F478443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 224 | 739 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100468768|Ga0070714_1004687682 |
| Length | 146 |
| Sequence | VLDFALLERNSDDVPKLHLTKVAFACRDVDSLTQRIANRAFGGEVRVATRMRPKRSAELIGGNLYWIVKHRLVAGLEILRFEDREDGRLDIVCSAELVVVSPRPRRAHQGWRYLEEADAPSAGDDGTGLGALPPILYGKLASLALV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 224 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 1.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 97.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5802081 | 2162886012 | Unclassified | 1259 |
| 2 | JGI24752J21851_1042724 | 3300001976 | Unclassified | 609 |
| 3 | JGI24740J21852_10001279 | 3300001979 | Bacteria | 11425 |
| 4 | JGI24740J21852_10124572 | 3300001979 | Bacteria | 644 |
| 5 | JGI24739J22299_10000632 | 3300001989 | Bacteria | 12645 |
| 6 | JGI24739J22299_10008617 | 3300001989 | Bacteria | 3805 |
| 7 | JGI24737J22298_10000103 | 3300001990 | Bacteria | 25390 |
| 8 | JGI24737J22298_10017157 | 3300001990 | Bacteria | 2334 |
| 9 | JGI24735J21928_10019965 | 3300002067 | Bacteria | 2056 |
| 10 | JGI24738J21930_10000018 | 3300002075 | Bacteria | 30549 |
| 11 | JGI24738J21930_10008304 | 3300002075 | Bacteria | 2364 |
| 12 | Ga0065712_10040760 | 3300005290 | Bacteria | 1206 |
| 13 | Ga0065715_10340560 | 3300005293 | Bacteria | 963 |
| 14 | Ga0065715_10584272 | 3300005293 | Bacteria | 718 |
| 15 | Ga0070658_10000107 | 3300005327 | Bacteria | 73895 |
| 16 | Ga0070658_10009613 | 3300005327 | Bacteria | 7761 |
| 17 | Ga0070658_10019253 | 3300005327 | Bacteria | 5468 |
| 18 | Ga0070658_10019568 | 3300005327 | Bacteria | 5420 |
| 19 | Ga0070658_10033380 | 3300005327 | Bacteria | 4140 |
| 20 | Ga0070658_10060655 | 3300005327 | Bacteria | 3081 |
| 21 | Ga0070658_10076497 | 3300005327 | Bacteria | 2745 |
| 22 | Ga0070658_10398910 | 3300005327 | Bacteria | 1181 |
| 23 | Ga0070658_11268895 | 3300005327 | Unclassified | 640 |
| 24 | Ga0070676_10002531 | 3300005328 | Bacteria | 9389 |
| 25 | Ga0070676_10027239 | 3300005328 | Bacteria | 3240 |
| 26 | Ga0070676_10036742 | 3300005328 | Bacteria | 2823 |
| 27 | Ga0070676_10908951 | 3300005328 | Bacteria | 656 |
| 28 | Ga0070683_100001635 | 3300005329 | Bacteria | 17347 |
| 29 | Ga0070683_100006411 | 3300005329 | Bacteria | 9866 |
| 30 | Ga0070683_100028335 | 3300005329 | Bacteria | 5061 |
| 31 | Ga0070683_100062139 | 3300005329 | Bacteria | 3472 |
| 32 | Ga0070683_100062612 | 3300005329 | Bacteria | 3459 |
| 33 | Ga0070683_100131879 | 3300005329 | Bacteria | 2365 |
| 34 | Ga0070683_100301837 | 3300005329 | Bacteria | 1523 |
| 35 | Ga0070683_100514835 | 3300005329 | Bacteria | 1143 |
| 36 | Ga0070683_100870353 | 3300005329 | Unclassified | 864 |
| 37 | Ga0070690_100026541 | 3300005330 | Bacteria | 3574 |
| 38 | Ga0070690_100902800 | 3300005330 | Bacteria | 691 |
| 39 | Ga0070670_100014652 | 3300005331 | Bacteria | 6731 |
| 40 | Ga0070670_100266583 | 3300005331 | Bacteria | 1494 |
| 41 | Ga0070670_101822775 | 3300005331 | Bacteria | 560 |
| 42 | Ga0070677_10405993 | 3300005333 | Unclassified | 719 |
| 43 | Ga0068869_100003378 | 3300005334 | Bacteria | 9741 |
| 44 | Ga0068869_100667997 | 3300005334 | Bacteria | 883 |
| 45 | Ga0070666_10001184 | 3300005335 | Bacteria | 15784 |
| 46 | Ga0070666_10713713 | 3300005335 | Unclassified | 736 |
| 47 | Ga0070680_100000477 | 3300005336 | Bacteria | 27458 |
| 48 | Ga0070680_100002652 | 3300005336 | Bacteria | 13265 |
| 49 | Ga0070680_100004694 | 3300005336 | Bacteria | 10278 |
| 50 | Ga0070680_100006732 | 3300005336 | Bacteria | 8753 |
| 51 | Ga0070680_100008676 | 3300005336 | Bacteria | 7792 |
| 52 | Ga0070680_100048693 | 3300005336 | Bacteria | 3454 |
| 53 | Ga0070680_100132389 | 3300005336 | Bacteria | 2087 |
| 54 | Ga0070680_100589438 | 3300005336 | Bacteria | 954 |
| 55 | Ga0070680_100711197 | 3300005336 | Bacteria | 864 |
| 56 | Ga0070682_100006724 | 3300005337 | Bacteria | 6449 |
| 57 | Ga0070682_100192650 | 3300005337 | Bacteria | 1432 |
| 58 | Ga0070682_100382896 | 3300005337 | Bacteria | 1058 |
| 59 | Ga0068868_100000972 | 3300005338 | Bacteria | 19505 |
| 60 | Ga0068868_100343657 | 3300005338 | Bacteria | 1276 |
| 61 | Ga0070660_100000861 | 3300005339 | Bacteria | 20243 |
| 62 | Ga0070660_100003065 | 3300005339 | Bacteria | 11487 |
| 63 | Ga0070660_100003086 | 3300005339 | Bacteria | 11449 |
| 64 | Ga0070660_100011318 | 3300005339 | Bacteria | 6332 |
| 65 | Ga0070660_100025166 | 3300005339 | Bacteria | 4422 |
| 66 | Ga0070660_100033421 | 3300005339 | Bacteria | 3877 |
| 67 | Ga0070660_100034397 | 3300005339 | Bacteria | 3828 |
| 68 | Ga0070660_100034860 | 3300005339 | Bacteria | 3806 |
| 69 | Ga0070660_100748122 | 3300005339 | Bacteria | 821 |
| 70 | Ga0070660_100786605 | 3300005339 | Bacteria | 800 |
| 71 | Ga0070689_100017523 | 3300005340 | Bacteria | 5263 |
| 72 | Ga0070691_10256308 | 3300005341 | Bacteria | 940 |
| 73 | Ga0070687_100037451 | 3300005343 | Bacteria | 2425 |
| 74 | Ga0070661_100000101 | 3300005344 | Bacteria | 70279 |
| 75 | Ga0070661_100004927 | 3300005344 | Bacteria | 9192 |
| 76 | Ga0070661_100005038 | 3300005344 | Bacteria | 9110 |
| 77 | Ga0070661_100055931 | 3300005344 | Bacteria | 2889 |
| 78 | Ga0070661_100131409 | 3300005344 | Bacteria | 1881 |
| 79 | Ga0070661_100187165 | 3300005344 | Bacteria | 1578 |
| 80 | Ga0070661_100232893 | 3300005344 | Bacteria | 1416 |
| 81 | Ga0070661_100612791 | 3300005344 | Bacteria | 881 |
| 82 | Ga0070692_10003217 | 3300005345 | Bacteria | 6575 |
| 83 | Ga0070692_10016353 | 3300005345 | Bacteria | 3528 |
| 84 | Ga0070692_10082450 | 3300005345 | Bacteria | 1734 |
| 85 | Ga0070692_10083589 | 3300005345 | Bacteria | 1724 |
| 86 | Ga0070692_10130734 | 3300005345 | Bacteria | 1411 |
| 87 | Ga0070668_100008284 | 3300005347 | Bacteria | 7716 |
| 88 | Ga0070668_100038015 | 3300005347 | Bacteria | 3677 |
| 89 | Ga0070668_101253443 | 3300005347 | Bacteria | 673 |
| 90 | Ga0070669_100000613 | 3300005353 | Bacteria | 26394 |
| 91 | Ga0070669_100016981 | 3300005353 | Bacteria | 5197 |
| 92 | Ga0070669_100084035 | 3300005353 | Bacteria | 2374 |
| 93 | Ga0070669_100653472 | 3300005353 | Bacteria | 885 |
| 94 | Ga0070669_101138821 | 3300005353 | Unclassified | 673 |
| 95 | Ga0070675_100073493 | 3300005354 | Bacteria | 2839 |
| 96 | Ga0070675_100360257 | 3300005354 | Bacteria | 1291 |
| 97 | Ga0070671_100000533 | 3300005355 | Bacteria | 26740 |
| 98 | Ga0070671_100014143 | 3300005355 | Bacteria | 6445 |
| 99 | Ga0070671_100030078 | 3300005355 | Bacteria | 4482 |
| 100 | Ga0070671_101046362 | 3300005355 | Unclassified | 716 |
| 101 | Ga0070674_101294478 | 3300005356 | Bacteria | 650 |
| 102 | Ga0070673_100003805 | 3300005364 | Bacteria | 9466 |
| 103 | Ga0070673_100057067 | 3300005364 | Bacteria | 3084 |
| 104 | Ga0070673_100308646 | 3300005364 | Bacteria | 1395 |
| 105 | Ga0070659_100000045 | 3300005366 | Bacteria | 101520 |
| 106 | Ga0070659_100016514 | 3300005366 | Bacteria | 5542 |
| 107 | Ga0070659_100057730 | 3300005366 | Bacteria | 3061 |
| 108 | Ga0070659_100059707 | 3300005366 | Bacteria | 3011 |
| 109 | Ga0070659_100154086 | 3300005366 | Bacteria | 1876 |
| 110 | Ga0070659_100202596 | 3300005366 | Bacteria | 1634 |
| 111 | Ga0070659_100219296 | 3300005366 | Bacteria | 1569 |
| 112 | Ga0070659_100259405 | 3300005366 | Bacteria | 1442 |
| 113 | Ga0070659_100702014 | 3300005366 | Unclassified | 875 |
| 114 | Ga0070659_100989752 | 3300005366 | Bacteria | 738 |
| 115 | Ga0070659_101062650 | 3300005366 | Bacteria | 712 |
| 116 | Ga0070667_100001174 | 3300005367 | Bacteria | 23830 |
| 117 | Ga0070667_100079689 | 3300005367 | Bacteria | 2800 |
| 118 | Ga0070667_100413617 | 3300005367 | Bacteria | 1229 |
| 119 | Ga0070667_100601984 | 3300005367 | Bacteria | 1013 |
| 120 | Ga0070714_100172953 | 3300005435 | Bacteria | 1961 |
| 121 | Ga0070714_100468768 | 3300005435 | Bacteria | 1198 |
| 122 | Ga0070714_101059704 | 3300005435 | Bacteria | 790 |
| 123 | Ga0070713_101767878 | 3300005436 | Unclassified | 600 |
| 124 | Ga0070694_100005710 | 3300005444 | Bacteria | 7546 |
| 125 | Ga0070694_101381431 | 3300005444 | Unclassified | 594 |
| 126 | Ga0070663_100000549 | 3300005455 | Bacteria | 19942 |
| 127 | Ga0070663_100047213 | 3300005455 | Bacteria | 3050 |
| 128 | Ga0070663_100180609 | 3300005455 | Bacteria | 1637 |
| 129 | Ga0070663_100322178 | 3300005455 | Bacteria | 1243 |
| 130 | Ga0070663_100456936 | 3300005455 | Bacteria | 1054 |
| 131 | Ga0070662_100000036 | 3300005457 | Bacteria | 77190 |
| 132 | Ga0070662_100015155 | 3300005457 | Bacteria | 5158 |
| 133 | Ga0070662_100026980 | 3300005457 | Bacteria | 3982 |
| 134 | Ga0070662_100068699 | 3300005457 | Bacteria | 2606 |
| 135 | Ga0070662_100283452 | 3300005457 | Bacteria | 1341 |
| 136 | Ga0070662_101925569 | 3300005457 | Unclassified | 511 |
| 137 | Ga0070681_10004074 | 3300005458 | Bacteria | 13800 |
| 138 | Ga0070681_10023867 | 3300005458 | Bacteria | 6157 |
| 139 | Ga0070681_10081032 | 3300005458 | Bacteria | 3201 |
| 140 | Ga0070681_10165930 | 3300005458 | Bacteria | 2131 |
| 141 | Ga0070681_10338619 | 3300005458 | Bacteria | 1414 |
| 142 | Ga0070681_10705275 | 3300005458 | Bacteria | 925 |
| 143 | Ga0070681_11014010 | 3300005458 | Bacteria | 750 |
| 144 | Ga0070681_11538171 | 3300005458 | Bacteria | 590 |
| 145 | Ga0068867_100001501 | 3300005459 | Bacteria | 16154 |
| 146 | Ga0068867_101293752 | 3300005459 | Bacteria | 673 |
| 147 | Ga0070685_10016844 | 3300005466 | Bacteria | 3901 |
| 148 | Ga0070679_100066466 | 3300005530 | Bacteria | 3594 |
| 149 | Ga0070679_100106227 | 3300005530 | Bacteria | 2793 |
| 150 | Ga0070679_100181881 | 3300005530 | Bacteria | 2074 |
| 151 | Ga0070679_100189064 | 3300005530 | Bacteria | 2029 |
| 152 | Ga0070679_100472562 | 3300005530 | Bacteria | 1198 |
| 153 | Ga0070684_100027913 | 3300005535 | Bacteria | 4769 |
| 154 | Ga0070684_100305960 | 3300005535 | Bacteria | 1459 |
| 155 | Ga0070684_100347638 | 3300005535 | Bacteria | 1364 |
| 156 | Ga0070684_100510099 | 3300005535 | Bacteria | 1114 |
| 157 | Ga0068853_100000059 | 3300005539 | Bacteria | 78301 |
| 158 | Ga0068853_100000570 | 3300005539 | Bacteria | 25231 |
| 159 | Ga0068853_100032863 | 3300005539 | Bacteria | 4398 |
| 160 | Ga0068853_100089942 | 3300005539 | Bacteria | 2697 |
| 161 | Ga0068853_100447637 | 3300005539 | Bacteria | 1214 |
| 162 | Ga0068853_100638202 | 3300005539 | Bacteria | 1013 |
| 163 | Ga0070672_100000866 | 3300005543 | Bacteria | 18097 |
| 164 | Ga0070672_100120352 | 3300005543 | Bacteria | 2148 |
| 165 | Ga0070686_100772757 | 3300005544 | Unclassified | 772 |
| 166 | Ga0070696_100042737 | 3300005546 | Bacteria | 3133 |
| 167 | Ga0070693_100000361 | 3300005547 | Bacteria | 20637 |
| 168 | Ga0070693_100092887 | 3300005547 | Bacteria | 1823 |
| 169 | Ga0070665_100004200 | 3300005548 | Bacteria | 15157 |
| 170 | Ga0070665_100062768 | 3300005548 | Bacteria | 3725 |
| 171 | Ga0070665_100795186 | 3300005548 | Bacteria | 959 |
| 172 | Ga0068855_100003767 | 3300005563 | Bacteria | 18537 |
| 173 | Ga0068855_100010268 | 3300005563 | Bacteria | 11292 |
| 174 | Ga0068855_100021027 | 3300005563 | Bacteria | 7824 |
| 175 | Ga0068855_100058235 | 3300005563 | Bacteria | 4526 |
| 176 | Ga0068855_100210192 | 3300005563 | Bacteria | 2187 |
| 177 | Ga0068855_100988817 | 3300005563 | Bacteria | 884 |
| 178 | Ga0070664_100000027 | 3300005564 | Bacteria | 90881 |
| 179 | Ga0070664_100007309 | 3300005564 | Bacteria | 8904 |
| 180 | Ga0070664_100014989 | 3300005564 | Bacteria | 6326 |
| 181 | Ga0070664_100184030 | 3300005564 | Bacteria | 1858 |
| 182 | Ga0070664_100191805 | 3300005564 | Bacteria | 1821 |
| 183 | Ga0070664_100379554 | 3300005564 | Bacteria | 1290 |
| 184 | Ga0070664_101123983 | 3300005564 | Bacteria | 740 |
| 185 | Ga0068857_100006503 | 3300005577 | Bacteria | 10025 |
| 186 | Ga0068857_100027425 | 3300005577 | Bacteria | 5024 |
| 187 | Ga0068857_100031864 | 3300005577 | Bacteria | 4658 |
| 188 | Ga0068857_100158885 | 3300005577 | Bacteria | 2050 |
| 189 | Ga0068857_100209968 | 3300005577 | Bacteria | 1776 |
| 190 | Ga0068857_101898123 | 3300005577 | Bacteria | 583 |
| 191 | Ga0068854_100014971 | 3300005578 | Bacteria | 5125 |
| 192 | Ga0068854_100031718 | 3300005578 | Bacteria | 3673 |
| 193 | Ga0068854_100049234 | 3300005578 | Bacteria | 3009 |
| 194 | Ga0068854_100064635 | 3300005578 | Bacteria | 2659 |
| 195 | Ga0068854_100077907 | 3300005578 | Bacteria | 2440 |
| 196 | Ga0068854_100173258 | 3300005578 | Bacteria | 1680 |
| 197 | Ga0068854_100189781 | 3300005578 | Bacteria | 1610 |
