F478443

General Info

Members Datasets Scaffolds Average Seq Length
739 224 739 133

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100468768|Ga0070714_1004687682
Length 146
Sequence VLDFALLERNSDDVPKLHLTKVAFACRDVDSLTQRIANRAFGGEVRVATRMRPKRSAELIGGNLYWIVKHRLVAGLEILRFEDREDGRLDIVCSAELVVVSPRPRRAHQGWRYLEEADAPSAGDDGTGLGALPPILYGKLASLALV

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.84
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5802081 2162886012 Unclassified 1259
2 JGI24752J21851_1042724 3300001976 Unclassified 609
3 JGI24740J21852_10001279 3300001979 Bacteria 11425
4 JGI24740J21852_10124572 3300001979 Bacteria 644
5 JGI24739J22299_10000632 3300001989 Bacteria 12645
6 JGI24739J22299_10008617 3300001989 Bacteria 3805
7 JGI24737J22298_10000103 3300001990 Bacteria 25390
8 JGI24737J22298_10017157 3300001990 Bacteria 2334
9 JGI24735J21928_10019965 3300002067 Bacteria 2056
10 JGI24738J21930_10000018 3300002075 Bacteria 30549
11 JGI24738J21930_10008304 3300002075 Bacteria 2364
12 Ga0065712_10040760 3300005290 Bacteria 1206
13 Ga0065715_10340560 3300005293 Bacteria 963
14 Ga0065715_10584272 3300005293 Bacteria 718
15 Ga0070658_10000107 3300005327 Bacteria 73895
16 Ga0070658_10009613 3300005327 Bacteria 7761
17 Ga0070658_10019253 3300005327 Bacteria 5468
18 Ga0070658_10019568 3300005327 Bacteria 5420
19 Ga0070658_10033380 3300005327 Bacteria 4140
20 Ga0070658_10060655 3300005327 Bacteria 3081
21 Ga0070658_10076497 3300005327 Bacteria 2745
22 Ga0070658_10398910 3300005327 Bacteria 1181
23 Ga0070658_11268895 3300005327 Unclassified 640
24 Ga0070676_10002531 3300005328 Bacteria 9389
25 Ga0070676_10027239 3300005328 Bacteria 3240
26 Ga0070676_10036742 3300005328 Bacteria 2823
27 Ga0070676_10908951 3300005328 Bacteria 656
28 Ga0070683_100001635 3300005329 Bacteria 17347
29 Ga0070683_100006411 3300005329 Bacteria 9866
30 Ga0070683_100028335 3300005329 Bacteria 5061
31 Ga0070683_100062139 3300005329 Bacteria 3472
32 Ga0070683_100062612 3300005329 Bacteria 3459
33 Ga0070683_100131879 3300005329 Bacteria 2365
34 Ga0070683_100301837 3300005329 Bacteria 1523
35 Ga0070683_100514835 3300005329 Bacteria 1143
36 Ga0070683_100870353 3300005329 Unclassified 864
37 Ga0070690_100026541 3300005330 Bacteria 3574
38 Ga0070690_100902800 3300005330 Bacteria 691
39 Ga0070670_100014652 3300005331 Bacteria 6731
40 Ga0070670_100266583 3300005331 Bacteria 1494
41 Ga0070670_101822775 3300005331 Bacteria 560
42 Ga0070677_10405993 3300005333 Unclassified 719
43 Ga0068869_100003378 3300005334 Bacteria 9741
44 Ga0068869_100667997 3300005334 Bacteria 883
45 Ga0070666_10001184 3300005335 Bacteria 15784
46 Ga0070666_10713713 3300005335 Unclassified 736
47 Ga0070680_100000477 3300005336 Bacteria 27458
48 Ga0070680_100002652 3300005336 Bacteria 13265
49 Ga0070680_100004694 3300005336 Bacteria 10278
50 Ga0070680_100006732 3300005336 Bacteria 8753
51 Ga0070680_100008676 3300005336 Bacteria 7792
52 Ga0070680_100048693 3300005336 Bacteria 3454
53 Ga0070680_100132389 3300005336 Bacteria 2087
54 Ga0070680_100589438 3300005336 Bacteria 954
55 Ga0070680_100711197 3300005336 Bacteria 864
56 Ga0070682_100006724 3300005337 Bacteria 6449
57 Ga0070682_100192650 3300005337 Bacteria 1432
58 Ga0070682_100382896 3300005337 Bacteria 1058
59 Ga0068868_100000972 3300005338 Bacteria 19505
60 Ga0068868_100343657 3300005338 Bacteria 1276
61 Ga0070660_100000861 3300005339 Bacteria 20243
62 Ga0070660_100003065 3300005339 Bacteria 11487
63 Ga0070660_100003086 3300005339 Bacteria 11449
64 Ga0070660_100011318 3300005339 Bacteria 6332
65 Ga0070660_100025166 3300005339 Bacteria 4422
66 Ga0070660_100033421 3300005339 Bacteria 3877
67 Ga0070660_100034397 3300005339 Bacteria 3828
68 Ga0070660_100034860 3300005339 Bacteria 3806
69 Ga0070660_100748122 3300005339 Bacteria 821
70 Ga0070660_100786605 3300005339 Bacteria 800
71 Ga0070689_100017523 3300005340 Bacteria 5263
72 Ga0070691_10256308 3300005341 Bacteria 940
73 Ga0070687_100037451 3300005343 Bacteria 2425
74 Ga0070661_100000101 3300005344 Bacteria 70279
75 Ga0070661_100004927 3300005344 Bacteria 9192
76 Ga0070661_100005038 3300005344 Bacteria 9110
77 Ga0070661_100055931 3300005344 Bacteria 2889
78 Ga0070661_100131409 3300005344 Bacteria 1881
79 Ga0070661_100187165 3300005344 Bacteria 1578
80 Ga0070661_100232893 3300005344 Bacteria 1416
81 Ga0070661_100612791 3300005344 Bacteria 881
82 Ga0070692_10003217 3300005345 Bacteria 6575
83 Ga0070692_10016353 3300005345 Bacteria 3528
84 Ga0070692_10082450 3300005345 Bacteria 1734
85 Ga0070692_10083589 3300005345 Bacteria 1724
86 Ga0070692_10130734 3300005345 Bacteria 1411
87 Ga0070668_100008284 3300005347 Bacteria 7716
88 Ga0070668_100038015 3300005347 Bacteria 3677
89 Ga0070668_101253443 3300005347 Bacteria 673
90 Ga0070669_100000613 3300005353 Bacteria 26394
91 Ga0070669_100016981 3300005353 Bacteria 5197
92 Ga0070669_100084035 3300005353 Bacteria 2374
93 Ga0070669_100653472 3300005353 Bacteria 885
94 Ga0070669_101138821 3300005353 Unclassified 673
95 Ga0070675_100073493 3300005354 Bacteria 2839
96 Ga0070675_100360257 3300005354 Bacteria 1291
97 Ga0070671_100000533 3300005355 Bacteria 26740
98 Ga0070671_100014143 3300005355 Bacteria 6445
99 Ga0070671_100030078 3300005355 Bacteria 4482
100 Ga0070671_101046362 3300005355 Unclassified 716
101 Ga0070674_101294478 3300005356 Bacteria 650
102 Ga0070673_100003805 3300005364 Bacteria 9466
103 Ga0070673_100057067 3300005364 Bacteria 3084
104 Ga0070673_100308646 3300005364 Bacteria 1395
105 Ga0070659_100000045 3300005366 Bacteria 101520
106 Ga0070659_100016514 3300005366 Bacteria 5542
107 Ga0070659_100057730 3300005366 Bacteria 3061
108 Ga0070659_100059707 3300005366 Bacteria 3011
109 Ga0070659_100154086 3300005366 Bacteria 1876
110 Ga0070659_100202596 3300005366 Bacteria 1634
111 Ga0070659_100219296 3300005366 Bacteria 1569
112 Ga0070659_100259405 3300005366 Bacteria 1442
113 Ga0070659_100702014 3300005366 Unclassified 875
114 Ga0070659_100989752 3300005366 Bacteria 738
115 Ga0070659_101062650 3300005366 Bacteria 712
116 Ga0070667_100001174 3300005367 Bacteria 23830
117 Ga0070667_100079689 3300005367 Bacteria 2800
118 Ga0070667_100413617 3300005367 Bacteria 1229
119 Ga0070667_100601984 3300005367 Bacteria 1013
120 Ga0070714_100172953 3300005435 Bacteria 1961
121 Ga0070714_100468768 3300005435 Bacteria 1198
122 Ga0070714_101059704 3300005435 Bacteria 790
123 Ga0070713_101767878 3300005436 Unclassified 600
124 Ga0070694_100005710 3300005444 Bacteria 7546
125 Ga0070694_101381431 3300005444 Unclassified 594
126 Ga0070663_100000549 3300005455 Bacteria 19942
127 Ga0070663_100047213 3300005455 Bacteria 3050
128 Ga0070663_100180609 3300005455 Bacteria 1637
129 Ga0070663_100322178 3300005455 Bacteria 1243
130 Ga0070663_100456936 3300005455 Bacteria 1054
131 Ga0070662_100000036 3300005457 Bacteria 77190
132 Ga0070662_100015155 3300005457 Bacteria 5158
133 Ga0070662_100026980 3300005457 Bacteria 3982
134 Ga0070662_100068699 3300005457 Bacteria 2606
135 Ga0070662_100283452 3300005457 Bacteria 1341
136 Ga0070662_101925569 3300005457 Unclassified 511
137 Ga0070681_10004074 3300005458 Bacteria 13800
138 Ga0070681_10023867 3300005458 Bacteria 6157
139 Ga0070681_10081032 3300005458 Bacteria 3201
140 Ga0070681_10165930 3300005458 Bacteria 2131
141 Ga0070681_10338619 3300005458 Bacteria 1414
142 Ga0070681_10705275 3300005458 Bacteria 925
143 Ga0070681_11014010 3300005458 Bacteria 750
144 Ga0070681_11538171 3300005458 Bacteria 590
145 Ga0068867_100001501 3300005459 Bacteria 16154
146 Ga0068867_101293752 3300005459 Bacteria 673
147 Ga0070685_10016844 3300005466 Bacteria 3901
148 Ga0070679_100066466 3300005530 Bacteria 3594
149 Ga0070679_100106227 3300005530 Bacteria 2793
150 Ga0070679_100181881 3300005530 Bacteria 2074
151 Ga0070679_100189064 3300005530 Bacteria 2029
152 Ga0070679_100472562 3300005530 Bacteria 1198
153 Ga0070684_100027913 3300005535 Bacteria 4769
154 Ga0070684_100305960 3300005535 Bacteria 1459
155 Ga0070684_100347638 3300005535 Bacteria 1364
156 Ga0070684_100510099 3300005535 Bacteria 1114
157 Ga0068853_100000059 3300005539 Bacteria 78301
158 Ga0068853_100000570 3300005539 Bacteria 25231
159 Ga0068853_100032863 3300005539 Bacteria 4398
160 Ga0068853_100089942 3300005539 Bacteria 2697
161 Ga0068853_100447637 3300005539 Bacteria 1214
162 Ga0068853_100638202 3300005539 Bacteria 1013
163 Ga0070672_100000866 3300005543 Bacteria 18097
164 Ga0070672_100120352 3300005543 Bacteria 2148
165 Ga0070686_100772757 3300005544 Unclassified 772
166 Ga0070696_100042737 3300005546 Bacteria 3133
167 Ga0070693_100000361 3300005547 Bacteria 20637
168 Ga0070693_100092887 3300005547 Bacteria 1823
169 Ga0070665_100004200 3300005548 Bacteria 15157
170 Ga0070665_100062768 3300005548 Bacteria 3725
171 Ga0070665_100795186 3300005548 Bacteria 959
172 Ga0068855_100003767 3300005563 Bacteria 18537
173 Ga0068855_100010268 3300005563 Bacteria 11292
174 Ga0068855_100021027 3300005563 Bacteria 7824
175 Ga0068855_100058235 3300005563 Bacteria 4526
176 Ga0068855_100210192 3300005563 Bacteria 2187
177 Ga0068855_100988817 3300005563 Bacteria 884
178 Ga0070664_100000027 3300005564 Bacteria 90881
179 Ga0070664_100007309 3300005564 Bacteria 8904
180 Ga0070664_100014989 3300005564 Bacteria 6326
181 Ga0070664_100184030 3300005564 Bacteria 1858
182 Ga0070664_100191805 3300005564 Bacteria 1821
183 Ga0070664_100379554 3300005564 Bacteria 1290
184 Ga0070664_101123983 3300005564 Bacteria 740
185 Ga0068857_100006503 3300005577 Bacteria 10025
186 Ga0068857_100027425 3300005577 Bacteria 5024
187 Ga0068857_100031864 3300005577 Bacteria 4658
188 Ga0068857_100158885 3300005577 Bacteria 2050
189 Ga0068857_100209968 3300005577 Bacteria 1776
190 Ga0068857_101898123 3300005577 Bacteria 583
191 Ga0068854_100014971 3300005578 Bacteria 5125
192 Ga0068854_100031718 3300005578 Bacteria 3673
193 Ga0068854_100049234 3300005578 Bacteria 3009
194 Ga0068854_100064635 3300005578 Bacteria 2659
195 Ga0068854_100077907 3300005578 Bacteria 2440
196 Ga0068854_100173258 3300005578 Bacteria 1680
197 Ga0068854_100189781 3300005578 Bacteria 1610
198 Ga0068854_100248935 3300005578 Bacteria 1418
199 Ga0068856_100000705 3300005614 Bacteria 36291
200 Ga0068856_100112245 3300005614 Bacteria 2723
201 Ga0068856_100177026 3300005614 Bacteria 2146
