0501083_0058981 3300049744 Bacteria 2568
710 Ga0501270_004785 3300049767 Bacteria 1538
711 Ga0501035_0157030 3300049822 Bacteria 1971
712 Ga0501044_0007739 3300049823 Bacteria 11813
713 Ga0501044_0088571 3300049823 Bacteria 3124
714 Ga0501044_0217815 3300049823 Bacteria 1861
715 nmdc:mga05p37_111337_c1 3300050507 Bacteria 3367
716 nmdc:mga09592_24195_c1 3300050508 Bacteria 5021
717 nmdc:mga09592_39448_c1 3300050508 Bacteria 3967
718 nmdc:mga0qj67_5807_c1 3300050509 Bacteria 9032
719 nmdc:mga0qj67_67633_c1 3300050509 Bacteria 2846
720 nmdc:mga0qj67_91425_c1 3300050509 Bacteria 2446
721 nmdc:mga06r32_35746_c1 3300050510 Bacteria 4688
722 nmdc:mga06r32_39521_c1 3300050510 Bacteria 4477
723 nmdc:mga06r32_49502_c1 3300050510 Bacteria 4018
724 nmdc:mga06r32_9509_c1 3300050510 Bacteria 8777
725 nmdc:mga08y16_80141_c1 3300050511 Bacteria 3404
726 nmdc:mga0n895_180010_c1 3300050512 Bacteria 2145
727 nmdc:mga0n895_188459_c1 3300050512 Bacteria 2094
728 nmdc:mga08x19_1893_c1 3300050514 Bacteria 12819
729 nmdc:mga0a205_13885_c1 3300050515 Bacteria 7509
730 Ga0495601_0018561 3300053077 Bacteria 4235
731 Ga0495601_0062695 3300053077 Bacteria 2362
732 Ga0495612_0000144 3300053078 Bacteria 30143
733 Ga0500635_0014106 3300053080 Bacteria 2334
734 Ga0495595_0030712 3300053084 Bacteria 2411
735 Ga0495595_0032185 3300053084 Bacteria 2361
736 Ga0500651_0000139 3300053093 Bacteria 45700
737 Ga0500618_000004 3300053125 Bacteria 293180
738 Ga0500622_0007717 3300053156 Bacteria 6077
739 Ga0501082_0054647 3300060353 Bacteria 3442