| 198 | Ga0068854_100248935 | 3300005578 | Bacteria | 1418 |
| 199 | Ga0068856_100000705 | 3300005614 | Bacteria | 36291 |
| 200 | Ga0068856_100112245 | 3300005614 | Bacteria | 2723 |
| 201 | Ga0068856_100177026 | 3300005614 | Bacteria | 2146 |
| 202 | Ga0068856_100844405 | 3300005614 | Unclassified | 935 |
| 203 | Ga0068856_100961209 | 3300005614 | Bacteria | 873 |
| 204 | Ga0068856_101446059 | 3300005614 | Bacteria | 702 |
| 205 | Ga0068856_102281372 | 3300005614 | Bacteria | 549 |
| 206 | Ga0068856_102461425 | 3300005614 | Bacteria | 527 |
| 207 | Ga0068852_100000433 | 3300005616 | Bacteria | 27783 |
| 208 | Ga0068852_100002112 | 3300005616 | Bacteria | 13601 |
| 209 | Ga0068852_100004730 | 3300005616 | Bacteria | 9661 |
| 210 | Ga0068852_100005166 | 3300005616 | Bacteria | 9308 |
| 211 | Ga0068852_100009994 | 3300005616 | Bacteria | 7060 |
| 212 | Ga0068852_100012833 | 3300005616 | Bacteria | 6385 |
| 213 | Ga0068852_100021917 | 3300005616 | Bacteria | 5112 |
| 214 | Ga0068852_100028840 | 3300005616 | Bacteria | 4548 |
| 215 | Ga0068852_100038267 | 3300005616 | Bacteria | 4030 |
| 216 | Ga0068852_100199101 | 3300005616 | Bacteria | 1895 |
| 217 | Ga0068852_100293902 | 3300005616 | Bacteria | 1570 |
| 218 | Ga0068852_100449243 | 3300005616 | Bacteria | 1276 |
| 219 | Ga0068852_101047860 | 3300005616 | Bacteria | 835 |
| 220 | Ga0068859_100001592 | 3300005617 | Bacteria | 23154 |
| 221 | Ga0068859_100004210 | 3300005617 | Bacteria | 14679 |
| 222 | Ga0068859_100186961 | 3300005617 | Bacteria | 2155 |
| 223 | Ga0068859_100505209 | 3300005617 | Bacteria | 1304 |
| 224 | Ga0068864_100000247 | 3300005618 | Bacteria | 48323 |
| 225 | Ga0068864_100008545 | 3300005618 | Bacteria | 8451 |
| 226 | Ga0068864_100018914 | 3300005618 | Bacteria | 5760 |
| 227 | Ga0068864_100081590 | 3300005618 | Bacteria | 2835 |
| 228 | Ga0068866_10126483 | 3300005718 | Bacteria | 1447 |
| 229 | Ga0068866_10525938 | 3300005718 | Bacteria | 787 |
| 230 | Ga0068861_100180793 | 3300005719 | Bacteria | 1755 |
| 231 | Ga0068861_100355085 | 3300005719 | Bacteria | 1287 |
| 232 | Ga0068851_10020047 | 3300005834 | Bacteria | 3234 |
| 233 | Ga0068851_10062018 | 3300005834 | Bacteria | 1917 |
| 234 | Ga0068870_10010268 | 3300005840 | Bacteria | 4294 |
| 235 | Ga0068870_10988314 | 3300005840 | Bacteria | 599 |
| 236 | Ga0068863_100001653 | 3300005841 | Bacteria | 22048 |
| 237 | Ga0068863_100069143 | 3300005841 | Bacteria | 3339 |
| 238 | Ga0068863_100234963 | 3300005841 | Bacteria | 1769 |
| 239 | Ga0068858_100006759 | 3300005842 | Bacteria | 11161 |
| 240 | Ga0068858_100017221 | 3300005842 | Bacteria | 6781 |
| 241 | Ga0068858_100022399 | 3300005842 | Bacteria | 5897 |
| 242 | Ga0068860_100021537 | 3300005843 | Bacteria | 6241 |
| 243 | Ga0068860_100027958 | 3300005843 | Bacteria | 5430 |
| 244 | Ga0068860_101165869 | 3300005843 | Bacteria | 790 |
| 245 | Ga0068862_100006024 | 3300005844 | Bacteria | 10096 |
| 246 | Ga0068862_100254750 | 3300005844 | Bacteria | 1600 |
| 247 | Ga0068862_101192545 | 3300005844 | Bacteria | 759 |
| 248 | Ga0097621_100026649 | 3300006237 | Bacteria | 4537 |
| 249 | Ga0097621_100219024 | 3300006237 | Bacteria | 1658 |
| 250 | Ga0097621_101420964 | 3300006237 | Unclassified | 657 |
| 251 | Ga0068871_100070496 | 3300006358 | Bacteria | 2873 |
| 252 | Ga0097620_100001592 | 3300006931 | Bacteria | 23154 |
| 253 | Ga0097620_100004210 | 3300006931 | Bacteria | 14679 |
| 254 | Ga0097620_100186953 | 3300006931 | Bacteria | 2155 |
| 255 | Ga0097620_100505223 | 3300006931 | Bacteria | 1304 |
| 256 | Ga0105240_10027015 | 3300009093 | Bacteria | 7524 |
| 257 | Ga0105240_10126852 | 3300009093 | Bacteria | 3065 |
| 258 | Ga0105240_10379048 | 3300009093 | Bacteria | 1598 |
| 259 | Ga0105245_10000128 | 3300009098 | Bacteria | 72249 |
| 260 | Ga0105245_10276026 | 3300009098 | Bacteria | 1641 |
| 261 | Ga0114129_10896631 | 3300009147 | Bacteria | 1124 |
| 262 | Ga0105243_10064347 | 3300009148 | Bacteria | 2943 |
| 263 | Ga0105243_10105180 | 3300009148 | Bacteria | 2351 |
| 264 | Ga0105243_10759863 | 3300009148 | Bacteria | 951 |
| 265 | Ga0105243_10817439 | 3300009148 | Bacteria | 920 |
| 266 | Ga0105241_10032667 | 3300009174 | Bacteria | 3903 |
| 267 | Ga0105241_10057413 | 3300009174 | Bacteria | 2986 |
| 268 | Ga0105241_10108525 | 3300009174 | Bacteria | 2219 |
| 269 | Ga0105241_10211699 | 3300009174 | Unclassified | 1624 |
| 270 | Ga0105242_10912682 | 3300009176 | Bacteria | 879 |
| 271 | Ga0105248_10001451 | 3300009177 | Bacteria | 26388 |
| 272 | Ga0105248_10005525 | 3300009177 | Bacteria | 13885 |
| 273 | Ga0105248_10018193 | 3300009177 | Bacteria | 7761 |
| 274 | Ga0105248_11168005 | 3300009177 | Bacteria | 870 |
| 275 | Ga0105237_10010769 | 3300009545 | Bacteria | 9706 |
| 276 | Ga0105238_10014228 | 3300009551 | Bacteria | 8046 |
| 277 | Ga0105238_10033353 | 3300009551 | Bacteria | 5241 |
| 278 | Ga0105238_10122248 | 3300009551 | Bacteria | 2583 |
| 279 | Ga0105238_10143149 | 3300009551 | Bacteria | 2367 |
| 280 | Ga0105249_10031339 | 3300009553 | Bacteria | 4809 |
| 281 | Ga0105249_10065744 | 3300009553 | Bacteria | 3337 |
| 282 | Ga0105249_11185354 | 3300009553 | Bacteria | 835 |
| 283 | Ga0105239_10118334 | 3300010375 | Bacteria | 2940 |
| 284 | Ga0105239_10218160 | 3300010375 | Bacteria | 2139 |
| 285 | Ga0105239_10263900 | 3300010375 | Bacteria | 1936 |
| 286 | Ga0105246_10007663 | 3300011119 | Bacteria | 6626 |
| 287 | Ga0105246_10011642 | 3300011119 | Bacteria | 5463 |
| 288 | Ga0105246_11300917 | 3300011119 | Bacteria | 674 |
| 289 | Ga0157373_10001921 | 3300013100 | Bacteria | 15792 |
| 290 | Ga0157373_10011033 | 3300013100 | Bacteria | 6655 |
| 291 | Ga0157373_10017730 | 3300013100 | Bacteria | 5183 |
| 292 | Ga0157373_10026865 | 3300013100 | Bacteria | 4155 |
| 293 | Ga0157373_10043735 | 3300013100 | Bacteria | 3199 |
| 294 | Ga0157373_10056049 | 3300013100 | Bacteria | 2799 |
| 295 | Ga0157373_10060140 | 3300013100 | Bacteria | 2692 |
| 296 | Ga0157373_10069117 | 3300013100 | Bacteria | 2497 |
| 297 | Ga0157373_10072216 | 3300013100 | Bacteria | 2436 |
| 298 | Ga0157373_10229162 | 3300013100 | Bacteria | 1312 |
| 299 | Ga0157373_10258216 | 3300013100 | Bacteria | 1233 |
| 300 | Ga0157373_10306653 | 3300013100 | Bacteria | 1128 |
| 301 | Ga0157373_10328756 | 3300013100 | Bacteria | 1088 |
| 302 | Ga0157373_10384756 | 3300013100 | Bacteria | 1004 |
| 303 | Ga0157373_10906988 | 3300013100 | Bacteria | 654 |
| 304 | Ga0157371_10001392 | 3300013102 | Bacteria | 25245 |
| 305 | Ga0157371_10002958 | 3300013102 | Bacteria | 15800 |
| 306 | Ga0157371_10014993 | 3300013102 | Bacteria | 5828 |
| 307 | Ga0157371_10055697 | 3300013102 | Bacteria | 2806 |
| 308 | Ga0157371_10058590 | 3300013102 | Bacteria | 2731 |
| 309 | Ga0157371_10070710 | 3300013102 | Bacteria | 2471 |
| 310 | Ga0157371_10112985 | 3300013102 | Bacteria | 1928 |
| 311 | Ga0157371_10140542 | 3300013102 | Bacteria | 1720 |
| 312 | Ga0157371_10140622 | 3300013102 | Bacteria | 1719 |
| 313 | Ga0157371_10255184 | 3300013102 | Unclassified | 1263 |
| 314 | Ga0157371_10308430 | 3300013102 | Bacteria | 1147 |
| 315 | Ga0157371_10416876 | 3300013102 | Unclassified | 984 |
| 316 | Ga0157371_10483958 | 3300013102 | Bacteria | 912 |
| 317 | Ga0157370_10000686 | 3300013104 | Bacteria | 42199 |
| 318 | Ga0157370_10011108 | 3300013104 | Bacteria | 9441 |
| 319 | Ga0157370_10047926 | 3300013104 | Bacteria | 4094 |
| 320 | Ga0157370_10060505 | 3300013104 | Bacteria | 3596 |
| 321 | Ga0157370_10093074 | 3300013104 | Bacteria | 2829 |
| 322 | Ga0157370_10141565 | 3300013104 | Bacteria | 2241 |
| 323 | Ga0157370_10212917 | 3300013104 | Bacteria | 1791 |
| 324 | Ga0157370_10286151 | 3300013104 | Bacteria | 1523 |
| 325 | Ga0157370_11887769 | 3300013104 | Unclassified | 536 |
| 326 | Ga0157369_10008678 | 3300013105 | Bacteria | 11651 |
| 327 | Ga0157369_10039739 | 3300013105 | Bacteria | 5140 |
| 328 | Ga0157369_10059618 | 3300013105 | Bacteria | 4115 |
| 329 | Ga0157369_10069335 | 3300013105 | Bacteria | 3788 |
| 330 | Ga0157369_10115743 | 3300013105 | Bacteria | 2847 |
| 331 | Ga0157369_10309826 | 3300013105 | Bacteria | 1642 |
| 332 | Ga0157369_10556221 | 3300013105 | Bacteria | 1186 |
| 333 | Ga0157369_10612319 | 3300013105 | Bacteria | 1124 |
| 334 | Ga0157369_12011390 | 3300013105 | Unclassified | 586 |
| 335 | Ga0157369_12247206 | 3300013105 | Bacteria | 553 |
| 336 | Ga0157374_10031240 | 3300013296 | Bacteria | 4840 |
| 337 | Ga0157378_10000396 | 3300013297 | Bacteria | 42907 |
| 338 | Ga0163162_10068534 | 3300013306 | Bacteria | 3600 |
| 339 | Ga0163162_10264490 | 3300013306 | Bacteria | 1851 |
| 340 | Ga0163162_10471362 | 3300013306 | Bacteria | 1387 |
| 341 | Ga0157372_10038042 | 3300013307 | Bacteria | 5309 |
| 342 | Ga0157372_10070283 | 3300013307 | Bacteria | 3938 |
| 343 | Ga0157372_10097641 | 3300013307 | Bacteria | 3350 |
| 344 | Ga0157372_10459311 | 3300013307 | Bacteria | 1484 |
| 345 | Ga0157372_11243324 | 3300013307 | Bacteria | 860 |
| 346 | Ga0157372_11540970 | 3300013307 | Bacteria | 765 |
| 347 | Ga0157375_10591103 | 3300013308 | Bacteria | 1270 |
| 348 | Ga0157375_10644106 | 3300013308 | Bacteria | 1216 |
| 349 | Ga0163163_10000187 | 3300014325 | Bacteria | 63661 |
| 350 | Ga0157380_11723141 | 3300014326 | Bacteria | 684 |
| 351 | Ga0157377_11115750 | 3300014745 | Bacteria | 605 |
| 352 | Ga0157379_10182906 | 3300014968 | Bacteria | 1893 |
| 353 | Ga0157379_10681921 | 3300014968 | Bacteria | 964 |
| 354 | Ga0197907_10087473 | 3300020069 | Bacteria | 2393 |
| 355 | Ga0206356_11579705 | 3300020070 | Bacteria | 558 |
| 356 | Ga0206354_10755474 | 3300020081 | Unclassified | 646 |
| 357 | Ga0206354_11422423 | 3300020081 | Bacteria | 958 |
| 358 | Ga0206353_10818459 | 3300020082 | Bacteria | 3127 |
| 359 | Ga0206353_11188791 | 3300020082 | Unclassified | 817 |
| 360 | Ga0207697_10000059 | 3300025315 | Bacteria | 45306 |
| 361 | Ga0207656_10040854 | 3300025321 | Bacteria | 1968 |
| 362 | Ga0207656_10357895 | 3300025321 | Bacteria | 729 |
| 363 | Ga0207682_10197253 | 3300025893 | Bacteria | 924 |
| 364 | Ga0207642_10117116 | 3300025899 | Bacteria | 1367 |
| 365 | Ga0207688_10000721 | 3300025901 | Bacteria | 16387 |
| 366 | Ga0207680_10004748 | 3300025903 | Bacteria | 6467 |
| 367 | Ga0207680_10138471 | 3300025903 | Bacteria | 1611 |
| 368 | Ga0207647_10000968 | 3300025904 | Bacteria | 22267 |
| 369 | Ga0207647_10001381 | 3300025904 | Bacteria | 18648 |
| 370 | Ga0207647_10014849 | 3300025904 | Bacteria | 5356 |
| 371 | Ga0207647_10051788 | 3300025904 | Archaea | 2536 |
| 372 | Ga0207645_10002144 | 3300025907 | Bacteria | 15772 |
| 373 | Ga0207645_10016875 | 3300025907 | Bacteria | 4824 |
| 374 | Ga0207645_10078345 | 3300025907 | Bacteria | 2118 |
| 375 | Ga0207643_10258584 | 3300025908 | Bacteria | 1074 |
| 376 | Ga0207705_10000086 | 3300025909 | Bacteria | 116132 |
| 377 | Ga0207705_10004131 | 3300025909 | Bacteria | 11008 |
| 378 | Ga0207705_10012975 | 3300025909 | Bacteria | 6014 |
| 379 | Ga0207705_10018733 | 3300025909 | Bacteria | 4953 |
| 380 | Ga0207705_10019330 | 3300025909 | Bacteria | 4871 |
| 381 | Ga0207705_10023122 | 3300025909 | Bacteria | 4433 |
| 382 | Ga0207705_10102751 | 3300025909 | Bacteria | 2104 |
| 383 | Ga0207705_10374960 | 3300025909 | Bacteria | 1099 |
| 384 | Ga0207705_10804549 | 3300025909 | Bacteria | 729 |
| 385 | Ga0207654_10096895 | 3300025911 | Bacteria | 1810 |
| 386 | Ga0207654_10116145 | 3300025911 | Unclassified | 1673 |
| 387 | Ga0207654_10238303 | 3300025911 | Bacteria | 1215 |
| 388 | Ga0207654_10325720 | 3300025911 | Bacteria | 1051 |
| 389 | Ga0207707_10086364 | 3300025912 | Bacteria | 2742 |
| 390 | Ga0207707_10096969 | 3300025912 | Bacteria | 2576 |
| 391 | Ga0207707_10238320 | 3300025912 | Bacteria | 1582 |
| 392 | Ga0207707_11096466 | 3300025912 | Bacteria | 649 |
| 393 | Ga0207695_10019721 | 3300025913 | Bacteria | 7753 |
| 394 | Ga0207695_10057499 | 3300025913 | Bacteria | 4040 |
| 395 | Ga0207671_10068265 | 3300025914 | Bacteria | 2648 |
| 396 | Ga0207671_11104349 | 3300025914 | Bacteria | 623 |
| 397 | Ga0207660_10000711 | 3300025917 | Bacteria | 22172 |
| 398 | Ga0207660_10002701 | 3300025917 | Bacteria | 11629 |
| 399 | Ga0207660_10005238 | 3300025917 | Bacteria | 8424 |
| 400 | Ga0207660_10156919 | 3300025917 | Bacteria | 1752 |
| 401 | Ga0207660_10159858 | 3300025917 | Bacteria | 1737 |
| 402 | Ga0207660_10367846 | 3300025917 | Bacteria | 1154 |
| 403 | Ga0207660_10509129 | 3300025917 | Bacteria | 977 |