202 Ga0068856_100844405 3300005614 Unclassified 935
203 Ga0068856_100961209 3300005614 Bacteria 873
204 Ga0068856_101446059 3300005614 Bacteria 702
205 Ga0068856_102281372 3300005614 Bacteria 549
206 Ga0068856_102461425 3300005614 Bacteria 527
207 Ga0068852_100000433 3300005616 Bacteria 27783
208 Ga0068852_100002112 3300005616 Bacteria 13601
209 Ga0068852_100004730 3300005616 Bacteria 9661
210 Ga0068852_100005166 3300005616 Bacteria 9308
211 Ga0068852_100009994 3300005616 Bacteria 7060
212 Ga0068852_100012833 3300005616 Bacteria 6385
213 Ga0068852_100021917 3300005616 Bacteria 5112
214 Ga0068852_100028840 3300005616 Bacteria 4548
215 Ga0068852_100038267 3300005616 Bacteria 4030
216 Ga0068852_100199101 3300005616 Bacteria 1895
217 Ga0068852_100293902 3300005616 Bacteria 1570
218 Ga0068852_100449243 3300005616 Bacteria 1276
219 Ga0068852_101047860 3300005616 Bacteria 835
220 Ga0068859_100001592 3300005617 Bacteria 23154
221 Ga0068859_100004210 3300005617 Bacteria 14679
222 Ga0068859_100186961 3300005617 Bacteria 2155
223 Ga0068859_100505209 3300005617 Bacteria 1304
224 Ga0068864_100000247 3300005618 Bacteria 48323
225 Ga0068864_100008545 3300005618 Bacteria 8451
226 Ga0068864_100018914 3300005618 Bacteria 5760
227 Ga0068864_100081590 3300005618 Bacteria 2835
228 Ga0068866_10126483 3300005718 Bacteria 1447
229 Ga0068866_10525938 3300005718 Bacteria 787
230 Ga0068861_100180793 3300005719 Bacteria 1755
231 Ga0068861_100355085 3300005719 Bacteria 1287
232 Ga0068851_10020047 3300005834 Bacteria 3234
233 Ga0068851_10062018 3300005834 Bacteria 1917
234 Ga0068870_10010268 3300005840 Bacteria 4294
235 Ga0068870_10988314 3300005840 Bacteria 599
236 Ga0068863_100001653 3300005841 Bacteria 22048
237 Ga0068863_100069143 3300005841 Bacteria 3339
238 Ga0068863_100234963 3300005841 Bacteria 1769
239 Ga0068858_100006759 3300005842 Bacteria 11161
240 Ga0068858_100017221 3300005842 Bacteria 6781
241 Ga0068858_100022399 3300005842 Bacteria 5897
242 Ga0068860_100021537 3300005843 Bacteria 6241
243 Ga0068860_100027958 3300005843 Bacteria 5430
244 Ga0068860_101165869 3300005843 Bacteria 790
245 Ga0068862_100006024 3300005844 Bacteria 10096
246 Ga0068862_100254750 3300005844 Bacteria 1600
247 Ga0068862_101192545 3300005844 Bacteria 759
248 Ga0097621_100026649 3300006237 Bacteria 4537
249 Ga0097621_100219024 3300006237 Bacteria 1658
250 Ga0097621_101420964 3300006237 Unclassified 657
251 Ga0068871_100070496 3300006358 Bacteria 2873
252 Ga0097620_100001592 3300006931 Bacteria 23154
253 Ga0097620_100004210 3300006931 Bacteria 14679
254 Ga0097620_100186953 3300006931 Bacteria 2155
255 Ga0097620_100505223 3300006931 Bacteria 1304
256 Ga0105240_10027015 3300009093 Bacteria 7524
257 Ga0105240_10126852 3300009093 Bacteria 3065
258 Ga0105240_10379048 3300009093 Bacteria 1598
259 Ga0105245_10000128 3300009098 Bacteria 72249
260 Ga0105245_10276026 3300009098 Bacteria 1641
261 Ga0114129_10896631 3300009147 Bacteria 1124
262 Ga0105243_10064347 3300009148 Bacteria 2943
263 Ga0105243_10105180 3300009148 Bacteria 2351
264 Ga0105243_10759863 3300009148 Bacteria 951
265 Ga0105243_10817439 3300009148 Bacteria 920
266 Ga0105241_10032667 3300009174 Bacteria 3903
267 Ga0105241_10057413 3300009174 Bacteria 2986
268 Ga0105241_10108525 3300009174 Bacteria 2219
269 Ga0105241_10211699 3300009174 Unclassified 1624
270 Ga0105242_10912682 3300009176 Bacteria 879
271 Ga0105248_10001451 3300009177 Bacteria 26388
272 Ga0105248_10005525 3300009177 Bacteria 13885
273 Ga0105248_10018193 3300009177 Bacteria 7761
274 Ga0105248_11168005 3300009177 Bacteria 870
275 Ga0105237_10010769 3300009545 Bacteria 9706
276 Ga0105238_10014228 3300009551 Bacteria 8046
277 Ga0105238_10033353 3300009551 Bacteria 5241
278 Ga0105238_10122248 3300009551 Bacteria 2583
279 Ga0105238_10143149 3300009551 Bacteria 2367
280 Ga0105249_10031339 3300009553 Bacteria 4809
281 Ga0105249_10065744 3300009553 Bacteria 3337
282 Ga0105249_11185354 3300009553 Bacteria 835
283 Ga0105239_10118334 3300010375 Bacteria 2940
284 Ga0105239_10218160 3300010375 Bacteria 2139
285 Ga0105239_10263900 3300010375 Bacteria 1936
286 Ga0105246_10007663 3300011119 Bacteria 6626
287 Ga0105246_10011642 3300011119 Bacteria 5463
288 Ga0105246_11300917 3300011119 Bacteria 674
289 Ga0157373_10001921 3300013100 Bacteria 15792
290 Ga0157373_10011033 3300013100 Bacteria 6655
291 Ga0157373_10017730 3300013100 Bacteria 5183
292 Ga0157373_10026865 3300013100 Bacteria 4155
293 Ga0157373_10043735 3300013100 Bacteria 3199
294 Ga0157373_10056049 3300013100 Bacteria 2799
295 Ga0157373_10060140 3300013100 Bacteria 2692
296 Ga0157373_10069117 3300013100 Bacteria 2497
297 Ga0157373_10072216 3300013100 Bacteria 2436
298 Ga0157373_10229162 3300013100 Bacteria 1312
299 Ga0157373_10258216 3300013100 Bacteria 1233
300 Ga0157373_10306653 3300013100 Bacteria 1128
301 Ga0157373_10328756 3300013100 Bacteria 1088
302 Ga0157373_10384756 3300013100 Bacteria 1004
303 Ga0157373_10906988 3300013100 Bacteria 654
304 Ga0157371_10001392 3300013102 Bacteria 25245
305 Ga0157371_10002958 3300013102 Bacteria 15800
306 Ga0157371_10014993 3300013102 Bacteria 5828
307 Ga0157371_10055697 3300013102 Bacteria 2806
308 Ga0157371_10058590 3300013102 Bacteria 2731
309 Ga0157371_10070710 3300013102 Bacteria 2471
310 Ga0157371_10112985 3300013102 Bacteria 1928
311 Ga0157371_10140542 3300013102 Bacteria 1720
312 Ga0157371_10140622 3300013102 Bacteria 1719
313 Ga0157371_10255184 3300013102 Unclassified 1263
314 Ga0157371_10308430 3300013102 Bacteria 1147
315 Ga0157371_10416876 3300013102 Unclassified 984
316 Ga0157371_10483958 3300013102 Bacteria 912
317 Ga0157370_10000686 3300013104 Bacteria 42199
318 Ga0157370_10011108 3300013104 Bacteria 9441
319 Ga0157370_10047926 3300013104 Bacteria 4094
320 Ga0157370_10060505 3300013104 Bacteria 3596
321 Ga0157370_10093074 3300013104 Bacteria 2829
322 Ga0157370_10141565 3300013104 Bacteria 2241
323 Ga0157370_10212917 3300013104 Bacteria 1791
324 Ga0157370_10286151 3300013104 Bacteria 1523
325 Ga0157370_11887769 3300013104 Unclassified 536
326 Ga0157369_10008678 3300013105 Bacteria 11651
327 Ga0157369_10039739 3300013105 Bacteria 5140
328 Ga0157369_10059618 3300013105 Bacteria 4115
329 Ga0157369_10069335 3300013105 Bacteria 3788
330 Ga0157369_10115743 3300013105 Bacteria 2847
331 Ga0157369_10309826 3300013105 Bacteria 1642
332 Ga0157369_10556221 3300013105 Bacteria 1186
333 Ga0157369_10612319 3300013105 Bacteria 1124
334 Ga0157369_12011390 3300013105 Unclassified 586
335 Ga0157369_12247206 3300013105 Bacteria 553
336 Ga0157374_10031240 3300013296 Bacteria 4840
337 Ga0157378_10000396 3300013297 Bacteria 42907
338 Ga0163162_10068534 3300013306 Bacteria 3600
339 Ga0163162_10264490 3300013306 Bacteria 1851
340 Ga0163162_10471362 3300013306 Bacteria 1387
341 Ga0157372_10038042 3300013307 Bacteria 5309
342 Ga0157372_10070283 3300013307 Bacteria 3938
343 Ga0157372_10097641 3300013307 Bacteria 3350
344 Ga0157372_10459311 3300013307 Bacteria 1484
345 Ga0157372_11243324 3300013307 Bacteria 860
346 Ga0157372_11540970 3300013307 Bacteria 765
347 Ga0157375_10591103 3300013308 Bacteria 1270
348 Ga0157375_10644106 3300013308 Bacteria 1216
349 Ga0163163_10000187 3300014325 Bacteria 63661
350 Ga0157380_11723141 3300014326 Bacteria 684
351 Ga0157377_11115750 3300014745 Bacteria 605
352 Ga0157379_10182906 3300014968 Bacteria 1893
353 Ga0157379_10681921 3300014968 Bacteria 964
354 Ga0197907_10087473 3300020069 Bacteria 2393
355 Ga0206356_11579705 3300020070 Bacteria 558
356 Ga0206354_10755474 3300020081 Unclassified 646
357 Ga0206354_11422423 3300020081 Bacteria 958
358 Ga0206353_10818459 3300020082 Bacteria 3127
359 Ga0206353_11188791 3300020082 Unclassified 817
360 Ga0207697_10000059 3300025315 Bacteria 45306
361 Ga0207656_10040854 3300025321 Bacteria 1968
362 Ga0207656_10357895 3300025321 Bacteria 729
363 Ga0207682_10197253 3300025893 Bacteria 924
364 Ga0207642_10117116 3300025899 Bacteria 1367
365 Ga0207688_10000721 3300025901 Bacteria 16387
366 Ga0207680_10004748 3300025903 Bacteria 6467
367 Ga0207680_10138471 3300025903 Bacteria 1611
368 Ga0207647_10000968 3300025904 Bacteria 22267
369 Ga0207647_10001381 3300025904 Bacteria 18648
370 Ga0207647_10014849 3300025904 Bacteria 5356
371 Ga0207647_10051788 3300025904 Archaea 2536
372 Ga0207645_10002144 3300025907 Bacteria 15772
373 Ga0207645_10016875 3300025907 Bacteria 4824
374 Ga0207645_10078345 3300025907 Bacteria 2118
375 Ga0207643_10258584 3300025908 Bacteria 1074
376 Ga0207705_10000086 3300025909 Bacteria 116132
377 Ga0207705_10004131 3300025909 Bacteria 11008
378 Ga0207705_10012975 3300025909 Bacteria 6014
379 Ga0207705_10018733 3300025909 Bacteria 4953
380 Ga0207705_10019330 3300025909 Bacteria 4871
381 Ga0207705_10023122 3300025909 Bacteria 4433
382 Ga0207705_10102751 3300025909 Bacteria 2104
383 Ga0207705_10374960 3300025909 Bacteria 1099
384 Ga0207705_10804549 3300025909 Bacteria 729
385 Ga0207654_10096895 3300025911 Bacteria 1810
386 Ga0207654_10116145 3300025911 Unclassified 1673
387 Ga0207654_10238303 3300025911 Bacteria 1215
388 Ga0207654_10325720 3300025911 Bacteria 1051
389 Ga0207707_10086364 3300025912 Bacteria 2742
390 Ga0207707_10096969 3300025912 Bacteria 2576
391 Ga0207707_10238320 3300025912 Bacteria 1582
392 Ga0207707_11096466 3300025912 Bacteria 649
393 Ga0207695_10019721 3300025913 Bacteria 7753
394 Ga0207695_10057499 3300025913 Bacteria 4040
395 Ga0207671_10068265 3300025914 Bacteria 2648
396 Ga0207671_11104349 3300025914 Bacteria 623
397 Ga0207660_10000711 3300025917 Bacteria 22172
398 Ga0207660_10002701 3300025917 Bacteria 11629
399 Ga0207660_10005238 3300025917 Bacteria 8424
400 Ga0207660_10156919 3300025917 Bacteria 1752
401 Ga0207660_10159858 3300025917 Bacteria 1737
402 Ga0207660_10367846 3300025917 Bacteria 1154
403 Ga0207660_10509129 3300025917 Bacteria 977
404 Ga0207657_10000133 3300025919 Bacteria 75282
405 Ga0207657_10000267 3300025919 Bacteria 55426
406 Ga0207657_10005242 3300025919 Bacteria 13581
407 Ga0207657_10005850 3300025919 Bacteria 12810
408 Ga0207657_10008846 3300025919 Bacteria 10185
409 Ga0207657_10054657 3300025919 Bacteria 3452
410 Ga0207657_10092503 3300025919 Bacteria 2520
411 Ga0207657_10124942 3300025919 Bacteria 2114
412 Ga0207657_10294401 3300025919 Bacteria 1287
413 Ga0207649_10000378 3300025920 Bacteria 33311