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0064326 Ga0316584_0064326_1449_2726 409
2 3300046536 Ga0495587_0000247 Ga0495587_0000247_22200_23510 416
3 3300035089 Ga0373944_0001436 Ga0373944_0001436_4654_5964 417
4 3300035116 Ga0373945_0003065 Ga0373945_0003065_3845_5155 417
5 3300035170 Ga0373943_0005557 Ga0373943_0005557_3872_5182 417
6 3300035171 Ga0373946_0005410 Ga0373946_0005410_104_1414 417
7 3300035692 Ga0373935_0002946 Ga0373935_0002946_7487_8797 417
8 3300035695 Ga0373927_0006522 Ga0373927_0006522_3682_4992 417
9 3300035725 Ga0373947_0007580 Ga0373947_0007580_2451_3761 417
10 3300037068 Ga0373925_0001104 Ga0373925_0001104_12466_13776 417
11 3300046455 Ga0495603_0014410 Ga0495603_0014410_313_1623 417
12 3300046459 Ga0495629_0102417 Ga0495629_0102417_42_1352 417
13 3300046472 Ga0495580_0019243 Ga0495580_0019243_665_1975 417
14 3300046473 Ga0495582_0003154 Ga0495582_0003154_2451_3761 417
15 3300046475 Ga0495639_0000744 Ga0495639_0000744_8215_9525 417
16 3300046531 Ga0495665_0001000 Ga0495665_0001000_6831_8141 417
17 3300046674 Ga0495588_0002120 Ga0495588_0002120_2372_3682 417
18 3300046683 Ga0495658_0001890 Ga0495658_0001890_3388_4698 417
19 3300046689 Ga0495613_0005422 Ga0495613_0005422_875_2185 417
20 3300047315 Ga0495581_0001999 Ga0495581_0001999_314_1624 417
21 3300047673 Ga0495593_0000112 Ga0495593_0000112_12570_13880 417
22 3300048089 Ga0495614_0000021 Ga0495614_0000021_33189_34499 417
23 3300035115 Ga0373941_0040149 Ga0373941_0040149_33_1340 418
24 3300046559 Ga0495667_0015531 Ga0495667_0015531_3089_4396 418
25 3300005336 Ga0070680_100008998 Ga0070680_1000089982 419
26 3300005458 Ga0070681_10003552 Ga0070681_100035528 419
27 3300005530 Ga0070679_100001192 Ga0070679_10000119213 419
28 3300009176 Ga0105242_10003851 Ga0105242_100038519 419
29 3300009177 Ga0105248_10034311 Ga0105248_100343112 419
30 3300025912 Ga0207707_10036704 Ga0207707_100367042 419
31 3300025917 Ga0207660_10022179 Ga0207660_100221794 419
32 3300025921 Ga0207652_10000636 Ga0207652_1000063623 419
33 3300048088 Ga0495602_0127718 Ga0495602_0127718_23_1333 419
34 3300042876 Ga0451577_0275736 Ga0451577_0275736_182_1507 420
35 3300047319 Ga0495674_0181705 Ga0495674_0181705_12_1385 432
36 3300013307 Ga0157372_10000462 Ga0157372_1000046217 433
37 3300005445 Ga0070708_100000045 Ga0070708_10000004556 437
38 3300047319 Ga0495674_0131027 Ga0495674_0131027_37_1404 437
39 3300005445 Ga0070708_100000788 Ga0070708_1000007887 438
40 3300005468 Ga0070707_100000955 Ga0070707_10000095527 438
41 3300005518 Ga0070699_100216923 Ga0070699_1002169231 438
42 3300025922 Ga0207646_10001505 Ga0207646_1000150510 438
43 3300031903 Ga0307407_10049258 Ga0307407_100492581 439
44 3300032002 Ga0307416_100019118 Ga0307416_1000191182 439
45 3300032005 Ga0307411_10048402 Ga0307411_100484022 439
46 3300032126 Ga0307415_100040120 Ga0307415_1000401203 439
47 3300044673 Ga0453683_0065200 Ga0453683_0065200_159_1616 439
48 3300009098 Ga0105245_10004656 Ga0105245_100046566 440
49 3300013100 Ga0157373_10009825 Ga0157373_100098256 440
50 3300013307 Ga0157372_10296199 Ga0157372_102961991 440
51 3300025920 Ga0207649_10000977 Ga0207649_100009776 440
52 3300035086 Ga0373934_0008669 Ga0373934_0008669_1268_2641 440
53 3300035172 Ga0373955_0030457 Ga0373955_0030457_1264_2637 440
54 3300046472 Ga0495580_0078402 Ga0495580_0078402_159_1532 440
55 3300046536 Ga0495587_0007799 Ga0495587_0007799_1018_2391 440
56 3300046543 Ga0495645_0002859 Ga0495645_0002859_5630_7003 440
57 3300046559 Ga0495667_0004689 Ga0495667_0004689_1929_3302 440
58 3300046679 Ga0495623_0045531 Ga0495623_0045531_776_2149 440
59 3300047444 Ga0495675_0005375 Ga0495675_0005375_2231_3604 440
60 3300048917 Ga0496114_0273660 Ga0496114_0273660_84_1457 440
61 3300053084 Ga0495595_0032185 Ga0495595_0032185_154_1527 440
62 3300031727 Ga0316576_10089054 Ga0316576_100890542 441
63 3300005577 Ga0068857_100066504 Ga0068857_1000665044 443
64 3300005329 Ga0070683_100003778 Ga0070683_10000377811 444
65 3300005457 Ga0070662_100107955 Ga0070662_1001079552 444
66 3300005458 Ga0070681_10110061 Ga0070681_101100611 444
67 3300005535 Ga0070684_100000255 Ga0070684_1000002552 444
68 3300005564 Ga0070664_100003696 Ga0070664_1000036967 444
69 3300005577 Ga0068857_100006087 Ga0068857_1000060873 444
70 3300025912 Ga0207707_10069146 Ga0207707_100691462 444
71 3300025921 Ga0207652_10104959 Ga0207652_101049591 444
72 3300025944 Ga0207661_10004037 Ga0207661_100040373 444
73 3300053125 Ga0500618_000004 Ga0500618_000004_181297_182769 444
74 3300005458 Ga0070681_10027309 Ga0070681_100273093 445
75 3300005547 Ga0070693_100007872 Ga0070693_1000078723 445
76 3300042876 Ga0451577_0017019 Ga0451577_0017019_4265_5722 445
77 3300049767 Ga0501270_004785 Ga0501270_004785_138_1526 445
78 3300035695 Ga0373927_0167275 Ga0373927_0167275_25_1419 446
79 3300005545 Ga0070695_100064466 Ga0070695_1000644661 447
80 3300025906 Ga0207699_10105072 Ga0207699_101050721 447
81 3300005842 Ga0068858_100005316 Ga0068858_1000053166 448
82 3300026035 Ga0207703_10003749 Ga0207703_100037496 448
83 3300027717 Ga0209998_10004984 Ga0209998_100049842 448
84 3300005468 Ga0070707_100019620 Ga0070707_1000196206 451
85 3300025922 Ga0207646_10014532 Ga0207646_100145326 451
86 3300031548 Ga0307408_100047441 Ga0307408_1000474412 451
87 3300005338 Ga0068868_100076407 Ga0068868_1000764072 452
88 3300049592 Ga0501076_0024265 Ga0501076_0024265_389_1846 452
89 3300049593 Ga0501077_0000408 Ga0501077_0000408_1725_3182 452
90 3300049741 Ga0501079_0022318 Ga0501079_0022318_580_2037 452
91 3300060353 Ga0501082_0054647 Ga0501082_0054647_569_2026 452
92 3300005336 Ga0070680_100013243 Ga0070680_1000132432 453
93 3300005458 Ga0070681_10000473 Ga0070681_1000047335 453
94 3300025899 Ga0207642_10049506 Ga0207642_100495062 453
95 3300025917 Ga0207660_10011400 Ga0207660_100114002 453
96 3300049742 Ga0501080_0021290 Ga0501080_0021290_3714_5177 454
97 3300005337 Ga0070682_100009731 Ga0070682_1000097312 455
98 3300005545 Ga0070695_100028288 Ga0070695_1000282882 455
99 3300005563 Ga0068855_100003992 Ga0068855_10000399220 455
100 3300009093 Ga0105240_10129986 Ga0105240_101299862 455
101 3300013307 Ga0157372_10059189 Ga0157372_100591891 455
102 3300027526 Ga0209968_1002434 Ga0209968_10024342 455
103 3300031728 Ga0316578_10029457 Ga0316578_100294572 455
104 3300045051 Ga0451576_0004992 Ga0451576_0004992_15061_16536 455
105 3300049584 Ga0501068_0139121 Ga0501068_0139121_16_1473 456
106 3300005328 Ga0070676_10011173 Ga0070676_100111732 457
107 3300025907 Ga0207645_10014184 Ga0207645_100141842 457
108 3300005467 Ga0070706_100006172 Ga0070706_1000061725 458
109 3300005471 Ga0070698_100030948 Ga0070698_1000309483 458
110 3300025910 Ga0207684_10016420 Ga0207684_100164205 458
111 3300005985 Ga0081539_10000174 Ga0081539_10000174106 459
112 3300006846 Ga0075430_100007578 Ga0075430_1000075782 459
113 3300009094 Ga0111539_10241863 Ga0111539_102418631 459
114 3300014326 Ga0157380_10052386 Ga0157380_100523861 459
115 3300025944 Ga0207661_10052768 Ga0207661_100527682 459
116 3300039437 Ga0436365_0048646 Ga0436365_0048646_4092_5528 459
117 3300047320 Ga0495672_0008695 Ga0495672_0008695_878_2314 459
118 3300050508 nmdc:mga09592_39448_c1 nmdc:mga09592_39448_c1_162_1619 459
119 3300005337 Ga0070682_100036763 Ga0070682_1000367632 460
120 3300005530 Ga0070679_100016156 Ga0070679_1000161566 460
121 3300009093 Ga0105240_10122645 Ga0105240_101226452 460
122 3300009098 Ga0105245_10028512 Ga0105245_100285122 460
123 3300009545 Ga0105237_10002557 Ga0105237_100025573 460