| 404 | Ga0207657_10000133 | 3300025919 | Bacteria | 75282 |
| 405 | Ga0207657_10000267 | 3300025919 | Bacteria | 55426 |
| 406 | Ga0207657_10005242 | 3300025919 | Bacteria | 13581 |
| 407 | Ga0207657_10005850 | 3300025919 | Bacteria | 12810 |
| 408 | Ga0207657_10008846 | 3300025919 | Bacteria | 10185 |
| 409 | Ga0207657_10054657 | 3300025919 | Bacteria | 3452 |
| 410 | Ga0207657_10092503 | 3300025919 | Bacteria | 2520 |
| 411 | Ga0207657_10124942 | 3300025919 | Bacteria | 2114 |
| 412 | Ga0207657_10294401 | 3300025919 | Bacteria | 1287 |
| 413 | Ga0207649_10000378 | 3300025920 | Bacteria | 33311 |
| 414 | Ga0207649_10031381 | 3300025920 | Bacteria | 3157 |
| 415 | Ga0207649_10191138 | 3300025920 | Bacteria | 1440 |
| 416 | Ga0207649_10252189 | 3300025920 | Bacteria | 1271 |
| 417 | Ga0207649_10352801 | 3300025920 | Bacteria | 1089 |
| 418 | Ga0207649_10442940 | 3300025920 | Bacteria | 979 |
| 419 | Ga0207649_10465146 | 3300025920 | Unclassified | 957 |
| 420 | Ga0207649_10487309 | 3300025920 | Bacteria | 936 |
| 421 | Ga0207649_10523691 | 3300025920 | Bacteria | 904 |
| 422 | Ga0207652_10041849 | 3300025921 | Bacteria | 3897 |
| 423 | Ga0207652_10066873 | 3300025921 | Bacteria | 3115 |
| 424 | Ga0207652_10723332 | 3300025921 | Bacteria | 887 |
| 425 | Ga0207652_10760263 | 3300025921 | Bacteria | 862 |
| 426 | Ga0207652_10788659 | 3300025921 | Unclassified | 844 |
| 427 | Ga0207681_10012674 | 3300025923 | Bacteria | 5205 |
| 428 | Ga0207681_10042342 | 3300025923 | Bacteria | 3042 |
| 429 | Ga0207694_10001964 | 3300025924 | Bacteria | 17016 |
| 430 | Ga0207694_10061732 | 3300025924 | Bacteria | 2917 |
| 431 | Ga0207694_10137561 | 3300025924 | Bacteria | 1963 |
| 432 | Ga0207694_10165810 | 3300025924 | Bacteria | 1787 |
| 433 | Ga0207650_10010511 | 3300025925 | Bacteria | 6348 |
| 434 | Ga0207650_10207863 | 3300025925 | Bacteria | 1571 |
| 435 | Ga0207659_10051002 | 3300025926 | Bacteria | 2941 |
| 436 | Ga0207687_10000688 | 3300025927 | Bacteria | 22793 |
| 437 | Ga0207687_10147036 | 3300025927 | Bacteria | 1794 |
| 438 | Ga0207664_10442792 | 3300025929 | Bacteria | 1159 |
| 439 | Ga0207664_10509144 | 3300025929 | Bacteria | 1078 |
| 440 | Ga0207644_10015617 | 3300025931 | Bacteria | 5100 |
| 441 | Ga0207644_10079499 | 3300025931 | Bacteria | 2419 |
| 442 | Ga0207644_10089244 | 3300025931 | Bacteria | 2294 |
| 443 | Ga0207690_10000080 | 3300025932 | Bacteria | 82082 |
| 444 | Ga0207690_10001597 | 3300025932 | Bacteria | 14142 |
| 445 | Ga0207690_10004642 | 3300025932 | Bacteria | 8126 |
| 446 | Ga0207690_10007944 | 3300025932 | Bacteria | 6299 |
| 447 | Ga0207690_10045680 | 3300025932 | Bacteria | 2895 |
| 448 | Ga0207690_10095329 | 3300025932 | Bacteria | 2113 |
| 449 | Ga0207690_10193393 | 3300025932 | Bacteria | 1540 |
| 450 | Ga0207690_10207875 | 3300025932 | Bacteria | 1491 |
| 451 | Ga0207690_10340231 | 3300025932 | Bacteria | 1184 |
| 452 | Ga0207690_10805864 | 3300025932 | Bacteria | 776 |
| 453 | Ga0207706_10000159 | 3300025933 | Bacteria | 75284 |
| 454 | Ga0207706_10000426 | 3300025933 | Bacteria | 45291 |
| 455 | Ga0207706_10001767 | 3300025933 | Bacteria | 21221 |
| 456 | Ga0207706_10003045 | 3300025933 | Bacteria | 16158 |
| 457 | Ga0207706_10040717 | 3300025933 | Bacteria | 4119 |
| 458 | Ga0207706_10051732 | 3300025933 | Bacteria | 3627 |
| 459 | Ga0207686_10539801 | 3300025934 | Bacteria | 910 |
| 460 | Ga0207709_10193898 | 3300025935 | Bacteria | 1445 |
| 461 | Ga0207709_10336057 | 3300025935 | Bacteria | 1135 |
| 462 | Ga0207670_11292471 | 3300025936 | Bacteria | 618 |
| 463 | Ga0207669_10005541 | 3300025937 | Bacteria | 5675 |
| 464 | Ga0207669_11768220 | 3300025937 | Bacteria | 528 |
| 465 | Ga0207691_10013333 | 3300025940 | Bacteria | 7872 |
| 466 | Ga0207691_10113343 | 3300025940 | Bacteria | 2409 |
| 467 | Ga0207711_10000744 | 3300025941 | Bacteria | 31965 |
| 468 | Ga0207711_10002355 | 3300025941 | Bacteria | 16937 |
| 469 | Ga0207711_10003526 | 3300025941 | Bacteria | 13544 |
| 470 | Ga0207711_10562316 | 3300025941 | Bacteria | 1064 |
| 471 | Ga0207689_10000128 | 3300025942 | Bacteria | 64122 |
| 472 | Ga0207689_10050102 | 3300025942 | Bacteria | 3444 |
| 473 | Ga0207689_10070985 | 3300025942 | Bacteria | 2861 |
| 474 | Ga0207661_10001549 | 3300025944 | Bacteria | 15638 |
| 475 | Ga0207661_10036102 | 3300025944 | Bacteria | 3856 |
| 476 | Ga0207661_10058294 | 3300025944 | Bacteria | 3107 |
| 477 | Ga0207661_10088312 | 3300025944 | Bacteria | 2577 |
| 478 | Ga0207661_10094886 | 3300025944 | Bacteria | 2493 |
| 479 | Ga0207661_10458338 | 3300025944 | Bacteria | 1162 |
| 480 | Ga0207661_10908919 | 3300025944 | Bacteria | 811 |
| 481 | Ga0207679_10000155 | 3300025945 | Bacteria | 56504 |
| 482 | Ga0207679_10021030 | 3300025945 | Bacteria | 4414 |
| 483 | Ga0207679_10023302 | 3300025945 | Bacteria | 4231 |
| 484 | Ga0207679_10212489 | 3300025945 | Unclassified | 1623 |
| 485 | Ga0207679_10431160 | 3300025945 | Bacteria | 1165 |
| 486 | Ga0207679_10979224 | 3300025945 | Bacteria | 775 |
| 487 | Ga0207667_10017533 | 3300025949 | Bacteria | 8054 |
| 488 | Ga0207667_10018898 | 3300025949 | Bacteria | 7709 |
| 489 | Ga0207667_10037566 | 3300025949 | Bacteria | 5176 |
| 490 | Ga0207667_10042322 | 3300025949 | Bacteria | 4842 |
| 491 | Ga0207667_10053023 | 3300025949 | Bacteria | 4268 |
| 492 | Ga0207667_10055114 | 3300025949 | Bacteria | 4180 |
| 493 | Ga0207667_10118071 | 3300025949 | Bacteria | 2734 |
| 494 | Ga0207667_10153295 | 3300025949 | Bacteria | 2371 |
| 495 | Ga0207667_12109732 | 3300025949 | Bacteria | 522 |
| 496 | Ga0207651_10001297 | 3300025960 | Bacteria | 11254 |
| 497 | Ga0207651_10669219 | 3300025960 | Bacteria | 912 |
| 498 | Ga0207651_11023569 | 3300025960 | Bacteria | 739 |
| 499 | Ga0207712_10934758 | 3300025961 | Bacteria | 768 |
| 500 | Ga0207668_10270781 | 3300025972 | Bacteria | 1388 |
| 501 | Ga0207668_10547427 | 3300025972 | Bacteria | 1002 |
| 502 | Ga0207668_10718534 | 3300025972 | Bacteria | 879 |
| 503 | Ga0207640_10005165 | 3300025981 | Bacteria | 7099 |
| 504 | Ga0207640_10037349 | 3300025981 | Bacteria | 3055 |
| 505 | Ga0207640_10063004 | 3300025981 | Bacteria | 2462 |
| 506 | Ga0207640_10067160 | 3300025981 | Bacteria | 2398 |
| 507 | Ga0207640_10177192 | 3300025981 | Bacteria | 1595 |
| 508 | Ga0207640_10314352 | 3300025981 | Bacteria | 1244 |
| 509 | Ga0207640_10337021 | 3300025981 | Bacteria | 1207 |
| 510 | Ga0207658_10012354 | 3300025986 | Bacteria | 5830 |
| 511 | Ga0207658_10054963 | 3300025986 | Bacteria | 2948 |
| 512 | Ga0207658_10218426 | 3300025986 | Bacteria | 1602 |
| 513 | Ga0207677_10006405 | 3300026023 | Bacteria | 6455 |
| 514 | Ga0207677_10635950 | 3300026023 | Bacteria | 940 |
| 515 | Ga0207703_10003199 | 3300026035 | Bacteria | 13789 |
| 516 | Ga0207703_10030128 | 3300026035 | Bacteria | 4286 |
| 517 | Ga0207703_10030986 | 3300026035 | Bacteria | 4228 |
| 518 | Ga0207639_10000137 | 3300026041 | Bacteria | 54378 |
| 519 | Ga0207639_10001284 | 3300026041 | Bacteria | 16946 |
| 520 | Ga0207639_10004961 | 3300026041 | Bacteria | 8966 |
| 521 | Ga0207639_10048237 | 3300026041 | Bacteria | 3222 |
| 522 | Ga0207639_10112034 | 3300026041 | Bacteria | 2226 |
| 523 | Ga0207639_10653102 | 3300026041 | Bacteria | 973 |
| 524 | Ga0207639_10722671 | 3300026041 | Bacteria | 925 |
| 525 | Ga0207678_10000973 | 3300026067 | Bacteria | 26103 |
| 526 | Ga0207678_10002271 | 3300026067 | Bacteria | 17395 |
| 527 | Ga0207678_10004199 | 3300026067 | Bacteria | 12929 |
| 528 | Ga0207678_10084825 | 3300026067 | Bacteria | 2709 |
| 529 | Ga0207678_10155934 | 3300026067 | Bacteria | 1949 |
| 530 | Ga0207678_10375665 | 3300026067 | Bacteria | 1228 |
| 531 | Ga0207678_10543744 | 3300026067 | Bacteria | 1015 |
| 532 | Ga0207702_10000246 | 3300026078 | Bacteria | 63201 |
| 533 | Ga0207702_10196423 | 3300026078 | Bacteria | 1868 |
| 534 | Ga0207702_10386791 | 3300026078 | Bacteria | 1346 |
| 535 | Ga0207702_10552615 | 3300026078 | Bacteria | 1126 |
| 536 | Ga0207702_10580725 | 3300026078 | Bacteria | 1098 |
| 537 | Ga0207702_10874550 | 3300026078 | Bacteria | 890 |
| 538 | Ga0207702_11263430 | 3300026078 | Bacteria | 732 |
| 539 | Ga0207702_11419196 | 3300026078 | Unclassified | 688 |
| 540 | Ga0207702_11755914 | 3300026078 | Bacteria | 613 |
| 541 | Ga0207641_10001758 | 3300026088 | Bacteria | 20880 |
| 542 | Ga0207641_10061282 | 3300026088 | Bacteria | 3208 |
| 543 | Ga0207641_10063990 | 3300026088 | Bacteria | 3143 |
| 544 | Ga0207648_10003309 | 3300026089 | Bacteria | 16928 |
| 545 | Ga0207648_10239230 | 3300026089 | Bacteria | 1616 |
| 546 | Ga0207676_10000220 | 3300026095 | Bacteria | 49329 |
| 547 | Ga0207676_10005619 | 3300026095 | Bacteria | 8874 |
| 548 | Ga0207676_10009270 | 3300026095 | Bacteria | 7002 |
| 549 | Ga0207676_10015190 | 3300026095 | Bacteria | 5554 |
| 550 | Ga0207674_10000827 | 3300026116 | Bacteria | 40278 |
| 551 | Ga0207674_10004899 | 3300026116 | Bacteria | 16018 |
| 552 | Ga0207674_10012242 | 3300026116 | Bacteria | 9595 |
| 553 | Ga0207674_10017536 | 3300026116 | Bacteria | 7811 |
| 554 | Ga0207675_100055033 | 3300026118 | Bacteria | 3712 |
| 555 | Ga0207675_100437483 | 3300026118 | Bacteria | 1294 |
| 556 | Ga0207683_11250536 | 3300026121 | Bacteria | 688 |
| 557 | Ga0207698_10000421 | 3300026142 | Bacteria | 24394 |
| 558 | Ga0207698_10001565 | 3300026142 | Bacteria | 13341 |
| 559 | Ga0207698_10001619 | 3300026142 | Bacteria | 13098 |
| 560 | Ga0207698_10006275 | 3300026142 | Bacteria | 7398 |
| 561 | Ga0207698_10008966 | 3300026142 | Bacteria | 6348 |
| 562 | Ga0207698_10013342 | 3300026142 | Bacteria | 5417 |
| 563 | Ga0207698_10059370 | 3300026142 | Bacteria | 2970 |
| 564 | Ga0207698_10067580 | 3300026142 | Bacteria | 2819 |
| 565 | Ga0207698_10072205 | 3300026142 | Bacteria | 2743 |
| 566 | Ga0207698_10083651 | 3300026142 | Bacteria | 2583 |
| 567 | Ga0207698_10148606 | 3300026142 | Bacteria | 2030 |
| 568 | Ga0207698_10211701 | 3300026142 | Bacteria | 1744 |
| 569 | Ga0207698_10506316 | 3300026142 | Bacteria | 1176 |
| 570 | Ga0207698_11039440 | 3300026142 | Bacteria | 831 |
| 571 | Ga0209983_1029422 | 3300027665 | Bacteria | 1168 |
| 572 | Ga0209974_10052186 | 3300027876 | Bacteria | 1376 |
| 573 | Ga0209974_10132559 | 3300027876 | Bacteria | 889 |
| 574 | Ga0268266_10044669 | 3300028379 | Bacteria | 3787 |
| 575 | Ga0268266_10044928 | 3300028379 | Bacteria | 3777 |
| 576 | Ga0268266_11561860 | 3300028379 | Unclassified | 635 |
| 577 | Ga0268265_10022231 | 3300028380 | Bacteria | 4453 |
| 578 | Ga0268265_10054802 | 3300028380 | Bacteria | 3027 |
| 579 | Ga0268265_10091343 | 3300028380 | Bacteria | 2435 |
| 580 | Ga0268264_10006398 | 3300028381 | Bacteria | 9922 |
| 581 | Ga0268264_10097034 | 3300028381 | Bacteria | 2554 |
| 582 | Ga0268264_10563890 | 3300028381 | Unclassified | 1118 |
| 583 | Ga0268264_10588828 | 3300028381 | Bacteria | 1095 |
| 584 | Ga0307408_100080001 | 3300031548 | Bacteria | 2440 |
| 585 | Ga0307408_100292496 | 3300031548 | Bacteria | 1361 |
| 586 | Ga0307405_11919848 | 3300031731 | Bacteria | 528 |
| 587 | Ga0307413_10335602 | 3300031824 | Bacteria | 1160 |
| 588 | Ga0307413_12152347 | 3300031824 | Unclassified | 505 |
| 589 | Ga0307410_10091123 | 3300031852 | Bacteria | 2164 |
| 590 | Ga0307406_10057541 | 3300031901 | Bacteria | 2494 |
| 591 | Ga0307407_10424373 | 3300031903 | Bacteria | 959 |
| 592 | Ga0307409_100110175 | 3300031995 | Bacteria | 2307 |
| 593 | Ga0307409_100363706 | 3300031995 | Bacteria | 1369 |
| 594 | Ga0307409_101885542 | 3300031995 | Bacteria | 627 |
| 595 | Ga0307409_101932378 | 3300031995 | Bacteria | 620 |
| 596 | Ga0307416_100200678 | 3300032002 | Bacteria | 1892 |
| 597 | Ga0307416_100343055 | 3300032002 | Bacteria | 1508 |
| 598 | Ga0307414_11035571 | 3300032004 | Bacteria | 756 |
| 599 | Ga0307414_11188522 | 3300032004 | Bacteria | 706 |
| 600 | Ga0307411_10079042 | 3300032005 | Bacteria | 2257 |
| 601 | Ga0307415_100099528 | 3300032126 | Bacteria | 2128 |
| 602 | Ga0307415_100616182 | 3300032126 | Bacteria | 968 |
| 603 | Ga0373928_0171963 | 3300035084 | Unclassified | 611 |
| 604 | Ga0373951_0008212 | 3300035091 | Bacteria | 2364 |
| 605 | Ga0373923_0047268 | 3300035111 | Bacteria | 1793 |
| 606 | Ga0373954_0085213 | 3300035118 | Bacteria | 1513 |
| 607 | Ga0373956_0156274 | 3300035119 | Bacteria | 1074 |
| 608 | Ga0373960_0161607 | 3300035121 | Unclassified | 771 |
| 609 | Ga0373955_1028398 | 3300035172 | Bacteria | 507 |
| 610 | Ga0373962_0121808 | 3300035242 | Bacteria | 832 |
| 611 | Ga0373931_0028286 | 3300035691 | Bacteria | 2868 |