414 Ga0207649_10031381 3300025920 Bacteria 3157
415 Ga0207649_10191138 3300025920 Bacteria 1440
416 Ga0207649_10252189 3300025920 Bacteria 1271
417 Ga0207649_10352801 3300025920 Bacteria 1089
418 Ga0207649_10442940 3300025920 Bacteria 979
419 Ga0207649_10465146 3300025920 Unclassified 957
420 Ga0207649_10487309 3300025920 Bacteria 936
421 Ga0207649_10523691 3300025920 Bacteria 904
422 Ga0207652_10041849 3300025921 Bacteria 3897
423 Ga0207652_10066873 3300025921 Bacteria 3115
424 Ga0207652_10723332 3300025921 Bacteria 887
425 Ga0207652_10760263 3300025921 Bacteria 862
426 Ga0207652_10788659 3300025921 Unclassified 844
427 Ga0207681_10012674 3300025923 Bacteria 5205
428 Ga0207681_10042342 3300025923 Bacteria 3042
429 Ga0207694_10001964 3300025924 Bacteria 17016
430 Ga0207694_10061732 3300025924 Bacteria 2917
431 Ga0207694_10137561 3300025924 Bacteria 1963
432 Ga0207694_10165810 3300025924 Bacteria 1787
433 Ga0207650_10010511 3300025925 Bacteria 6348
434 Ga0207650_10207863 3300025925 Bacteria 1571
435 Ga0207659_10051002 3300025926 Bacteria 2941
436 Ga0207687_10000688 3300025927 Bacteria 22793
437 Ga0207687_10147036 3300025927 Bacteria 1794
438 Ga0207664_10442792 3300025929 Bacteria 1159
439 Ga0207664_10509144 3300025929 Bacteria 1078
440 Ga0207644_10015617 3300025931 Bacteria 5100
441 Ga0207644_10079499 3300025931 Bacteria 2419
442 Ga0207644_10089244 3300025931 Bacteria 2294
443 Ga0207690_10000080 3300025932 Bacteria 82082
444 Ga0207690_10001597 3300025932 Bacteria 14142
445 Ga0207690_10004642 3300025932 Bacteria 8126
446 Ga0207690_10007944 3300025932 Bacteria 6299
447 Ga0207690_10045680 3300025932 Bacteria 2895
448 Ga0207690_10095329 3300025932 Bacteria 2113
449 Ga0207690_10193393 3300025932 Bacteria 1540
450 Ga0207690_10207875 3300025932 Bacteria 1491
451 Ga0207690_10340231 3300025932 Bacteria 1184
452 Ga0207690_10805864 3300025932 Bacteria 776
453 Ga0207706_10000159 3300025933 Bacteria 75284
454 Ga0207706_10000426 3300025933 Bacteria 45291
455 Ga0207706_10001767 3300025933 Bacteria 21221
456 Ga0207706_10003045 3300025933 Bacteria 16158
457 Ga0207706_10040717 3300025933 Bacteria 4119
458 Ga0207706_10051732 3300025933 Bacteria 3627
459 Ga0207686_10539801 3300025934 Bacteria 910
460 Ga0207709_10193898 3300025935 Bacteria 1445
461 Ga0207709_10336057 3300025935 Bacteria 1135
462 Ga0207670_11292471 3300025936 Bacteria 618
463 Ga0207669_10005541 3300025937 Bacteria 5675
464 Ga0207669_11768220 3300025937 Bacteria 528
465 Ga0207691_10013333 3300025940 Bacteria 7872
466 Ga0207691_10113343 3300025940 Bacteria 2409
467 Ga0207711_10000744 3300025941 Bacteria 31965
468 Ga0207711_10002355 3300025941 Bacteria 16937
469 Ga0207711_10003526 3300025941 Bacteria 13544
470 Ga0207711_10562316 3300025941 Bacteria 1064
471 Ga0207689_10000128 3300025942 Bacteria 64122
472 Ga0207689_10050102 3300025942 Bacteria 3444
473 Ga0207689_10070985 3300025942 Bacteria 2861
474 Ga0207661_10001549 3300025944 Bacteria 15638
475 Ga0207661_10036102 3300025944 Bacteria 3856
476 Ga0207661_10058294 3300025944 Bacteria 3107
477 Ga0207661_10088312 3300025944 Bacteria 2577
478 Ga0207661_10094886 3300025944 Bacteria 2493
479 Ga0207661_10458338 3300025944 Bacteria 1162
480 Ga0207661_10908919 3300025944 Bacteria 811
481 Ga0207679_10000155 3300025945 Bacteria 56504
482 Ga0207679_10021030 3300025945 Bacteria 4414
483 Ga0207679_10023302 3300025945 Bacteria 4231
484 Ga0207679_10212489 3300025945 Unclassified 1623
485 Ga0207679_10431160 3300025945 Bacteria 1165
486 Ga0207679_10979224 3300025945 Bacteria 775
487 Ga0207667_10017533 3300025949 Bacteria 8054
488 Ga0207667_10018898 3300025949 Bacteria 7709
489 Ga0207667_10037566 3300025949 Bacteria 5176
490 Ga0207667_10042322 3300025949 Bacteria 4842
491 Ga0207667_10053023 3300025949 Bacteria 4268
492 Ga0207667_10055114 3300025949 Bacteria 4180
493 Ga0207667_10118071 3300025949 Bacteria 2734
494 Ga0207667_10153295 3300025949 Bacteria 2371
495 Ga0207667_12109732 3300025949 Bacteria 522
496 Ga0207651_10001297 3300025960 Bacteria 11254
497 Ga0207651_10669219 3300025960 Bacteria 912
498 Ga0207651_11023569 3300025960 Bacteria 739
499 Ga0207712_10934758 3300025961 Bacteria 768
500 Ga0207668_10270781 3300025972 Bacteria 1388
501 Ga0207668_10547427 3300025972 Bacteria 1002
502 Ga0207668_10718534 3300025972 Bacteria 879
503 Ga0207640_10005165 3300025981 Bacteria 7099
504 Ga0207640_10037349 3300025981 Bacteria 3055
505 Ga0207640_10063004 3300025981 Bacteria 2462
506 Ga0207640_10067160 3300025981 Bacteria 2398
507 Ga0207640_10177192 3300025981 Bacteria 1595
508 Ga0207640_10314352 3300025981 Bacteria 1244
509 Ga0207640_10337021 3300025981 Bacteria 1207
510 Ga0207658_10012354 3300025986 Bacteria 5830
511 Ga0207658_10054963 3300025986 Bacteria 2948
512 Ga0207658_10218426 3300025986 Bacteria 1602
513 Ga0207677_10006405 3300026023 Bacteria 6455
514 Ga0207677_10635950 3300026023 Bacteria 940
515 Ga0207703_10003199 3300026035 Bacteria 13789
516 Ga0207703_10030128 3300026035 Bacteria 4286
517 Ga0207703_10030986 3300026035 Bacteria 4228
518 Ga0207639_10000137 3300026041 Bacteria 54378
519 Ga0207639_10001284 3300026041 Bacteria 16946
520 Ga0207639_10004961 3300026041 Bacteria 8966
521 Ga0207639_10048237 3300026041 Bacteria 3222
522 Ga0207639_10112034 3300026041 Bacteria 2226
523 Ga0207639_10653102 3300026041 Bacteria 973
524 Ga0207639_10722671 3300026041 Bacteria 925
525 Ga0207678_10000973 3300026067 Bacteria 26103
526 Ga0207678_10002271 3300026067 Bacteria 17395
527 Ga0207678_10004199 3300026067 Bacteria 12929
528 Ga0207678_10084825 3300026067 Bacteria 2709
529 Ga0207678_10155934 3300026067 Bacteria 1949
530 Ga0207678_10375665 3300026067 Bacteria 1228
531 Ga0207678_10543744 3300026067 Bacteria 1015
532 Ga0207702_10000246 3300026078 Bacteria 63201
533 Ga0207702_10196423 3300026078 Bacteria 1868
534 Ga0207702_10386791 3300026078 Bacteria 1346
535 Ga0207702_10552615 3300026078 Bacteria 1126
536 Ga0207702_10580725 3300026078 Bacteria 1098
537 Ga0207702_10874550 3300026078 Bacteria 890
538 Ga0207702_11263430 3300026078 Bacteria 732
539 Ga0207702_11419196 3300026078 Unclassified 688
540 Ga0207702_11755914 3300026078 Bacteria 613
541 Ga0207641_10001758 3300026088 Bacteria 20880
542 Ga0207641_10061282 3300026088 Bacteria 3208
543 Ga0207641_10063990 3300026088 Bacteria 3143
544 Ga0207648_10003309 3300026089 Bacteria 16928
545 Ga0207648_10239230 3300026089 Bacteria 1616
546 Ga0207676_10000220 3300026095 Bacteria 49329
547 Ga0207676_10005619 3300026095 Bacteria 8874
548 Ga0207676_10009270 3300026095 Bacteria 7002
549 Ga0207676_10015190 3300026095 Bacteria 5554
550 Ga0207674_10000827 3300026116 Bacteria 40278
551 Ga0207674_10004899 3300026116 Bacteria 16018
552 Ga0207674_10012242 3300026116 Bacteria 9595
553 Ga0207674_10017536 3300026116 Bacteria 7811
554 Ga0207675_100055033 3300026118 Bacteria 3712
555 Ga0207675_100437483 3300026118 Bacteria 1294
556 Ga0207683_11250536 3300026121 Bacteria 688
557 Ga0207698_10000421 3300026142 Bacteria 24394
558 Ga0207698_10001565 3300026142 Bacteria 13341
559 Ga0207698_10001619 3300026142 Bacteria 13098
560 Ga0207698_10006275 3300026142 Bacteria 7398
561 Ga0207698_10008966 3300026142 Bacteria 6348
562 Ga0207698_10013342 3300026142 Bacteria 5417
563 Ga0207698_10059370 3300026142 Bacteria 2970
564 Ga0207698_10067580 3300026142 Bacteria 2819
565 Ga0207698_10072205 3300026142 Bacteria 2743
566 Ga0207698_10083651 3300026142 Bacteria 2583
567 Ga0207698_10148606 3300026142 Bacteria 2030
568 Ga0207698_10211701 3300026142 Bacteria 1744
569 Ga0207698_10506316 3300026142 Bacteria 1176
570 Ga0207698_11039440 3300026142 Bacteria 831
571 Ga0209983_1029422 3300027665 Bacteria 1168
572 Ga0209974_10052186 3300027876 Bacteria 1376
573 Ga0209974_10132559 3300027876 Bacteria 889
574 Ga0268266_10044669 3300028379 Bacteria 3787
575 Ga0268266_10044928 3300028379 Bacteria 3777
576 Ga0268266_11561860 3300028379 Unclassified 635
577 Ga0268265_10022231 3300028380 Bacteria 4453
578 Ga0268265_10054802 3300028380 Bacteria 3027
579 Ga0268265_10091343 3300028380 Bacteria 2435
580 Ga0268264_10006398 3300028381 Bacteria 9922
581 Ga0268264_10097034 3300028381 Bacteria 2554
582 Ga0268264_10563890 3300028381 Unclassified 1118
583 Ga0268264_10588828 3300028381 Bacteria 1095
584 Ga0307408_100080001 3300031548 Bacteria 2440
585 Ga0307408_100292496 3300031548 Bacteria 1361
586 Ga0307405_11919848 3300031731 Bacteria 528
587 Ga0307413_10335602 3300031824 Bacteria 1160
588 Ga0307413_12152347 3300031824 Unclassified 505
589 Ga0307410_10091123 3300031852 Bacteria 2164
590 Ga0307406_10057541 3300031901 Bacteria 2494
591 Ga0307407_10424373 3300031903 Bacteria 959
592 Ga0307409_100110175 3300031995 Bacteria 2307
593 Ga0307409_100363706 3300031995 Bacteria 1369
594 Ga0307409_101885542 3300031995 Bacteria 627
595 Ga0307409_101932378 3300031995 Bacteria 620
596 Ga0307416_100200678 3300032002 Bacteria 1892
597 Ga0307416_100343055 3300032002 Bacteria 1508
598 Ga0307414_11035571 3300032004 Bacteria 756
599 Ga0307414_11188522 3300032004 Bacteria 706
600 Ga0307411_10079042 3300032005 Bacteria 2257
601 Ga0307415_100099528 3300032126 Bacteria 2128
602 Ga0307415_100616182 3300032126 Bacteria 968
603 Ga0373928_0171963 3300035084 Unclassified 611
604 Ga0373951_0008212 3300035091 Bacteria 2364
605 Ga0373923_0047268 3300035111 Bacteria 1793
606 Ga0373954_0085213 3300035118 Bacteria 1513
607 Ga0373956_0156274 3300035119 Bacteria 1074
608 Ga0373960_0161607 3300035121 Unclassified 771
609 Ga0373955_1028398 3300035172 Bacteria 507
610 Ga0373962_0121808 3300035242 Bacteria 832
611 Ga0373931_0028286 3300035691 Bacteria 2868
612 Ga0373935_0309818 3300035692 Bacteria 1118
613 Ga0373937_0008086 3300036401 Bacteria 9130
614 Ga0395899_0001906 3300037312 Bacteria 17205
615 Ga0395899_0015290 3300037312 Bacteria 5848
616 Ga0395899_0033784 3300037312 Bacteria 3841
617 Ga0395899_0041859 3300037312 Bacteria 3421
618 Ga0395899_0099675 3300037312 Bacteria 2098
619 Ga0395899_0103209 3300037312 Bacteria 2057
620 Ga0395899_0106354 3300037312 Bacteria 2020
621 Ga0395899_0149902 3300037312 Bacteria 1653
622 Ga0395899_0270210 3300037312 Bacteria 1160
623 Ga0395899_0362165 3300037312 Bacteria 967
624 Ga0395899_0442582 3300037312 Bacteria 852
625 Ga0395899_0498246 3300037312 Unclassified 790
626 Ga0395899_0824625 3300037312 Bacteria 571