124 3300013296 Ga0157374_10056699 Ga0157374_100566992 460
125 3300025912 Ga0207707_10016185 Ga0207707_100161856 460
126 3300025913 Ga0207695_10000228 Ga0207695_100002282 460
127 3300025921 Ga0207652_10042995 Ga0207652_100429952 460
128 3300031731 Ga0307405_10064762 Ga0307405_100647621 460
129 3300031903 Ga0307407_10001055 Ga0307407_100010553 460
130 3300032002 Ga0307416_100006153 Ga0307416_1000061534 460
131 3300032002 Ga0307416_100006883 Ga0307416_1000068833 460
132 3300032005 Ga0307411_10008269 Ga0307411_100082693 460
133 3300032005 Ga0307411_10058549 Ga0307411_100585492 460
134 3300032126 Ga0307415_100022058 Ga0307415_1000220581 460
135 3300046462 Ga0495651_0011099 Ga0495651_0011099_1209_2756 460
136 3300046516 Ga0495628_0040012 Ga0495628_0040012_1306_2853 460
137 3300046533 Ga0495640_0027288 Ga0495640_0027288_569_2116 460
138 3300047322 Ga0495680_0049696 Ga0495680_0049696_1638_3092 460
139 3300047471 Ga0495684_0014722 Ga0495684_0014722_876_2330 460
140 3300005356 Ga0070674_100048685 Ga0070674_1000486852 462
141 3300005435 Ga0070714_100009543 Ga0070714_1000095432 462
142 3300005547 Ga0070693_100011143 Ga0070693_1000111433 462
143 3300006028 Ga0070717_10007977 Ga0070717_100079775 462
144 3300006175 Ga0070712_100001803 Ga0070712_10000180312 462
145 3300006881 Ga0068865_100004459 Ga0068865_1000044596 462
146 3300013307 Ga0157372_10004316 Ga0157372_100043164 462
147 3300025906 Ga0207699_10008236 Ga0207699_100082364 462
148 3300025918 Ga0207662_10053993 Ga0207662_100539932 462
149 3300025928 Ga0207700_10002118 Ga0207700_100021185 462
150 3300025929 Ga0207664_10009782 Ga0207664_100097822 462
151 3300025933 Ga0207706_10002211 Ga0207706_1000221114 462
152 3300026075 Ga0207708_10006826 Ga0207708_100068268 462
153 3300032139 Ga0316580_10004290 Ga0316580_100042903 462
154 3300046472 Ga0495580_0007212 Ga0495580_0007212_1884_3332 462
155 3300046475 Ga0495639_0017510 Ga0495639_0017510_491_1939 462
156 3300046499 Ga0495594_0008848 Ga0495594_0008848_1806_3254 462
157 3300047471 Ga0495684_0025843 Ga0495684_0025843_829_2277 462
158 3300005457 Ga0070662_100001083 Ga0070662_10000108317 463
159 3300005530 Ga0070679_100037856 Ga0070679_1000378564 463
160 3300005539 Ga0068853_100005516 Ga0068853_1000055164 463
161 3300005563 Ga0068855_100022823 Ga0068855_1000228231 463
162 3300006847 Ga0075431_100001735 Ga0075431_10000173515 463
163 3300006914 Ga0075436_100001419 Ga0075436_1000014198 463
164 3300009093 Ga0105240_10031972 Ga0105240_100319721 463
165 3300009094 Ga0111539_10048865 Ga0111539_100488651 463
166 3300009553 Ga0105249_10000061 Ga0105249_1000006116 463
167 3300009553 Ga0105249_10027811 Ga0105249_100278112 463
168 3300013100 Ga0157373_10072212 Ga0157373_100722122 463
169 3300013104 Ga0157370_10021084 Ga0157370_100210842 463
170 3300013308 Ga0157375_10013585 Ga0157375_100135853 463
171 3300014325 Ga0163163_10072742 Ga0163163_100727424 463
172 3300014497 Ga0182008_10005125 Ga0182008_100051253 463
173 3300020082 Ga0206353_10072611 Ga0206353_100726112 463
174 3300021384 Ga0213876_10082548 Ga0213876_100825482 463
175 3300025912 Ga0207707_10005244 Ga0207707_100052441 463
176 3300025913 Ga0207695_10002260 Ga0207695_1000226022 463
177 3300025913 Ga0207695_10025474 Ga0207695_100254744 463
178 3300025913 Ga0207695_10046486 Ga0207695_100464865 463
179 3300025917 Ga0207660_10084435 Ga0207660_100844352 463
180 3300025921 Ga0207652_10055836 Ga0207652_100558361 463
181 3300025961 Ga0207712_10000144 Ga0207712_1000014470 463
182 3300026041 Ga0207639_10007445 Ga0207639_100074453 463
183 3300026041 Ga0207639_10082849 Ga0207639_100828492 463
184 3300026067 Ga0207678_10078502 Ga0207678_100785023 463
185 3300026078 Ga0207702_10159909 Ga0207702_101599091 463
186 3300026142 Ga0207698_10020236 Ga0207698_100202361 463
187 3300026142 Ga0207698_10166252 Ga0207698_101662521 463
188 3300031691 Ga0316579_10019736 Ga0316579_100197362 463
189 3300031733 Ga0316577_10033763 Ga0316577_100337633 463
190 3300032126 Ga0307415_100120425 Ga0307415_1001204252 463
191 3300035086 Ga0373934_0003665 Ga0373934_0003665_3901_5349 463
192 3300035724 Ga0373933_0016367 Ga0373933_0016367_438_1886 463
193 3300036401 Ga0373937_0142648 Ga0373937_0142648_96_1544 463
194 3300039437 Ga0436365_0687141 Ga0436365_0687141_135_1583 463
195 3300039437 Ga0436365_0743102 Ga0436365_0743102_114_1562 463
196 3300046459 Ga0495629_0007207 Ga0495629_0007207_1154_2602 463
197 3300046462 Ga0495651_0046841 Ga0495651_0046841_888_2336 463
198 3300046473 Ga0495582_0009665 Ga0495582_0009665_272_1720 463
199 3300046477 Ga0495664_0005674 Ga0495664_0005674_4172_5620 463
200 3300046499 Ga0495594_0015731 Ga0495594_0015731_2305_3753 463
201 3300046516 Ga0495628_0022744 Ga0495628_0022744_3163_4611 463
202 3300046529 Ga0495652_0006330 Ga0495652_0006330_4435_5883 463
203 3300046536 Ga0495587_0000661 Ga0495587_0000661_16508_17956 463
204 3300046543 Ga0495645_0007825 Ga0495645_0007825_1202_2650 463
205 3300046559 Ga0495667_0027601 Ga0495667_0027601_1354_2802 463
206 3300046678 Ga0495599_0005612 Ga0495599_0005612_730_2178 463
207 3300047317 Ga0495604_0070638 Ga0495604_0070638_615_2063 463
208 3300047471 Ga0495684_0008178 Ga0495684_0008178_3928_5376 463
209 3300048088 Ga0495602_0030788 Ga0495602_0030788_1420_2967 463
210 3300048907 Ga0496104_0077132 Ga0496104_0077132_1241_2689 463
211 3300049743 Ga0501081_0093226 Ga0501081_0093226_29_1477 463
212 3300050510 nmdc:mga06r32_35746_c1 nmdc:mga06r32_35746_c1_212_1660 463
213 3300050511 nmdc:mga08y16_80141_c1 nmdc:mga08y16_80141_c1_168_1715 463
214 3300053077 Ga0495601_0062695 Ga0495601_0062695_83_1531 463
215 3300005530 Ga0070679_100181669 Ga0070679_1001816691 464
216 3300049570 Ga0501033_0005356 Ga0501033_0005356_660_2144 464
217 3300049574 Ga0501038_0038193 Ga0501038_0038193_722_2206 464
218 3300049823 Ga0501044_0007739 Ga0501044_0007739_9504_10988 464
219 3300005341 Ga0070691_10007806 Ga0070691_100078063 465
220 3300005343 Ga0070687_100010099 Ga0070687_1000100993 465
221 3300005344 Ga0070661_100042448 Ga0070661_1000424483 465
222 3300005353 Ga0070669_100021469 Ga0070669_1000214692 465
223 3300005354 Ga0070675_100016435 Ga0070675_1000164353 465
224 3300005439 Ga0070711_100000962 Ga0070711_10000096210 465
225 3300005466 Ga0070685_10037465 Ga0070685_100374652 465
226 3300005616 Ga0068852_100012815 Ga0068852_1000128155 465
227 3300005616 Ga0068852_100031878 Ga0068852_1000318782 465
228 3300005617 Ga0068859_100028872 Ga0068859_1000288723 465
229 3300005617 Ga0068859_100134064 Ga0068859_1001340642 465
230 3300005840 Ga0068870_10009478 Ga0068870_100094784 465
231 3300006871 Ga0075434_100202041 Ga0075434_1002020412 465
232 3300006931 Ga0097620_100028872 Ga0097620_1000288723 465
233 3300006931 Ga0097620_100134063 Ga0097620_1001340632 465
234 3300009174 Ga0105241_10000296 Ga0105241_1000029618 465
235 3300009176 Ga0105242_10147146 Ga0105242_101471461 465
236 3300013105 Ga0157369_10041660 Ga0157369_100416602 465
237 3300013105 Ga0157369_10156786 Ga0157369_101567862 465
238 3300013307 Ga0157372_10039293 Ga0157372_100392932 465
239 3300013308 Ga0157375_10060624 Ga0157375_100606241 465
240 3300014745 Ga0157377_10036782 Ga0157377_100367822 465
241 3300025908 Ga0207643_10024224 Ga0207643_100242242 465
242 3300025911 Ga0207654_10000519 Ga0207654_100005193 465
243 3300025916 Ga0207663_10020208 Ga0207663_100202082 465
244 3300025918 Ga0207662_10002391 Ga0207662_100023913 465
245 3300025919 Ga0207657_10052851 Ga0207657_100528513 465
246 3300025923 Ga0207681_10024834 Ga0207681_100248342 465