| 612 | Ga0373935_0309818 | 3300035692 | Bacteria | 1118 |
| 613 | Ga0373937_0008086 | 3300036401 | Bacteria | 9130 |
| 614 | Ga0395899_0001906 | 3300037312 | Bacteria | 17205 |
| 615 | Ga0395899_0015290 | 3300037312 | Bacteria | 5848 |
| 616 | Ga0395899_0033784 | 3300037312 | Bacteria | 3841 |
| 617 | Ga0395899_0041859 | 3300037312 | Bacteria | 3421 |
| 618 | Ga0395899_0099675 | 3300037312 | Bacteria | 2098 |
| 619 | Ga0395899_0103209 | 3300037312 | Bacteria | 2057 |
| 620 | Ga0395899_0106354 | 3300037312 | Bacteria | 2020 |
| 621 | Ga0395899_0149902 | 3300037312 | Bacteria | 1653 |
| 622 | Ga0395899_0270210 | 3300037312 | Bacteria | 1160 |
| 623 | Ga0395899_0362165 | 3300037312 | Bacteria | 967 |
| 624 | Ga0395899_0442582 | 3300037312 | Bacteria | 852 |
| 625 | Ga0395899_0498246 | 3300037312 | Unclassified | 790 |
| 626 | Ga0395899_0824625 | 3300037312 | Bacteria | 571 |
| 627 | Ga0395900_0000447 | 3300037418 | Bacteria | 59069 |
| 628 | Ga0395900_0055653 | 3300037418 | Bacteria | 4073 |
| 629 | Ga0395900_0070117 | 3300037418 | Bacteria | 3603 |
| 630 | Ga0395900_0079680 | 3300037418 | Bacteria | 3365 |
| 631 | Ga0395900_0173564 | 3300037418 | Bacteria | 2193 |
| 632 | Ga0395900_0239111 | 3300037418 | Bacteria | 1822 |
| 633 | Ga0395900_0253231 | 3300037418 | Bacteria | 1761 |
| 634 | Ga0395900_0315078 | 3300037418 | Bacteria | 1546 |
| 635 | Ga0395900_0412256 | 3300037418 | Bacteria | 1313 |
| 636 | Ga0395900_0442238 | 3300037418 | Bacteria | 1257 |
| 637 | Ga0395900_0526478 | 3300037418 | Bacteria | 1129 |
| 638 | Ga0395900_0544897 | 3300037418 | Bacteria | 1105 |
| 639 | Ga0395900_0833937 | 3300037418 | Bacteria | 848 |
| 640 | Ga0395900_0899189 | 3300037418 | Unclassified | 809 |
| 641 | Ga0395900_1033061 | 3300037418 | Bacteria | 741 |
| 642 | Ga0395898_0011697 | 3300037466 | Bacteria | 9100 |
| 643 | Ga0395898_0083259 | 3300037466 | Bacteria | 3083 |
| 644 | Ga0395898_0088326 | 3300037466 | Bacteria | 2984 |
| 645 | Ga0395898_0110666 | 3300037466 | Bacteria | 2632 |
| 646 | Ga0395898_0111874 | 3300037466 | Bacteria | 2617 |
| 647 | Ga0395898_0180232 | 3300037466 | Bacteria | 2019 |
| 648 | Ga0395898_0629625 | 3300037466 | Unclassified | 1015 |
| 649 | Ga0395898_0720986 | 3300037466 | Bacteria | 939 |
| 650 | Ga0395898_1740063 | 3300037466 | Bacteria | 545 |
| 651 | Ga0395905_0000187 | 3300037471 | Bacteria | 98895 |
| 652 | Ga0395905_0004624 | 3300037471 | Bacteria | 14237 |
| 653 | Ga0395905_0019955 | 3300037471 | Bacteria | 6351 |
| 654 | Ga0395905_0078505 | 3300037471 | Bacteria | 3093 |
| 655 | Ga0395905_0084520 | 3300037471 | Bacteria | 2973 |
| 656 | Ga0395905_0226697 | 3300037471 | Bacteria | 1748 |
| 657 | Ga0395905_0246156 | 3300037471 | Bacteria | 1670 |
| 658 | Ga0395905_0340970 | 3300037471 | Bacteria | 1390 |
| 659 | Ga0395905_0377867 | 3300037471 | Bacteria | 1310 |
| 660 | Ga0395905_0403715 | 3300037471 | Bacteria | 1262 |
| 661 | Ga0395905_1004132 | 3300037471 | Bacteria | 737 |
| 662 | Ga0395905_1006643 | 3300037471 | Bacteria | 736 |
| 663 | Ga0395905_1111291 | 3300037471 | Bacteria | 694 |
| 664 | Ga0395905_1329505 | 3300037471 | Unclassified | 622 |
| 665 | Ga0395905_1769107 | 3300037471 | Bacteria | 523 |
| 666 | Ga0395901_0000324 | 3300038443 | Bacteria | 59134 |
| 667 | Ga0395901_0032370 | 3300038443 | Bacteria | 5395 |
| 668 | Ga0395901_0043378 | 3300038443 | Bacteria | 4666 |
| 669 | Ga0395901_0056287 | 3300038443 | Bacteria | 4090 |
| 670 | Ga0395901_0115251 | 3300038443 | Bacteria | 2823 |
| 671 | Ga0395901_0378893 | 3300038443 | Bacteria | 1456 |
| 672 | Ga0395901_0726547 | 3300038443 | Bacteria | 988 |
| 673 | Ga0395901_1274975 | 3300038443 | Bacteria | 697 |
| 674 | Ga0395901_1502295 | 3300038443 | Bacteria | 629 |
| 675 | Ga0466966_0196540 | 3300044684 | Bacteria | 1221 |
| 676 | Ga0466961_0065766 | 3300044693 | Bacteria | 2304 |
| 677 | Ga0466963_0004598 | 3300044694 | Bacteria | 8035 |
| 678 | Ga0466963_0005117 | 3300044694 | Bacteria | 7660 |
| 679 | Ga0466963_0039353 | 3300044694 | Bacteria | 3096 |
| 680 | Ga0466963_0124686 | 3300044694 | Bacteria | 1775 |
| 681 | Ga0466963_0242665 | 3300044694 | Bacteria | 1264 |
| 682 | Ga0466964_0022607 | 3300044706 | Bacteria | 2442 |
| 683 | Ga0453684_0360581 | 3300044712 | Bacteria | 1637 |
| 684 | Ga0466971_0062393 | 3300044719 | Bacteria | 1686 |
| 685 | Ga0466971_0400063 | 3300044719 | Bacteria | 669 |
| 686 | Ga0466970_0105760 | 3300044765 | Unclassified | 1535 |
| 687 | Ga0466957_0009743 | 3300044842 | Bacteria | 5487 |
| 688 | Ga0466957_0095693 | 3300044842 | Bacteria | 1865 |
| 689 | Ga0466957_0143882 | 3300044842 | Bacteria | 1538 |
| 690 | Ga0466959_0030022 | 3300045049 | Bacteria | 4027 |
| 691 | Ga0466959_0267248 | 3300045049 | Bacteria | 1176 |
| 692 | Ga0466958_0001186 | 3300045836 | Bacteria | 12153 |
| 693 | Ga0466958_0013790 | 3300045836 | Bacteria | 4608 |
| 694 | Ga0466958_0118416 | 3300045836 | Bacteria | 1657 |
| 695 | Ga0466967_0014760 | 3300045976 | Bacteria | 6103 |
| 696 | Ga0466967_0016917 | 3300045976 | Bacteria | 5767 |
| 697 | Ga0466967_0041146 | 3300045976 | Bacteria | 3982 |
| 698 | Ga0466967_0043652 | 3300045976 | Bacteria | 3883 |
| 699 | Ga0466967_0075882 | 3300045976 | Bacteria | 3022 |
| 700 | Ga0466967_0098890 | 3300045976 | Bacteria | 2664 |
| 701 | Ga0466967_0117896 | 3300045976 | Bacteria | 2448 |
| 702 | Ga0466967_1286798 | 3300045976 | Bacteria | 728 |
| 703 | Ga0495584_0345244 | 3300046491 | Bacteria | 756 |
| 704 | Ga0495668_0273738 | 3300046616 | Bacteria | 925 |
| 705 | Ga0495623_0155323 | 3300046679 | Bacteria | 1349 |
| 706 | Ga0495669_0067032 | 3300046684 | Bacteria | 1631 |
| 707 | Ga0496100_0177685 | 3300048903 | Bacteria | 1538 |
| 708 | Ga0496101_0012991 | 3300048904 | Bacteria | 5570 |
| 709 | Ga0496102_0134653 | 3300048905 | Bacteria | 2315 |
| 710 | Ga0496103_0067103 | 3300048906 | Bacteria | 2240 |
| 711 | Ga0496103_0421365 | 3300048906 | Bacteria | 857 |
| 712 | Ga0496105_0371655 | 3300048908 | Bacteria | 1139 |
| 713 | Ga0496106_0022698 | 3300048909 | Bacteria | 4663 |
| 714 | Ga0496106_0229494 | 3300048909 | Bacteria | 1482 |
| 715 | Ga0496107_0004256 | 3300048910 | Bacteria | 9679 |
| 716 | Ga0496107_0346012 | 3300048910 | Bacteria | 1106 |
| 717 | Ga0496108_0025939 | 3300048911 | Bacteria | 4833 |
| 718 | Ga0496108_0897410 | 3300048911 | Bacteria | 761 |
| 719 | Ga0496109_0017833 | 3300048912 | Bacteria | 6228 |
| 720 | Ga0496109_0269210 | 3300048912 | Bacteria | 1605 |
| 721 | Ga0496109_0432629 | 3300048912 | Bacteria | 1243 |
| 722 | Ga0496110_0005528 | 3300048913 | Bacteria | 9921 |
| 723 | Ga0496110_0543461 | 3300048913 | Bacteria | 1056 |
| 724 | Ga0496111_0021519 | 3300048914 | Bacteria | 4505 |
| 725 | Ga0496111_0546362 | 3300048914 | Bacteria | 851 |
| 726 | Ga0496112_0006261 | 3300048915 | Bacteria | 10431 |
| 727 | Ga0496113_0423362 | 3300048916 | Bacteria | 1069 |
| 728 | Ga0501067_0031805 | 3300049583 | Bacteria | 2928 |
| 729 | Ga0501070_0446862 | 3300049586 | Bacteria | 1042 |
| 730 | Ga0501074_0187914 | 3300049590 | Bacteria | 1473 |
| 731 | Ga0501233_025411 | 3300049668 | Unclassified | 1302 |
| 732 | Ga0501080_0094630 | 3300049742 | Bacteria | 2774 |
| 733 | Ga0501270_050416 | 3300049767 | Bacteria | 753 |
| 734 | nmdc:mga0rr50_510936_c1 | 3300050513 | Bacteria | 1022 |
| 735 | nmdc:mga08x19_559351_c1 | 3300050514 | Bacteria | 809 |
| 736 | Ga0587088_093176 | 3300059508 | Unclassified | 663 |
| 737 | Ga0587067_091100 | 3300059640 | Unclassified | 691 |
| 738 | Ga0466962_0024643 | 3300061719 | Bacteria | 2889 |
| 739 | Ga0530510_0772873 | 3300061734 | Unclassified | 733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_101767878 | Ga0070713_1017678782 | 125 |
| 2 | 3300005293 | Ga0065715_10584272 | Ga0065715_105842722 | 128 |
| 3 | 3300005327 | Ga0070658_10009613 | Ga0070658_100096135 | 128 |
| 4 | 3300005329 | Ga0070683_100062612 | Ga0070683_1000626122 | 128 |
| 5 | 3300005333 | Ga0070677_10405993 | Ga0070677_104059932 | 128 |
| 6 | 3300005338 | Ga0068868_100343657 | Ga0068868_1003436571 | 128 |
| 7 | 3300005344 | Ga0070661_100612791 | Ga0070661_1006127912 | 128 |
| 8 | 3300005535 | Ga0070684_100027913 | Ga0070684_1000279132 | 128 |
| 9 | 3300005563 | Ga0068855_100210192 | Ga0068855_1002101922 | 128 |
| 10 | 3300005614 | Ga0068856_100961209 | Ga0068856_1009612092 | 128 |
| 11 | 3300009098 | Ga0105245_10276026 | Ga0105245_102760262 | 128 |
| 12 | 3300009176 | Ga0105242_10912682 | Ga0105242_109126822 | 128 |
| 13 | 3300009177 | Ga0105248_10018193 | Ga0105248_100181935 | 128 |
| 14 | 3300009553 | Ga0105249_11185354 | Ga0105249_111853542 | 128 |
| 15 | 3300010375 | Ga0105239_10218160 | Ga0105239_102181603 | 128 |
| 16 | 3300013102 | Ga0157371_10055697 | Ga0157371_100556972 | 128 |
| 17 | 3300013102 | Ga0157371_10058590 | Ga0157371_100585902 | 128 |
| 18 | 3300013102 | Ga0157371_10140542 | Ga0157371_101405422 | 128 |
| 19 | 3300013102 | Ga0157371_10308430 | Ga0157371_103084302 | 128 |
| 20 | 3300013102 | Ga0157371_10416876 | Ga0157371_104168762 | 128 |
| 21 | 3300013104 | Ga0157370_10060505 | Ga0157370_100605051 | 128 |
| 22 | 3300013104 | Ga0157370_10212917 | Ga0157370_102129172 | 128 |
| 23 | 3300013104 | Ga0157370_10286151 | Ga0157370_102861512 | 128 |
| 24 | 3300013105 | Ga0157369_10069335 | Ga0157369_100693355 | 128 |
| 25 | 3300013306 | Ga0163162_10068534 | Ga0163162_100685342 | 128 |
| 26 | 3300013307 | Ga0157372_11243324 | Ga0157372_112433242 | 128 |
| 27 | 3300014326 | Ga0157380_11723141 | Ga0157380_117231411 | 128 |
| 28 | 3300025909 | Ga0207705_10102751 | Ga0207705_101027513 | 128 |
| 29 | 3300025919 | Ga0207657_10124942 | Ga0207657_101249422 | 128 |
| 30 | 3300025920 | Ga0207649_10523691 | Ga0207649_105236912 | 128 |
| 31 | 3300025929 | Ga0207664_10442792 | Ga0207664_104427922 | 128 |
| 32 | 3300025949 | Ga0207667_10118071 | Ga0207667_101180712 | 128 |
| 33 | 3300026078 | Ga0207702_10874550 | Ga0207702_108745502 | 128 |
| 34 | 3300026078 | Ga0207702_11263430 | Ga0207702_112634302 | 128 |
| 35 | 3300037312 | Ga0395899_0149902 | Ga0395899_0149902_114_500 | 128 |
| 36 | 3300037312 | Ga0395899_0362165 | Ga0395899_0362165_114_500 | 128 |
| 37 | 3300037466 | Ga0395898_1740063 | Ga0395898_1740063_46_432 | 128 |
| 38 | 3300037471 | Ga0395905_1004132 | Ga0395905_1004132_238_624 | 128 |
| 39 | 3300037471 | Ga0395905_1111291 | Ga0395905_1111291_116_502 | 128 |
| 40 | 3300044765 | Ga0466970_0105760 | Ga0466970_0105760_200_586 | 128 |
| 41 | 3300045049 | Ga0466959_0030022 | Ga0466959_0030022_1130_1516 | 128 |
| 42 | 3300048903 | Ga0496100_0177685 | Ga0496100_0177685_398_784 | 128 |
| 43 | 3300048904 | Ga0496101_0012991 | Ga0496101_0012991_2584_2970 | 128 |
| 44 | 3300048908 | Ga0496105_0371655 | Ga0496105_0371655_398_784 | 128 |
| 45 | 3300048909 | Ga0496106_0022698 | Ga0496106_0022698_1683_2069 | 128 |
| 46 | 3300048910 | Ga0496107_0004256 | Ga0496107_0004256_1714_2100 | 128 |
| 47 | 3300048911 | Ga0496108_0025939 | Ga0496108_0025939_614_1000 | 128 |
| 48 | 3300048912 | Ga0496109_0017833 | Ga0496109_0017833_398_784 | 128 |
| 49 | 3300048913 | Ga0496110_0005528 | Ga0496110_0005528_3562_3948 | 128 |
| 50 | 3300048914 | Ga0496111_0021519 | Ga0496111_0021519_2601_2987 | 128 |
| 51 | 3300048916 | Ga0496113_0423362 | Ga0496113_0423362_625_1011 | 128 |
| 52 | 3300049668 | Ga0501233_025411 | Ga0501233_025411_872_1258 | 128 |
| 53 | 3300049767 | Ga0501270_050416 | Ga0501270_050416_337_723 | 128 |
| 54 | 3300050513 | nmdc:mga0rr50_510936_c1 | nmdc:mga0rr50_510936_c1_409_795 | 128 |
| 55 | 3300050514 | nmdc:mga08x19_559351_c1 | nmdc:mga08x19_559351_c1_50_436 | 128 |
| 56 | 3300031995 | Ga0307409_101932378 | Ga0307409_1019323781 | 130 |
| 57 | 3300037471 | Ga0395905_0226697 | Ga0395905_0226697_276_668 | 130 |
| 58 | 3300001976 | JGI24752J21851_1042724 | JGI24752J21851_10427241 | 131 |
| 59 | 3300005290 | Ga0065712_10040760 | Ga0065712_100407602 | 131 |
| 60 | 3300005339 | Ga0070660_100000861 | Ga0070660_10000086122 | 131 |
| 61 | 3300005345 | Ga0070692_10082450 | Ga0070692_100824501 | 131 |
| 62 | 3300005353 | Ga0070669_100016981 | Ga0070669_1000169813 | 131 |
| 63 | 3300005353 | Ga0070669_100084035 | Ga0070669_1000840353 | 131 |
| 64 | 3300005367 | Ga0070667_100079689 | Ga0070667_1000796891 | 131 |
| 65 | 3300005457 | Ga0070662_100068699 | Ga0070662_1000686993 | 131 |
| 66 | 3300005458 | Ga0070681_10705275 | Ga0070681_107052751 | 131 |
| 67 | 3300005547 | Ga0070693_100000361 | Ga0070693_1000003616 | 131 |
| 68 | 3300005548 | Ga0070665_100062768 | Ga0070665_1000627687 | 131 |