627 Ga0395900_0000447 3300037418 Bacteria 59069
628 Ga0395900_0055653 3300037418 Bacteria 4073
629 Ga0395900_0070117 3300037418 Bacteria 3603
630 Ga0395900_0079680 3300037418 Bacteria 3365
631 Ga0395900_0173564 3300037418 Bacteria 2193
632 Ga0395900_0239111 3300037418 Bacteria 1822
633 Ga0395900_0253231 3300037418 Bacteria 1761
634 Ga0395900_0315078 3300037418 Bacteria 1546
635 Ga0395900_0412256 3300037418 Bacteria 1313
636 Ga0395900_0442238 3300037418 Bacteria 1257
637 Ga0395900_0526478 3300037418 Bacteria 1129
638 Ga0395900_0544897 3300037418 Bacteria 1105
639 Ga0395900_0833937 3300037418 Bacteria 848
640 Ga0395900_0899189 3300037418 Unclassified 809
641 Ga0395900_1033061 3300037418 Bacteria 741
642 Ga0395898_0011697 3300037466 Bacteria 9100
643 Ga0395898_0083259 3300037466 Bacteria 3083
644 Ga0395898_0088326 3300037466 Bacteria 2984
645 Ga0395898_0110666 3300037466 Bacteria 2632
646 Ga0395898_0111874 3300037466 Bacteria 2617
647 Ga0395898_0180232 3300037466 Bacteria 2019
648 Ga0395898_0629625 3300037466 Unclassified 1015
649 Ga0395898_0720986 3300037466 Bacteria 939
650 Ga0395898_1740063 3300037466 Bacteria 545
651 Ga0395905_0000187 3300037471 Bacteria 98895
652 Ga0395905_0004624 3300037471 Bacteria 14237
653 Ga0395905_0019955 3300037471 Bacteria 6351
654 Ga0395905_0078505 3300037471 Bacteria 3093
655 Ga0395905_0084520 3300037471 Bacteria 2973
656 Ga0395905_0226697 3300037471 Bacteria 1748
657 Ga0395905_0246156 3300037471 Bacteria 1670
658 Ga0395905_0340970 3300037471 Bacteria 1390
659 Ga0395905_0377867 3300037471 Bacteria 1310
660 Ga0395905_0403715 3300037471 Bacteria 1262
661 Ga0395905_1004132 3300037471 Bacteria 737
662 Ga0395905_1006643 3300037471 Bacteria 736
663 Ga0395905_1111291 3300037471 Bacteria 694
664 Ga0395905_1329505 3300037471 Unclassified 622
665 Ga0395905_1769107 3300037471 Bacteria 523
666 Ga0395901_0000324 3300038443 Bacteria 59134
667 Ga0395901_0032370 3300038443 Bacteria 5395
668 Ga0395901_0043378 3300038443 Bacteria 4666
669 Ga0395901_0056287 3300038443 Bacteria 4090
670 Ga0395901_0115251 3300038443 Bacteria 2823
671 Ga0395901_0378893 3300038443 Bacteria 1456
672 Ga0395901_0726547 3300038443 Bacteria 988
673 Ga0395901_1274975 3300038443 Bacteria 697
674 Ga0395901_1502295 3300038443 Bacteria 629
675 Ga0466966_0196540 3300044684 Bacteria 1221
676 Ga0466961_0065766 3300044693 Bacteria 2304
677 Ga0466963_0004598 3300044694 Bacteria 8035
678 Ga0466963_0005117 3300044694 Bacteria 7660
679 Ga0466963_0039353 3300044694 Bacteria 3096
680 Ga0466963_0124686 3300044694 Bacteria 1775
681 Ga0466963_0242665 3300044694 Bacteria 1264
682 Ga0466964_0022607 3300044706 Bacteria 2442
683 Ga0453684_0360581 3300044712 Bacteria 1637
684 Ga0466971_0062393 3300044719 Bacteria 1686
685 Ga0466971_0400063 3300044719 Bacteria 669
686 Ga0466970_0105760 3300044765 Unclassified 1535
687 Ga0466957_0009743 3300044842 Bacteria 5487
688 Ga0466957_0095693 3300044842 Bacteria 1865
689 Ga0466957_0143882 3300044842 Bacteria 1538
690 Ga0466959_0030022 3300045049 Bacteria 4027
691 Ga0466959_0267248 3300045049 Bacteria 1176
692 Ga0466958_0001186 3300045836 Bacteria 12153
693 Ga0466958_0013790 3300045836 Bacteria 4608
694 Ga0466958_0118416 3300045836 Bacteria 1657
695 Ga0466967_0014760 3300045976 Bacteria 6103
696 Ga0466967_0016917 3300045976 Bacteria 5767
697 Ga0466967_0041146 3300045976 Bacteria 3982
698 Ga0466967_0043652 3300045976 Bacteria 3883
699 Ga0466967_0075882 3300045976 Bacteria 3022
700 Ga0466967_0098890 3300045976 Bacteria 2664
701 Ga0466967_0117896 3300045976 Bacteria 2448
702 Ga0466967_1286798 3300045976 Bacteria 728
703 Ga0495584_0345244 3300046491 Bacteria 756
704 Ga0495668_0273738 3300046616 Bacteria 925
705 Ga0495623_0155323 3300046679 Bacteria 1349
706 Ga0495669_0067032 3300046684 Bacteria 1631
707 Ga0496100_0177685 3300048903 Bacteria 1538
708 Ga0496101_0012991 3300048904 Bacteria 5570
709 Ga0496102_0134653 3300048905 Bacteria 2315
710 Ga0496103_0067103 3300048906 Bacteria 2240
711 Ga0496103_0421365 3300048906 Bacteria 857
712 Ga0496105_0371655 3300048908 Bacteria 1139
713 Ga0496106_0022698 3300048909 Bacteria 4663
714 Ga0496106_0229494 3300048909 Bacteria 1482
715 Ga0496107_0004256 3300048910 Bacteria 9679
716 Ga0496107_0346012 3300048910 Bacteria 1106
717 Ga0496108_0025939 3300048911 Bacteria 4833
718 Ga0496108_0897410 3300048911 Bacteria 761
719 Ga0496109_0017833 3300048912 Bacteria 6228
720 Ga0496109_0269210 3300048912 Bacteria 1605
721 Ga0496109_0432629 3300048912 Bacteria 1243
722 Ga0496110_0005528 3300048913 Bacteria 9921
723 Ga0496110_0543461 3300048913 Bacteria 1056
724 Ga0496111_0021519 3300048914 Bacteria 4505
725 Ga0496111_0546362 3300048914 Bacteria 851
726 Ga0496112_0006261 3300048915 Bacteria 10431
727 Ga0496113_0423362 3300048916 Bacteria 1069
728 Ga0501067_0031805 3300049583 Bacteria 2928
729 Ga0501070_0446862 3300049586 Bacteria 1042
730 Ga0501074_0187914 3300049590 Bacteria 1473
731 Ga0501233_025411 3300049668 Unclassified 1302
732 Ga0501080_0094630 3300049742 Bacteria 2774
733 Ga0501270_050416 3300049767 Bacteria 753
734 nmdc:mga0rr50_510936_c1 3300050513 Bacteria 1022
735 nmdc:mga08x19_559351_c1 3300050514 Bacteria 809
736 Ga0587088_093176 3300059508 Unclassified 663
737 Ga0587067_091100 3300059640 Unclassified 691
738 Ga0466962_0024643 3300061719 Bacteria 2889
739 Ga0530510_0772873 3300061734 Unclassified 733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_101767878 Ga0070713_1017678782 125
2 3300005293 Ga0065715_10584272 Ga0065715_105842722 128
3 3300005327 Ga0070658_10009613 Ga0070658_100096135 128
4 3300005329 Ga0070683_100062612 Ga0070683_1000626122 128
5 3300005333 Ga0070677_10405993 Ga0070677_104059932 128
6 3300005338 Ga0068868_100343657 Ga0068868_1003436571 128
7 3300005344 Ga0070661_100612791 Ga0070661_1006127912 128
8 3300005535 Ga0070684_100027913 Ga0070684_1000279132 128
9 3300005563 Ga0068855_100210192 Ga0068855_1002101922 128
10 3300005614 Ga0068856_100961209 Ga0068856_1009612092 128
11 3300009098 Ga0105245_10276026 Ga0105245_102760262 128
12 3300009176 Ga0105242_10912682 Ga0105242_109126822 128
13 3300009177 Ga0105248_10018193 Ga0105248_100181935 128
14 3300009553 Ga0105249_11185354 Ga0105249_111853542 128
15 3300010375 Ga0105239_10218160 Ga0105239_102181603 128
16 3300013102 Ga0157371_10055697 Ga0157371_100556972 128
17 3300013102 Ga0157371_10058590 Ga0157371_100585902 128
18 3300013102 Ga0157371_10140542 Ga0157371_101405422 128
19 3300013102 Ga0157371_10308430 Ga0157371_103084302 128
20 3300013102 Ga0157371_10416876 Ga0157371_104168762 128
21 3300013104 Ga0157370_10060505 Ga0157370_100605051 128
22 3300013104 Ga0157370_10212917 Ga0157370_102129172 128
23 3300013104 Ga0157370_10286151 Ga0157370_102861512 128
24 3300013105 Ga0157369_10069335 Ga0157369_100693355 128
25 3300013306 Ga0163162_10068534 Ga0163162_100685342 128
26 3300013307 Ga0157372_11243324 Ga0157372_112433242 128
27 3300014326 Ga0157380_11723141 Ga0157380_117231411 128
28 3300025909 Ga0207705_10102751 Ga0207705_101027513 128
29 3300025919 Ga0207657_10124942 Ga0207657_101249422 128
30 3300025920 Ga0207649_10523691 Ga0207649_105236912 128
31 3300025929 Ga0207664_10442792 Ga0207664_104427922 128
32 3300025949 Ga0207667_10118071 Ga0207667_101180712 128
33 3300026078 Ga0207702_10874550 Ga0207702_108745502 128
34 3300026078 Ga0207702_11263430 Ga0207702_112634302 128
35 3300037312 Ga0395899_0149902 Ga0395899_0149902_114_500 128
36 3300037312 Ga0395899_0362165 Ga0395899_0362165_114_500 128
37 3300037466 Ga0395898_1740063 Ga0395898_1740063_46_432 128
38 3300037471 Ga0395905_1004132 Ga0395905_1004132_238_624 128
39 3300037471 Ga0395905_1111291 Ga0395905_1111291_116_502 128
40 3300044765 Ga0466970_0105760 Ga0466970_0105760_200_586 128
41 3300045049 Ga0466959_0030022 Ga0466959_0030022_1130_1516 128
42 3300048903 Ga0496100_0177685 Ga0496100_0177685_398_784 128
43 3300048904 Ga0496101_0012991 Ga0496101_0012991_2584_2970 128
44 3300048908 Ga0496105_0371655 Ga0496105_0371655_398_784 128
45 3300048909 Ga0496106_0022698 Ga0496106_0022698_1683_2069 128
46 3300048910 Ga0496107_0004256 Ga0496107_0004256_1714_2100 128
47 3300048911 Ga0496108_0025939 Ga0496108_0025939_614_1000 128
48 3300048912 Ga0496109_0017833 Ga0496109_0017833_398_784 128
49 3300048913 Ga0496110_0005528 Ga0496110_0005528_3562_3948 128
50 3300048914 Ga0496111_0021519 Ga0496111_0021519_2601_2987 128
51 3300048916 Ga0496113_0423362 Ga0496113_0423362_625_1011 128
52 3300049668 Ga0501233_025411 Ga0501233_025411_872_1258 128
53 3300049767 Ga0501270_050416 Ga0501270_050416_337_723 128
54 3300050513 nmdc:mga0rr50_510936_c1 nmdc:mga0rr50_510936_c1_409_795 128
55 3300050514 nmdc:mga08x19_559351_c1 nmdc:mga08x19_559351_c1_50_436 128
56 3300031995 Ga0307409_101932378 Ga0307409_1019323781 130
57 3300037471 Ga0395905_0226697 Ga0395905_0226697_276_668 130
58 3300001976 JGI24752J21851_1042724 JGI24752J21851_10427241 131
59 3300005290 Ga0065712_10040760 Ga0065712_100407602 131
60 3300005339 Ga0070660_100000861 Ga0070660_10000086122 131
61 3300005345 Ga0070692_10082450 Ga0070692_100824501 131
62 3300005353 Ga0070669_100016981 Ga0070669_1000169813 131
63 3300005353 Ga0070669_100084035 Ga0070669_1000840353 131
64 3300005367 Ga0070667_100079689 Ga0070667_1000796891 131
65 3300005457 Ga0070662_100068699 Ga0070662_1000686993 131
66 3300005458 Ga0070681_10705275 Ga0070681_107052751 131
67 3300005547 Ga0070693_100000361 Ga0070693_1000003616 131
68 3300005548 Ga0070665_100062768 Ga0070665_1000627687 131
69 3300005840 Ga0068870_10988314 Ga0068870_109883141 131
70 3300009148 Ga0105243_10817439 Ga0105243_108174392 131
71 3300010375 Ga0105239_10263900 Ga0105239_102639003 131
72 3300013100 Ga0157373_10384756 Ga0157373_103847562 131
73 3300014745 Ga0157377_11115750 Ga0157377_111157502 131
74 3300025893 Ga0207682_10197253 Ga0207682_101972531 131
75 3300025904 Ga0207647_10014849 Ga0207647_100148496 131
76 3300025924 Ga0207694_10061732 Ga0207694_100617324 131
77 3300025933 Ga0207706_10040717 Ga0207706_100407173 131
78 3300025986 Ga0207658_10054963 Ga0207658_100549631 131
79 3300026121 Ga0207683_11250536 Ga0207683_112505362 131
80 3300027665 Ga0209983_1029422 Ga0209983_10294222 131
81 3300027876 Ga0209974_10052186 Ga0209974_100521862 131
82 3300028379 Ga0268266_10044928 Ga0268266_100449287 131
83 3300028380 Ga0268265_10091343 Ga0268265_100913432 131