247 3300025926 Ga0207659_10015665 Ga0207659_100156654 465
248 3300025944 Ga0207661_10074879 Ga0207661_100748793 465
249 3300026116 Ga0207674_10028280 Ga0207674_100282801 465
250 3300026142 Ga0207698_10015879 Ga0207698_100158792 465
251 3300026142 Ga0207698_10141636 Ga0207698_101416362 465
252 3300031548 Ga0307408_100028608 Ga0307408_1000286083 465
253 3300032002 Ga0307416_100003078 Ga0307416_1000030782 465
254 3300035086 Ga0373934_0000529 Ga0373934_0000529_6724_8274 465
255 3300035118 Ga0373954_0047768 Ga0373954_0047768_80_1630 465
256 3300035410 Ga0373924_0004195 Ga0373924_0004195_1349_2899 465
257 3300035724 Ga0373933_0000033 Ga0373933_0000033_25976_27526 465
258 3300036401 Ga0373937_0000158 Ga0373937_0000158_30712_32262 465
259 3300044684 Ga0466966_0007566 Ga0466966_0007566_3465_4955 465
260 3300045049 Ga0466959_0016100 Ga0466959_0016100_2846_4336 465
261 3300046462 Ga0495651_0000572 Ga0495651_0000572_3174_4724 465
262 3300046463 Ga0495653_0000173 Ga0495653_0000173_29336_30886 465
263 3300046511 Ga0495608_0000418 Ga0495608_0000418_23898_25448 465
264 3300046516 Ga0495628_0000467 Ga0495628_0000467_24223_25773 465
265 3300046529 Ga0495652_0000658 Ga0495652_0000658_14638_16188 465
266 3300046543 Ga0495645_0000210 Ga0495645_0000210_5420_6970 465
267 3300046559 Ga0495667_0005920 Ga0495667_0005920_1458_3008 465
268 3300046663 Ga0495635_0000157 Ga0495635_0000157_25058_26608 465
269 3300046675 Ga0495657_0001969 Ga0495657_0001969_3747_5297 465
270 3300046678 Ga0495599_0000065 Ga0495599_0000065_64644_66194 465
271 3300046679 Ga0495623_0000014 Ga0495623_0000014_55590_57140 465
272 3300046680 Ga0495646_0000129 Ga0495646_0000129_29666_31216 465
273 3300046689 Ga0495613_0059959 Ga0495613_0059959_1128_2678 465
274 3300046809 Ga0495600_0000105 Ga0495600_0000105_23877_25427 465
275 3300047315 Ga0495581_0021028 Ga0495581_0021028_143_1693 465
276 3300047317 Ga0495604_0000359 Ga0495604_0000359_18318_19868 465
277 3300047319 Ga0495674_0000362 Ga0495674_0000362_10465_12015 465
278 3300047322 Ga0495680_0001244 Ga0495680_0001244_23485_25035 465
279 3300047444 Ga0495675_0027318 Ga0495675_0027318_1571_3121 465
280 3300047471 Ga0495684_0000288 Ga0495684_0000288_20960_22510 465
281 3300048088 Ga0495602_0039271 Ga0495602_0039271_852_2402 465
282 3300048915 Ga0496112_0014418 Ga0496112_0014418_3010_4473 465
283 3300048915 Ga0496112_0255399 Ga0496112_0255399_135_1598 465
284 3300049581 Ga0501047_0036917 Ga0501047_0036917_3087_4634 465
285 3300050512 nmdc:mga0n895_180010_c1 nmdc:mga0n895_180010_c1_230_1777 465
286 3300053077 Ga0495601_0018561 Ga0495601_0018561_1634_3184 465
287 3300053078 Ga0495612_0000144 Ga0495612_0000144_15811_17361 465
288 3300053084 Ga0495595_0030712 Ga0495595_0030712_164_1714 465
289 3300005328 Ga0070676_10004316 Ga0070676_100043163 466
290 3300005333 Ga0070677_10036695 Ga0070677_100366952 466
291 3300005336 Ga0070680_100039287 Ga0070680_1000392872 466
292 3300005353 Ga0070669_100003393 Ga0070669_1000033935 466
293 3300005356 Ga0070674_100000605 Ga0070674_1000006056 466
294 3300005444 Ga0070694_100012174 Ga0070694_1000121743 466
295 3300005445 Ga0070708_100038954 Ga0070708_1000389544 466
296 3300005445 Ga0070708_100068887 Ga0070708_1000688872 466
297 3300005457 Ga0070662_100000596 Ga0070662_1000005966 466
298 3300005468 Ga0070707_100055557 Ga0070707_1000555572 466
299 3300005530 Ga0070679_100002731 Ga0070679_1000027319 466
300 3300005544 Ga0070686_100024875 Ga0070686_1000248753 466
301 3300005545 Ga0070695_100029087 Ga0070695_1000290873 466
302 3300005545 Ga0070695_100177326 Ga0070695_1001773261 466
303 3300005563 Ga0068855_100031885 Ga0068855_1000318857 466
304 3300005577 Ga0068857_100049820 Ga0068857_1000498202 466
305 3300005618 Ga0068864_100045010 Ga0068864_1000450103 466
306 3300005718 Ga0068866_10000381 Ga0068866_1000038115 466
307 3300005719 Ga0068861_100000159 Ga0068861_1000001593 466
308 3300005719 Ga0068861_100012359 Ga0068861_1000123592 466
309 3300005844 Ga0068862_100001333 Ga0068862_10000133310 466
310 3300006175 Ga0070712_100067208 Ga0070712_1000672083 466
311 3300006846 Ga0075430_100000568 Ga0075430_10000056821 466
312 3300006846 Ga0075430_100002373 Ga0075430_1000023736 466
313 3300006852 Ga0075433_10018833 Ga0075433_100188336 466
314 3300006881 Ga0068865_100057701 Ga0068865_1000577012 466
315 3300009093 Ga0105240_10005639 Ga0105240_100056395 466
316 3300009093 Ga0105240_10012038 Ga0105240_100120384 466
317 3300009093 Ga0105240_10136438 Ga0105240_101364382 466
318 3300009093 Ga0105240_10198875 Ga0105240_101988752 466
319 3300009094 Ga0111539_10018419 Ga0111539_100184191 466
320 3300009094 Ga0111539_10124865 Ga0111539_101248652 466
321 3300009147 Ga0114129_10010360 Ga0114129_1001036011 466
322 3300009176 Ga0105242_10014450 Ga0105242_100144501 466
323 3300009553 Ga0105249_10000251 Ga0105249_1000025138 466
324 3300009553 Ga0105249_10000572 Ga0105249_1000057211 466
325 3300011119 Ga0105246_10122408 Ga0105246_101224081 466
326 3300013104 Ga0157370_10009110 Ga0157370_100091109 466
327 3300013105 Ga0157369_10009566 Ga0157369_100095668 466
328 3300013105 Ga0157369_10068959 Ga0157369_100689595 466
329 3300013105 Ga0157369_10282407 Ga0157369_102824071 466
330 3300013297 Ga0157378_10001106 Ga0157378_100011066 466
331 3300013306 Ga0163162_10000718 Ga0163162_1000071825 466
332 3300013306 Ga0163162_10021283 Ga0163162_100212832 466
333 3300013307 Ga0157372_10007168 Ga0157372_100071686 466
334 3300013307 Ga0157372_10033524 Ga0157372_100335245 466
335 3300014325 Ga0163163_10302315 Ga0163163_103023151 466
336 3300014326 Ga0157380_10099246 Ga0157380_100992462 466
337 3300025315 Ga0207697_10003842 Ga0207697_100038422 466
338 3300025903 Ga0207680_10040035 Ga0207680_100400352 466
339 3300025907 Ga0207645_10001472 Ga0207645_100014722 466
340 3300025907 Ga0207645_10001749 Ga0207645_100017495 466
341 3300025908 Ga0207643_10002930 Ga0207643_100029308 466
342 3300025911 Ga0207654_10025846 Ga0207654_100258462 466
343 3300025912 Ga0207707_10002786 Ga0207707_100027868 466
344 3300025912 Ga0207707_10036988 Ga0207707_100369884 466
345 3300025914 Ga0207671_10012340 Ga0207671_100123403 466
346 3300025915 Ga0207693_10003926 Ga0207693_100039268 466
347 3300025917 Ga0207660_10058005 Ga0207660_100580052 466
348 3300025917 Ga0207660_10061568 Ga0207660_100615682 466
349 3300025918 Ga0207662_10006744 Ga0207662_100067442 466
350 3300025919 Ga0207657_10089345 Ga0207657_100893452 466
351 3300025920 Ga0207649_10046601 Ga0207649_100466011 466
352 3300025921 Ga0207652_10013395 Ga0207652_100133957 466
353 3300025922 Ga0207646_10092391 Ga0207646_100923912 466
354 3300025923 Ga0207681_10002613 Ga0207681_100026135 466
355 3300025923 Ga0207681_10002918 Ga0207681_100029185 466
356 3300025926 Ga0207659_10005657 Ga0207659_100056577 466
357 3300025933 Ga0207706_10000015 Ga0207706_10000015115 466
358 3300025938 Ga0207704_10004757 Ga0207704_100047574 466
359 3300025941 Ga0207711_10002798 Ga0207711_1000279810 466
360 3300025942 Ga0207689_10005150 Ga0207689_100051503 466
361 3300025961 Ga0207712_10002363 Ga0207712_1000236313 466
362 3300025961 Ga0207712_10002544 Ga0207712_100025448 466
363 3300025961 Ga0207712_10004478 Ga0207712_100044783 466
364 3300025972 Ga0207668_10003462 Ga0207668_100034627 466
365 3300025972 Ga0207668_10087489 Ga0207668_100874891 466
366 3300025981 Ga0207640_10000931 Ga0207640_1000093110 466
367 3300025986 Ga0207658_10094189 Ga0207658_100941892 466
368 3300026067 Ga0207678_10015292 Ga0207678_100152927 466
369 3300026075 Ga0207708_10016424 Ga0207708_100164244 466