| 69 | 3300005840 | Ga0068870_10988314 | Ga0068870_109883141 | 131 |
| 70 | 3300009148 | Ga0105243_10817439 | Ga0105243_108174392 | 131 |
| 71 | 3300010375 | Ga0105239_10263900 | Ga0105239_102639003 | 131 |
| 72 | 3300013100 | Ga0157373_10384756 | Ga0157373_103847562 | 131 |
| 73 | 3300014745 | Ga0157377_11115750 | Ga0157377_111157502 | 131 |
| 74 | 3300025893 | Ga0207682_10197253 | Ga0207682_101972531 | 131 |
| 75 | 3300025904 | Ga0207647_10014849 | Ga0207647_100148496 | 131 |
| 76 | 3300025924 | Ga0207694_10061732 | Ga0207694_100617324 | 131 |
| 77 | 3300025933 | Ga0207706_10040717 | Ga0207706_100407173 | 131 |
| 78 | 3300025986 | Ga0207658_10054963 | Ga0207658_100549631 | 131 |
| 79 | 3300026121 | Ga0207683_11250536 | Ga0207683_112505362 | 131 |
| 80 | 3300027665 | Ga0209983_1029422 | Ga0209983_10294222 | 131 |
| 81 | 3300027876 | Ga0209974_10052186 | Ga0209974_100521862 | 131 |
| 82 | 3300028379 | Ga0268266_10044928 | Ga0268266_100449287 | 131 |
| 83 | 3300028380 | Ga0268265_10091343 | Ga0268265_100913432 | 131 |
| 84 | 3300028381 | Ga0268264_10563890 | Ga0268264_105638902 | 131 |
| 85 | 3300031548 | Ga0307408_100080001 | Ga0307408_1000800013 | 131 |
| 86 | 3300031548 | Ga0307408_100292496 | Ga0307408_1002924963 | 131 |
| 87 | 3300031731 | Ga0307405_11919848 | Ga0307405_119198481 | 131 |
| 88 | 3300031995 | Ga0307409_100110175 | Ga0307409_1001101752 | 131 |
| 89 | 3300031995 | Ga0307409_101885542 | Ga0307409_1018855421 | 131 |
| 90 | 3300032002 | Ga0307416_100200678 | Ga0307416_1002006782 | 131 |
| 91 | 3300032002 | Ga0307416_100343055 | Ga0307416_1003430552 | 131 |
| 92 | 3300032005 | Ga0307411_10079042 | Ga0307411_100790422 | 131 |
| 93 | 3300044712 | Ga0453684_0360581 | Ga0453684_0360581_660_1055 | 131 |
| 94 | 3300046491 | Ga0495584_0345244 | Ga0495584_0345244_259_660 | 131 |
| 95 | 3300046616 | Ga0495668_0273738 | Ga0495668_0273738_416_811 | 131 |
| 96 | 3300046684 | Ga0495669_0067032 | Ga0495669_0067032_501_902 | 131 |
| 97 | 3300048906 | Ga0496103_0067103 | Ga0496103_0067103_1389_1784 | 131 |
| 98 | 3300048911 | Ga0496108_0897410 | Ga0496108_0897410_338_733 | 131 |
| 99 | 3300048912 | Ga0496109_0269210 | Ga0496109_0269210_313_708 | 131 |
| 100 | 3300048914 | Ga0496111_0546362 | Ga0496111_0546362_139_534 | 131 |
| 101 | 3300013105 | Ga0157369_12011390 | Ga0157369_120113901 | 132 |
| 102 | 3300031995 | Ga0307409_100363706 | Ga0307409_1003637062 | 132 |
| 103 | 3300032126 | Ga0307415_100616182 | Ga0307415_1006161822 | 132 |
| 104 | 3300044684 | Ga0466966_0196540 | Ga0466966_0196540_528_926 | 132 |
| 105 | 3300044693 | Ga0466961_0065766 | Ga0466961_0065766_1200_1598 | 132 |
| 106 | 3300045049 | Ga0466959_0267248 | Ga0466959_0267248_177_575 | 132 |
| 107 | 3300001979 | JGI24740J21852_10001279 | JGI24740J21852_1000127910 | 133 |
| 108 | 3300001979 | JGI24740J21852_10124572 | JGI24740J21852_101245722 | 133 |
| 109 | 3300001989 | JGI24739J22299_10000632 | JGI24739J22299_100006327 | 133 |
| 110 | 3300001989 | JGI24739J22299_10008617 | JGI24739J22299_100086172 | 133 |
| 111 | 3300001990 | JGI24737J22298_10000103 | JGI24737J22298_1000010313 | 133 |
| 112 | 3300001990 | JGI24737J22298_10017157 | JGI24737J22298_100171573 | 133 |
| 113 | 3300002067 | JGI24735J21928_10019965 | JGI24735J21928_100199651 | 133 |
| 114 | 3300002075 | JGI24738J21930_10000018 | JGI24738J21930_100000189 | 133 |
| 115 | 3300002075 | JGI24738J21930_10008304 | JGI24738J21930_100083043 | 133 |
| 116 | 3300005327 | Ga0070658_10000107 | Ga0070658_100001077 | 133 |
| 117 | 3300005327 | Ga0070658_10019253 | Ga0070658_100192534 | 133 |
| 118 | 3300005327 | Ga0070658_10019568 | Ga0070658_100195687 | 133 |
| 119 | 3300005327 | Ga0070658_10033380 | Ga0070658_100333806 | 133 |
| 120 | 3300005327 | Ga0070658_10060655 | Ga0070658_100606551 | 133 |
| 121 | 3300005327 | Ga0070658_10076497 | Ga0070658_100764971 | 133 |
| 122 | 3300005327 | Ga0070658_10398910 | Ga0070658_103989102 | 133 |
| 123 | 3300005327 | Ga0070658_11268895 | Ga0070658_112688951 | 133 |
| 124 | 3300005328 | Ga0070676_10002531 | Ga0070676_100025314 | 133 |
| 125 | 3300005328 | Ga0070676_10027239 | Ga0070676_100272392 | 133 |
| 126 | 3300005328 | Ga0070676_10036742 | Ga0070676_100367423 | 133 |
| 127 | 3300005328 | Ga0070676_10908951 | Ga0070676_109089512 | 133 |
| 128 | 3300005329 | Ga0070683_100001635 | Ga0070683_1000016356 | 133 |
| 129 | 3300005329 | Ga0070683_100006411 | Ga0070683_1000064115 | 133 |
| 130 | 3300005329 | Ga0070683_100028335 | Ga0070683_1000283354 | 133 |
| 131 | 3300005329 | Ga0070683_100062139 | Ga0070683_1000621393 | 133 |
| 132 | 3300005329 | Ga0070683_100131879 | Ga0070683_1001318794 | 133 |
| 133 | 3300005329 | Ga0070683_100301837 | Ga0070683_1003018372 | 133 |
| 134 | 3300005329 | Ga0070683_100514835 | Ga0070683_1005148352 | 133 |
| 135 | 3300005329 | Ga0070683_100870353 | Ga0070683_1008703531 | 133 |
| 136 | 3300005330 | Ga0070690_100026541 | Ga0070690_1000265413 | 133 |
| 137 | 3300005330 | Ga0070690_100902800 | Ga0070690_1009028001 | 133 |
| 138 | 3300005331 | Ga0070670_100014652 | Ga0070670_1000146528 | 133 |
| 139 | 3300005331 | Ga0070670_100266583 | Ga0070670_1002665833 | 133 |
| 140 | 3300005331 | Ga0070670_101822775 | Ga0070670_1018227751 | 133 |
| 141 | 3300005334 | Ga0068869_100003378 | Ga0068869_1000033785 | 133 |
| 142 | 3300005334 | Ga0068869_100667997 | Ga0068869_1006679972 | 133 |
| 143 | 3300005335 | Ga0070666_10001184 | Ga0070666_100011846 | 133 |
| 144 | 3300005335 | Ga0070666_10713713 | Ga0070666_107137131 | 133 |
| 145 | 3300005336 | Ga0070680_100000477 | Ga0070680_1000004776 | 133 |
| 146 | 3300005336 | Ga0070680_100002652 | Ga0070680_1000026528 | 133 |
| 147 | 3300005336 | Ga0070680_100004694 | Ga0070680_1000046944 | 133 |
| 148 | 3300005336 | Ga0070680_100006732 | Ga0070680_1000067326 | 133 |
| 149 | 3300005336 | Ga0070680_100008676 | Ga0070680_1000086765 | 133 |
| 150 | 3300005336 | Ga0070680_100048693 | Ga0070680_1000486932 | 133 |
| 151 | 3300005336 | Ga0070680_100132389 | Ga0070680_1001323892 | 133 |
| 152 | 3300005336 | Ga0070680_100589438 | Ga0070680_1005894382 | 133 |
| 153 | 3300005336 | Ga0070680_100711197 | Ga0070680_1007111972 | 133 |
| 154 | 3300005337 | Ga0070682_100006724 | Ga0070682_1000067245 | 133 |
| 155 | 3300005337 | Ga0070682_100192650 | Ga0070682_1001926501 | 133 |
| 156 | 3300005337 | Ga0070682_100382896 | Ga0070682_1003828962 | 133 |
| 157 | 3300005338 | Ga0068868_100000972 | Ga0068868_1000009725 | 133 |
| 158 | 3300005339 | Ga0070660_100003065 | Ga0070660_1000030659 | 133 |
| 159 | 3300005339 | Ga0070660_100003086 | Ga0070660_1000030863 | 133 |
| 160 | 3300005339 | Ga0070660_100011318 | Ga0070660_1000113182 | 133 |
| 161 | 3300005339 | Ga0070660_100025166 | Ga0070660_1000251662 | 133 |
| 162 | 3300005339 | Ga0070660_100033421 | Ga0070660_1000334215 | 133 |
| 163 | 3300005339 | Ga0070660_100034397 | Ga0070660_1000343975 | 133 |
| 164 | 3300005339 | Ga0070660_100034860 | Ga0070660_1000348602 | 133 |
| 165 | 3300005339 | Ga0070660_100748122 | Ga0070660_1007481221 | 133 |
| 166 | 3300005339 | Ga0070660_100786605 | Ga0070660_1007866051 | 133 |
| 167 | 3300005340 | Ga0070689_100017523 | Ga0070689_1000175232 | 133 |
| 168 | 3300005341 | Ga0070691_10256308 | Ga0070691_102563082 | 133 |
| 169 | 3300005343 | Ga0070687_100037451 | Ga0070687_1000374512 | 133 |
| 170 | 3300005344 | Ga0070661_100000101 | Ga0070661_10000010130 | 133 |
| 171 | 3300005344 | Ga0070661_100004927 | Ga0070661_1000049278 | 133 |
| 172 | 3300005344 | Ga0070661_100005038 | Ga0070661_1000050386 | 133 |
| 173 | 3300005344 | Ga0070661_100055931 | Ga0070661_1000559312 | 133 |
| 174 | 3300005344 | Ga0070661_100131409 | Ga0070661_1001314092 | 133 |
| 175 | 3300005344 | Ga0070661_100187165 | Ga0070661_1001871652 | 133 |
| 176 | 3300005344 | Ga0070661_100232893 | Ga0070661_1002328932 | 133 |
| 177 | 3300005345 | Ga0070692_10003217 | Ga0070692_100032174 | 133 |
| 178 | 3300005345 | Ga0070692_10016353 | Ga0070692_100163533 | 133 |
| 179 | 3300005345 | Ga0070692_10083589 | Ga0070692_100835892 | 133 |
| 180 | 3300005345 | Ga0070692_10130734 | Ga0070692_101307342 | 133 |
| 181 | 3300005347 | Ga0070668_100008284 | Ga0070668_1000082842 | 133 |
| 182 | 3300005347 | Ga0070668_100038015 | Ga0070668_1000380152 | 133 |
| 183 | 3300005347 | Ga0070668_101253443 | Ga0070668_1012534432 | 133 |
| 184 | 3300005353 | Ga0070669_100000613 | Ga0070669_1000006135 | 133 |
| 185 | 3300005353 | Ga0070669_100653472 | Ga0070669_1006534722 | 133 |
| 186 | 3300005353 | Ga0070669_101138821 | Ga0070669_1011388212 | 133 |
| 187 | 3300005354 | Ga0070675_100073493 | Ga0070675_1000734932 | 133 |
| 188 | 3300005354 | Ga0070675_100360257 | Ga0070675_1003602571 | 133 |
| 189 | 3300005355 | Ga0070671_100000533 | Ga0070671_10000053313 | 133 |
| 190 | 3300005355 | Ga0070671_100014143 | Ga0070671_1000141433 | 133 |
| 191 | 3300005355 | Ga0070671_100030078 | Ga0070671_1000300784 | 133 |
| 192 | 3300005355 | Ga0070671_101046362 | Ga0070671_1010463622 | 133 |
| 193 | 3300005356 | Ga0070674_101294478 | Ga0070674_1012944782 | 133 |
| 194 | 3300005364 | Ga0070673_100003805 | Ga0070673_1000038053 | 133 |
| 195 | 3300005364 | Ga0070673_100057067 | Ga0070673_1000570673 | 133 |
| 196 | 3300005364 | Ga0070673_100308646 | Ga0070673_1003086462 | 133 |
| 197 | 3300005366 | Ga0070659_100000045 | Ga0070659_10000004569 | 133 |
| 198 | 3300005366 | Ga0070659_100016514 | Ga0070659_1000165144 | 133 |
| 199 | 3300005366 | Ga0070659_100057730 | Ga0070659_1000577302 | 133 |
| 200 | 3300005366 | Ga0070659_100059707 | Ga0070659_1000597072 | 133 |
| 201 | 3300005366 | Ga0070659_100154086 | Ga0070659_1001540863 | 133 |
| 202 | 3300005366 | Ga0070659_100202596 | Ga0070659_1002025962 | 133 |
| 203 | 3300005366 | Ga0070659_100219296 | Ga0070659_1002192962 | 133 |
| 204 | 3300005366 | Ga0070659_100259405 | Ga0070659_1002594052 | 133 |
| 205 | 3300005366 | Ga0070659_100702014 | Ga0070659_1007020141 | 133 |
| 206 | 3300005366 | Ga0070659_100989752 | Ga0070659_1009897522 | 133 |
| 207 | 3300005366 | Ga0070659_101062650 | Ga0070659_1010626502 | 133 |
| 208 | 3300005367 | Ga0070667_100001174 | Ga0070667_10000117413 | 133 |
| 209 | 3300005367 | Ga0070667_100413617 | Ga0070667_1004136172 | 133 |
| 210 | 3300005367 | Ga0070667_100601984 | Ga0070667_1006019841 | 133 |
| 211 | 3300005435 | Ga0070714_100172953 | Ga0070714_1001729532 | 133 |
| 212 | 3300005435 | Ga0070714_100468768 | Ga0070714_1004687682 | 133 |
| 213 | 3300005435 | Ga0070714_101059704 | Ga0070714_1010597041 | 133 |
| 214 | 3300005444 | Ga0070694_100005710 | Ga0070694_1000057105 | 133 |
| 215 | 3300005444 | Ga0070694_101381431 | Ga0070694_1013814311 | 133 |
| 216 | 3300005455 | Ga0070663_100000549 | Ga0070663_1000005499 | 133 |
| 217 | 3300005455 | Ga0070663_100047213 | Ga0070663_1000472133 | 133 |
| 218 | 3300005455 | Ga0070663_100180609 | Ga0070663_1001806092 | 133 |
| 219 | 3300005455 | Ga0070663_100322178 | Ga0070663_1003221782 | 133 |
| 220 | 3300005455 | Ga0070663_100456936 | Ga0070663_1004569362 | 133 |
| 221 | 3300005457 | Ga0070662_100000036 | Ga0070662_10000003652 | 133 |
| 222 | 3300005457 | Ga0070662_100015155 | Ga0070662_1000151554 | 133 |
| 223 | 3300005457 | Ga0070662_100026980 | Ga0070662_1000269802 | 133 |
| 224 | 3300005457 | Ga0070662_100283452 | Ga0070662_1002834523 | 133 |
| 225 | 3300005457 | Ga0070662_101925569 | Ga0070662_1019255691 | 133 |
| 226 | 3300005458 | Ga0070681_10004074 | Ga0070681_100040748 | 133 |
| 227 | 3300005458 | Ga0070681_10023867 | Ga0070681_100238675 | 133 |
| 228 | 3300005458 | Ga0070681_10081032 | Ga0070681_100810321 | 133 |
| 229 | 3300005458 | Ga0070681_10165930 | Ga0070681_101659302 | 133 |
| 230 | 3300005458 | Ga0070681_10338619 | Ga0070681_103386192 | 133 |
| 231 | 3300005458 | Ga0070681_11014010 | Ga0070681_110140101 | 133 |
| 232 | 3300005458 | Ga0070681_11538171 | Ga0070681_115381711 | 133 |
| 233 | 3300005459 | Ga0068867_100001501 | Ga0068867_10000150112 | 133 |
| 234 | 3300005459 | Ga0068867_101293752 | Ga0068867_1012937521 | 133 |
| 235 | 3300005466 | Ga0070685_10016844 | Ga0070685_100168442 | 133 |
| 236 | 3300005530 | Ga0070679_100066466 | Ga0070679_1000664662 | 133 |
| 237 | 3300005530 | Ga0070679_100106227 | Ga0070679_1001062274 | 133 |
| 238 | 3300005530 | Ga0070679_100181881 | Ga0070679_1001818812 | 133 |
| 239 | 3300005530 | Ga0070679_100189064 | Ga0070679_1001890643 | 133 |
| 240 | 3300005530 | Ga0070679_100472562 | Ga0070679_1004725622 | 133 |
| 241 | 3300005535 | Ga0070684_100305960 | Ga0070684_1003059601 | 133 |
| 242 | 3300005535 | Ga0070684_100347638 | Ga0070684_1003476382 | 133 |