84 3300028381 Ga0268264_10563890 Ga0268264_105638902 131
85 3300031548 Ga0307408_100080001 Ga0307408_1000800013 131
86 3300031548 Ga0307408_100292496 Ga0307408_1002924963 131
87 3300031731 Ga0307405_11919848 Ga0307405_119198481 131
88 3300031995 Ga0307409_100110175 Ga0307409_1001101752 131
89 3300031995 Ga0307409_101885542 Ga0307409_1018855421 131
90 3300032002 Ga0307416_100200678 Ga0307416_1002006782 131
91 3300032002 Ga0307416_100343055 Ga0307416_1003430552 131
92 3300032005 Ga0307411_10079042 Ga0307411_100790422 131
93 3300044712 Ga0453684_0360581 Ga0453684_0360581_660_1055 131
94 3300046491 Ga0495584_0345244 Ga0495584_0345244_259_660 131
95 3300046616 Ga0495668_0273738 Ga0495668_0273738_416_811 131
96 3300046684 Ga0495669_0067032 Ga0495669_0067032_501_902 131
97 3300048906 Ga0496103_0067103 Ga0496103_0067103_1389_1784 131
98 3300048911 Ga0496108_0897410 Ga0496108_0897410_338_733 131
99 3300048912 Ga0496109_0269210 Ga0496109_0269210_313_708 131
100 3300048914 Ga0496111_0546362 Ga0496111_0546362_139_534 131
101 3300013105 Ga0157369_12011390 Ga0157369_120113901 132
102 3300031995 Ga0307409_100363706 Ga0307409_1003637062 132
103 3300032126 Ga0307415_100616182 Ga0307415_1006161822 132
104 3300044684 Ga0466966_0196540 Ga0466966_0196540_528_926 132
105 3300044693 Ga0466961_0065766 Ga0466961_0065766_1200_1598 132
106 3300045049 Ga0466959_0267248 Ga0466959_0267248_177_575 132
107 3300001979 JGI24740J21852_10001279 JGI24740J21852_1000127910 133
108 3300001979 JGI24740J21852_10124572 JGI24740J21852_101245722 133
109 3300001989 JGI24739J22299_10000632 JGI24739J22299_100006327 133
110 3300001989 JGI24739J22299_10008617 JGI24739J22299_100086172 133
111 3300001990 JGI24737J22298_10000103 JGI24737J22298_1000010313 133
112 3300001990 JGI24737J22298_10017157 JGI24737J22298_100171573 133
113 3300002067 JGI24735J21928_10019965 JGI24735J21928_100199651 133
114 3300002075 JGI24738J21930_10000018 JGI24738J21930_100000189 133
115 3300002075 JGI24738J21930_10008304 JGI24738J21930_100083043 133
116 3300005327 Ga0070658_10000107 Ga0070658_100001077 133
117 3300005327 Ga0070658_10019253 Ga0070658_100192534 133
118 3300005327 Ga0070658_10019568 Ga0070658_100195687 133
119 3300005327 Ga0070658_10033380 Ga0070658_100333806 133
120 3300005327 Ga0070658_10060655 Ga0070658_100606551 133
121 3300005327 Ga0070658_10076497 Ga0070658_100764971 133
122 3300005327 Ga0070658_10398910 Ga0070658_103989102 133
123 3300005327 Ga0070658_11268895 Ga0070658_112688951 133
124 3300005328 Ga0070676_10002531 Ga0070676_100025314 133
125 3300005328 Ga0070676_10027239 Ga0070676_100272392 133
126 3300005328 Ga0070676_10036742 Ga0070676_100367423 133
127 3300005328 Ga0070676_10908951 Ga0070676_109089512 133
128 3300005329 Ga0070683_100001635 Ga0070683_1000016356 133
129 3300005329 Ga0070683_100006411 Ga0070683_1000064115 133
130 3300005329 Ga0070683_100028335 Ga0070683_1000283354 133
131 3300005329 Ga0070683_100062139 Ga0070683_1000621393 133
132 3300005329 Ga0070683_100131879 Ga0070683_1001318794 133
133 3300005329 Ga0070683_100301837 Ga0070683_1003018372 133
134 3300005329 Ga0070683_100514835 Ga0070683_1005148352 133
135 3300005329 Ga0070683_100870353 Ga0070683_1008703531 133
136 3300005330 Ga0070690_100026541 Ga0070690_1000265413 133
137 3300005330 Ga0070690_100902800 Ga0070690_1009028001 133
138 3300005331 Ga0070670_100014652 Ga0070670_1000146528 133
139 3300005331 Ga0070670_100266583 Ga0070670_1002665833 133
140 3300005331 Ga0070670_101822775 Ga0070670_1018227751 133
141 3300005334 Ga0068869_100003378 Ga0068869_1000033785 133
142 3300005334 Ga0068869_100667997 Ga0068869_1006679972 133
143 3300005335 Ga0070666_10001184 Ga0070666_100011846 133
144 3300005335 Ga0070666_10713713 Ga0070666_107137131 133
145 3300005336 Ga0070680_100000477 Ga0070680_1000004776 133
146 3300005336 Ga0070680_100002652 Ga0070680_1000026528 133
147 3300005336 Ga0070680_100004694 Ga0070680_1000046944 133
148 3300005336 Ga0070680_100006732 Ga0070680_1000067326 133
149 3300005336 Ga0070680_100008676 Ga0070680_1000086765 133
150 3300005336 Ga0070680_100048693 Ga0070680_1000486932 133
151 3300005336 Ga0070680_100132389 Ga0070680_1001323892 133
152 3300005336 Ga0070680_100589438 Ga0070680_1005894382 133
153 3300005336 Ga0070680_100711197 Ga0070680_1007111972 133
154 3300005337 Ga0070682_100006724 Ga0070682_1000067245 133
155 3300005337 Ga0070682_100192650 Ga0070682_1001926501 133
156 3300005337 Ga0070682_100382896 Ga0070682_1003828962 133
157 3300005338 Ga0068868_100000972 Ga0068868_1000009725 133
158 3300005339 Ga0070660_100003065 Ga0070660_1000030659 133
159 3300005339 Ga0070660_100003086 Ga0070660_1000030863 133
160 3300005339 Ga0070660_100011318 Ga0070660_1000113182 133
161 3300005339 Ga0070660_100025166 Ga0070660_1000251662 133
162 3300005339 Ga0070660_100033421 Ga0070660_1000334215 133
163 3300005339 Ga0070660_100034397 Ga0070660_1000343975 133
164 3300005339 Ga0070660_100034860 Ga0070660_1000348602 133
165 3300005339 Ga0070660_100748122 Ga0070660_1007481221 133
166 3300005339 Ga0070660_100786605 Ga0070660_1007866051 133
167 3300005340 Ga0070689_100017523 Ga0070689_1000175232 133
168 3300005341 Ga0070691_10256308 Ga0070691_102563082 133
169 3300005343 Ga0070687_100037451 Ga0070687_1000374512 133
170 3300005344 Ga0070661_100000101 Ga0070661_10000010130 133
171 3300005344 Ga0070661_100004927 Ga0070661_1000049278 133
172 3300005344 Ga0070661_100005038 Ga0070661_1000050386 133
173 3300005344 Ga0070661_100055931 Ga0070661_1000559312 133
174 3300005344 Ga0070661_100131409 Ga0070661_1001314092 133
175 3300005344 Ga0070661_100187165 Ga0070661_1001871652 133
176 3300005344 Ga0070661_100232893 Ga0070661_1002328932 133
177 3300005345 Ga0070692_10003217 Ga0070692_100032174 133
178 3300005345 Ga0070692_10016353 Ga0070692_100163533 133
179 3300005345 Ga0070692_10083589 Ga0070692_100835892 133
180 3300005345 Ga0070692_10130734 Ga0070692_101307342 133
181 3300005347 Ga0070668_100008284 Ga0070668_1000082842 133
182 3300005347 Ga0070668_100038015 Ga0070668_1000380152 133
183 3300005347 Ga0070668_101253443 Ga0070668_1012534432 133
184 3300005353 Ga0070669_100000613 Ga0070669_1000006135 133
185 3300005353 Ga0070669_100653472 Ga0070669_1006534722 133
186 3300005353 Ga0070669_101138821 Ga0070669_1011388212 133
187 3300005354 Ga0070675_100073493 Ga0070675_1000734932 133
188 3300005354 Ga0070675_100360257 Ga0070675_1003602571 133
189 3300005355 Ga0070671_100000533 Ga0070671_10000053313 133
190 3300005355 Ga0070671_100014143 Ga0070671_1000141433 133
191 3300005355 Ga0070671_100030078 Ga0070671_1000300784 133
192 3300005355 Ga0070671_101046362 Ga0070671_1010463622 133
193 3300005356 Ga0070674_101294478 Ga0070674_1012944782 133
194 3300005364 Ga0070673_100003805 Ga0070673_1000038053 133
195 3300005364 Ga0070673_100057067 Ga0070673_1000570673 133
196 3300005364 Ga0070673_100308646 Ga0070673_1003086462 133
197 3300005366 Ga0070659_100000045 Ga0070659_10000004569 133
198 3300005366 Ga0070659_100016514 Ga0070659_1000165144 133
199 3300005366 Ga0070659_100057730 Ga0070659_1000577302 133
200 3300005366 Ga0070659_100059707 Ga0070659_1000597072 133
201 3300005366 Ga0070659_100154086 Ga0070659_1001540863 133
202 3300005366 Ga0070659_100202596 Ga0070659_1002025962 133
203 3300005366 Ga0070659_100219296 Ga0070659_1002192962 133
204 3300005366 Ga0070659_100259405 Ga0070659_1002594052 133
205 3300005366 Ga0070659_100702014 Ga0070659_1007020141 133
206 3300005366 Ga0070659_100989752 Ga0070659_1009897522 133
207 3300005366 Ga0070659_101062650 Ga0070659_1010626502 133
208 3300005367 Ga0070667_100001174 Ga0070667_10000117413 133
209 3300005367 Ga0070667_100413617 Ga0070667_1004136172 133
210 3300005367 Ga0070667_100601984 Ga0070667_1006019841 133
211 3300005435 Ga0070714_100172953 Ga0070714_1001729532 133
212 3300005435 Ga0070714_100468768 Ga0070714_1004687682 133
213 3300005435 Ga0070714_101059704 Ga0070714_1010597041 133
214 3300005444 Ga0070694_100005710 Ga0070694_1000057105 133
215 3300005444 Ga0070694_101381431 Ga0070694_1013814311 133
216 3300005455 Ga0070663_100000549 Ga0070663_1000005499 133
217 3300005455 Ga0070663_100047213 Ga0070663_1000472133 133
218 3300005455 Ga0070663_100180609 Ga0070663_1001806092 133
219 3300005455 Ga0070663_100322178 Ga0070663_1003221782 133
220 3300005455 Ga0070663_100456936 Ga0070663_1004569362 133
221 3300005457 Ga0070662_100000036 Ga0070662_10000003652 133
222 3300005457 Ga0070662_100015155 Ga0070662_1000151554 133
223 3300005457 Ga0070662_100026980 Ga0070662_1000269802 133
224 3300005457 Ga0070662_100283452 Ga0070662_1002834523 133
225 3300005457 Ga0070662_101925569 Ga0070662_1019255691 133
226 3300005458 Ga0070681_10004074 Ga0070681_100040748 133
227 3300005458 Ga0070681_10023867 Ga0070681_100238675 133
228 3300005458 Ga0070681_10081032 Ga0070681_100810321 133
229 3300005458 Ga0070681_10165930 Ga0070681_101659302 133
230 3300005458 Ga0070681_10338619 Ga0070681_103386192 133
231 3300005458 Ga0070681_11014010 Ga0070681_110140101 133
232 3300005458 Ga0070681_11538171 Ga0070681_115381711 133
233 3300005459 Ga0068867_100001501 Ga0068867_10000150112 133
234 3300005459 Ga0068867_101293752 Ga0068867_1012937521 133
235 3300005466 Ga0070685_10016844 Ga0070685_100168442 133
236 3300005530 Ga0070679_100066466 Ga0070679_1000664662 133
237 3300005530 Ga0070679_100106227 Ga0070679_1001062274 133
238 3300005530 Ga0070679_100181881 Ga0070679_1001818812 133
239 3300005530 Ga0070679_100189064 Ga0070679_1001890643 133
240 3300005530 Ga0070679_100472562 Ga0070679_1004725622 133
241 3300005535 Ga0070684_100305960 Ga0070684_1003059601 133
242 3300005535 Ga0070684_100347638 Ga0070684_1003476382 133
243 3300005535 Ga0070684_100510099 Ga0070684_1005100992 133
244 3300005539 Ga0068853_100000059 Ga0068853_10000005940 133
245 3300005539 Ga0068853_100000570 Ga0068853_10000057016 133
246 3300005539 Ga0068853_100032863 Ga0068853_1000328632 133
247 3300005539 Ga0068853_100089942 Ga0068853_1000899422 133
248 3300005539 Ga0068853_100447637 Ga0068853_1004476371 133
249 3300005539 Ga0068853_100638202 Ga0068853_1006382022 133
250 3300005543 Ga0070672_100000866 Ga0070672_1000008664 133
251 3300005543 Ga0070672_100120352 Ga0070672_1001203521 133
252 3300005544 Ga0070686_100772757 Ga0070686_1007727571 133
253 3300005546 Ga0070696_100042737 Ga0070696_1000427375 133