370 3300026089 Ga0207648_10000010 Ga0207648_10000010128 466
371 3300026089 Ga0207648_10005675 Ga0207648_100056758 466
372 3300026116 Ga0207674_10063525 Ga0207674_100635252 466
373 3300026118 Ga0207675_100000030 Ga0207675_10000003090 466
374 3300026142 Ga0207698_10053717 Ga0207698_100537172 466
375 3300028380 Ga0268265_10001535 Ga0268265_100015355 466
376 3300028381 Ga0268264_10003591 Ga0268264_100035919 466
377 3300031727 Ga0316576_10054774 Ga0316576_100547743 466
378 3300031733 Ga0316577_10046400 Ga0316577_100464002 466
379 3300031901 Ga0307406_10013715 Ga0307406_100137155 466
380 3300032002 Ga0307416_100240338 Ga0307416_1002403381 466
381 3300042876 Ga0451577_0064730 Ga0451577_0064730_1643_3100 466
382 3300045051 Ga0451576_0031139 Ga0451576_0031139_2844_4301 466
383 3300048904 Ga0496101_0112044 Ga0496101_0112044_485_1942 466
384 3300049586 Ga0501070_0038186 Ga0501070_0038186_1625_3082 466
385 3300049590 Ga0501074_0134044 Ga0501074_0134044_163_1632 466
386 3300049742 Ga0501080_0101363 Ga0501080_0101363_401_1858 466
387 3300049823 Ga0501044_0217815 Ga0501044_0217815_86_1600 466
388 3300050507 nmdc:mga05p37_111337_c1 nmdc:mga05p37_111337_c1_210_1700 466
389 3300050508 nmdc:mga09592_24195_c1 nmdc:mga09592_24195_c1_627_2114 466
390 3300050509 nmdc:mga0qj67_5807_c1 nmdc:mga0qj67_5807_c1_3742_5229 466
391 3300050510 nmdc:mga06r32_49502_c1 nmdc:mga06r32_49502_c1_922_2412 466
392 3300050512 nmdc:mga0n895_188459_c1 nmdc:mga0n895_188459_c1_83_1573 466
393 3300050514 nmdc:mga08x19_1893_c1 nmdc:mga08x19_1893_c1_5847_7334 466
394 3300050515 nmdc:mga0a205_13885_c1 nmdc:mga0a205_13885_c1_436_1926 466
395 3300005329 Ga0070683_100017780 Ga0070683_1000177804 467
396 3300005329 Ga0070683_100017906 Ga0070683_1000179063 467
397 3300005329 Ga0070683_100186461 Ga0070683_1001864611 467
398 3300005356 Ga0070674_100009667 Ga0070674_1000096672 467
399 3300005366 Ga0070659_100037062 Ga0070659_1000370623 467
400 3300005367 Ga0070667_100023342 Ga0070667_1000233421 467
401 3300005434 Ga0070709_10011304 Ga0070709_100113042 467
402 3300005471 Ga0070698_100000535 Ga0070698_10000053514 467
403 3300005535 Ga0070684_100154688 Ga0070684_1001546882 467
404 3300005546 Ga0070696_100000113 Ga0070696_10000011319 467
405 3300005564 Ga0070664_100000990 Ga0070664_10000099017 467
406 3300005564 Ga0070664_100069625 Ga0070664_1000696253 467
407 3300005577 Ga0068857_100020444 Ga0068857_1000204446 467
408 3300005616 Ga0068852_100025942 Ga0068852_1000259423 467
409 3300005843 Ga0068860_100119338 Ga0068860_1001193382 467
410 3300009094 Ga0111539_10152236 Ga0111539_101522362 467
411 3300013307 Ga0157372_10004800 Ga0157372_100048001 467
412 3300013307 Ga0157372_10043164 Ga0157372_100431642 467
413 3300014325 Ga0163163_10093096 Ga0163163_100930963 467
414 3300025907 Ga0207645_10076105 Ga0207645_100761052 467
415 3300025909 Ga0207705_10010105 Ga0207705_100101055 467
416 3300025909 Ga0207705_10011492 Ga0207705_100114922 467
417 3300025919 Ga0207657_10119649 Ga0207657_101196492 467
418 3300025932 Ga0207690_10112282 Ga0207690_101122821 467
419 3300025938 Ga0207704_10012345 Ga0207704_100123455 467
420 3300025940 Ga0207691_10014192 Ga0207691_100141922 467
421 3300025944 Ga0207661_10012610 Ga0207661_100126105 467
422 3300025944 Ga0207661_10020685 Ga0207661_100206853 467
423 3300025944 Ga0207661_10033947 Ga0207661_100339474 467
424 3300026089 Ga0207648_10012817 Ga0207648_100128172 467
425 3300026116 Ga0207674_10023628 Ga0207674_100236286 467
426 3300026142 Ga0207698_10009309 Ga0207698_100093092 467
427 3300031731 Ga0307405_10006048 Ga0307405_100060484 467
428 3300031824 Ga0307413_10000344 Ga0307413_1000034412 467
429 3300031901 Ga0307406_10005718 Ga0307406_100057182 467
430 3300031911 Ga0307412_10009550 Ga0307412_100095504 467
431 3300032002 Ga0307416_100007260 Ga0307416_1000072605 467
432 3300032002 Ga0307416_100081892 Ga0307416_1000818922 467
433 3300032004 Ga0307414_10058579 Ga0307414_100585793 467
434 3300032126 Ga0307415_100003986 Ga0307415_1000039864 467
435 3300032126 Ga0307415_100040391 Ga0307415_1000403912 467
436 3300036401 Ga0373937_0017625 Ga0373937_0017625_2310_3851 467
437 3300046536 Ga0495587_0043772 Ga0495587_0043772_1045_2595 467
438 3300046679 Ga0495623_0042696 Ga0495623_0042696_1153_2694 467
439 3300048088 Ga0495602_0100569 Ga0495602_0100569_604_2145 467
440 3300048911 Ga0496108_0037075 Ga0496108_0037075_199_1743 467
441 3300048916 Ga0496113_0031174 Ga0496113_0031174_1554_3098 467
442 3300049581 Ga0501047_0053591 Ga0501047_0053591_20_1579 467
443 3300049586 Ga0501070_0030086 Ga0501070_0030086_876_2435 467
444 3300005295 Ga0065707_10092569 Ga0065707_100925692 468
445 3300005327 Ga0070658_10005468 Ga0070658_100054684 468
446 3300005327 Ga0070658_10011659 Ga0070658_100116594 468
447 3300005327 Ga0070658_10083059 Ga0070658_100830593 468
448 3300005328 Ga0070676_10001172 Ga0070676_1000117213 468
449 3300005329 Ga0070683_100006226 Ga0070683_1000062264 468
450 3300005329 Ga0070683_100006465 Ga0070683_1000064655 468
451 3300005329 Ga0070683_100007195 Ga0070683_1000071958 468
452 3300005329 Ga0070683_100017278 Ga0070683_1000172782 468
453 3300005329 Ga0070683_100039807 Ga0070683_1000398072 468
454 3300005330 Ga0070690_100014715 Ga0070690_1000147155 468
455 3300005331 Ga0070670_100062618 Ga0070670_1000626182 468
456 3300005331 Ga0070670_100088062 Ga0070670_1000880622 468
457 3300005334 Ga0068869_100001479 Ga0068869_10000147911 468
458 3300005334 Ga0068869_100037987 Ga0068869_1000379874 468
459 3300005336 Ga0070680_100004841 Ga0070680_10000484111 468
460 3300005336 Ga0070680_100005076 Ga0070680_1000050767 468
461 3300005336 Ga0070680_100010389 Ga0070680_1000103897 468
462 3300005336 Ga0070680_100017623 Ga0070680_1000176231 468
463 3300005336 Ga0070680_100037373 Ga0070680_1000373732 468
464 3300005336 Ga0070680_100108761 Ga0070680_1001087611 468
465 3300005336 Ga0070680_100155218 Ga0070680_1001552182 468
466 3300005337 Ga0070682_100005004 Ga0070682_1000050044 468
467 3300005338 Ga0068868_100012394 Ga0068868_1000123945 468
468 3300005339 Ga0070660_100002151 Ga0070660_10000215115 468
469 3300005339 Ga0070660_100013004 Ga0070660_1000130042 468
470 3300005339 Ga0070660_100127725 Ga0070660_1001277252 468
471 3300005340 Ga0070689_100030654 Ga0070689_1000306543 468
472 3300005343 Ga0070687_100000549 Ga0070687_1000005492 468
473 3300005344 Ga0070661_100000331 Ga0070661_1000003313 468
474 3300005344 Ga0070661_100003958 Ga0070661_1000039584 468
475 3300005347 Ga0070668_100000182 Ga0070668_10000018235 468
476 3300005353 Ga0070669_100037086 Ga0070669_1000370862 468
477 3300005354 Ga0070675_100002184 Ga0070675_1000021849 468
478 3300005364 Ga0070673_100018937 Ga0070673_1000189372 468
479 3300005364 Ga0070673_100043692 Ga0070673_1000436922 468
480 3300005364 Ga0070673_100071563 Ga0070673_1000715632 468
481 3300005365 Ga0070688_100019639 Ga0070688_1000196393 468
482 3300005366 Ga0070659_100000927 Ga0070659_1000009278 468
483 3300005366 Ga0070659_100002500 Ga0070659_1000025007 468
484 3300005366 Ga0070659_100011745 Ga0070659_1000117454 468
485 3300005366 Ga0070659_100013618 Ga0070659_1000136184 468
486 3300005366 Ga0070659_100114982 Ga0070659_1001149822 468
487 3300005367 Ga0070667_100003736 Ga0070667_10000373610 468
488 3300005435 Ga0070714_100009617 Ga0070714_1000096178 468
489 3300005435 Ga0070714_100031774 Ga0070714_1000317743 468
490 3300005440 Ga0070705_100047597 Ga0070705_1000475972 468
491 3300005457 Ga0070662_100002883 Ga0070662_1000028837 468
492 3300005458 Ga0070681_10003870 Ga0070681_1000387015 468