| 243 | 3300005535 | Ga0070684_100510099 | Ga0070684_1005100992 | 133 |
| 244 | 3300005539 | Ga0068853_100000059 | Ga0068853_10000005940 | 133 |
| 245 | 3300005539 | Ga0068853_100000570 | Ga0068853_10000057016 | 133 |
| 246 | 3300005539 | Ga0068853_100032863 | Ga0068853_1000328632 | 133 |
| 247 | 3300005539 | Ga0068853_100089942 | Ga0068853_1000899422 | 133 |
| 248 | 3300005539 | Ga0068853_100447637 | Ga0068853_1004476371 | 133 |
| 249 | 3300005539 | Ga0068853_100638202 | Ga0068853_1006382022 | 133 |
| 250 | 3300005543 | Ga0070672_100000866 | Ga0070672_1000008664 | 133 |
| 251 | 3300005543 | Ga0070672_100120352 | Ga0070672_1001203521 | 133 |
| 252 | 3300005544 | Ga0070686_100772757 | Ga0070686_1007727571 | 133 |
| 253 | 3300005546 | Ga0070696_100042737 | Ga0070696_1000427375 | 133 |
| 254 | 3300005547 | Ga0070693_100092887 | Ga0070693_1000928873 | 133 |
| 255 | 3300005548 | Ga0070665_100004200 | Ga0070665_1000042008 | 133 |
| 256 | 3300005548 | Ga0070665_100795186 | Ga0070665_1007951861 | 133 |
| 257 | 3300005563 | Ga0068855_100003767 | Ga0068855_10000376715 | 133 |
| 258 | 3300005563 | Ga0068855_100010268 | Ga0068855_1000102689 | 133 |
| 259 | 3300005563 | Ga0068855_100021027 | Ga0068855_1000210275 | 133 |
| 260 | 3300005563 | Ga0068855_100058235 | Ga0068855_1000582352 | 133 |
| 261 | 3300005563 | Ga0068855_100988817 | Ga0068855_1009888172 | 133 |
| 262 | 3300005564 | Ga0070664_100000027 | Ga0070664_10000002752 | 133 |
| 263 | 3300005564 | Ga0070664_100007309 | Ga0070664_1000073096 | 133 |
| 264 | 3300005564 | Ga0070664_100014989 | Ga0070664_1000149896 | 133 |
| 265 | 3300005564 | Ga0070664_100184030 | Ga0070664_1001840302 | 133 |
| 266 | 3300005564 | Ga0070664_100191805 | Ga0070664_1001918052 | 133 |
| 267 | 3300005564 | Ga0070664_100379554 | Ga0070664_1003795542 | 133 |
| 268 | 3300005564 | Ga0070664_101123983 | Ga0070664_1011239832 | 133 |
| 269 | 3300005577 | Ga0068857_100006503 | Ga0068857_1000065035 | 133 |
| 270 | 3300005577 | Ga0068857_100027425 | Ga0068857_1000274252 | 133 |
| 271 | 3300005577 | Ga0068857_100031864 | Ga0068857_1000318643 | 133 |
| 272 | 3300005577 | Ga0068857_100158885 | Ga0068857_1001588852 | 133 |
| 273 | 3300005577 | Ga0068857_100209968 | Ga0068857_1002099683 | 133 |
| 274 | 3300005577 | Ga0068857_101898123 | Ga0068857_1018981231 | 133 |
| 275 | 3300005578 | Ga0068854_100014971 | Ga0068854_1000149714 | 133 |
| 276 | 3300005578 | Ga0068854_100031718 | Ga0068854_1000317185 | 133 |
| 277 | 3300005578 | Ga0068854_100049234 | Ga0068854_1000492343 | 133 |
| 278 | 3300005578 | Ga0068854_100064635 | Ga0068854_1000646352 | 133 |
| 279 | 3300005578 | Ga0068854_100077907 | Ga0068854_1000779072 | 133 |
| 280 | 3300005578 | Ga0068854_100173258 | Ga0068854_1001732582 | 133 |
| 281 | 3300005578 | Ga0068854_100189781 | Ga0068854_1001897812 | 133 |
| 282 | 3300005578 | Ga0068854_100248935 | Ga0068854_1002489352 | 133 |
| 283 | 3300005614 | Ga0068856_100000705 | Ga0068856_1000007055 | 133 |
| 284 | 3300005614 | Ga0068856_100112245 | Ga0068856_1001122452 | 133 |
| 285 | 3300005614 | Ga0068856_100177026 | Ga0068856_1001770262 | 133 |
| 286 | 3300005614 | Ga0068856_100844405 | Ga0068856_1008444051 | 133 |
| 287 | 3300005614 | Ga0068856_101446059 | Ga0068856_1014460592 | 133 |
| 288 | 3300005614 | Ga0068856_102281372 | Ga0068856_1022813722 | 133 |
| 289 | 3300005614 | Ga0068856_102461425 | Ga0068856_1024614251 | 133 |
| 290 | 3300005616 | Ga0068852_100000433 | Ga0068852_10000043322 | 133 |
| 291 | 3300005616 | Ga0068852_100002112 | Ga0068852_1000021126 | 133 |
| 292 | 3300005616 | Ga0068852_100004730 | Ga0068852_1000047303 | 133 |
| 293 | 3300005616 | Ga0068852_100005166 | Ga0068852_1000051669 | 133 |
| 294 | 3300005616 | Ga0068852_100009994 | Ga0068852_1000099947 | 133 |
| 295 | 3300005616 | Ga0068852_100012833 | Ga0068852_1000128332 | 133 |
| 296 | 3300005616 | Ga0068852_100021917 | Ga0068852_1000219172 | 133 |
| 297 | 3300005616 | Ga0068852_100028840 | Ga0068852_1000288402 | 133 |
| 298 | 3300005616 | Ga0068852_100038267 | Ga0068852_1000382674 | 133 |
| 299 | 3300005616 | Ga0068852_100199101 | Ga0068852_1001991012 | 133 |
| 300 | 3300005616 | Ga0068852_100293902 | Ga0068852_1002939021 | 133 |
| 301 | 3300005616 | Ga0068852_100449243 | Ga0068852_1004492432 | 133 |
| 302 | 3300005616 | Ga0068852_101047860 | Ga0068852_1010478602 | 133 |
| 303 | 3300005617 | Ga0068859_100001592 | Ga0068859_1000015927 | 133 |
| 304 | 3300005617 | Ga0068859_100004210 | Ga0068859_10000421011 | 133 |
| 305 | 3300005617 | Ga0068859_100186961 | Ga0068859_1001869612 | 133 |
| 306 | 3300005617 | Ga0068859_100505209 | Ga0068859_1005052092 | 133 |
| 307 | 3300005618 | Ga0068864_100000247 | Ga0068864_10000024741 | 133 |
| 308 | 3300005618 | Ga0068864_100008545 | Ga0068864_1000085457 | 133 |
| 309 | 3300005618 | Ga0068864_100018914 | Ga0068864_1000189143 | 133 |
| 310 | 3300005618 | Ga0068864_100081590 | Ga0068864_1000815903 | 133 |
| 311 | 3300005718 | Ga0068866_10126483 | Ga0068866_101264832 | 133 |
| 312 | 3300005718 | Ga0068866_10525938 | Ga0068866_105259382 | 133 |
| 313 | 3300005719 | Ga0068861_100180793 | Ga0068861_1001807933 | 133 |
| 314 | 3300005719 | Ga0068861_100355085 | Ga0068861_1003550851 | 133 |
| 315 | 3300005834 | Ga0068851_10020047 | Ga0068851_100200474 | 133 |
| 316 | 3300005834 | Ga0068851_10062018 | Ga0068851_100620182 | 133 |
| 317 | 3300005840 | Ga0068870_10010268 | Ga0068870_100102686 | 133 |
| 318 | 3300005841 | Ga0068863_100001653 | Ga0068863_10000165325 | 133 |
| 319 | 3300005841 | Ga0068863_100069143 | Ga0068863_1000691434 | 133 |
| 320 | 3300005841 | Ga0068863_100234963 | Ga0068863_1002349632 | 133 |
| 321 | 3300005842 | Ga0068858_100006759 | Ga0068858_10000675910 | 133 |
| 322 | 3300005842 | Ga0068858_100017221 | Ga0068858_1000172215 | 133 |
| 323 | 3300005842 | Ga0068858_100022399 | Ga0068858_1000223996 | 133 |
| 324 | 3300005843 | Ga0068860_100021537 | Ga0068860_1000215374 | 133 |
| 325 | 3300005843 | Ga0068860_100027958 | Ga0068860_1000279582 | 133 |
| 326 | 3300005843 | Ga0068860_101165869 | Ga0068860_1011658692 | 133 |
| 327 | 3300005844 | Ga0068862_100006024 | Ga0068862_1000060247 | 133 |
| 328 | 3300005844 | Ga0068862_100254750 | Ga0068862_1002547503 | 133 |
| 329 | 3300005844 | Ga0068862_101192545 | Ga0068862_1011925451 | 133 |
| 330 | 3300006237 | Ga0097621_100026649 | Ga0097621_1000266493 | 133 |
| 331 | 3300006237 | Ga0097621_100219024 | Ga0097621_1002190242 | 133 |
| 332 | 3300006237 | Ga0097621_101420964 | Ga0097621_1014209642 | 133 |
| 333 | 3300006358 | Ga0068871_100070496 | Ga0068871_1000704962 | 133 |
| 334 | 3300006931 | Ga0097620_100001592 | Ga0097620_1000015927 | 133 |
| 335 | 3300006931 | Ga0097620_100004210 | Ga0097620_10000421011 | 133 |
| 336 | 3300006931 | Ga0097620_100186953 | Ga0097620_1001869532 | 133 |
| 337 | 3300006931 | Ga0097620_100505223 | Ga0097620_1005052232 | 133 |
| 338 | 3300009093 | Ga0105240_10027015 | Ga0105240_100270156 | 133 |
| 339 | 3300009093 | Ga0105240_10126852 | Ga0105240_101268522 | 133 |
| 340 | 3300009093 | Ga0105240_10379048 | Ga0105240_103790482 | 133 |
| 341 | 3300009098 | Ga0105245_10000128 | Ga0105245_1000012818 | 133 |
| 342 | 3300009147 | Ga0114129_10896631 | Ga0114129_108966312 | 133 |
| 343 | 3300009148 | Ga0105243_10064347 | Ga0105243_100643475 | 133 |
| 344 | 3300009148 | Ga0105243_10105180 | Ga0105243_101051804 | 133 |
| 345 | 3300009148 | Ga0105243_10759863 | Ga0105243_107598632 | 133 |
| 346 | 3300009174 | Ga0105241_10032667 | Ga0105241_100326675 | 133 |
| 347 | 3300009174 | Ga0105241_10057413 | Ga0105241_100574132 | 133 |
| 348 | 3300009174 | Ga0105241_10108525 | Ga0105241_101085252 | 133 |
| 349 | 3300009174 | Ga0105241_10211699 | Ga0105241_102116992 | 133 |
| 350 | 3300009177 | Ga0105248_10001451 | Ga0105248_1000145121 | 133 |
| 351 | 3300009177 | Ga0105248_10005525 | Ga0105248_100055257 | 133 |
| 352 | 3300009177 | Ga0105248_11168005 | Ga0105248_111680052 | 133 |
| 353 | 3300009545 | Ga0105237_10010769 | Ga0105237_100107692 | 133 |
| 354 | 3300009551 | Ga0105238_10014228 | Ga0105238_100142282 | 133 |
| 355 | 3300009551 | Ga0105238_10033353 | Ga0105238_100333535 | 133 |
| 356 | 3300009551 | Ga0105238_10122248 | Ga0105238_101222484 | 133 |
| 357 | 3300009551 | Ga0105238_10143149 | Ga0105238_101431493 | 133 |
| 358 | 3300009553 | Ga0105249_10031339 | Ga0105249_100313396 | 133 |
| 359 | 3300009553 | Ga0105249_10065744 | Ga0105249_100657443 | 133 |
| 360 | 3300010375 | Ga0105239_10118334 | Ga0105239_101183344 | 133 |
| 361 | 3300011119 | Ga0105246_10007663 | Ga0105246_100076633 | 133 |
| 362 | 3300011119 | Ga0105246_10011642 | Ga0105246_100116426 | 133 |
| 363 | 3300011119 | Ga0105246_11300917 | Ga0105246_113009172 | 133 |
| 364 | 3300013100 | Ga0157373_10001921 | Ga0157373_100019212 | 133 |
| 365 | 3300013100 | Ga0157373_10011033 | Ga0157373_100110335 | 133 |
| 366 | 3300013100 | Ga0157373_10017730 | Ga0157373_100177305 | 133 |
| 367 | 3300013100 | Ga0157373_10026865 | Ga0157373_100268652 | 133 |
| 368 | 3300013100 | Ga0157373_10043735 | Ga0157373_100437352 | 133 |
| 369 | 3300013100 | Ga0157373_10056049 | Ga0157373_100560492 | 133 |
| 370 | 3300013100 | Ga0157373_10060140 | Ga0157373_100601403 | 133 |
| 371 | 3300013100 | Ga0157373_10069117 | Ga0157373_100691174 | 133 |
| 372 | 3300013100 | Ga0157373_10072216 | Ga0157373_100722162 | 133 |
| 373 | 3300013100 | Ga0157373_10229162 | Ga0157373_102291621 | 133 |
| 374 | 3300013100 | Ga0157373_10258216 | Ga0157373_102582162 | 133 |
| 375 | 3300013100 | Ga0157373_10306653 | Ga0157373_103066532 | 133 |
| 376 | 3300013100 | Ga0157373_10328756 | Ga0157373_103287562 | 133 |
| 377 | 3300013100 | Ga0157373_10906988 | Ga0157373_109069882 | 133 |
| 378 | 3300013102 | Ga0157371_10001392 | Ga0157371_100013924 | 133 |
| 379 | 3300013102 | Ga0157371_10002958 | Ga0157371_1000295815 | 133 |
| 380 | 3300013102 | Ga0157371_10014993 | Ga0157371_100149935 | 133 |
| 381 | 3300013102 | Ga0157371_10070710 | Ga0157371_100707103 | 133 |
| 382 | 3300013102 | Ga0157371_10112985 | Ga0157371_101129852 | 133 |
| 383 | 3300013102 | Ga0157371_10140622 | Ga0157371_101406222 | 133 |
| 384 | 3300013102 | Ga0157371_10255184 | Ga0157371_102551842 | 133 |
| 385 | 3300013102 | Ga0157371_10483958 | Ga0157371_104839582 | 133 |
| 386 | 3300013104 | Ga0157370_10000686 | Ga0157370_1000068631 | 133 |
| 387 | 3300013104 | Ga0157370_10011108 | Ga0157370_100111086 | 133 |
| 388 | 3300013104 | Ga0157370_10047926 | Ga0157370_100479263 | 133 |
| 389 | 3300013104 | Ga0157370_10093074 | Ga0157370_100930743 | 133 |
| 390 | 3300013104 | Ga0157370_10141565 | Ga0157370_101415652 | 133 |
| 391 | 3300013104 | Ga0157370_11887769 | Ga0157370_118877691 | 133 |
| 392 | 3300013105 | Ga0157369_10008678 | Ga0157369_100086786 | 133 |
| 393 | 3300013105 | Ga0157369_10039739 | Ga0157369_100397394 | 133 |
| 394 | 3300013105 | Ga0157369_10059618 | Ga0157369_100596182 | 133 |
| 395 | 3300013105 | Ga0157369_10115743 | Ga0157369_101157433 | 133 |
| 396 | 3300013105 | Ga0157369_10309826 | Ga0157369_103098262 | 133 |
| 397 | 3300013105 | Ga0157369_10556221 | Ga0157369_105562212 | 133 |
| 398 | 3300013105 | Ga0157369_10612319 | Ga0157369_106123192 | 133 |
| 399 | 3300013105 | Ga0157369_12247206 | Ga0157369_122472061 | 133 |
| 400 | 3300013296 | Ga0157374_10031240 | Ga0157374_100312404 | 133 |
| 401 | 3300013297 | Ga0157378_10000396 | Ga0157378_100003965 | 133 |
| 402 | 3300013306 | Ga0163162_10264490 | Ga0163162_102644901 | 133 |
| 403 | 3300013306 | Ga0163162_10471362 | Ga0163162_104713622 | 133 |
| 404 | 3300013307 | Ga0157372_10038042 | Ga0157372_100380425 | 133 |
| 405 | 3300013307 | Ga0157372_10070283 | Ga0157372_100702834 | 133 |
| 406 | 3300013307 | Ga0157372_10097641 | Ga0157372_100976412 | 133 |
| 407 | 3300013307 | Ga0157372_10459311 | Ga0157372_104593112 | 133 |
| 408 | 3300013307 | Ga0157372_11540970 | Ga0157372_115409702 | 133 |
| 409 | 3300013308 | Ga0157375_10591103 | Ga0157375_105911032 | 133 |
| 410 | 3300013308 | Ga0157375_10644106 | Ga0157375_106441061 | 133 |
| 411 | 3300014325 | Ga0163163_10000187 | Ga0163163_1000018726 | 133 |
| 412 | 3300014968 | Ga0157379_10182906 | Ga0157379_101829062 | 133 |
| 413 | 3300014968 | Ga0157379_10681921 | Ga0157379_106819212 | 133 |
| 414 | 3300020069 | Ga0197907_10087473 | Ga0197907_100874731 | 133 |
| 415 | 3300020070 | Ga0206356_11579705 | Ga0206356_115797051 | 133 |
| 416 | 3300020081 | Ga0206354_10755474 | Ga0206354_107554742 | 133 |
| 417 | 3300020081 | Ga0206354_11422423 | Ga0206354_114224232 | 133 |