254 3300005547 Ga0070693_100092887 Ga0070693_1000928873 133
255 3300005548 Ga0070665_100004200 Ga0070665_1000042008 133
256 3300005548 Ga0070665_100795186 Ga0070665_1007951861 133
257 3300005563 Ga0068855_100003767 Ga0068855_10000376715 133
258 3300005563 Ga0068855_100010268 Ga0068855_1000102689 133
259 3300005563 Ga0068855_100021027 Ga0068855_1000210275 133
260 3300005563 Ga0068855_100058235 Ga0068855_1000582352 133
261 3300005563 Ga0068855_100988817 Ga0068855_1009888172 133
262 3300005564 Ga0070664_100000027 Ga0070664_10000002752 133
263 3300005564 Ga0070664_100007309 Ga0070664_1000073096 133
264 3300005564 Ga0070664_100014989 Ga0070664_1000149896 133
265 3300005564 Ga0070664_100184030 Ga0070664_1001840302 133
266 3300005564 Ga0070664_100191805 Ga0070664_1001918052 133
267 3300005564 Ga0070664_100379554 Ga0070664_1003795542 133
268 3300005564 Ga0070664_101123983 Ga0070664_1011239832 133
269 3300005577 Ga0068857_100006503 Ga0068857_1000065035 133
270 3300005577 Ga0068857_100027425 Ga0068857_1000274252 133
271 3300005577 Ga0068857_100031864 Ga0068857_1000318643 133
272 3300005577 Ga0068857_100158885 Ga0068857_1001588852 133
273 3300005577 Ga0068857_100209968 Ga0068857_1002099683 133
274 3300005577 Ga0068857_101898123 Ga0068857_1018981231 133
275 3300005578 Ga0068854_100014971 Ga0068854_1000149714 133
276 3300005578 Ga0068854_100031718 Ga0068854_1000317185 133
277 3300005578 Ga0068854_100049234 Ga0068854_1000492343 133
278 3300005578 Ga0068854_100064635 Ga0068854_1000646352 133
279 3300005578 Ga0068854_100077907 Ga0068854_1000779072 133
280 3300005578 Ga0068854_100173258 Ga0068854_1001732582 133
281 3300005578 Ga0068854_100189781 Ga0068854_1001897812 133
282 3300005578 Ga0068854_100248935 Ga0068854_1002489352 133
283 3300005614 Ga0068856_100000705 Ga0068856_1000007055 133
284 3300005614 Ga0068856_100112245 Ga0068856_1001122452 133
285 3300005614 Ga0068856_100177026 Ga0068856_1001770262 133
286 3300005614 Ga0068856_100844405 Ga0068856_1008444051 133
287 3300005614 Ga0068856_101446059 Ga0068856_1014460592 133
288 3300005614 Ga0068856_102281372 Ga0068856_1022813722 133
289 3300005614 Ga0068856_102461425 Ga0068856_1024614251 133
290 3300005616 Ga0068852_100000433 Ga0068852_10000043322 133
291 3300005616 Ga0068852_100002112 Ga0068852_1000021126 133
292 3300005616 Ga0068852_100004730 Ga0068852_1000047303 133
293 3300005616 Ga0068852_100005166 Ga0068852_1000051669 133
294 3300005616 Ga0068852_100009994 Ga0068852_1000099947 133
295 3300005616 Ga0068852_100012833 Ga0068852_1000128332 133
296 3300005616 Ga0068852_100021917 Ga0068852_1000219172 133
297 3300005616 Ga0068852_100028840 Ga0068852_1000288402 133
298 3300005616 Ga0068852_100038267 Ga0068852_1000382674 133
299 3300005616 Ga0068852_100199101 Ga0068852_1001991012 133
300 3300005616 Ga0068852_100293902 Ga0068852_1002939021 133
301 3300005616 Ga0068852_100449243 Ga0068852_1004492432 133
302 3300005616 Ga0068852_101047860 Ga0068852_1010478602 133
303 3300005617 Ga0068859_100001592 Ga0068859_1000015927 133
304 3300005617 Ga0068859_100004210 Ga0068859_10000421011 133
305 3300005617 Ga0068859_100186961 Ga0068859_1001869612 133
306 3300005617 Ga0068859_100505209 Ga0068859_1005052092 133
307 3300005618 Ga0068864_100000247 Ga0068864_10000024741 133
308 3300005618 Ga0068864_100008545 Ga0068864_1000085457 133
309 3300005618 Ga0068864_100018914 Ga0068864_1000189143 133
310 3300005618 Ga0068864_100081590 Ga0068864_1000815903 133
311 3300005718 Ga0068866_10126483 Ga0068866_101264832 133
312 3300005718 Ga0068866_10525938 Ga0068866_105259382 133
313 3300005719 Ga0068861_100180793 Ga0068861_1001807933 133
314 3300005719 Ga0068861_100355085 Ga0068861_1003550851 133
315 3300005834 Ga0068851_10020047 Ga0068851_100200474 133
316 3300005834 Ga0068851_10062018 Ga0068851_100620182 133
317 3300005840 Ga0068870_10010268 Ga0068870_100102686 133
318 3300005841 Ga0068863_100001653 Ga0068863_10000165325 133
319 3300005841 Ga0068863_100069143 Ga0068863_1000691434 133
320 3300005841 Ga0068863_100234963 Ga0068863_1002349632 133
321 3300005842 Ga0068858_100006759 Ga0068858_10000675910 133
322 3300005842 Ga0068858_100017221 Ga0068858_1000172215 133
323 3300005842 Ga0068858_100022399 Ga0068858_1000223996 133
324 3300005843 Ga0068860_100021537 Ga0068860_1000215374 133
325 3300005843 Ga0068860_100027958 Ga0068860_1000279582 133
326 3300005843 Ga0068860_101165869 Ga0068860_1011658692 133
327 3300005844 Ga0068862_100006024 Ga0068862_1000060247 133
328 3300005844 Ga0068862_100254750 Ga0068862_1002547503 133
329 3300005844 Ga0068862_101192545 Ga0068862_1011925451 133
330 3300006237 Ga0097621_100026649 Ga0097621_1000266493 133
331 3300006237 Ga0097621_100219024 Ga0097621_1002190242 133
332 3300006237 Ga0097621_101420964 Ga0097621_1014209642 133
333 3300006358 Ga0068871_100070496 Ga0068871_1000704962 133
334 3300006931 Ga0097620_100001592 Ga0097620_1000015927 133
335 3300006931 Ga0097620_100004210 Ga0097620_10000421011 133
336 3300006931 Ga0097620_100186953 Ga0097620_1001869532 133
337 3300006931 Ga0097620_100505223 Ga0097620_1005052232 133
338 3300009093 Ga0105240_10027015 Ga0105240_100270156 133
339 3300009093 Ga0105240_10126852 Ga0105240_101268522 133
340 3300009093 Ga0105240_10379048 Ga0105240_103790482 133
341 3300009098 Ga0105245_10000128 Ga0105245_1000012818 133
342 3300009147 Ga0114129_10896631 Ga0114129_108966312 133
343 3300009148 Ga0105243_10064347 Ga0105243_100643475 133
344 3300009148 Ga0105243_10105180 Ga0105243_101051804 133
345 3300009148 Ga0105243_10759863 Ga0105243_107598632 133
346 3300009174 Ga0105241_10032667 Ga0105241_100326675 133
347 3300009174 Ga0105241_10057413 Ga0105241_100574132 133
348 3300009174 Ga0105241_10108525 Ga0105241_101085252 133
349 3300009174 Ga0105241_10211699 Ga0105241_102116992 133
350 3300009177 Ga0105248_10001451 Ga0105248_1000145121 133
351 3300009177 Ga0105248_10005525 Ga0105248_100055257 133
352 3300009177 Ga0105248_11168005 Ga0105248_111680052 133
353 3300009545 Ga0105237_10010769 Ga0105237_100107692 133
354 3300009551 Ga0105238_10014228 Ga0105238_100142282 133
355 3300009551 Ga0105238_10033353 Ga0105238_100333535 133
356 3300009551 Ga0105238_10122248 Ga0105238_101222484 133
357 3300009551 Ga0105238_10143149 Ga0105238_101431493 133
358 3300009553 Ga0105249_10031339 Ga0105249_100313396 133
359 3300009553 Ga0105249_10065744 Ga0105249_100657443 133
360 3300010375 Ga0105239_10118334 Ga0105239_101183344 133
361 3300011119 Ga0105246_10007663 Ga0105246_100076633 133
362 3300011119 Ga0105246_10011642 Ga0105246_100116426 133
363 3300011119 Ga0105246_11300917 Ga0105246_113009172 133
364 3300013100 Ga0157373_10001921 Ga0157373_100019212 133
365 3300013100 Ga0157373_10011033 Ga0157373_100110335 133
366 3300013100 Ga0157373_10017730 Ga0157373_100177305 133
367 3300013100 Ga0157373_10026865 Ga0157373_100268652 133
368 3300013100 Ga0157373_10043735 Ga0157373_100437352 133
369 3300013100 Ga0157373_10056049 Ga0157373_100560492 133
370 3300013100 Ga0157373_10060140 Ga0157373_100601403 133
371 3300013100 Ga0157373_10069117 Ga0157373_100691174 133
372 3300013100 Ga0157373_10072216 Ga0157373_100722162 133
373 3300013100 Ga0157373_10229162 Ga0157373_102291621 133
374 3300013100 Ga0157373_10258216 Ga0157373_102582162 133
375 3300013100 Ga0157373_10306653 Ga0157373_103066532 133
376 3300013100 Ga0157373_10328756 Ga0157373_103287562 133
377 3300013100 Ga0157373_10906988 Ga0157373_109069882 133
378 3300013102 Ga0157371_10001392 Ga0157371_100013924 133
379 3300013102 Ga0157371_10002958 Ga0157371_1000295815 133
380 3300013102 Ga0157371_10014993 Ga0157371_100149935 133
381 3300013102 Ga0157371_10070710 Ga0157371_100707103 133
382 3300013102 Ga0157371_10112985 Ga0157371_101129852 133
383 3300013102 Ga0157371_10140622 Ga0157371_101406222 133
384 3300013102 Ga0157371_10255184 Ga0157371_102551842 133
385 3300013102 Ga0157371_10483958 Ga0157371_104839582 133
386 3300013104 Ga0157370_10000686 Ga0157370_1000068631 133
387 3300013104 Ga0157370_10011108 Ga0157370_100111086 133
388 3300013104 Ga0157370_10047926 Ga0157370_100479263 133
389 3300013104 Ga0157370_10093074 Ga0157370_100930743 133
390 3300013104 Ga0157370_10141565 Ga0157370_101415652 133
391 3300013104 Ga0157370_11887769 Ga0157370_118877691 133
392 3300013105 Ga0157369_10008678 Ga0157369_100086786 133
393 3300013105 Ga0157369_10039739 Ga0157369_100397394 133
394 3300013105 Ga0157369_10059618 Ga0157369_100596182 133
395 3300013105 Ga0157369_10115743 Ga0157369_101157433 133
396 3300013105 Ga0157369_10309826 Ga0157369_103098262 133
397 3300013105 Ga0157369_10556221 Ga0157369_105562212 133
398 3300013105 Ga0157369_10612319 Ga0157369_106123192 133
399 3300013105 Ga0157369_12247206 Ga0157369_122472061 133
400 3300013296 Ga0157374_10031240 Ga0157374_100312404 133
401 3300013297 Ga0157378_10000396 Ga0157378_100003965 133
402 3300013306 Ga0163162_10264490 Ga0163162_102644901 133
403 3300013306 Ga0163162_10471362 Ga0163162_104713622 133
404 3300013307 Ga0157372_10038042 Ga0157372_100380425 133
405 3300013307 Ga0157372_10070283 Ga0157372_100702834 133
406 3300013307 Ga0157372_10097641 Ga0157372_100976412 133
407 3300013307 Ga0157372_10459311 Ga0157372_104593112 133
408 3300013307 Ga0157372_11540970 Ga0157372_115409702 133
409 3300013308 Ga0157375_10591103 Ga0157375_105911032 133
410 3300013308 Ga0157375_10644106 Ga0157375_106441061 133
411 3300014325 Ga0163163_10000187 Ga0163163_1000018726 133
412 3300014968 Ga0157379_10182906 Ga0157379_101829062 133
413 3300014968 Ga0157379_10681921 Ga0157379_106819212 133
414 3300020069 Ga0197907_10087473 Ga0197907_100874731 133
415 3300020070 Ga0206356_11579705 Ga0206356_115797051 133
416 3300020081 Ga0206354_10755474 Ga0206354_107554742 133
417 3300020081 Ga0206354_11422423 Ga0206354_114224232 133
418 3300020082 Ga0206353_10818459 Ga0206353_108184594 133
419 3300020082 Ga0206353_11188791 Ga0206353_111887912 133
420 3300025315 Ga0207697_10000059 Ga0207697_1000005938 133
421 3300025321 Ga0207656_10040854 Ga0207656_100408542 133
422 3300025321 Ga0207656_10357895 Ga0207656_103578951 133
423 3300025899 Ga0207642_10117116 Ga0207642_101171162 133
424 3300025901 Ga0207688_10000721 Ga0207688_1000072112 133
425 3300025903 Ga0207680_10004748 Ga0207680_100047481 133
426 3300025903 Ga0207680_10138471 Ga0207680_101384712 133