493 3300005458 Ga0070681_10008927 Ga0070681_100089279 468
494 3300005458 Ga0070681_10034461 Ga0070681_100344614 468
495 3300005458 Ga0070681_10187652 Ga0070681_101876521 468
496 3300005471 Ga0070698_100121428 Ga0070698_1001214281 468
497 3300005530 Ga0070679_100003029 Ga0070679_10000302912 468
498 3300005530 Ga0070679_100004557 Ga0070679_1000045576 468
499 3300005530 Ga0070679_100006728 Ga0070679_1000067282 468
500 3300005530 Ga0070679_100009679 Ga0070679_1000096792 468
501 3300005530 Ga0070679_100019454 Ga0070679_1000194542 468
502 3300005530 Ga0070679_100068102 Ga0070679_1000681022 468
503 3300005535 Ga0070684_100026387 Ga0070684_1000263873 468
504 3300005535 Ga0070684_100029652 Ga0070684_1000296522 468
505 3300005535 Ga0070684_100046227 Ga0070684_1000462272 468
506 3300005543 Ga0070672_100016273 Ga0070672_1000162732 468
507 3300005545 Ga0070695_100010556 Ga0070695_1000105564 468
508 3300005547 Ga0070693_100007102 Ga0070693_1000071025 468
509 3300005548 Ga0070665_100000399 Ga0070665_10000039945 468
510 3300005563 Ga0068855_100028001 Ga0068855_1000280014 468
511 3300005563 Ga0068855_100038801 Ga0068855_1000388015 468
512 3300005563 Ga0068855_100062029 Ga0068855_1000620292 468
513 3300005564 Ga0070664_100003425 Ga0070664_10000342510 468
514 3300005614 Ga0068856_100003727 Ga0068856_10000372712 468
515 3300005614 Ga0068856_100022892 Ga0068856_1000228926 468
516 3300005615 Ga0070702_100000366 Ga0070702_10000036611 468
517 3300005616 Ga0068852_100006987 Ga0068852_1000069879 468
518 3300005617 Ga0068859_100013810 Ga0068859_1000138105 468
519 3300005618 Ga0068864_100001549 Ga0068864_10000154911 468
520 3300005718 Ga0068866_10021583 Ga0068866_100215833 468
521 3300005834 Ga0068851_10051371 Ga0068851_100513712 468
522 3300005841 Ga0068863_100003160 Ga0068863_10000316012 468
523 3300005841 Ga0068863_100128205 Ga0068863_1001282052 468
524 3300005844 Ga0068862_100036850 Ga0068862_1000368504 468
525 3300005985 Ga0081539_10009701 Ga0081539_100097016 468
526 3300006237 Ga0097621_100034285 Ga0097621_1000342852 468
527 3300006846 Ga0075430_100056456 Ga0075430_1000564563 468
528 3300006846 Ga0075430_100068805 Ga0075430_1000688052 468
529 3300006847 Ga0075431_100046401 Ga0075431_1000464013 468
530 3300006931 Ga0097620_100013811 Ga0097620_1000138115 468
531 3300009174 Ga0105241_10009823 Ga0105241_100098232 468
532 3300009551 Ga0105238_10021425 Ga0105238_100214252 468
533 3300010375 Ga0105239_10035253 Ga0105239_100352532 468
534 3300010375 Ga0105239_10046185 Ga0105239_100461852 468
535 3300011119 Ga0105246_10000522 Ga0105246_100005224 468
536 3300013100 Ga0157373_10016451 Ga0157373_100164512 468
537 3300013102 Ga0157371_10030300 Ga0157371_100303003 468
538 3300013102 Ga0157371_10034702 Ga0157371_100347022 468
539 3300013104 Ga0157370_10128779 Ga0157370_101287792 468
540 3300013296 Ga0157374_10030377 Ga0157374_100303772 468
541 3300013307 Ga0157372_10004905 Ga0157372_100049058 468
542 3300013307 Ga0157372_10009706 Ga0157372_100097067 468
543 3300013307 Ga0157372_10052660 Ga0157372_100526603 468
544 3300014325 Ga0163163_10022786 Ga0163163_100227865 468
545 3300014745 Ga0157377_10001101 Ga0157377_100011017 468
546 3300014969 Ga0157376_10014136 Ga0157376_100141362 468
547 3300022467 Ga0224712_10024797 Ga0224712_100247971 468
548 3300025909 Ga0207705_10002060 Ga0207705_1000206010 468
549 3300025909 Ga0207705_10017850 Ga0207705_100178503 468
550 3300025911 Ga0207654_10056097 Ga0207654_100560972 468
551 3300025912 Ga0207707_10000423 Ga0207707_100004236 468
552 3300025912 Ga0207707_10027874 Ga0207707_100278743 468
553 3300025912 Ga0207707_10031879 Ga0207707_100318792 468
554 3300025913 Ga0207695_10007739 Ga0207695_100077392 468
555 3300025913 Ga0207695_10020940 Ga0207695_100209402 468
556 3300025917 Ga0207660_10004363 Ga0207660_100043632 468
557 3300025917 Ga0207660_10004590 Ga0207660_100045901 468
558 3300025917 Ga0207660_10024837 Ga0207660_100248372 468
559 3300025919 Ga0207657_10012334 Ga0207657_100123349 468
560 3300025921 Ga0207652_10062110 Ga0207652_100621102 468
561 3300025921 Ga0207652_10084147 Ga0207652_100841472 468
562 3300025921 Ga0207652_10111016 Ga0207652_101110162 468
563 3300025924 Ga0207694_10003260 Ga0207694_100032607 468
564 3300025925 Ga0207650_10005032 Ga0207650_100050323 468
565 3300025928 Ga0207700_10107713 Ga0207700_101077132 468
566 3300025928 Ga0207700_10146869 Ga0207700_101468692 468
567 3300025932 Ga0207690_10013013 Ga0207690_100130132 468
568 3300025935 Ga0207709_10071646 Ga0207709_100716462 468
569 3300025940 Ga0207691_10000840 Ga0207691_1000084017 468
570 3300025942 Ga0207689_10007205 Ga0207689_100072052 468
571 3300025942 Ga0207689_10023712 Ga0207689_100237125 468
572 3300025944 Ga0207661_10000472 Ga0207661_1000047217 468
573 3300025944 Ga0207661_10004340 Ga0207661_100043402 468
574 3300025944 Ga0207661_10009167 Ga0207661_100091675 468
575 3300025944 Ga0207661_10122373 Ga0207661_101223732 468
576 3300025945 Ga0207679_10003434 Ga0207679_100034345 468
577 3300025949 Ga0207667_10022814 Ga0207667_100228145 468
578 3300025949 Ga0207667_10082568 Ga0207667_100825682 468
579 3300025949 Ga0207667_10107699 Ga0207667_101076992 468
580 3300025949 Ga0207667_10119480 Ga0207667_101194803 468
581 3300025960 Ga0207651_10046823 Ga0207651_100468232 468
582 3300025981 Ga0207640_10030753 Ga0207640_100307532 468
583 3300025986 Ga0207658_10013897 Ga0207658_100138972 468
584 3300026023 Ga0207677_10003526 Ga0207677_100035266 468
585 3300026035 Ga0207703_10153607 Ga0207703_101536072 468
586 3300026078 Ga0207702_10007494 Ga0207702_100074944 468
587 3300026088 Ga0207641_10017047 Ga0207641_100170472 468
588 3300026095 Ga0207676_10008097 Ga0207676_100080972 468
589 3300026116 Ga0207674_10000528 Ga0207674_100005287 468
590 3300026118 Ga0207675_100033324 Ga0207675_1000333244 468
591 3300026142 Ga0207698_10051996 Ga0207698_100519962 468
592 3300028380 Ga0268265_10015921 Ga0268265_100159214 468
593 3300031238 Ga0265332_10012632 Ga0265332_100126322 468
594 3300031548 Ga0307408_100017279 Ga0307408_1000172791 468
595 3300031731 Ga0307405_10000745 Ga0307405_100007455 468
596 3300031824 Ga0307413_10004295 Ga0307413_100042952 468
597 3300031852 Ga0307410_10007833 Ga0307410_100078332 468
598 3300031852 Ga0307410_10012534 Ga0307410_100125342 468
599 3300031901 Ga0307406_10058696 Ga0307406_100586962 468
600 3300031901 Ga0307406_10071466 Ga0307406_100714662 468
601 3300031903 Ga0307407_10004507 Ga0307407_100045073 468
602 3300031903 Ga0307407_10031289 Ga0307407_100312891 468
603 3300031903 Ga0307407_10033144 Ga0307407_100331442 468
604 3300031903 Ga0307407_10101376 Ga0307407_101013761 468
605 3300031911 Ga0307412_10016126 Ga0307412_100161263 468
606 3300031911 Ga0307412_10036303 Ga0307412_100363032 468
607 3300031911 Ga0307412_10045006 Ga0307412_100450062 468
608 3300031995 Ga0307409_100000357 Ga0307409_1000003576 468
609 3300031995 Ga0307409_100011126 Ga0307409_1000111263 468
610 3300031995 Ga0307409_100016802 Ga0307409_1000168022 468
611 3300031995 Ga0307409_100091311 Ga0307409_1000913112 468
612 3300032002 Ga0307416_100003262 Ga0307416_1000032622 468
613 3300032002 Ga0307416_100010390 Ga0307416_1000103902 468
614 3300032002 Ga0307416_100014672 Ga0307416_1000146723 468
615 3300032002 Ga0307416_100103190 Ga0307416_1001031901 468
616 3300032004 Ga0307414_10056051 Ga0307414_100560512 468
617 3300032004 Ga0307414_10063539 Ga0307414_100635392 468
618 3300032005 Ga0307411_10002232 Ga0307411_100022327 468
619 3300032126 Ga0307415_100002295 Ga0307415_1000022955 468