| 418 | 3300020082 | Ga0206353_10818459 | Ga0206353_108184594 | 133 |
| 419 | 3300020082 | Ga0206353_11188791 | Ga0206353_111887912 | 133 |
| 420 | 3300025315 | Ga0207697_10000059 | Ga0207697_1000005938 | 133 |
| 421 | 3300025321 | Ga0207656_10040854 | Ga0207656_100408542 | 133 |
| 422 | 3300025321 | Ga0207656_10357895 | Ga0207656_103578951 | 133 |
| 423 | 3300025899 | Ga0207642_10117116 | Ga0207642_101171162 | 133 |
| 424 | 3300025901 | Ga0207688_10000721 | Ga0207688_1000072112 | 133 |
| 425 | 3300025903 | Ga0207680_10004748 | Ga0207680_100047481 | 133 |
| 426 | 3300025903 | Ga0207680_10138471 | Ga0207680_101384712 | 133 |
| 427 | 3300025904 | Ga0207647_10000968 | Ga0207647_100009685 | 133 |
| 428 | 3300025904 | Ga0207647_10001381 | Ga0207647_100013816 | 133 |
| 429 | 3300025904 | Ga0207647_10051788 | Ga0207647_100517883 | 133 |
| 430 | 3300025907 | Ga0207645_10002144 | Ga0207645_100021447 | 133 |
| 431 | 3300025907 | Ga0207645_10016875 | Ga0207645_100168752 | 133 |
| 432 | 3300025907 | Ga0207645_10078345 | Ga0207645_100783454 | 133 |
| 433 | 3300025908 | Ga0207643_10258584 | Ga0207643_102585842 | 133 |
| 434 | 3300025909 | Ga0207705_10000086 | Ga0207705_10000086119 | 133 |
| 435 | 3300025909 | Ga0207705_10004131 | Ga0207705_100041313 | 133 |
| 436 | 3300025909 | Ga0207705_10012975 | Ga0207705_100129756 | 133 |
| 437 | 3300025909 | Ga0207705_10018733 | Ga0207705_100187332 | 133 |
| 438 | 3300025909 | Ga0207705_10019330 | Ga0207705_100193303 | 133 |
| 439 | 3300025909 | Ga0207705_10023122 | Ga0207705_100231224 | 133 |
| 440 | 3300025909 | Ga0207705_10374960 | Ga0207705_103749602 | 133 |
| 441 | 3300025909 | Ga0207705_10804549 | Ga0207705_108045492 | 133 |
| 442 | 3300025911 | Ga0207654_10096895 | Ga0207654_100968953 | 133 |
| 443 | 3300025911 | Ga0207654_10116145 | Ga0207654_101161452 | 133 |
| 444 | 3300025911 | Ga0207654_10238303 | Ga0207654_102383032 | 133 |
| 445 | 3300025911 | Ga0207654_10325720 | Ga0207654_103257202 | 133 |
| 446 | 3300025912 | Ga0207707_10086364 | Ga0207707_100863642 | 133 |
| 447 | 3300025912 | Ga0207707_10096969 | Ga0207707_100969691 | 133 |
| 448 | 3300025912 | Ga0207707_10238320 | Ga0207707_102383202 | 133 |
| 449 | 3300025912 | Ga0207707_11096466 | Ga0207707_110964662 | 133 |
| 450 | 3300025913 | Ga0207695_10019721 | Ga0207695_100197217 | 133 |
| 451 | 3300025913 | Ga0207695_10057499 | Ga0207695_100574994 | 133 |
| 452 | 3300025914 | Ga0207671_10068265 | Ga0207671_100682653 | 133 |
| 453 | 3300025914 | Ga0207671_11104349 | Ga0207671_111043492 | 133 |
| 454 | 3300025917 | Ga0207660_10000711 | Ga0207660_1000071113 | 133 |
| 455 | 3300025917 | Ga0207660_10002701 | Ga0207660_100027018 | 133 |
| 456 | 3300025917 | Ga0207660_10005238 | Ga0207660_100052381 | 133 |
| 457 | 3300025917 | Ga0207660_10156919 | Ga0207660_101569192 | 133 |
| 458 | 3300025917 | Ga0207660_10159858 | Ga0207660_101598583 | 133 |
| 459 | 3300025917 | Ga0207660_10367846 | Ga0207660_103678462 | 133 |
| 460 | 3300025917 | Ga0207660_10509129 | Ga0207660_105091291 | 133 |
| 461 | 3300025919 | Ga0207657_10000133 | Ga0207657_1000013351 | 133 |
| 462 | 3300025919 | Ga0207657_10000267 | Ga0207657_1000026741 | 133 |
| 463 | 3300025919 | Ga0207657_10005242 | Ga0207657_1000524211 | 133 |
| 464 | 3300025919 | Ga0207657_10005850 | Ga0207657_100058507 | 133 |
| 465 | 3300025919 | Ga0207657_10008846 | Ga0207657_100088464 | 133 |
| 466 | 3300025919 | Ga0207657_10054657 | Ga0207657_100546574 | 133 |
| 467 | 3300025919 | Ga0207657_10092503 | Ga0207657_100925033 | 133 |
| 468 | 3300025919 | Ga0207657_10294401 | Ga0207657_102944012 | 133 |
| 469 | 3300025920 | Ga0207649_10000378 | Ga0207649_1000037822 | 133 |
| 470 | 3300025920 | Ga0207649_10031381 | Ga0207649_100313812 | 133 |
| 471 | 3300025920 | Ga0207649_10191138 | Ga0207649_101911382 | 133 |
| 472 | 3300025920 | Ga0207649_10252189 | Ga0207649_102521892 | 133 |
| 473 | 3300025920 | Ga0207649_10352801 | Ga0207649_103528011 | 133 |
| 474 | 3300025920 | Ga0207649_10442940 | Ga0207649_104429402 | 133 |
| 475 | 3300025920 | Ga0207649_10465146 | Ga0207649_104651462 | 133 |
| 476 | 3300025920 | Ga0207649_10487309 | Ga0207649_104873092 | 133 |
| 477 | 3300025921 | Ga0207652_10041849 | Ga0207652_100418493 | 133 |
| 478 | 3300025921 | Ga0207652_10066873 | Ga0207652_100668732 | 133 |
| 479 | 3300025921 | Ga0207652_10723332 | Ga0207652_107233321 | 133 |
| 480 | 3300025921 | Ga0207652_10760263 | Ga0207652_107602632 | 133 |
| 481 | 3300025921 | Ga0207652_10788659 | Ga0207652_107886592 | 133 |
| 482 | 3300025923 | Ga0207681_10012674 | Ga0207681_100126745 | 133 |
| 483 | 3300025923 | Ga0207681_10042342 | Ga0207681_100423423 | 133 |
| 484 | 3300025924 | Ga0207694_10001964 | Ga0207694_100019647 | 133 |
| 485 | 3300025924 | Ga0207694_10137561 | Ga0207694_101375612 | 133 |
| 486 | 3300025924 | Ga0207694_10165810 | Ga0207694_101658102 | 133 |
| 487 | 3300025925 | Ga0207650_10010511 | Ga0207650_100105113 | 133 |
| 488 | 3300025925 | Ga0207650_10207863 | Ga0207650_102078633 | 133 |
| 489 | 3300025926 | Ga0207659_10051002 | Ga0207659_100510024 | 133 |
| 490 | 3300025927 | Ga0207687_10000688 | Ga0207687_1000068821 | 133 |
| 491 | 3300025927 | Ga0207687_10147036 | Ga0207687_101470362 | 133 |
| 492 | 3300025929 | Ga0207664_10509144 | Ga0207664_105091442 | 133 |
| 493 | 3300025931 | Ga0207644_10015617 | Ga0207644_100156172 | 133 |
| 494 | 3300025931 | Ga0207644_10079499 | Ga0207644_100794992 | 133 |
| 495 | 3300025931 | Ga0207644_10089244 | Ga0207644_100892442 | 133 |
| 496 | 3300025932 | Ga0207690_10000080 | Ga0207690_1000008040 | 133 |
| 497 | 3300025932 | Ga0207690_10001597 | Ga0207690_1000159710 | 133 |
| 498 | 3300025932 | Ga0207690_10004642 | Ga0207690_100046425 | 133 |
| 499 | 3300025932 | Ga0207690_10007944 | Ga0207690_100079447 | 133 |
| 500 | 3300025932 | Ga0207690_10045680 | Ga0207690_100456802 | 133 |
| 501 | 3300025932 | Ga0207690_10095329 | Ga0207690_100953292 | 133 |
| 502 | 3300025932 | Ga0207690_10193393 | Ga0207690_101933931 | 133 |
| 503 | 3300025932 | Ga0207690_10207875 | Ga0207690_102078752 | 133 |
| 504 | 3300025932 | Ga0207690_10340231 | Ga0207690_103402312 | 133 |
| 505 | 3300025932 | Ga0207690_10805864 | Ga0207690_108058642 | 133 |
| 506 | 3300025933 | Ga0207706_10000159 | Ga0207706_1000015951 | 133 |
| 507 | 3300025933 | Ga0207706_10000426 | Ga0207706_1000042638 | 133 |
| 508 | 3300025933 | Ga0207706_10001767 | Ga0207706_1000176712 | 133 |
| 509 | 3300025933 | Ga0207706_10003045 | Ga0207706_1000304517 | 133 |
| 510 | 3300025933 | Ga0207706_10051732 | Ga0207706_100517322 | 133 |
| 511 | 3300025934 | Ga0207686_10539801 | Ga0207686_105398011 | 133 |
| 512 | 3300025935 | Ga0207709_10193898 | Ga0207709_101938982 | 133 |
| 513 | 3300025935 | Ga0207709_10336057 | Ga0207709_103360572 | 133 |
| 514 | 3300025936 | Ga0207670_11292471 | Ga0207670_112924712 | 133 |
| 515 | 3300025937 | Ga0207669_10005541 | Ga0207669_100055416 | 133 |
| 516 | 3300025937 | Ga0207669_11768220 | Ga0207669_117682201 | 133 |
| 517 | 3300025940 | Ga0207691_10013333 | Ga0207691_100133337 | 133 |
| 518 | 3300025940 | Ga0207691_10113343 | Ga0207691_101133433 | 133 |
| 519 | 3300025941 | Ga0207711_10000744 | Ga0207711_100007443 | 133 |
| 520 | 3300025941 | Ga0207711_10002355 | Ga0207711_100023558 | 133 |
| 521 | 3300025941 | Ga0207711_10003526 | Ga0207711_1000352614 | 133 |
| 522 | 3300025941 | Ga0207711_10562316 | Ga0207711_105623162 | 133 |
| 523 | 3300025942 | Ga0207689_10000128 | Ga0207689_1000012826 | 133 |
| 524 | 3300025942 | Ga0207689_10050102 | Ga0207689_100501023 | 133 |
| 525 | 3300025942 | Ga0207689_10070985 | Ga0207689_100709852 | 133 |
| 526 | 3300025944 | Ga0207661_10001549 | Ga0207661_100015494 | 133 |
| 527 | 3300025944 | Ga0207661_10036102 | Ga0207661_100361026 | 133 |
| 528 | 3300025944 | Ga0207661_10058294 | Ga0207661_100582942 | 133 |
| 529 | 3300025944 | Ga0207661_10088312 | Ga0207661_100883123 | 133 |
| 530 | 3300025944 | Ga0207661_10094886 | Ga0207661_100948862 | 133 |
| 531 | 3300025944 | Ga0207661_10458338 | Ga0207661_104583382 | 133 |
| 532 | 3300025944 | Ga0207661_10908919 | Ga0207661_109089192 | 133 |
| 533 | 3300025945 | Ga0207679_10000155 | Ga0207679_1000015531 | 133 |
| 534 | 3300025945 | Ga0207679_10021030 | Ga0207679_100210305 | 133 |
| 535 | 3300025945 | Ga0207679_10023302 | Ga0207679_100233024 | 133 |
| 536 | 3300025945 | Ga0207679_10212489 | Ga0207679_102124892 | 133 |
| 537 | 3300025945 | Ga0207679_10431160 | Ga0207679_104311602 | 133 |
| 538 | 3300025945 | Ga0207679_10979224 | Ga0207679_109792242 | 133 |
| 539 | 3300025949 | Ga0207667_10017533 | Ga0207667_100175335 | 133 |
| 540 | 3300025949 | Ga0207667_10018898 | Ga0207667_100188986 | 133 |
| 541 | 3300025949 | Ga0207667_10037566 | Ga0207667_100375664 | 133 |
| 542 | 3300025949 | Ga0207667_10042322 | Ga0207667_100423224 | 133 |
| 543 | 3300025949 | Ga0207667_10053023 | Ga0207667_100530234 | 133 |
| 544 | 3300025949 | Ga0207667_10055114 | Ga0207667_100551144 | 133 |
| 545 | 3300025949 | Ga0207667_10153295 | Ga0207667_101532953 | 133 |
| 546 | 3300025949 | Ga0207667_12109732 | Ga0207667_121097321 | 133 |
| 547 | 3300025960 | Ga0207651_10001297 | Ga0207651_100012974 | 133 |
| 548 | 3300025960 | Ga0207651_10669219 | Ga0207651_106692192 | 133 |
| 549 | 3300025960 | Ga0207651_11023569 | Ga0207651_110235691 | 133 |
| 550 | 3300025961 | Ga0207712_10934758 | Ga0207712_109347582 | 133 |
| 551 | 3300025972 | Ga0207668_10270781 | Ga0207668_102707812 | 133 |
| 552 | 3300025972 | Ga0207668_10547427 | Ga0207668_105474272 | 133 |
| 553 | 3300025972 | Ga0207668_10718534 | Ga0207668_107185341 | 133 |
| 554 | 3300025981 | Ga0207640_10005165 | Ga0207640_100051655 | 133 |
| 555 | 3300025981 | Ga0207640_10037349 | Ga0207640_100373493 | 133 |
| 556 | 3300025981 | Ga0207640_10063004 | Ga0207640_100630042 | 133 |
| 557 | 3300025981 | Ga0207640_10067160 | Ga0207640_100671602 | 133 |
| 558 | 3300025981 | Ga0207640_10177192 | Ga0207640_101771923 | 133 |
| 559 | 3300025981 | Ga0207640_10314352 | Ga0207640_103143522 | 133 |
| 560 | 3300025981 | Ga0207640_10337021 | Ga0207640_103370212 | 133 |
| 561 | 3300025986 | Ga0207658_10012354 | Ga0207658_100123545 | 133 |
| 562 | 3300025986 | Ga0207658_10218426 | Ga0207658_102184262 | 133 |
| 563 | 3300026023 | Ga0207677_10006405 | Ga0207677_100064055 | 133 |
| 564 | 3300026023 | Ga0207677_10635950 | Ga0207677_106359502 | 133 |
| 565 | 3300026035 | Ga0207703_10003199 | Ga0207703_100031991 | 133 |
| 566 | 3300026035 | Ga0207703_10030128 | Ga0207703_100301284 | 133 |
| 567 | 3300026035 | Ga0207703_10030986 | Ga0207703_100309863 | 133 |
| 568 | 3300026041 | Ga0207639_10000137 | Ga0207639_100001376 | 133 |
| 569 | 3300026041 | Ga0207639_10001284 | Ga0207639_1000128414 | 133 |
| 570 | 3300026041 | Ga0207639_10004961 | Ga0207639_100049616 | 133 |
| 571 | 3300026041 | Ga0207639_10048237 | Ga0207639_100482372 | 133 |
| 572 | 3300026041 | Ga0207639_10112034 | Ga0207639_101120341 | 133 |
| 573 | 3300026041 | Ga0207639_10653102 | Ga0207639_106531022 | 133 |
| 574 | 3300026041 | Ga0207639_10722671 | Ga0207639_107226712 | 133 |
| 575 | 3300026067 | Ga0207678_10000973 | Ga0207678_1000097321 | 133 |
| 576 | 3300026067 | Ga0207678_10002271 | Ga0207678_100022714 | 133 |
| 577 | 3300026067 | Ga0207678_10004199 | Ga0207678_100041996 | 133 |
| 578 | 3300026067 | Ga0207678_10084825 | Ga0207678_100848254 | 133 |
| 579 | 3300026067 | Ga0207678_10155934 | Ga0207678_101559342 | 133 |
| 580 | 3300026067 | Ga0207678_10375665 | Ga0207678_103756652 | 133 |
| 581 | 3300026067 | Ga0207678_10543744 | Ga0207678_105437441 | 133 |
| 582 | 3300026078 | Ga0207702_10000246 | Ga0207702_1000024640 | 133 |
| 583 | 3300026078 | Ga0207702_10196423 | Ga0207702_101964232 | 133 |
| 584 | 3300026078 | Ga0207702_10386791 | Ga0207702_103867913 | 133 |
| 585 | 3300026078 | Ga0207702_10552615 | Ga0207702_105526151 | 133 |
| 586 | 3300026078 | Ga0207702_10580725 | Ga0207702_105807252 | 133 |
| 587 | 3300026078 | Ga0207702_11419196 | Ga0207702_114191961 | 133 |
| 588 | 3300026078 | Ga0207702_11755914 | Ga0207702_117559142 | 133 |
| 589 | 3300026088 | Ga0207641_10001758 | Ga0207641_100017582 | 133 |
| 590 | 3300026088 | Ga0207641_10061282 | Ga0207641_100612822 | 133 |
| 591 | 3300026088 | Ga0207641_10063990 | Ga0207641_100639902 | 133 |
| 592 | 3300026089 | Ga0207648_10003309 | Ga0207648_1000330912 | 133 |
| 593 | 3300026089 | Ga0207648_10239230 | Ga0207648_102392302 | 133 |
| 594 | 3300026095 | Ga0207676_10000220 | Ga0207676_1000022012 | 133 |
| 595 | 3300026095 | Ga0207676_10005619 | Ga0207676_100056196 | 133 |