427 3300025904 Ga0207647_10000968 Ga0207647_100009685 133
428 3300025904 Ga0207647_10001381 Ga0207647_100013816 133
429 3300025904 Ga0207647_10051788 Ga0207647_100517883 133
430 3300025907 Ga0207645_10002144 Ga0207645_100021447 133
431 3300025907 Ga0207645_10016875 Ga0207645_100168752 133
432 3300025907 Ga0207645_10078345 Ga0207645_100783454 133
433 3300025908 Ga0207643_10258584 Ga0207643_102585842 133
434 3300025909 Ga0207705_10000086 Ga0207705_10000086119 133
435 3300025909 Ga0207705_10004131 Ga0207705_100041313 133
436 3300025909 Ga0207705_10012975 Ga0207705_100129756 133
437 3300025909 Ga0207705_10018733 Ga0207705_100187332 133
438 3300025909 Ga0207705_10019330 Ga0207705_100193303 133
439 3300025909 Ga0207705_10023122 Ga0207705_100231224 133
440 3300025909 Ga0207705_10374960 Ga0207705_103749602 133
441 3300025909 Ga0207705_10804549 Ga0207705_108045492 133
442 3300025911 Ga0207654_10096895 Ga0207654_100968953 133
443 3300025911 Ga0207654_10116145 Ga0207654_101161452 133
444 3300025911 Ga0207654_10238303 Ga0207654_102383032 133
445 3300025911 Ga0207654_10325720 Ga0207654_103257202 133
446 3300025912 Ga0207707_10086364 Ga0207707_100863642 133
447 3300025912 Ga0207707_10096969 Ga0207707_100969691 133
448 3300025912 Ga0207707_10238320 Ga0207707_102383202 133
449 3300025912 Ga0207707_11096466 Ga0207707_110964662 133
450 3300025913 Ga0207695_10019721 Ga0207695_100197217 133
451 3300025913 Ga0207695_10057499 Ga0207695_100574994 133
452 3300025914 Ga0207671_10068265 Ga0207671_100682653 133
453 3300025914 Ga0207671_11104349 Ga0207671_111043492 133
454 3300025917 Ga0207660_10000711 Ga0207660_1000071113 133
455 3300025917 Ga0207660_10002701 Ga0207660_100027018 133
456 3300025917 Ga0207660_10005238 Ga0207660_100052381 133
457 3300025917 Ga0207660_10156919 Ga0207660_101569192 133
458 3300025917 Ga0207660_10159858 Ga0207660_101598583 133
459 3300025917 Ga0207660_10367846 Ga0207660_103678462 133
460 3300025917 Ga0207660_10509129 Ga0207660_105091291 133
461 3300025919 Ga0207657_10000133 Ga0207657_1000013351 133
462 3300025919 Ga0207657_10000267 Ga0207657_1000026741 133
463 3300025919 Ga0207657_10005242 Ga0207657_1000524211 133
464 3300025919 Ga0207657_10005850 Ga0207657_100058507 133
465 3300025919 Ga0207657_10008846 Ga0207657_100088464 133
466 3300025919 Ga0207657_10054657 Ga0207657_100546574 133
467 3300025919 Ga0207657_10092503 Ga0207657_100925033 133
468 3300025919 Ga0207657_10294401 Ga0207657_102944012 133
469 3300025920 Ga0207649_10000378 Ga0207649_1000037822 133
470 3300025920 Ga0207649_10031381 Ga0207649_100313812 133
471 3300025920 Ga0207649_10191138 Ga0207649_101911382 133
472 3300025920 Ga0207649_10252189 Ga0207649_102521892 133
473 3300025920 Ga0207649_10352801 Ga0207649_103528011 133
474 3300025920 Ga0207649_10442940 Ga0207649_104429402 133
475 3300025920 Ga0207649_10465146 Ga0207649_104651462 133
476 3300025920 Ga0207649_10487309 Ga0207649_104873092 133
477 3300025921 Ga0207652_10041849 Ga0207652_100418493 133
478 3300025921 Ga0207652_10066873 Ga0207652_100668732 133
479 3300025921 Ga0207652_10723332 Ga0207652_107233321 133
480 3300025921 Ga0207652_10760263 Ga0207652_107602632 133
481 3300025921 Ga0207652_10788659 Ga0207652_107886592 133
482 3300025923 Ga0207681_10012674 Ga0207681_100126745 133
483 3300025923 Ga0207681_10042342 Ga0207681_100423423 133
484 3300025924 Ga0207694_10001964 Ga0207694_100019647 133
485 3300025924 Ga0207694_10137561 Ga0207694_101375612 133
486 3300025924 Ga0207694_10165810 Ga0207694_101658102 133
487 3300025925 Ga0207650_10010511 Ga0207650_100105113 133
488 3300025925 Ga0207650_10207863 Ga0207650_102078633 133
489 3300025926 Ga0207659_10051002 Ga0207659_100510024 133
490 3300025927 Ga0207687_10000688 Ga0207687_1000068821 133
491 3300025927 Ga0207687_10147036 Ga0207687_101470362 133
492 3300025929 Ga0207664_10509144 Ga0207664_105091442 133
493 3300025931 Ga0207644_10015617 Ga0207644_100156172 133
494 3300025931 Ga0207644_10079499 Ga0207644_100794992 133
495 3300025931 Ga0207644_10089244 Ga0207644_100892442 133
496 3300025932 Ga0207690_10000080 Ga0207690_1000008040 133
497 3300025932 Ga0207690_10001597 Ga0207690_1000159710 133
498 3300025932 Ga0207690_10004642 Ga0207690_100046425 133
499 3300025932 Ga0207690_10007944 Ga0207690_100079447 133
500 3300025932 Ga0207690_10045680 Ga0207690_100456802 133
501 3300025932 Ga0207690_10095329 Ga0207690_100953292 133
502 3300025932 Ga0207690_10193393 Ga0207690_101933931 133
503 3300025932 Ga0207690_10207875 Ga0207690_102078752 133
504 3300025932 Ga0207690_10340231 Ga0207690_103402312 133
505 3300025932 Ga0207690_10805864 Ga0207690_108058642 133
506 3300025933 Ga0207706_10000159 Ga0207706_1000015951 133
507 3300025933 Ga0207706_10000426 Ga0207706_1000042638 133
508 3300025933 Ga0207706_10001767 Ga0207706_1000176712 133
509 3300025933 Ga0207706_10003045 Ga0207706_1000304517 133
510 3300025933 Ga0207706_10051732 Ga0207706_100517322 133
511 3300025934 Ga0207686_10539801 Ga0207686_105398011 133
512 3300025935 Ga0207709_10193898 Ga0207709_101938982 133
513 3300025935 Ga0207709_10336057 Ga0207709_103360572 133
514 3300025936 Ga0207670_11292471 Ga0207670_112924712 133
515 3300025937 Ga0207669_10005541 Ga0207669_100055416 133
516 3300025937 Ga0207669_11768220 Ga0207669_117682201 133
517 3300025940 Ga0207691_10013333 Ga0207691_100133337 133
518 3300025940 Ga0207691_10113343 Ga0207691_101133433 133
519 3300025941 Ga0207711_10000744 Ga0207711_100007443 133
520 3300025941 Ga0207711_10002355 Ga0207711_100023558 133
521 3300025941 Ga0207711_10003526 Ga0207711_1000352614 133
522 3300025941 Ga0207711_10562316 Ga0207711_105623162 133
523 3300025942 Ga0207689_10000128 Ga0207689_1000012826 133
524 3300025942 Ga0207689_10050102 Ga0207689_100501023 133
525 3300025942 Ga0207689_10070985 Ga0207689_100709852 133
526 3300025944 Ga0207661_10001549 Ga0207661_100015494 133
527 3300025944 Ga0207661_10036102 Ga0207661_100361026 133
528 3300025944 Ga0207661_10058294 Ga0207661_100582942 133
529 3300025944 Ga0207661_10088312 Ga0207661_100883123 133
530 3300025944 Ga0207661_10094886 Ga0207661_100948862 133
531 3300025944 Ga0207661_10458338 Ga0207661_104583382 133
532 3300025944 Ga0207661_10908919 Ga0207661_109089192 133
533 3300025945 Ga0207679_10000155 Ga0207679_1000015531 133
534 3300025945 Ga0207679_10021030 Ga0207679_100210305 133
535 3300025945 Ga0207679_10023302 Ga0207679_100233024 133
536 3300025945 Ga0207679_10212489 Ga0207679_102124892 133
537 3300025945 Ga0207679_10431160 Ga0207679_104311602 133
538 3300025945 Ga0207679_10979224 Ga0207679_109792242 133
539 3300025949 Ga0207667_10017533 Ga0207667_100175335 133
540 3300025949 Ga0207667_10018898 Ga0207667_100188986 133
541 3300025949 Ga0207667_10037566 Ga0207667_100375664 133
542 3300025949 Ga0207667_10042322 Ga0207667_100423224 133
543 3300025949 Ga0207667_10053023 Ga0207667_100530234 133
544 3300025949 Ga0207667_10055114 Ga0207667_100551144 133
545 3300025949 Ga0207667_10153295 Ga0207667_101532953 133
546 3300025949 Ga0207667_12109732 Ga0207667_121097321 133
547 3300025960 Ga0207651_10001297 Ga0207651_100012974 133
548 3300025960 Ga0207651_10669219 Ga0207651_106692192 133
549 3300025960 Ga0207651_11023569 Ga0207651_110235691 133
550 3300025961 Ga0207712_10934758 Ga0207712_109347582 133
551 3300025972 Ga0207668_10270781 Ga0207668_102707812 133
552 3300025972 Ga0207668_10547427 Ga0207668_105474272 133
553 3300025972 Ga0207668_10718534 Ga0207668_107185341 133
554 3300025981 Ga0207640_10005165 Ga0207640_100051655 133
555 3300025981 Ga0207640_10037349 Ga0207640_100373493 133
556 3300025981 Ga0207640_10063004 Ga0207640_100630042 133
557 3300025981 Ga0207640_10067160 Ga0207640_100671602 133
558 3300025981 Ga0207640_10177192 Ga0207640_101771923 133
559 3300025981 Ga0207640_10314352 Ga0207640_103143522 133
560 3300025981 Ga0207640_10337021 Ga0207640_103370212 133
561 3300025986 Ga0207658_10012354 Ga0207658_100123545 133
562 3300025986 Ga0207658_10218426 Ga0207658_102184262 133
563 3300026023 Ga0207677_10006405 Ga0207677_100064055 133
564 3300026023 Ga0207677_10635950 Ga0207677_106359502 133
565 3300026035 Ga0207703_10003199 Ga0207703_100031991 133
566 3300026035 Ga0207703_10030128 Ga0207703_100301284 133
567 3300026035 Ga0207703_10030986 Ga0207703_100309863 133
568 3300026041 Ga0207639_10000137 Ga0207639_100001376 133
569 3300026041 Ga0207639_10001284 Ga0207639_1000128414 133
570 3300026041 Ga0207639_10004961 Ga0207639_100049616 133
571 3300026041 Ga0207639_10048237 Ga0207639_100482372 133
572 3300026041 Ga0207639_10112034 Ga0207639_101120341 133
573 3300026041 Ga0207639_10653102 Ga0207639_106531022 133
574 3300026041 Ga0207639_10722671 Ga0207639_107226712 133
575 3300026067 Ga0207678_10000973 Ga0207678_1000097321 133
576 3300026067 Ga0207678_10002271 Ga0207678_100022714 133
577 3300026067 Ga0207678_10004199 Ga0207678_100041996 133
578 3300026067 Ga0207678_10084825 Ga0207678_100848254 133
579 3300026067 Ga0207678_10155934 Ga0207678_101559342 133
580 3300026067 Ga0207678_10375665 Ga0207678_103756652 133
581 3300026067 Ga0207678_10543744 Ga0207678_105437441 133
582 3300026078 Ga0207702_10000246 Ga0207702_1000024640 133
583 3300026078 Ga0207702_10196423 Ga0207702_101964232 133
584 3300026078 Ga0207702_10386791 Ga0207702_103867913 133
585 3300026078 Ga0207702_10552615 Ga0207702_105526151 133
586 3300026078 Ga0207702_10580725 Ga0207702_105807252 133
587 3300026078 Ga0207702_11419196 Ga0207702_114191961 133
588 3300026078 Ga0207702_11755914 Ga0207702_117559142 133
589 3300026088 Ga0207641_10001758 Ga0207641_100017582 133
590 3300026088 Ga0207641_10061282 Ga0207641_100612822 133
591 3300026088 Ga0207641_10063990 Ga0207641_100639902 133
592 3300026089 Ga0207648_10003309 Ga0207648_1000330912 133
593 3300026089 Ga0207648_10239230 Ga0207648_102392302 133
594 3300026095 Ga0207676_10000220 Ga0207676_1000022012 133
595 3300026095 Ga0207676_10005619 Ga0207676_100056196 133
596 3300026095 Ga0207676_10009270 Ga0207676_100092706 133
597 3300026095 Ga0207676_10015190 Ga0207676_100151903 133
598 3300026116 Ga0207674_10000827 Ga0207674_1000082720 133
599 3300026116 Ga0207674_10004899 Ga0207674_100048996 133
600 3300026116 Ga0207674_10012242 Ga0207674_100122428 133
601 3300026116 Ga0207674_10017536 Ga0207674_100175367 133
602 3300026118 Ga0207675_100055033 Ga0207675_1000550335 133
603 3300026118 Ga0207675_100437483 Ga0207675_1004374833 133
604 3300026142 Ga0207698_10000421 Ga0207698_100004215 133
605 3300026142 Ga0207698_10001565 Ga0207698_100015658 133
606 3300026142 Ga0207698_10001619 Ga0207698_100016196 133
607 3300026142 Ga0207698_10006275 Ga0207698_100062755 133
608 3300026142 Ga0207698_10008966 Ga0207698_100089665 133
609 3300026142 Ga0207698_10013342 Ga0207698_100133425 133
610 3300026142 Ga0207698_10059370 Ga0207698_100593702 133
611 3300026142 Ga0207698_10067580 Ga0207698_100675804 133
612 3300026142 Ga0207698_10072205 Ga0207698_100722054 133
613 3300026142 Ga0207698_10083651 Ga0207698_100836512 133
614 3300026142 Ga0207698_10148606 Ga0207698_101486062 133
615 3300026142 Ga0207698_10211701 Ga0207698_102117012 133
616 3300026142 Ga0207698_10506316 Ga0207698_105063162 133
617 3300026142 Ga0207698_11039440 Ga0207698_110394402 133
618 3300027876 Ga0209974_10132559 Ga0209974_101325592 133
619 3300028379 Ga0268266_10044669 Ga0268266_100446693 133
620 3300028379 Ga0268266_11561860 Ga0268266_115618602 133
621 3300028380 Ga0268265_10022231 Ga0268265_100222314 133
622 3300028380 Ga0268265_10054802 Ga0268265_100548022 133
623 3300028381 Ga0268264_10006398 Ga0268264_100063988 133
624 3300028381 Ga0268264_10097034 Ga0268264_100970344 133
625 3300028381 Ga0268264_10588828 Ga0268264_105888282 133
626 3300031824 Ga0307413_10335602 Ga0307413_103356021 133
627 3300031824 Ga0307413_12152347 Ga0307413_121523471 133
628 3300031852 Ga0307410_10091123 Ga0307410_100911232 133
629 3300031901 Ga0307406_10057541 Ga0307406_100575412 133
630 3300031903 Ga0307407_10424373 Ga0307407_104243732 133
631 3300032004 Ga0307414_11035571 Ga0307414_110355711 133
632 3300032126 Ga0307415_100099528 Ga0307415_1000995282 133
633 3300035084 Ga0373928_0171963 Ga0373928_0171963_41_442 133
634 3300035091 Ga0373951_0008212 Ga0373951_0008212_913_1314 133
635 3300035111 Ga0373923_0047268 Ga0373923_0047268_1034_1465 133
636 3300035118 Ga0373954_0085213 Ga0373954_0085213_601_1032 133
637 3300035119 Ga0373956_0156274 Ga0373956_0156274_172_603 133
638 3300035121 Ga0373960_0161607 Ga0373960_0161607_246_647 133
639 3300035172 Ga0373955_1028398 Ga0373955_1028398_44_475 133
640 3300035242 Ga0373962_0121808 Ga0373962_0121808_398_799 133
641 3300035691 Ga0373931_0028286 Ga0373931_0028286_1023_1424 133
642 3300035692 Ga0373935_0309818 Ga0373935_0309818_325_756 133
643 3300036401 Ga0373937_0008086 Ga0373937_0008086_8368_8799 133
644 3300037312 Ga0395899_0001906 Ga0395899_0001906_11452_11853 133
645 3300037312 Ga0395899_0015290 Ga0395899_0015290_4297_4698 133
646 3300037312 Ga0395899_0033784 Ga0395899_0033784_625_1026 133
647 3300037312 Ga0395899_0041859 Ga0395899_0041859_796_1200 133
648 3300037312 Ga0395899_0099675 Ga0395899_0099675_357_758 133
649 3300037312 Ga0395899_0103209 Ga0395899_0103209_565_969 133
650 3300037312 Ga0395899_0106354 Ga0395899_0106354_1437_1838 133
651 3300037312 Ga0395899_0270210 Ga0395899_0270210_179_580 133
652 3300037312 Ga0395899_0442582 Ga0395899_0442582_381_782 133
653 3300037312 Ga0395899_0498246 Ga0395899_0498246_153_554 133
654 3300037312 Ga0395899_0824625 Ga0395899_0824625_19_420 133
655 3300037418 Ga0395900_0000447 Ga0395900_0000447_16379_16780 133
656 3300037418 Ga0395900_0055653 Ga0395900_0055653_983_1384 133
657 3300037418 Ga0395900_0070117 Ga0395900_0070117_615_1016 133
658 3300037418 Ga0395900_0079680 Ga0395900_0079680_2747_3148 133
659 3300037418 Ga0395900_0173564 Ga0395900_0173564_493_894 133
660 3300037418 Ga0395900_0239111 Ga0395900_0239111_723_1124 133
661 3300037418 Ga0395900_0253231 Ga0395900_0253231_925_1326 133
662 3300037418 Ga0395900_0315078 Ga0395900_0315078_1060_1461 133
663 3300037418 Ga0395900_0412256 Ga0395900_0412256_453_857 133
664 3300037418 Ga0395900_0442238 Ga0395900_0442238_569_970 133
665 3300037418 Ga0395900_0526478 Ga0395900_0526478_605_1006 133
666 3300037418 Ga0395900_0544897 Ga0395900_0544897_371_775 133
667 3300037418 Ga0395900_0833937 Ga0395900_0833937_87_488 133
668 3300037418 Ga0395900_0899189 Ga0395900_0899189_148_549 133
669 3300037418 Ga0395900_1033061 Ga0395900_1033061_135_563 133
670 3300037466 Ga0395898_0011697 Ga0395898_0011697_8625_9026 133
671 3300037466 Ga0395898_0083259 Ga0395898_0083259_851_1252 133
672 3300037466 Ga0395898_0088326 Ga0395898_0088326_362_763 133
673 3300037466 Ga0395898_0110666 Ga0395898_0110666_2014_2415 133
674 3300037466 Ga0395898_0111874 Ga0395898_0111874_272_673 133
675 3300037466 Ga0395898_0180232 Ga0395898_0180232_1131_1532 133
676 3300037466 Ga0395898_0629625 Ga0395898_0629625_382_783 133
677 3300037466 Ga0395898_0720986 Ga0395898_0720986_193_594 133
678 3300037471 Ga0395905_0000187 Ga0395905_0000187_64075_64503 133
679 3300037471 Ga0395905_0004624 Ga0395905_0004624_11278_11715 133
680 3300037471 Ga0395905_0019955 Ga0395905_0019955_5228_5629 133
681 3300037471 Ga0395905_0078505 Ga0395905_0078505_706_1107 133
682 3300037471 Ga0395905_0084520 Ga0395905_0084520_1699_2100 133
683 3300037471 Ga0395905_0246156 Ga0395905_0246156_1212_1613 133
684 3300037471 Ga0395905_0340970 Ga0395905_0340970_703_1104 133
685 3300037471 Ga0395905_0377867 Ga0395905_0377867_411_812 133
686 3300037471 Ga0395905_0403715 Ga0395905_0403715_515_934 133
687 3300037471 Ga0395905_1006643 Ga0395905_1006643_312_713 133
688 3300037471 Ga0395905_1329505 Ga0395905_1329505_37_438 133
689 3300037471 Ga0395905_1769107 Ga0395905_1769107_71_472 133
690 3300038443 Ga0395901_0000324 Ga0395901_0000324_16411_16812 133
691 3300038443 Ga0395901_0032370 Ga0395901_0032370_2357_2758 133
692 3300038443 Ga0395901_0043378 Ga0395901_0043378_3685_4086 133
693 3300038443 Ga0395901_0056287 Ga0395901_0056287_2816_3217 133
694 3300038443 Ga0395901_0115251 Ga0395901_0115251_428_829 133
695 3300038443 Ga0395901_0378893 Ga0395901_0378893_237_638 133
696 3300038443 Ga0395901_0726547 Ga0395901_0726547_34_435 133
697 3300038443 Ga0395901_1274975 Ga0395901_1274975_82_486 133
698 3300038443 Ga0395901_1502295 Ga0395901_1502295_159_560 133
699 3300044694 Ga0466963_0004598 Ga0466963_0004598_1692_2093 133
700 3300044694 Ga0466963_0005117 Ga0466963_0005117_2741_3142 133
701 3300044694 Ga0466963_0039353 Ga0466963_0039353_1487_1888 133
702 3300044694 Ga0466963_0124686 Ga0466963_0124686_956_1357 133
703 3300044694 Ga0466963_0242665 Ga0466963_0242665_190_591 133
704 3300044706 Ga0466964_0022607 Ga0466964_0022607_1031_1432 133
705 3300044719 Ga0466971_0062393 Ga0466971_0062393_639_1040 133
706 3300044719 Ga0466971_0400063 Ga0466971_0400063_237_638 133
707 3300044842 Ga0466957_0009743 Ga0466957_0009743_288_689 133
708 3300044842 Ga0466957_0095693 Ga0466957_0095693_410_811 133
709 3300044842 Ga0466957_0143882 Ga0466957_0143882_89_526 133
710 3300045836 Ga0466958_0001186 Ga0466958_0001186_6947_7348 133
711 3300045836 Ga0466958_0013790 Ga0466958_0013790_393_815 133
712 3300045836 Ga0466958_0118416 Ga0466958_0118416_248_685 133
713 3300045976 Ga0466967_0014760 Ga0466967_0014760_4011_4412 133
714 3300045976 Ga0466967_0016917 Ga0466967_0016917_3024_3425 133
715 3300045976 Ga0466967_0041146 Ga0466967_0041146_3055_3456 133
716 3300045976 Ga0466967_0043652 Ga0466967_0043652_16_417 133
717 3300045976 Ga0466967_0075882 Ga0466967_0075882_172_573 133
718 3300045976 Ga0466967_0098890 Ga0466967_0098890_258_659 133
719 3300045976 Ga0466967_0117896 Ga0466967_0117896_1154_1555 133
720 3300045976 Ga0466967_1286798 Ga0466967_1286798_54_455 133
721 3300046679 Ga0495623_0155323 Ga0495623_0155323_482_913 133
722 3300048905 Ga0496102_0134653 Ga0496102_0134653_1752_2153 133
723 3300048906 Ga0496103_0421365 Ga0496103_0421365_205_606 133
724 3300048909 Ga0496106_0229494 Ga0496106_0229494_912_1313 133
725 3300048910 Ga0496107_0346012 Ga0496107_0346012_231_632 133
726 3300048912 Ga0496109_0432629 Ga0496109_0432629_159_560 133
727 3300048913 Ga0496110_0543461 Ga0496110_0543461_614_1015 133
728 3300048915 Ga0496112_0006261 Ga0496112_0006261_4172_4573 133
729 3300049583 Ga0501067_0031805 Ga0501067_0031805_1967_2368 133
730 3300049586 Ga0501070_0446862 Ga0501070_0446862_126_527 133
731 3300049590 Ga0501074_0187914 Ga0501074_0187914_635_1036 133
732 3300049742 Ga0501080_0094630 Ga0501080_0094630_280_681 133
733 3300059508 Ga0587088_093176 Ga0587088_093176_212_613 133
734 3300059640 Ga0587067_091100 Ga0587067_091100_168_569 133
735 3300061719 Ga0466962_0024643 Ga0466962_0024643_964_1365 133
736 3300061734 Ga0530510_0772873 Ga0530510_0772873_191_592 133
737 2162886012 MBSR1b_contig_5802081 MBSR1b_0904.00000080 134
738 3300005293 Ga0065715_10340560 Ga0065715_103405601 134
739 3300032004 Ga0307414_11188522 Ga0307414_111885221 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

19

146

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v47-assembly1.cif.gz_A crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.6371 33 93
7b8w-assembly1.cif.gz_A structure of limk1 kinase domain with allosteric inhibitor th-470 0.6314 64 82
2gks-assembly1.cif.gz_B crystal structure of the bi-functional atp sulfurylase-aps kinase from aquifex aeolicus, a chemolithotrophic thermophile 0.6008 33 88
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.5956 62 93
5y6c-assembly2.cif.gz_B crystal structure of zmasch s128a mutant protein from zymomonas mobilis 0.5683 5 106
ID Description Score Start End Superfamily
af_I6X7G8_41_118_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6915 32 84 2.40.50.140
af_Q9VRJ1_539_644_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.6666 63 82 2.40.30.130
af_A0A1D6KPV4_2_110_3.40.395.10 Alpha Beta;3-Layer(aba) Sandwich;Adenoviral Proteinase; Chain;Adenoviral Proteinase; Chain A 0.6649 111 132 3.40.395.10
af_A0A2R8QQC0_103_236_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.657 29 82 2.40.10.10
af_I6YC99_39_118_2.40.30.170 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain 0.6329 32 84 2.40.30.170
ID Description Score Start End GO Terms
AF-A0A2W5APN5-F1-model_v4 DUF1489 domain-containing protein 0.9696 1 88
AF-A0A2W5APN5-F1-model_v4 DUF1489 domain-containing protein 0.9588 1 88
AF-A0A2R7IW93-F1-model_v4 DUF1489 domain-containing protein 0.9273 3 109
AF-A0A6A4U4Y7-F1-model_v4 DUF1489 domain-containing protein 0.9265 1 108
AF-A0A520HM13-F1-model_v4 DUF1489 family protein 0.922 4 109

Feature Viewer

pLDDT pTM Quality
91.17 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map