620 3300032126 Ga0307415_100002668 Ga0307415_1000026686 468
621 3300035725 Ga0373947_0017785 Ga0373947_0017785_1171_2724 468
622 3300042876 Ga0451577_0000005 Ga0451577_0000005_35838_37382 468
623 3300042876 Ga0451577_0001689 Ga0451577_0001689_1592_3055 468
624 3300042876 Ga0451577_0082408 Ga0451577_0082408_897_2360 468
625 3300042876 Ga0451577_0101001 Ga0451577_0101001_500_1963 468
626 3300044712 Ga0453684_0000330 Ga0453684_0000330_108506_109969 468
627 3300046499 Ga0495594_0042180 Ga0495594_0042180_827_2380 468
628 3300046535 Ga0495586_0021334 Ga0495586_0021334_162_1715 468
629 3300049568 Ga0501031_0039396 Ga0501031_0039396_78_1622 468
630 3300049575 Ga0501039_0138424 Ga0501039_0138424_135_1595 468
631 3300049578 Ga0501042_0102925 Ga0501042_0102925_229_1689 468
632 3300049580 Ga0501046_0107457 Ga0501046_0107457_570_2030 468
633 3300049582 Ga0501048_0013752 Ga0501048_0013752_4439_5899 468
634 3300049590 Ga0501074_0082164 Ga0501074_0082164_602_2062 468
635 3300049591 Ga0501075_0017633 Ga0501075_0017633_804_2348 468
636 3300049742 Ga0501080_0213659 Ga0501080_0213659_21_1565 468
637 3300049744 Ga0501083_0058981 Ga0501083_0058981_569_2029 468
638 3300049822 Ga0501035_0157030 Ga0501035_0157030_321_1865 468
639 3300050509 nmdc:mga0qj67_67633_c1 nmdc:mga0qj67_67633_c1_122_1672 468
640 3300050509 nmdc:mga0qj67_91425_c1 nmdc:mga0qj67_91425_c1_852_2402 468
641 3300050510 nmdc:mga06r32_39521_c1 nmdc:mga06r32_39521_c1_2423_3967 468
642 3300050510 nmdc:mga06r32_9509_c1 nmdc:mga06r32_9509_c1_6764_8314 468
643 3300005366 Ga0070659_100000100 Ga0070659_10000010045 469
644 3300005458 Ga0070681_10004476 Ga0070681_1000447614 469
645 3300005471 Ga0070698_100072240 Ga0070698_1000722402 469
646 3300005518 Ga0070699_100158927 Ga0070699_1001589271 469
647 3300005530 Ga0070679_100127335 Ga0070679_1001273352 469
648 3300005549 Ga0070704_100110884 Ga0070704_1001108842 469
649 3300006880 Ga0075429_100007625 Ga0075429_1000076251 469
650 3300013100 Ga0157373_10000069 Ga0157373_100000693 469
651 3300013307 Ga0157372_10011953 Ga0157372_100119533 469
652 3300025250 Ga0209026_1002502 Ga0209026_10025022 469
653 3300025917 Ga0207660_10028354 Ga0207660_100283543 469
654 3300025932 Ga0207690_10000609 Ga0207690_1000060919 469
655 3300031251 Ga0265327_10003773 Ga0265327_100037731 469
656 3300031731 Ga0307405_10064648 Ga0307405_100646482 469
657 3300031852 Ga0307410_10010966 Ga0307410_100109664 469
658 3300037312 Ga0395899_0101203 Ga0395899_0101203_466_2046 469
659 3300037418 Ga0395900_0010889 Ga0395900_0010889_4708_6288 469
660 3300037418 Ga0395900_0014902 Ga0395900_0014902_4191_5660 469
661 3300037471 Ga0395905_0006399 Ga0395905_0006399_2022_3602 469
662 3300038443 Ga0395901_0008806 Ga0395901_0008806_7311_8891 469
663 3300046460 Ga0495638_0073531 Ga0495638_0073531_150_1649 469
664 3300049570 Ga0501033_0008106 Ga0501033_0008106_566_2041 469
665 3300049571 Ga0501034_0126368 Ga0501034_0126368_698_2173 469
666 3300049823 Ga0501044_0088571 Ga0501044_0088571_1113_2588 469
667 3300005530 Ga0070679_100146456 Ga0070679_1001464562 470
668 3300009545 Ga0105237_10009074 Ga0105237_100090749 470
669 3300025914 Ga0207671_10009085 Ga0207671_100090852 470
670 3300031344 Ga0265316_10098584 Ga0265316_100985841 470
671 3300031548 Ga0307408_100000629 Ga0307408_10000062912 470
672 3300031548 Ga0307408_100000729 Ga0307408_1000007294 470
673 3300032002 Ga0307416_100213981 Ga0307416_1002139812 470
674 3300041511 Ga0451855_1231084 Ga0451855_1231084_665_2134 470
675 3300053080 Ga0500635_0014106 Ga0500635_0014106_199_1668 470
676 3300044673 Ga0453683_0021427 Ga0453683_0021427_622_2100 471
677 3300005289 Ga0065704_10000251 Ga0065704_100002514 472
678 3300013100 Ga0157373_10000634 Ga0157373_1000063414 472
679 3300013102 Ga0157371_10005499 Ga0157371_100054998 472
680 3300015261 Ga0182006_1001502 Ga0182006_10015024 472
681 3300031727 Ga0316576_10055572 Ga0316576_100555722 472
682 3300031911 Ga0307412_10000009 Ga0307412_10000009293 472
683 3300032002 Ga0307416_100000344 Ga0307416_10000034416 472
684 3300037471 Ga0395905_0000023 Ga0395905_0000023_100057_101526 472
685 3300042876 Ga0451577_0105694 Ga0451577_0105694_247_1728 472
686 3300044673 Ga0453683_0000072 Ga0453683_0000072_97923_99404 472
687 3300044673 Ga0453683_0003129 Ga0453683_0003129_8650_10131 472
688 3300044673 Ga0453683_0040223 Ga0453683_0040223_1393_2874 472
689 3300044673 Ga0453683_0140678 Ga0453683_0140678_32_1513 472
690 3300044712 Ga0453684_0000091 Ga0453684_0000091_146620_148101 472
691 3300044712 Ga0453684_0010910 Ga0453684_0010910_12310_13794 472
692 3300044712 Ga0453684_0023474 Ga0453684_0023474_4457_5923 472
693 3300044712 Ga0453684_0038874 Ga0453684_0038874_1453_2934 472
694 3300044712 Ga0453684_0090744 Ga0453684_0090744_1444_2925 472
695 3300044712 Ga0453684_0148230 Ga0453684_0148230_1094_2575 472
696 3300044712 Ga0453684_0156818 Ga0453684_0156818_351_1832 472
697 3300045051 Ga0451576_0000280 Ga0451576_0000280_68698_70179 472
698 3300045051 Ga0451576_0003878 Ga0451576_0003878_8034_9515 472
699 3300045051 Ga0451576_0028814 Ga0451576_0028814_74_1555 472
700 3300045051 Ga0451576_0085109 Ga0451576_0085109_898_2364 472
701 3300053093 Ga0500651_0000139 Ga0500651_0000139_12456_13988 472
702 3300053156 Ga0500622_0007717 Ga0500622_0007717_1034_2506 472
703 3300005289 Ga0065704_10082553 Ga0065704_100825532 473
704 3300005327 Ga0070658_10000047 Ga0070658_1000004761 473
705 3300005563 Ga0068855_100042147 Ga0068855_1000421472 473
706 3300005834 Ga0068851_10000042 Ga0068851_1000004266 473
707 3300013102 Ga0157371_10001005 Ga0157371_1000100515 473
708 3300013104 Ga0157370_10001850 Ga0157370_100018507 473
709 3300013104 Ga0157370_10018303 Ga0157370_100183033 473
710 3300014326 Ga0157380_10144727 Ga0157380_101447272 473
711 3300014497 Ga0182008_10000200 Ga0182008_1000020039 473
712 3300015261 Ga0182006_1001978 Ga0182006_10019789 473
713 3300025321 Ga0207656_10000176 Ga0207656_1000017622 473
714 3300025909 Ga0207705_10000052 Ga0207705_1000005261 473
715 3300025949 Ga0207667_10005189 Ga0207667_1000518911 473
716 3300031344 Ga0265316_10006843 Ga0265316_100068434 473
717 3300031691 Ga0316579_10004878 Ga0316579_100048783 473
718 3300031727 Ga0316576_10009153 Ga0316576_100091532 473
719 3300031728 Ga0316578_10046552 Ga0316578_100465522 473
720 3300031733 Ga0316577_10034188 Ga0316577_100341882 473
721 3300031995 Ga0307409_100223277 Ga0307409_1002232771 473
722 3300032004 Ga0307414_10000078 Ga0307414_100000788 473
723 3300032004 Ga0307414_10142145 Ga0307414_101421453 473
724 3300032126 Ga0307415_100048847 Ga0307415_1000488472 473
725 3300035398 Ga0316574_0085756 Ga0316574_0085756_192_1667 473
726 3300036712 Ga0316584_0008704 Ga0316584_0008704_1918_3387 473
727 3300042876 Ga0451577_0002841 Ga0451577_0002841_6265_7743 473
728 3300042876 Ga0451577_0122443 Ga0451577_0122443_810_2291 473
729 3300044712 Ga0453684_0000792 Ga0453684_0000792_95195_96673 473
730 3300044712 Ga0453684_0010913 Ga0453684_0010913_8877_10376 473
731 3300044712 Ga0453684_0011356 Ga0453684_0011356_8435_9910 473
732 3300044712 Ga0453684_0020471 Ga0453684_0020471_5639_7114 473
733 3300044712 Ga0453684_0125513 Ga0453684_0125513_962_2443 473
734 3300044712 Ga0453684_0203347 Ga0453684_0203347_771_2246 473
735 3300045051 Ga0451576_0036406 Ga0451576_0036406_2969_4444 473
736 3300045051 Ga0451576_0097164 Ga0451576_0097164_268_1746 473
737 3300048925 Ga0496122_0001073 Ga0496122_0001073_29942_31411 473
738 3300048926 Ga0496123_0008196 Ga0496123_0008196_575_2044 473
739 3300003323 rootH1_10115330 rootH1_101153305 475

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

88

358

0.99

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

356

529

0.96

PF00571

CBS

CBS domain

168

222

0.95

PF00571

CBS

CBS domain

229

284

0.9

PF03060

NMO

Nitronate monooxygenase

283

433

0.84

PF01070

FMN_dh

FMN-dependent dehydrogenase

309

428

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5r-assembly1.cif.gz_A cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - apo form 0.9336 98 215
1vrd-assembly1.cif.gz_A crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9163 12 452
3ffs-assembly1.cif.gz_B the crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase 0.9143 11 452
1vrd-assembly1.cif.gz_A crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution 0.9107 12 452
3khj-assembly2.cif.gz_E c. parvum inosine monophosphate dehydrogenase bound by inhibitor c64 0.9106 11 453
ID Description Score Start End Superfamily
4dqwB02 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9409 100 208 3.10.580.10
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.91 98 208 3.10.580.10
2o16A00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9068 98 211 3.10.580.10
af_Q8BGM7_334_480_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9052 98 208 3.10.580.10
af_Q2FXM2_188_307_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9032 100 211 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A348TRI4-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.966 103 232 GO:0003938
GO:0006183
AF-A0A800M5P1-F1-model_v4 CBS domain-containing protein 0.9621 6 349 GO:0003938
GO:0006177
GO:0006183
GO:0046872
AF-A0A2T2SI51-F1-model_v4 Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) 0.9612 7 376 GO:0003938
GO:0006177
GO:0006183
GO:0046872
AF-A0A2E7FDG8-F1-model_v4 IMP dehydrogenase (EC 1.1.1.205) 0.9593 4 288 GO:0003938
GO:0006183
AF-A0A6N9EZ52-F1-model_v4 deleted 0.9592 1 266

Feature Viewer

pLDDT pTM Quality
82.33 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map