| 596 | 3300026095 | Ga0207676_10009270 | Ga0207676_100092706 | 133 |
| 597 | 3300026095 | Ga0207676_10015190 | Ga0207676_100151903 | 133 |
| 598 | 3300026116 | Ga0207674_10000827 | Ga0207674_1000082720 | 133 |
| 599 | 3300026116 | Ga0207674_10004899 | Ga0207674_100048996 | 133 |
| 600 | 3300026116 | Ga0207674_10012242 | Ga0207674_100122428 | 133 |
| 601 | 3300026116 | Ga0207674_10017536 | Ga0207674_100175367 | 133 |
| 602 | 3300026118 | Ga0207675_100055033 | Ga0207675_1000550335 | 133 |
| 603 | 3300026118 | Ga0207675_100437483 | Ga0207675_1004374833 | 133 |
| 604 | 3300026142 | Ga0207698_10000421 | Ga0207698_100004215 | 133 |
| 605 | 3300026142 | Ga0207698_10001565 | Ga0207698_100015658 | 133 |
| 606 | 3300026142 | Ga0207698_10001619 | Ga0207698_100016196 | 133 |
| 607 | 3300026142 | Ga0207698_10006275 | Ga0207698_100062755 | 133 |
| 608 | 3300026142 | Ga0207698_10008966 | Ga0207698_100089665 | 133 |
| 609 | 3300026142 | Ga0207698_10013342 | Ga0207698_100133425 | 133 |
| 610 | 3300026142 | Ga0207698_10059370 | Ga0207698_100593702 | 133 |
| 611 | 3300026142 | Ga0207698_10067580 | Ga0207698_100675804 | 133 |
| 612 | 3300026142 | Ga0207698_10072205 | Ga0207698_100722054 | 133 |
| 613 | 3300026142 | Ga0207698_10083651 | Ga0207698_100836512 | 133 |
| 614 | 3300026142 | Ga0207698_10148606 | Ga0207698_101486062 | 133 |
| 615 | 3300026142 | Ga0207698_10211701 | Ga0207698_102117012 | 133 |
| 616 | 3300026142 | Ga0207698_10506316 | Ga0207698_105063162 | 133 |
| 617 | 3300026142 | Ga0207698_11039440 | Ga0207698_110394402 | 133 |
| 618 | 3300027876 | Ga0209974_10132559 | Ga0209974_101325592 | 133 |
| 619 | 3300028379 | Ga0268266_10044669 | Ga0268266_100446693 | 133 |
| 620 | 3300028379 | Ga0268266_11561860 | Ga0268266_115618602 | 133 |
| 621 | 3300028380 | Ga0268265_10022231 | Ga0268265_100222314 | 133 |
| 622 | 3300028380 | Ga0268265_10054802 | Ga0268265_100548022 | 133 |
| 623 | 3300028381 | Ga0268264_10006398 | Ga0268264_100063988 | 133 |
| 624 | 3300028381 | Ga0268264_10097034 | Ga0268264_100970344 | 133 |
| 625 | 3300028381 | Ga0268264_10588828 | Ga0268264_105888282 | 133 |
| 626 | 3300031824 | Ga0307413_10335602 | Ga0307413_103356021 | 133 |
| 627 | 3300031824 | Ga0307413_12152347 | Ga0307413_121523471 | 133 |
| 628 | 3300031852 | Ga0307410_10091123 | Ga0307410_100911232 | 133 |
| 629 | 3300031901 | Ga0307406_10057541 | Ga0307406_100575412 | 133 |
| 630 | 3300031903 | Ga0307407_10424373 | Ga0307407_104243732 | 133 |
| 631 | 3300032004 | Ga0307414_11035571 | Ga0307414_110355711 | 133 |
| 632 | 3300032126 | Ga0307415_100099528 | Ga0307415_1000995282 | 133 |
| 633 | 3300035084 | Ga0373928_0171963 | Ga0373928_0171963_41_442 | 133 |
| 634 | 3300035091 | Ga0373951_0008212 | Ga0373951_0008212_913_1314 | 133 |
| 635 | 3300035111 | Ga0373923_0047268 | Ga0373923_0047268_1034_1465 | 133 |
| 636 | 3300035118 | Ga0373954_0085213 | Ga0373954_0085213_601_1032 | 133 |
| 637 | 3300035119 | Ga0373956_0156274 | Ga0373956_0156274_172_603 | 133 |
| 638 | 3300035121 | Ga0373960_0161607 | Ga0373960_0161607_246_647 | 133 |
| 639 | 3300035172 | Ga0373955_1028398 | Ga0373955_1028398_44_475 | 133 |
| 640 | 3300035242 | Ga0373962_0121808 | Ga0373962_0121808_398_799 | 133 |
| 641 | 3300035691 | Ga0373931_0028286 | Ga0373931_0028286_1023_1424 | 133 |
| 642 | 3300035692 | Ga0373935_0309818 | Ga0373935_0309818_325_756 | 133 |
| 643 | 3300036401 | Ga0373937_0008086 | Ga0373937_0008086_8368_8799 | 133 |
| 644 | 3300037312 | Ga0395899_0001906 | Ga0395899_0001906_11452_11853 | 133 |
| 645 | 3300037312 | Ga0395899_0015290 | Ga0395899_0015290_4297_4698 | 133 |
| 646 | 3300037312 | Ga0395899_0033784 | Ga0395899_0033784_625_1026 | 133 |
| 647 | 3300037312 | Ga0395899_0041859 | Ga0395899_0041859_796_1200 | 133 |
| 648 | 3300037312 | Ga0395899_0099675 | Ga0395899_0099675_357_758 | 133 |
| 649 | 3300037312 | Ga0395899_0103209 | Ga0395899_0103209_565_969 | 133 |
| 650 | 3300037312 | Ga0395899_0106354 | Ga0395899_0106354_1437_1838 | 133 |
| 651 | 3300037312 | Ga0395899_0270210 | Ga0395899_0270210_179_580 | 133 |
| 652 | 3300037312 | Ga0395899_0442582 | Ga0395899_0442582_381_782 | 133 |
| 653 | 3300037312 | Ga0395899_0498246 | Ga0395899_0498246_153_554 | 133 |
| 654 | 3300037312 | Ga0395899_0824625 | Ga0395899_0824625_19_420 | 133 |
| 655 | 3300037418 | Ga0395900_0000447 | Ga0395900_0000447_16379_16780 | 133 |
| 656 | 3300037418 | Ga0395900_0055653 | Ga0395900_0055653_983_1384 | 133 |
| 657 | 3300037418 | Ga0395900_0070117 | Ga0395900_0070117_615_1016 | 133 |
| 658 | 3300037418 | Ga0395900_0079680 | Ga0395900_0079680_2747_3148 | 133 |
| 659 | 3300037418 | Ga0395900_0173564 | Ga0395900_0173564_493_894 | 133 |
| 660 | 3300037418 | Ga0395900_0239111 | Ga0395900_0239111_723_1124 | 133 |
| 661 | 3300037418 | Ga0395900_0253231 | Ga0395900_0253231_925_1326 | 133 |
| 662 | 3300037418 | Ga0395900_0315078 | Ga0395900_0315078_1060_1461 | 133 |
| 663 | 3300037418 | Ga0395900_0412256 | Ga0395900_0412256_453_857 | 133 |
| 664 | 3300037418 | Ga0395900_0442238 | Ga0395900_0442238_569_970 | 133 |
| 665 | 3300037418 | Ga0395900_0526478 | Ga0395900_0526478_605_1006 | 133 |
| 666 | 3300037418 | Ga0395900_0544897 | Ga0395900_0544897_371_775 | 133 |
| 667 | 3300037418 | Ga0395900_0833937 | Ga0395900_0833937_87_488 | 133 |
| 668 | 3300037418 | Ga0395900_0899189 | Ga0395900_0899189_148_549 | 133 |
| 669 | 3300037418 | Ga0395900_1033061 | Ga0395900_1033061_135_563 | 133 |
| 670 | 3300037466 | Ga0395898_0011697 | Ga0395898_0011697_8625_9026 | 133 |
| 671 | 3300037466 | Ga0395898_0083259 | Ga0395898_0083259_851_1252 | 133 |
| 672 | 3300037466 | Ga0395898_0088326 | Ga0395898_0088326_362_763 | 133 |
| 673 | 3300037466 | Ga0395898_0110666 | Ga0395898_0110666_2014_2415 | 133 |
| 674 | 3300037466 | Ga0395898_0111874 | Ga0395898_0111874_272_673 | 133 |
| 675 | 3300037466 | Ga0395898_0180232 | Ga0395898_0180232_1131_1532 | 133 |
| 676 | 3300037466 | Ga0395898_0629625 | Ga0395898_0629625_382_783 | 133 |
| 677 | 3300037466 | Ga0395898_0720986 | Ga0395898_0720986_193_594 | 133 |
| 678 | 3300037471 | Ga0395905_0000187 | Ga0395905_0000187_64075_64503 | 133 |
| 679 | 3300037471 | Ga0395905_0004624 | Ga0395905_0004624_11278_11715 | 133 |
| 680 | 3300037471 | Ga0395905_0019955 | Ga0395905_0019955_5228_5629 | 133 |
| 681 | 3300037471 | Ga0395905_0078505 | Ga0395905_0078505_706_1107 | 133 |
| 682 | 3300037471 | Ga0395905_0084520 | Ga0395905_0084520_1699_2100 | 133 |
| 683 | 3300037471 | Ga0395905_0246156 | Ga0395905_0246156_1212_1613 | 133 |
| 684 | 3300037471 | Ga0395905_0340970 | Ga0395905_0340970_703_1104 | 133 |
| 685 | 3300037471 | Ga0395905_0377867 | Ga0395905_0377867_411_812 | 133 |
| 686 | 3300037471 | Ga0395905_0403715 | Ga0395905_0403715_515_934 | 133 |
| 687 | 3300037471 | Ga0395905_1006643 | Ga0395905_1006643_312_713 | 133 |
| 688 | 3300037471 | Ga0395905_1329505 | Ga0395905_1329505_37_438 | 133 |
| 689 | 3300037471 | Ga0395905_1769107 | Ga0395905_1769107_71_472 | 133 |
| 690 | 3300038443 | Ga0395901_0000324 | Ga0395901_0000324_16411_16812 | 133 |
| 691 | 3300038443 | Ga0395901_0032370 | Ga0395901_0032370_2357_2758 | 133 |
| 692 | 3300038443 | Ga0395901_0043378 | Ga0395901_0043378_3685_4086 | 133 |
| 693 | 3300038443 | Ga0395901_0056287 | Ga0395901_0056287_2816_3217 | 133 |
| 694 | 3300038443 | Ga0395901_0115251 | Ga0395901_0115251_428_829 | 133 |
| 695 | 3300038443 | Ga0395901_0378893 | Ga0395901_0378893_237_638 | 133 |
| 696 | 3300038443 | Ga0395901_0726547 | Ga0395901_0726547_34_435 | 133 |
| 697 | 3300038443 | Ga0395901_1274975 | Ga0395901_1274975_82_486 | 133 |
| 698 | 3300038443 | Ga0395901_1502295 | Ga0395901_1502295_159_560 | 133 |
| 699 | 3300044694 | Ga0466963_0004598 | Ga0466963_0004598_1692_2093 | 133 |
| 700 | 3300044694 | Ga0466963_0005117 | Ga0466963_0005117_2741_3142 | 133 |
| 701 | 3300044694 | Ga0466963_0039353 | Ga0466963_0039353_1487_1888 | 133 |
| 702 | 3300044694 | Ga0466963_0124686 | Ga0466963_0124686_956_1357 | 133 |
| 703 | 3300044694 | Ga0466963_0242665 | Ga0466963_0242665_190_591 | 133 |
| 704 | 3300044706 | Ga0466964_0022607 | Ga0466964_0022607_1031_1432 | 133 |
| 705 | 3300044719 | Ga0466971_0062393 | Ga0466971_0062393_639_1040 | 133 |
| 706 | 3300044719 | Ga0466971_0400063 | Ga0466971_0400063_237_638 | 133 |
| 707 | 3300044842 | Ga0466957_0009743 | Ga0466957_0009743_288_689 | 133 |
| 708 | 3300044842 | Ga0466957_0095693 | Ga0466957_0095693_410_811 | 133 |
| 709 | 3300044842 | Ga0466957_0143882 | Ga0466957_0143882_89_526 | 133 |
| 710 | 3300045836 | Ga0466958_0001186 | Ga0466958_0001186_6947_7348 | 133 |
| 711 | 3300045836 | Ga0466958_0013790 | Ga0466958_0013790_393_815 | 133 |
| 712 | 3300045836 | Ga0466958_0118416 | Ga0466958_0118416_248_685 | 133 |
| 713 | 3300045976 | Ga0466967_0014760 | Ga0466967_0014760_4011_4412 | 133 |
| 714 | 3300045976 | Ga0466967_0016917 | Ga0466967_0016917_3024_3425 | 133 |
| 715 | 3300045976 | Ga0466967_0041146 | Ga0466967_0041146_3055_3456 | 133 |
| 716 | 3300045976 | Ga0466967_0043652 | Ga0466967_0043652_16_417 | 133 |
| 717 | 3300045976 | Ga0466967_0075882 | Ga0466967_0075882_172_573 | 133 |
| 718 | 3300045976 | Ga0466967_0098890 | Ga0466967_0098890_258_659 | 133 |
| 719 | 3300045976 | Ga0466967_0117896 | Ga0466967_0117896_1154_1555 | 133 |
| 720 | 3300045976 | Ga0466967_1286798 | Ga0466967_1286798_54_455 | 133 |
| 721 | 3300046679 | Ga0495623_0155323 | Ga0495623_0155323_482_913 | 133 |
| 722 | 3300048905 | Ga0496102_0134653 | Ga0496102_0134653_1752_2153 | 133 |
| 723 | 3300048906 | Ga0496103_0421365 | Ga0496103_0421365_205_606 | 133 |
| 724 | 3300048909 | Ga0496106_0229494 | Ga0496106_0229494_912_1313 | 133 |
| 725 | 3300048910 | Ga0496107_0346012 | Ga0496107_0346012_231_632 | 133 |
| 726 | 3300048912 | Ga0496109_0432629 | Ga0496109_0432629_159_560 | 133 |
| 727 | 3300048913 | Ga0496110_0543461 | Ga0496110_0543461_614_1015 | 133 |
| 728 | 3300048915 | Ga0496112_0006261 | Ga0496112_0006261_4172_4573 | 133 |
| 729 | 3300049583 | Ga0501067_0031805 | Ga0501067_0031805_1967_2368 | 133 |
| 730 | 3300049586 | Ga0501070_0446862 | Ga0501070_0446862_126_527 | 133 |
| 731 | 3300049590 | Ga0501074_0187914 | Ga0501074_0187914_635_1036 | 133 |
| 732 | 3300049742 | Ga0501080_0094630 | Ga0501080_0094630_280_681 | 133 |
| 733 | 3300059508 | Ga0587088_093176 | Ga0587088_093176_212_613 | 133 |
| 734 | 3300059640 | Ga0587067_091100 | Ga0587067_091100_168_569 | 133 |
| 735 | 3300061719 | Ga0466962_0024643 | Ga0466962_0024643_964_1365 | 133 |
| 736 | 3300061734 | Ga0530510_0772873 | Ga0530510_0772873_191_592 | 133 |
| 737 | 2162886012 | MBSR1b_contig_5802081 | MBSR1b_0904.00000080 | 134 |
| 738 | 3300005293 | Ga0065715_10340560 | Ga0065715_103405601 | 134 |
| 739 | 3300032004 | Ga0307414_11188522 | Ga0307414_111885221 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v47-assembly1.cif.gz_A | crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps | 0.6371 | 33 | 93 |
| 7b8w-assembly1.cif.gz_A | structure of limk1 kinase domain with allosteric inhibitor th-470 | 0.6314 | 64 | 82 |
| 2gks-assembly1.cif.gz_B | crystal structure of the bi-functional atp sulfurylase-aps kinase from aquifex aeolicus, a chemolithotrophic thermophile | 0.6008 | 33 | 88 |
| 1wjx-assembly1.cif.gz_A | crystal sturucture of tt0801 from thermus thermophilus | 0.5956 | 62 | 93 |
| 5y6c-assembly2.cif.gz_B | crystal structure of zmasch s128a mutant protein from zymomonas mobilis | 0.5683 | 5 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X7G8_41_118_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.6915 | 32 | 84 | 2.40.50.140 |
| af_Q9VRJ1_539_644_2.40.30.130 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.6666 | 63 | 82 | 2.40.30.130 |
| af_A0A1D6KPV4_2_110_3.40.395.10 | Alpha Beta;3-Layer(aba) Sandwich;Adenoviral Proteinase; Chain;Adenoviral Proteinase; Chain A | 0.6649 | 111 | 132 | 3.40.395.10 |
| af_A0A2R8QQC0_103_236_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.657 | 29 | 82 | 2.40.10.10 |
| af_I6YC99_39_118_2.40.30.170 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain | 0.6329 | 32 | 84 | 2.40.30.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5APN5-F1-model_v4 | DUF1489 domain-containing protein | 0.9696 | 1 | 88 |
|
| AF-A0A2W5APN5-F1-model_v4 | DUF1489 domain-containing protein | 0.9588 | 1 | 88 |
|
| AF-A0A2R7IW93-F1-model_v4 | DUF1489 domain-containing protein | 0.9273 | 3 | 109 |
|
| AF-A0A6A4U4Y7-F1-model_v4 | DUF1489 domain-containing protein | 0.9265 | 1 | 108 |
|
| AF-A0A520HM13-F1-model_v4 | DUF1489 family protein | 0.922 | 4 | 109 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar