F478423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 298 | 720 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300053108|Ga0500562_004594|Ga0500562_004594_2133_2933 |
| Length | 266 |
| Sequence | MSPTMRNTMHSAPAPATPKREPSLQAERLSKSFLSGVVRVQVLQELSISIYPAELTLISGPSGCGKSTLLSLLSGLQPADSGHARALGEDLSKLNKRALERFRLKHTGFVFQGFNLFPALTAKEQVQLPLGYLGFDDKRSAARAMQALTEVGMTHRANAYPAQMSGGEKQRIAIARALAKEPELLFADEPTSALDADNGQKIIDILHGIARSHGTTVLCVSHDPRLVRHADRVLAMEDGAIRNDWQPSGHAPVRAERAALTADQHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 3 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 4 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 5 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 6 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 7 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 8 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 9 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 10 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 11 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 12 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 13 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 14 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 15 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 16 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 117 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 195 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 210 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 211 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 288 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 289 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 290 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 291 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 292 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 297 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 298 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.07 |
| Metatranscriptomes | 1.49 |
| Isolates | 2.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.05 |
| Nodule | 0.27 |
| Rhizoplane | 1.22 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1009123 | 3300001904 | Bacteria | 1641 |
| 2 | JGI24741J21665_1001625 | 3300001915 | Bacteria | 6285 |
| 3 | JGI24741J21665_1002187 | 3300001915 | Bacteria | 5191 |
| 4 | JGI24741J21665_1009546 | 3300001915 | Bacteria | 1777 |
| 5 | JGI24741J21665_1014773 | 3300001915 | Bacteria | 1298 |
| 6 | JGI24740J21852_10002171 | 3300001979 | Bacteria | 8971 |
| 7 | JGI24740J21852_10013580 | 3300001979 | Bacteria | 3032 |
| 8 | JGI25156J39149_1002818 | 3300002705 | Bacteria | 6001 |
| 9 | JGI25162J39368_1000605 | 3300002737 | Bacteria | 25839 |
| 10 | JGI25162J39368_1001369 | 3300002737 | Bacteria | 13418 |
| 11 | JGI25162J39368_1001619 | 3300002737 | Bacteria | 11287 |
| 12 | JGI25157J39369_1001681 | 3300002741 | Bacteria | 7511 |
| 13 | JGI25157J39369_1004324 | 3300002741 | Bacteria | 2618 |
| 14 | JGI25164J39214_1000390 | 3300002772 | Bacteria | 25835 |
| 15 | JGI25164J39214_1000439 | 3300002772 | Bacteria | 22628 |
| 16 | JGI25165J46597_1000725 | 3300003214 | Bacteria | 25839 |
| 17 | JGI25165J46597_1003866 | 3300003214 | Bacteria | 3477 |
| 18 | rootH2_10177447 | 3300003320 | Bacteria | 1783 |
| 19 | rootH1_10256714 | 3300003323 | Bacteria | 2426 |
| 20 | Ga0055538_1000251 | 3300003751 | Bacteria | 28537 |
| 21 | Ga0055539_1000286 | 3300003752 | Bacteria | 28537 |
| 22 | Ga0055533_1000274 | 3300003756 | Bacteria | 28154 |
| 23 | Ga0055532_1000316 | 3300003758 | Bacteria | 28537 |
| 24 | Ga0055525_1000384 | 3300003759 | Bacteria | 28537 |
| 25 | Ga0055526_1000012 | 3300003771 | Bacteria | 234368 |
| 26 | Ga0055537_1000021 | 3300003773 | Bacteria | 116840 |
| 27 | Ga0055524_1000037 | 3300003775 | Bacteria | 167140 |
| 28 | Ga0055534_1000006 | 3300003784 | Bacteria | 234368 |
| 29 | Ga0055528_1000006 | 3300003790 | Bacteria | 234368 |
| 30 | Ga0055541_1000185 | 3300003841 | Bacteria | 28537 |
| 31 | Ga0065165_1000566 | 3300005262 | Bacteria | 54948 |
| 32 | Ga0070658_10240450 | 3300005327 | Bacteria | 1534 |
| 33 | Ga0070658_10333580 | 3300005327 | Bacteria | 1296 |
| 34 | Ga0070658_10352043 | 3300005327 | Bacteria | 1261 |
| 35 | Ga0070676_10128970 | 3300005328 | Bacteria | 1597 |
| 36 | Ga0070683_100010639 | 3300005329 | Bacteria | 7909 |
| 37 | Ga0070683_100027521 | 3300005329 | Bacteria | 5128 |
| 38 | Ga0070670_100002058 | 3300005331 | Bacteria | 16469 |
| 39 | Ga0070670_100099592 | 3300005331 | Bacteria | 2501 |
| 40 | Ga0068869_100436686 | 3300005334 | Bacteria | 1083 |
| 41 | Ga0070666_10000350 | 3300005335 | Bacteria | 28941 |
| 42 | Ga0070666_10009638 | 3300005335 | Bacteria | 6026 |
| 43 | Ga0070666_10068370 | 3300005335 | Bacteria | 2414 |
| 44 | Ga0070680_100000239 | 3300005336 | Bacteria | 36253 |
| 45 | Ga0070680_100022260 | 3300005336 | Bacteria | 5045 |
| 46 | Ga0070680_100054006 | 3300005336 | Bacteria | 3279 |
| 47 | Ga0070680_100089125 | 3300005336 | Bacteria | 2553 |
| 48 | Ga0070680_100193900 | 3300005336 | Bacteria | 1712 |
| 49 | Ga0070682_100013760 | 3300005337 | Bacteria | 4664 |
| 50 | Ga0070660_100051419 | 3300005339 | Bacteria | 3173 |
| 51 | Ga0070660_100070368 | 3300005339 | Bacteria | 2730 |
| 52 | Ga0070660_100073009 | 3300005339 | Bacteria | 2682 |
| 53 | Ga0070660_100097751 | 3300005339 | Bacteria | 2323 |
| 54 | Ga0070660_100294005 | 3300005339 | Bacteria | 1330 |
| 55 | Ga0070660_100424355 | 3300005339 | Bacteria | 1101 |
| 56 | Ga0070691_10000595 | 3300005341 | Bacteria | 13871 |
| 57 | Ga0070691_10014457 | 3300005341 | Bacteria | 3622 |
| 58 | Ga0070691_10059932 | 3300005341 | Bacteria | 1829 |
| 59 | Ga0070691_10179881 | 3300005341 | Bacteria | 1100 |
| 60 | Ga0070661_100011682 | 3300005344 | Bacteria | 6123 |
| 61 | Ga0070661_100056566 | 3300005344 | Bacteria | 2874 |
| 62 | Ga0070661_100063654 | 3300005344 | Bacteria | 2709 |
| 63 | Ga0070661_100491766 | 3300005344 | Bacteria | 981 |
| 64 | Ga0070692_10001558 | 3300005345 | Bacteria | 8418 |
| 65 | Ga0070692_10003790 | 3300005345 | Bacteria | 6216 |
| 66 | Ga0070692_10007323 | 3300005345 | Bacteria | 4858 |
| 67 | Ga0070692_10175332 | 3300005345 | Bacteria | 1239 |
| 68 | Ga0070668_100040519 | 3300005347 | Bacteria | 3564 |
| 69 | Ga0070671_100335198 | 3300005355 | Bacteria | 1290 |
| 70 | Ga0070659_100017881 | 3300005366 | Bacteria | 5341 |
| 71 | Ga0070659_100047479 | 3300005366 | Bacteria | 3368 |
| 72 | Ga0070659_100448990 | 3300005366 | Bacteria | 1093 |
| 73 | Ga0070667_100045478 | 3300005367 | Bacteria | 3691 |
| 74 | Ga0070667_100076928 | 3300005367 | Bacteria | 2849 |
| 75 | Ga0070667_100145634 | 3300005367 | Bacteria | 2077 |
| 76 | Ga0070714_100000030 | 3300005435 | Bacteria | 136610 |
| 77 | Ga0070714_100002250 | 3300005435 | Bacteria | 14199 |
| 78 | Ga0070714_100226350 | 3300005435 | Bacteria | 1721 |
| 79 | Ga0070713_100001474 | 3300005436 | Bacteria | 15027 |
| 80 | Ga0070710_10008440 | 3300005437 | Bacteria | 5014 |
| 81 | Ga0070708_100132677 | 3300005445 | Bacteria | 2306 |
| 82 | Ga0070663_100013292 | 3300005455 | Bacteria | 5243 |
| 83 | Ga0070663_100016021 | 3300005455 | Bacteria | 4854 |
| 84 | Ga0070663_100225189 | 3300005455 | Bacteria | 1474 |
| 85 | Ga0070662_100211734 | 3300005457 | Bacteria | 1543 |
| 86 | Ga0070681_10000066 | 3300005458 | Bacteria | 75733 |
| 87 | Ga0070681_10001719 | 3300005458 | Bacteria | 19589 |
| 88 | Ga0070681_10005052 | 3300005458 | Bacteria | 12723 |
| 89 | Ga0070681_10169395 | 3300005458 | Bacteria | 2106 |
| 90 | Ga0070681_10396294 | 3300005458 | Bacteria | 1292 |
| 91 | Ga0068867_100164135 | 3300005459 | Bacteria | 1754 |
| 92 | Ga0070685_10004579 | 3300005466 | Bacteria | 6995 |
| 93 | Ga0070679_100000195 | 3300005530 | Bacteria | 49445 |
| 94 | Ga0070679_100001729 | 3300005530 | Bacteria | 19684 |
| 95 | Ga0070679_100036870 | 3300005530 | Bacteria | 4854 |
| 96 | Ga0070679_100094144 | 3300005530 | Bacteria | 2983 |
| 97 | Ga0070679_100109779 | 3300005530 | Bacteria | 2745 |
| 98 | Ga0070679_100125623 | 3300005530 | Bacteria | 2548 |
| 99 | Ga0070684_100010722 | 3300005535 | Bacteria | 7273 |
| 100 | Ga0070684_100043440 | 3300005535 | Bacteria | 3881 |
| 101 | Ga0068853_100000489 | 3300005539 | Bacteria | 27026 |
| 102 | Ga0068853_100005468 | 3300005539 | Bacteria | 9953 |
| 103 | Ga0068853_100012163 | 3300005539 | Bacteria | 6999 |
| 104 | Ga0068853_100016535 | 3300005539 | Bacteria | 6074 |
| 105 | Ga0068853_100017139 | 3300005539 | Bacteria | 5976 |
| 106 | Ga0068853_100023369 | 3300005539 | Bacteria | 5174 |
| 107 | Ga0068853_100109441 | 3300005539 | Bacteria | 2452 |
| 108 | Ga0068853_100120411 | 3300005539 | Bacteria | 2340 |
| 109 | Ga0068853_100504145 | 3300005539 | Bacteria | 1143 |
| 110 | Ga0070696_100041401 | 3300005546 | Bacteria | 3182 |
| 111 | Ga0070693_100027258 | 3300005547 | Bacteria | 3094 |
| 112 | Ga0070693_100040304 | 3300005547 | Bacteria | 2621 |
| 113 | Ga0070693_100045515 | 3300005547 | Bacteria | 2488 |
| 114 | Ga0070693_100087149 | 3300005547 | Bacteria | 1875 |
| 115 | Ga0070665_100000092 | 3300005548 | Bacteria | 174397 |
| 116 | Ga0070665_100002383 | 3300005548 | Bacteria | 20737 |
| 117 | Ga0070665_100192708 | 3300005548 | Bacteria | 2039 |
| 118 | Ga0068855_100028055 | 3300005563 | Bacteria | 6733 |
| 119 | Ga0068855_100053950 | 3300005563 | Bacteria | 4728 |
| 120 | Ga0068855_100070522 | 3300005563 | Bacteria | 4065 |
| 121 | Ga0068855_100113173 | 3300005563 | Bacteria | 3113 |
| 122 | Ga0068855_100191537 | 3300005563 | Bacteria | 2306 |
| 123 | Ga0068855_100286220 | 3300005563 | Bacteria | 1828 |
| 124 | Ga0068855_100528314 | 3300005563 | Bacteria | 1279 |
| 125 | Ga0070664_100093962 | 3300005564 | Bacteria | 2600 |
| 126 | Ga0070664_100360793 | 3300005564 | Bacteria | 1323 |
| 127 | Ga0070664_100459181 | 3300005564 | Bacteria | 1170 |
| 128 | Ga0068857_100013171 | 3300005577 | Bacteria | 7206 |
| 129 | Ga0068857_100013205 | 3300005577 | Bacteria | 7197 |
| 130 | Ga0068857_100052780 | 3300005577 | Bacteria | 3606 |
| 131 | Ga0068857_100067730 | 3300005577 | Bacteria | 3177 |
| 132 | Ga0068857_100084313 | 3300005577 | Bacteria | 2839 |
| 133 | Ga0068857_100170520 | 3300005577 | Bacteria | 1978 |
| 134 | Ga0068857_100257199 | 3300005577 | Bacteria | 1602 |
| 135 | Ga0068857_100259455 | 3300005577 | Bacteria | 1595 |
| 136 | Ga0068854_100070811 | 3300005578 | Bacteria | 2549 |
| 137 | Ga0068854_100098676 | 3300005578 | Bacteria | 2186 |
| 138 | Ga0068856_100000616 | 3300005614 | Bacteria | 39024 |
| 139 | Ga0068856_100002412 | 3300005614 | Bacteria | 19225 |
| 140 | Ga0068856_100030997 | 3300005614 | Bacteria | 5230 |
| 141 | Ga0068856_100136197 | 3300005614 | Bacteria | 2461 |
| 142 | Ga0068856_100137069 | 3300005614 | Bacteria | 2453 |
| 143 | Ga0068856_100178471 | 3300005614 | Bacteria | 2136 |
| 144 | Ga0068856_100381721 | 3300005614 | Bacteria | 1428 |
| 145 | Ga0068856_100631338 | 3300005614 | Bacteria | 1092 |
| 146 | Ga0068852_100007256 | 3300005616 | Bacteria | 8083 |
| 147 | Ga0068852_100040233 | 3300005616 | Bacteria | 3942 |
| 148 | Ga0068852_100111931 | 3300005616 | Bacteria | 2483 |
| 149 | Ga0068852_100136829 | 3300005616 | Bacteria | 2262 |
| 150 | Ga0068852_100154976 | 3300005616 | Bacteria | 2133 |
| 151 | Ga0068852_100351942 | 3300005616 | Bacteria | 1438 |
| 152 | Ga0068859_100017309 | 3300005617 | Bacteria | 7239 |
| 153 | Ga0068859_100035642 | 3300005617 | Bacteria | 4993 |
| 154 | Ga0068864_100007613 | 3300005618 | Bacteria | 8917 |
| 155 | Ga0068851_10000687 | 3300005834 | Bacteria | 14435 |
| 156 | Ga0068851_10023061 | 3300005834 | Bacteria | 3039 |
| 157 | Ga0068851_10025349 | 3300005834 | Bacteria | 2908 |
| 158 | Ga0068863_100015047 | 3300005841 | Bacteria | 7434 |
| 159 | Ga0068863_100161157 | 3300005841 | Bacteria | 2149 |
| 160 | Ga0068858_100001419 | 3300005842 | Bacteria | 24633 |
| 161 | Ga0068860_100003032 | 3300005843 | Bacteria | 17342 |
| 162 | Ga0068860_100020529 | 3300005843 | Bacteria | 6398 |
| 163 | Ga0068862_100000165 | 3300005844 | Bacteria | 73621 |
| 164 | Ga0068862_100051763 | 3300005844 | Bacteria | 3512 |
| 165 | Ga0075364_10008565 | 3300006051 | Bacteria | 6119 |
| 166 | Ga0070712_100040456 | 3300006175 | Bacteria | 3196 |
| 167 | Ga0097621_100099986 | 3300006237 | Bacteria | 2439 |
| 168 | Ga0097621_100238628 | 3300006237 | Bacteria | 1589 |
| 169 | Ga0068871_100572127 | 3300006358 | Bacteria | 1025 |
| 170 | Ga0068871_100632371 | 3300006358 | Bacteria | 976 |
| 171 | Ga0068865_100016347 | 3300006881 | Bacteria | 4747 |
| 172 | Ga0068865_100257754 | 3300006881 | Bacteria | 1379 |
| 173 | Ga0097620_100017309 | 3300006931 | Bacteria | 7239 |
| 174 | Ga0097620_100035641 | 3300006931 | Bacteria | 4993 |
| 175 | Ga0105251_10000872 | 3300009011 | Bacteria | 27050 |
| 176 | Ga0105250_10000043 | 3300009092 | Bacteria | 129336 |
| 177 | Ga0105240_10000315 | 3300009093 | Bacteria | 92923 |
| 178 | Ga0105240_10002058 | 3300009093 | Bacteria | 32990 |
| 179 | Ga0105240_10015231 | 3300009093 | Bacteria | 10462 |
| 180 | Ga0105240_10029279 | 3300009093 | Bacteria | 7179 |
| 181 | Ga0105240_10047100 | 3300009093 | Bacteria | 5458 |
| 182 | Ga0105240_10074811 | 3300009093 | Bacteria | 4180 |
| 183 | Ga0105240_10104490 | 3300009093 | Bacteria | 3440 |
| 184 | Ga0105240_10276126 | 3300009093 | Bacteria | 1933 |
| 185 | Ga0105240_10403121 | 3300009093 | Bacteria | 1540 |
| 186 | Ga0105240_10960550 | 3300009093 | Bacteria | 916 |
| 187 | Ga0105245_10157811 | 3300009098 | Bacteria | 2150 |
| 188 | Ga0105243_10001046 | 3300009148 | Bacteria | 25338 |
| 189 | Ga0105243_10030891 | 3300009148 | Bacteria | 4128 |
| 190 | Ga0105241_10007584 | 3300009174 | Bacteria | 7977 |
| 191 | Ga0105241_10009513 | 3300009174 | Bacteria | 7139 |
| 192 | Ga0105241_10043966 | 3300009174 | Bacteria | 3384 |
| 193 | Ga0105241_10113613 | 3300009174 | Bacteria | 2171 |
| 194 | Ga0105242_10002824 | 3300009176 | Bacteria | 13606 |
| 195 | Ga0105237_10000150 | 3300009545 | Bacteria | 97072 |
| 196 | Ga0105237_10008060 | 3300009545 | Bacteria | 11456 |
| 197 | Ga0105237_10014526 | 3300009545 | Bacteria | 8230 |
| 198 | Ga0105237_10027131 | 3300009545 | Bacteria | 5849 |
| 199 | Ga0105237_10107485 | 3300009545 | Bacteria | 2782 |
| 200 | Ga0105237_10150781 | 3300009545 | Bacteria | 2321 |
| 201 | Ga0105237_10193136 | 3300009545 | Bacteria | 2035 |
| 202 | Ga0105237_10195930 | 3300009545 | Bacteria | 2020 |
| 203 | Ga0105237_10234794 | 3300009545 | Bacteria | 1835 |
| 204 | Ga0105237_10440428 | 3300009545 | Bacteria | 1309 |
| 205 | Ga0105237_10480616 | 3300009545 | Bacteria | 1248 |
| 206 | Ga0105238_10000270 | 3300009551 | Bacteria | 58093 |
| 207 | Ga0105238_10002470 | 3300009551 | Bacteria | 18501 |
| 208 | Ga0105238_10010010 | 3300009551 | Bacteria | 9512 |
| 209 | Ga0105238_10011232 | 3300009551 | Bacteria | 9011 |
| 210 | Ga0105238_10013764 | 3300009551 | Bacteria | 8176 |
| 211 | Ga0105238_10171703 | 3300009551 | Bacteria | 2144 |
| 212 | Ga0105238_10277919 | 3300009551 | Bacteria | 1655 |
| 213 | Ga0105249_10031285 | 3300009553 | Bacteria | 4812 |
| 214 | Ga0105249_10112226 | 3300009553 | Bacteria | 2578 |
| 215 | Ga0105249_10268711 | 3300009553 | Bacteria | 1698 |
| 216 | Ga0105239_10000023 | 3300010375 | Bacteria | 257478 |
| 217 | Ga0105239_10004269 | 3300010375 | Bacteria | 17142 |
| 218 | Ga0105239_10007220 | 3300010375 | Bacteria | 12763 |
| 219 | Ga0105239_10010578 | 3300010375 | Bacteria | 10315 |
| 220 | Ga0105239_10039813 | 3300010375 | Bacteria | 5150 |
| 221 | Ga0105239_10235823 | 3300010375 | Bacteria | 2053 |
| 222 | Ga0105239_10459569 | 3300010375 | Bacteria | 1445 |
| 223 | Ga0105239_10907735 | 3300010375 | Bacteria | 1011 |
| 224 | Ga0105246_10010675 | 3300011119 | Bacteria | 5689 |
| 225 | Ga0157373_10009136 | 3300013100 | Bacteria | 7330 |
| 226 | Ga0157373_10027507 | 3300013100 | Bacteria | 4103 |
| 227 | Ga0157373_10073928 | 3300013100 | Bacteria | 2405 |
| 228 | Ga0157373_10126849 | 3300013100 | Bacteria | 1795 |
| 229 | Ga0157373_10158615 | 3300013100 | Bacteria | 1592 |
| 230 | Ga0157373_10226940 | 3300013100 | Bacteria | 1318 |
| 231 | Ga0157373_10330868 | 3300013100 | Bacteria | 1085 |
| 232 | Ga0157371_10021396 | 3300013102 | Bacteria | 4749 |
| 233 | Ga0157371_10037807 | 3300013102 | Bacteria | 3454 |
| 234 | Ga0157371_10037988 | 3300013102 | Bacteria | 3445 |
| 235 | Ga0157371_10077699 | 3300013102 | Bacteria | 2351 |
| 236 | Ga0157371_10270309 | 3300013102 | Bacteria | 1227 |
| 237 | Ga0157371_10308336 | 3300013102 | Bacteria | 1147 |
| 238 | Ga0157370_10000662 | 3300013104 | Bacteria | 42848 |
| 239 | Ga0157370_10001955 | 3300013104 | Bacteria | 25396 |
| 240 | Ga0157370_10057105 | 3300013104 | Bacteria | 3713 |
| 241 | Ga0157370_10072144 | 3300013104 | Bacteria | 3258 |
| 242 | Ga0157370_10076915 | 3300013104 | Bacteria | 3144 |
| 243 | Ga0157370_10077984 | 3300013104 | Bacteria | 3120 |
| 244 | Ga0157370_10289452 | 3300013104 | Bacteria | 1513 |
| 245 | Ga0157370_10358921 | 3300013104 | Bacteria | 1343 |
| 246 | Ga0157370_10362185 | 3300013104 | Bacteria | 1336 |
| 247 | Ga0157369_10000011 | 3300013105 | Bacteria | 271560 |
| 248 | Ga0157369_10011883 | 3300013105 | Bacteria | 9890 |
| 249 | Ga0157369_10015904 | 3300013105 | Bacteria | 8472 |
| 250 | Ga0157369_10037435 | 3300013105 | Bacteria | 5311 |
| 251 | Ga0157369_10062258 | 3300013105 | Bacteria | 4021 |
| 252 | Ga0157369_10729521 | 3300013105 | Bacteria | 1020 |
| 253 | Ga0157374_10435778 | 3300013296 | Bacteria | 1311 |
| 254 | Ga0157378_10000742 | 3300013297 | Bacteria | 30520 |
| 255 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 256 | Ga0163162_10043255 | 3300013306 | Bacteria | 4510 |
| 257 | Ga0157372_10001728 | 3300013307 | Bacteria | 23694 |
| 258 | Ga0157372_10021015 | 3300013307 | Bacteria | 7047 |
| 259 | Ga0157372_10031724 | 3300013307 | Bacteria | 5787 |
| 260 | Ga0157372_10034240 | 3300013307 | Bacteria | 5583 |
| 261 | Ga0157372_10058048 | 3300013307 | Bacteria | 4325 |
| 262 | Ga0157372_10072613 | 3300013307 | Bacteria | 3878 |
| 263 | Ga0157372_10084140 | 3300013307 | Bacteria | 3605 |
| 264 | Ga0157372_10119838 | 3300013307 | Bacteria | 3021 |
| 265 | Ga0157372_10262641 | 3300013307 | Bacteria | 2005 |
| 266 | Ga0157372_10307719 | 3300013307 | Bacteria | 1844 |
| 267 | Ga0157372_10327602 | 3300013307 | Bacteria | 1783 |
| 268 | Ga0157372_10513176 | 3300013307 | Bacteria | 1397 |
| 269 | Ga0157375_10000948 | 3300013308 | Bacteria | 25130 |
| 270 | Ga0163163_10001486 | 3300014325 | Bacteria | 19850 |
| 271 | Ga0163163_10004834 | 3300014325 | Bacteria | 11573 |
| 272 | Ga0182008_10000325 | 3300014497 | Bacteria | 37641 |
| 273 | Ga0182008_10002759 | 3300014497 | Bacteria | 10892 |
| 274 | Ga0157379_10003069 | 3300014968 | Bacteria | 14127 |
| 275 | Ga0157376_10006607 | 3300014969 | Bacteria | 8206 |
| 276 | Ga0182006_1031084 | 3300015261 | Bacteria | 2154 |
| 277 | Ga0182007_10013140 | 3300015262 | Bacteria | 3169 |
| 278 | Ga0182005_1010993 | 3300015265 | Bacteria | 2591 |
| 279 | Ga0183369_1020 | 3300015685 | Bacteria | 111322 |
| 280 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 281 | Ga0206356_10169834 | 3300020070 | Bacteria | 2490 |
| 282 | Ga0206356_10896713 | 3300020070 | Bacteria | 1497 |
| 283 | Ga0206356_11346780 | 3300020070 | Bacteria | 2325 |
| 284 | Ga0206354_10259504 | 3300020081 | Bacteria | 1293 |
| 285 | Ga0206354_10264878 | 3300020081 | Bacteria | 4356 |
| 286 | Ga0206353_10003797 | 3300020082 | Bacteria | 4820 |
| 287 | Ga0206353_10103272 | 3300020082 | Bacteria | 2295 |
| 288 | Ga0206353_10112387 | 3300020082 | Bacteria | 4221 |
| 289 | Ga0206353_11359476 | 3300020082 | Bacteria | 2154 |
| 290 | Ga0154015_1493589 | 3300020610 | Bacteria | 3005 |
| 291 | Ga0154015_1604739 | 3300020610 | Bacteria | 1330 |
| 292 | Ga0209435_100154 | 3300025206 | Bacteria | 22442 |
| 293 | Ga0209784_100152 | 3300025224 | Bacteria | 63246 |
| 294 | Ga0209566_100192 | 3300025225 | Bacteria | 63440 |
| 295 | Ga0209674_100196 | 3300025226 | Bacteria | 63246 |
| 296 | Ga0209674_103679 | 3300025226 | Bacteria | 2737 |
| 297 | Ga0209147_100330 | 3300025229 | Bacteria | 35746 |
| 298 | Ga0209563_100156 | 3300025230 | Bacteria | 63329 |
| 299 | Ga0207427_100118 | 3300025231 | Bacteria | 102109 |
| 300 | Ga0207427_100120 | 3300025231 | Bacteria | 101516 |
| 301 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 302 | Ga0209437_100231 | 3300025233 | Bacteria | 94387 |
| 303 | Ga0209437_101151 | 3300025233 | Bacteria | 7896 |
| 304 | Ga0209258_100615 | 3300025242 | Bacteria | 28576 |
| 305 | Ga0209646_1000332 | 3300025246 | Bacteria | 35552 |
| 306 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 307 | Ga0209026_1000122 | 3300025250 | Bacteria | 126140 |
| 308 | Ga0209677_100152 | 3300025253 | Bacteria | 63540 |
| 309 | Ga0209759_1002588 | 3300025256 | Bacteria | 7803 |
| 310 | Ga0209759_1006503 | 3300025256 | Bacteria | 3916 |
| 311 | Ga0209759_1016157 | 3300025256 | Bacteria | 1897 |
| 312 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 313 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 314 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 315 | Ga0209565_1002845 | 3300025263 | Bacteria | 5954 |
| 316 | Ga0209455_1000323 | 3300025272 | Bacteria | 47398 |
| 317 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 318 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 319 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 320 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 321 | Ga0209051_1025716 | 3300025303 | Bacteria | 2388 |
| 322 | Ga0207656_10000776 | 3300025321 | Bacteria | 10460 |
| 323 | Ga0207656_10159007 | 3300025321 | Bacteria | 1074 |
| 324 | Ga0207696_1000509 | 3300025711 | Bacteria | 32376 |
| 325 | Ga0207713_1003587 | 3300025735 | Bacteria | 10480 |
| 326 | Ga0207692_10005174 | 3300025898 | Bacteria | 5208 |
| 327 | Ga0207680_10000092 | 3300025903 | Bacteria | 41687 |
| 328 | Ga0207680_10037622 | 3300025903 | Bacteria | 2795 |
| 329 | Ga0207680_10138706 | 3300025903 | Bacteria | 1610 |
| 330 | Ga0207647_10000198 | 3300025904 | Bacteria | 49337 |
| 331 | Ga0207647_10003544 | 3300025904 | Bacteria | 11709 |
| 332 | Ga0207647_10006817 | 3300025904 | Bacteria | 8280 |
| 333 | Ga0207647_10017679 | 3300025904 | Bacteria | 4843 |
| 334 | Ga0207647_10074550 | 3300025904 | Bacteria | 2043 |
| 335 | Ga0207645_10150881 | 3300025907 | Bacteria | 1517 |
| 336 | Ga0207705_10001297 | 3300025909 | Bacteria | 20070 |
| 337 | Ga0207705_10002953 | 3300025909 | Bacteria | 13000 |
| 338 | Ga0207705_10005116 | 3300025909 | Bacteria | 9834 |
| 339 | Ga0207705_10007645 | 3300025909 | Bacteria | 7949 |
| 340 | Ga0207705_10143123 | 3300025909 | Bacteria | 1787 |
| 341 | Ga0207705_10156987 | 3300025909 | Bacteria | 1707 |
| 342 | Ga0207654_10026625 | 3300025911 | Bacteria | 3134 |
| 343 | Ga0207654_10074837 | 3300025911 | Bacteria | 2022 |
| 344 | Ga0207654_10189909 | 3300025911 | Bacteria | 1346 |
| 345 | Ga0207707_10000065 | 3300025912 | Bacteria | 106546 |
| 346 | Ga0207707_10000068 | 3300025912 | Bacteria | 103683 |
| 347 | Ga0207707_10001385 | 3300025912 | Bacteria | 22524 |
| 348 | Ga0207707_10003405 | 3300025912 | Bacteria | 14101 |
| 349 | Ga0207707_10011701 | 3300025912 | Bacteria | 7635 |
| 350 | Ga0207707_10030775 | 3300025912 | Bacteria | 4695 |
| 351 | Ga0207707_10106782 | 3300025912 | Bacteria | 2447 |
| 352 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 353 | Ga0207695_10000256 | 3300025913 | Bacteria | 135850 |
| 354 | Ga0207695_10001104 | 3300025913 | Bacteria | 46882 |
| 355 | Ga0207695_10002140 | 3300025913 | Bacteria | 29914 |
| 356 | Ga0207695_10004841 | 3300025913 | Bacteria | 18173 |
| 357 | Ga0207695_10006519 | 3300025913 | Bacteria | 15111 |
| 358 | Ga0207695_10022622 | 3300025913 | Bacteria | 7128 |
| 359 | Ga0207695_10027834 | 3300025913 | Bacteria | 6285 |
| 360 | Ga0207695_10028928 | 3300025913 | Bacteria | 6134 |
| 361 | Ga0207695_10424073 | 3300025913 | Bacteria | 1214 |
| 362 | Ga0207671_10000570 | 3300025914 | Bacteria | 49510 |
| 363 | Ga0207671_10000716 | 3300025914 | Bacteria | 42402 |
| 364 | Ga0207671_10009998 | 3300025914 | Bacteria | 7876 |
| 365 | Ga0207671_10011245 | 3300025914 | Bacteria | 7302 |
| 366 | Ga0207671_10054162 | 3300025914 | Bacteria | 2973 |
| 367 | Ga0207671_10426611 | 3300025914 | Bacteria | 1055 |
| 368 | Ga0207660_10000181 | 3300025917 | Bacteria | 40287 |
| 369 | Ga0207660_10000502 | 3300025917 | Bacteria | 26090 |
| 370 | Ga0207660_10001334 | 3300025917 | Bacteria | 16506 |
| 371 | Ga0207660_10010540 | 3300025917 | Bacteria | 6003 |
| 372 | Ga0207660_10013253 | 3300025917 | Bacteria | 5401 |
| 373 | Ga0207660_10013765 | 3300025917 | Bacteria | 5309 |
| 374 | Ga0207660_10048414 | 3300025917 | Bacteria | 3008 |
| 375 | Ga0207660_10361322 | 3300025917 | Bacteria | 1165 |
| 376 | Ga0207657_10018195 | 3300025919 | Bacteria | 6722 |
| 377 | Ga0207657_10018263 | 3300025919 | Bacteria | 6706 |
| 378 | Ga0207657_10021798 | 3300025919 | Bacteria | 6019 |
| 379 | Ga0207657_10044192 | 3300025919 | Bacteria | 3918 |
| 380 | Ga0207657_10086825 | 3300025919 | Bacteria | 2618 |
| 381 | Ga0207657_10096034 | 3300025919 | Bacteria | 2466 |
| 382 | Ga0207657_10105060 | 3300025919 | Bacteria | 2338 |
| 383 | Ga0207657_10140928 | 3300025919 | Bacteria | 1970 |
| 384 | Ga0207657_10324810 | 3300025919 | Bacteria | 1216 |
| 385 | Ga0207649_10001915 | 3300025920 | Bacteria | 11887 |
| 386 | Ga0207649_10009079 | 3300025920 | Bacteria | 5435 |
| 387 | Ga0207649_10018624 | 3300025920 | Bacteria | 3953 |
| 388 | Ga0207649_10048311 | 3300025920 | Bacteria | 2624 |
| 389 | Ga0207649_10265800 | 3300025920 | Bacteria | 1241 |
| 390 | Ga0207652_10000081 | 3300025921 | Bacteria | 103132 |
| 391 | Ga0207652_10000213 | 3300025921 | Bacteria | 61477 |
| 392 | Ga0207652_10002964 | 3300025921 | Bacteria | 14184 |
| 393 | Ga0207652_10076647 | 3300025921 | Bacteria | 2917 |
| 394 | Ga0207652_10079425 | 3300025921 | Bacteria | 2866 |
| 395 | Ga0207652_10079522 | 3300025921 | Bacteria | 2864 |
| 396 | Ga0207652_10110866 | 3300025921 | Bacteria | 2433 |
| 397 | Ga0207694_10000267 | 3300025924 | Bacteria | 49520 |
| 398 | Ga0207694_10002269 | 3300025924 | Bacteria | 15735 |
| 399 | Ga0207694_10010172 | 3300025924 | Bacteria | 7089 |
| 400 | Ga0207694_10019421 | 3300025924 | Bacteria | 5135 |
| 401 | Ga0207694_10052125 | 3300025924 | Bacteria | 3172 |
| 402 | Ga0207694_10219523 | 3300025924 | Bacteria | 1550 |
| 403 | Ga0207694_10756646 | 3300025924 | Bacteria | 820 |
| 404 | Ga0207650_10031088 | 3300025925 | Bacteria | 3853 |
| 405 | Ga0207687_10079930 | 3300025927 | Bacteria | 2358 |
| 406 | Ga0207700_10034895 | 3300025928 | Bacteria | 3616 |
| 407 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 408 | Ga0207664_10001232 | 3300025929 | Bacteria | 16942 |
| 409 | Ga0207664_10050239 | 3300025929 | Bacteria | 3288 |
| 410 | Ga0207644_10630627 | 3300025931 | Bacteria | 891 |
| 411 | Ga0207690_10019820 | 3300025932 | Bacteria | 4145 |
| 412 | Ga0207690_10022227 | 3300025932 | Bacteria | 3943 |
| 413 | Ga0207690_10056684 | 3300025932 | Bacteria | 2644 |
| 414 | Ga0207690_10091683 | 3300025932 | Bacteria | 2148 |
| 415 | Ga0207690_10166837 | 3300025932 | Bacteria | 1646 |
| 416 | Ga0207706_10014962 | 3300025933 | Bacteria | 7026 |
| 417 | Ga0207706_10016229 | 3300025933 | Bacteria | 6730 |
| 418 | Ga0207706_10035126 | 3300025933 | Bacteria | 4459 |
| 419 | Ga0207706_10124565 | 3300025933 | Bacteria | 2267 |
| 420 | Ga0207686_10004297 | 3300025934 | Bacteria | 7639 |
| 421 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 422 | Ga0207709_10068019 | 3300025935 | Bacteria | 2250 |
| 423 | Ga0207704_10022179 | 3300025938 | Bacteria | 3397 |
| 424 | Ga0207704_10316245 | 3300025938 | Bacteria | 1202 |
| 425 | Ga0207661_10054426 | 3300025944 | Bacteria | 3205 |
| 426 | Ga0207661_10061390 | 3300025944 | Bacteria | 3036 |
| 427 | Ga0207667_10005041 | 3300025949 | Bacteria | 16131 |
| 428 | Ga0207667_10015858 | 3300025949 | Bacteria | 8538 |
| 429 | Ga0207667_10018972 | 3300025949 | Bacteria | 7691 |
| 430 | Ga0207667_10030752 | 3300025949 | Bacteria | 5802 |
| 431 | Ga0207667_10037324 | 3300025949 | Bacteria | 5194 |
| 432 | Ga0207667_10044075 | 3300025949 | Bacteria | 4729 |
| 433 | Ga0207667_10251073 | 3300025949 | Bacteria | 1809 |
| 434 | Ga0207667_10508463 | 3300025949 | Bacteria | 1221 |
| 435 | Ga0207667_10565938 | 3300025949 | Bacteria | 1148 |
| 436 | Ga0207712_10000644 | 3300025961 | Bacteria | 27291 |
| 437 | Ga0207712_10156560 | 3300025961 | Bacteria | 1765 |
| 438 | Ga0207668_10238302 | 3300025972 | Bacteria | 1470 |
| 439 | Ga0207640_10001690 | 3300025981 | Bacteria | 11828 |
| 440 | Ga0207640_10006810 | 3300025981 | Bacteria | 6285 |
| 441 | Ga0207640_10019057 | 3300025981 | Bacteria | 4046 |
| 442 | Ga0207640_10040325 | 3300025981 | Bacteria | 2961 |
| 443 | Ga0207640_10050429 | 3300025981 | Bacteria | 2700 |
| 444 | Ga0207640_10058000 | 3300025981 | Bacteria | 2549 |
| 445 | Ga0207640_10171350 | 3300025981 | Bacteria | 1618 |
| 446 | Ga0207640_10321542 | 3300025981 | Bacteria | 1232 |
| 447 | Ga0207658_10004134 | 3300025986 | Bacteria | 10122 |
| 448 | Ga0207658_10846757 | 3300025986 | Bacteria | 831 |
| 449 | Ga0207677_10038712 | 3300026023 | Bacteria | 3128 |
| 450 | Ga0207677_10286619 | 3300026023 | Bacteria | 1354 |
| 451 | Ga0207703_10000769 | 3300026035 | Bacteria | 31525 |
| 452 | Ga0207703_10291821 | 3300026035 | Bacteria | 1484 |
| 453 | Ga0207639_10000125 | 3300026041 | Bacteria | 56190 |
| 454 | Ga0207639_10000240 | 3300026041 | Bacteria | 41113 |
| 455 | Ga0207639_10003606 | 3300026041 | Bacteria | 10399 |
| 456 | Ga0207639_10012868 | 3300026041 | Bacteria | 5838 |
| 457 | Ga0207639_10013363 | 3300026041 | Bacteria | 5746 |
| 458 | Ga0207639_10014688 | 3300026041 | Bacteria | 5515 |
| 459 | Ga0207639_10032218 | 3300026041 | Bacteria | 3857 |
| 460 | Ga0207639_10060096 | 3300026041 | Bacteria | 2931 |
| 461 | Ga0207639_10084919 | 3300026041 | Bacteria | 2516 |
| 462 | Ga0207639_10093507 | 3300026041 | Bacteria | 2411 |
| 463 | Ga0207639_10107689 | 3300026041 | Bacteria | 2264 |
| 464 | Ga0207639_10194346 | 3300026041 | Bacteria | 1735 |
| 465 | Ga0207639_10196705 | 3300026041 | Bacteria | 1726 |
| 466 | Ga0207639_10324537 | 3300026041 | Bacteria | 1368 |
| 467 | Ga0207639_10558508 | 3300026041 | Bacteria | 1052 |
| 468 | Ga0207678_10006481 | 3300026067 | Bacteria | 10384 |
| 469 | Ga0207678_10008510 | 3300026067 | Bacteria | 9044 |
| 470 | Ga0207678_10012413 | 3300026067 | Bacteria | 7478 |
| 471 | Ga0207678_10017779 | 3300026067 | Bacteria | 6243 |
| 472 | Ga0207678_10017867 | 3300026067 | Bacteria | 6230 |
| 473 | Ga0207678_10052558 | 3300026067 | Bacteria | 3514 |
| 474 | Ga0207678_10072036 | 3300026067 | Bacteria | 2961 |
| 475 | Ga0207678_10170506 | 3300026067 | Bacteria | 1858 |
| 476 | Ga0207678_10202868 | 3300026067 | Bacteria | 1696 |
| 477 | Ga0207702_10000143 | 3300026078 | Bacteria | 84903 |
| 478 | Ga0207702_10000321 | 3300026078 | Bacteria | 54950 |
| 479 | Ga0207702_10000843 | 3300026078 | Bacteria | 32128 |
| 480 | Ga0207702_10006583 | 3300026078 | Bacteria | 9986 |
| 481 | Ga0207702_10010147 | 3300026078 | Bacteria | 7886 |
| 482 | Ga0207702_10037018 | 3300026078 | Bacteria | 4082 |
| 483 | Ga0207702_10104728 | 3300026078 | Bacteria | 2504 |
| 484 | Ga0207702_10157551 | 3300026078 | Bacteria | 2071 |
| 485 | Ga0207702_10859371 | 3300026078 | Bacteria | 898 |
| 486 | Ga0207641_10013297 | 3300026088 | Bacteria | 6751 |
| 487 | Ga0207641_10044183 | 3300026088 | Bacteria | 3746 |
| 488 | Ga0207648_10026007 | 3300026089 | Bacteria | 5205 |
| 489 | Ga0207676_10004232 | 3300026095 | Bacteria | 10136 |
| 490 | Ga0207674_10013433 | 3300026116 | Bacteria | 9089 |
| 491 | Ga0207674_10017769 | 3300026116 | Bacteria | 7753 |
| 492 | Ga0207674_10019073 | 3300026116 | Bacteria | 7434 |
| 493 | Ga0207674_10048121 | 3300026116 | Bacteria | 4366 |
| 494 | Ga0207674_10063334 | 3300026116 | Bacteria | 3733 |
| 495 | Ga0207674_10138751 | 3300026116 | Bacteria | 2392 |
| 496 | Ga0207674_10147841 | 3300026116 | Bacteria | 2308 |
| 497 | Ga0207674_10255320 | 3300026116 | Bacteria | 1700 |
| 498 | Ga0207674_10264204 | 3300026116 | Bacteria | 1668 |
| 499 | Ga0207674_10410559 | 3300026116 | Bacteria | 1309 |
| 500 | Ga0207683_10198745 | 3300026121 | Bacteria | 1822 |
| 501 | Ga0207698_10002432 | 3300026142 | Bacteria | 11029 |
| 502 | Ga0207698_10010163 | 3300026142 | Bacteria | 6031 |
| 503 | Ga0207698_10059655 | 3300026142 | Bacteria | 2963 |
| 504 | Ga0207698_10103604 | 3300026142 | Bacteria | 2365 |
| 505 | Ga0207698_10103707 | 3300026142 | Bacteria | 2364 |
| 506 | Ga0207698_10208337 | 3300026142 | Bacteria | 1757 |
| 507 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 508 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 509 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 510 | Ga0268266_10402883 | 3300028379 | Bacteria | 1294 |
| 511 | Ga0268265_10000203 | 3300028380 | Bacteria | 69132 |
| 512 | Ga0268265_10160000 | 3300028380 | Bacteria | 1911 |
| 513 | Ga0268264_10005067 | 3300028381 | Bacteria | 11155 |
| 514 | Ga0268264_10031101 | 3300028381 | Bacteria | 4376 |
| 515 | Ga0268264_10295045 | 3300028381 | Bacteria | 1524 |
| 516 | Ga0265319_1005385 | 3300028563 | Bacteria | 6131 |
| 517 | Ga0265332_10047995 | 3300031238 | Bacteria | 1837 |
| 518 | Ga0265316_10111362 | 3300031344 | Bacteria | 2073 |
| 519 | Ga0316575_10012645 | 3300031665 | Bacteria | 3143 |
| 520 | Ga0316583_10029633 | 3300032133 | Bacteria | 1951 |
| 521 | Ga0373944_0101318 | 3300035089 | Bacteria | 973 |
| 522 | Ga0373953_0043343 | 3300035117 | Bacteria | 1796 |
| 523 | Ga0373957_0050392 | 3300035120 | Bacteria | 1591 |
| 524 | Ga0373933_0067021 | 3300035724 | Bacteria | 2177 |
| 525 | Ga0373937_0178226 | 3300036401 | Bacteria | 1995 |
| 526 | Ga0373937_0648871 | 3300036401 | Bacteria | 1001 |
| 527 | Ga0395899_0020935 | 3300037312 | Bacteria | 4960 |
| 528 | Ga0395899_0035784 | 3300037312 | Bacteria | 3726 |
| 529 | Ga0395899_0046833 | 3300037312 | Bacteria | 3220 |
| 530 | Ga0395899_0048433 | 3300037312 | Bacteria | 3163 |
| 531 | Ga0395900_0000013 | 3300037418 | Bacteria | 388765 |
| 532 | Ga0395900_0022037 | 3300037418 | Bacteria | 6515 |
| 533 | Ga0395898_0047872 | 3300037466 | Bacteria | 4193 |
| 534 | Ga0395898_0058393 | 3300037466 | Bacteria | 3755 |
| 535 | Ga0395898_0069262 | 3300037466 | Bacteria | 3413 |
| 536 | Ga0395898_0075288 | 3300037466 | Bacteria | 3260 |
| 537 | Ga0395898_0170099 | 3300037466 | Bacteria | 2083 |
| 538 | Ga0395898_0233893 | 3300037466 | Bacteria | 1752 |
| 539 | Ga0395898_0659858 | 3300037466 | Bacteria | 988 |
| 540 | Ga0395901_0002971 | 3300038443 | Bacteria | 17103 |
| 541 | Ga0395901_0048209 | 3300038443 | Bacteria | 4423 |
| 542 | Ga0395901_0079685 | 3300038443 | Bacteria | 3419 |
| 543 | Ga0395901_0115202 | 3300038443 | Bacteria | 2823 |
| 544 | Ga0395901_0180258 | 3300038443 | Bacteria | 2215 |
| 545 | Ga0451793_0131431 | 3300041452 | Bacteria | 7707 |
| 546 | Ga0451793_1859178 | 3300041452 | Bacteria | 3176 |
| 547 | Ga0451802_0471939 | 3300041460 | Bacteria | 1284 |
| 548 | Ga0451807_0042530 | 3300041486 | Bacteria | 1353 |
| 549 | Ga0451853_3345382 | 3300041512 | Bacteria | 1757 |
| 550 | Ga0439437_000473 | 3300042000 | Bacteria | 3961 |
| 551 | Ga0439432_099717 | 3300042006 | Bacteria | 870 |
| 552 | Ga0439459_0004955 | 3300042438 | Bacteria | 2166 |
| 553 | Ga0466972_0000428 | 3300044658 | Bacteria | 21873 |
| 554 | Ga0466972_0025123 | 3300044658 | Bacteria | 2955 |
| 555 | Ga0466972_0176680 | 3300044658 | Bacteria | 1001 |
| 556 | Ga0466982_0016592 | 3300044672 | Bacteria | 4069 |
| 557 | Ga0466965_0021725 | 3300044683 | Bacteria | 3092 |
| 558 | Ga0466965_0029584 | 3300044683 | Bacteria | 2666 |
| 559 | Ga0466961_0039104 | 3300044693 | Bacteria | 3041 |
| 560 | Ga0466971_0036019 | 3300044719 | Bacteria | 2219 |
| 561 | Ga0466968_0053825 | 3300044735 | Bacteria | 1725 |
| 562 | Ga0466970_0000215 | 3300044765 | Bacteria | 28327 |
| 563 | Ga0466957_0015743 | 3300044842 | Bacteria | 4418 |
| 564 | Ga0466957_0043009 | 3300044842 | Bacteria | 2734 |
| 565 | Ga0466959_0004244 | 3300045049 | Bacteria | 9561 |
| 566 | Ga0466959_0178873 | 3300045049 | Bacteria | 1484 |
| 567 | Ga0495638_0000268 | 3300046460 | Bacteria | 70252 |
| 568 | Ga0495580_0106478 | 3300046472 | Bacteria | 1948 |
| 569 | Ga0495639_0031776 | 3300046475 | Bacteria | 2352 |
| 570 | Ga0495585_0000243 | 3300046492 | Bacteria | 56533 |
| 571 | Ga0495606_0026152 | 3300046507 | Bacteria | 4163 |
| 572 | Ga0495631_0001374 | 3300046518 | Bacteria | 14834 |
| 573 | Ga0495648_0000551 | 3300046524 | Bacteria | 40309 |
| 574 | Ga0495665_0033925 | 3300046531 | Bacteria | 2729 |
| 575 | Ga0495633_0000648 | 3300046558 | Bacteria | 32320 |
| 576 | Ga0495661_0000731 | 3300046665 | Bacteria | 32210 |
| 577 | Ga0495657_0095530 | 3300046675 | Bacteria | 1900 |
| 578 | Ga0495646_0304090 | 3300046680 | Bacteria | 843 |
| 579 | Ga0495647_0028894 | 3300046681 | Bacteria | 2047 |
| 580 | Ga0495658_0002704 | 3300046683 | Bacteria | 8935 |
| 581 | Ga0495600_0075557 | 3300046809 | Bacteria | 2200 |
| 582 | Ga0495674_0195655 | 3300047319 | Bacteria | 1679 |
| 583 | Ga0495672_0083241 | 3300047320 | Bacteria | 1778 |
| 584 | Ga0495680_0255029 | 3300047322 | Bacteria | 1242 |
| 585 | Ga0495684_0087873 | 3300047471 | Bacteria | 2356 |
| 586 | Ga0495686_0101742 | 3300047472 | Bacteria | 1732 |
| 587 | Ga0496101_0045149 | 3300048904 | Bacteria | 3155 |
| 588 | Ga0496104_0000018 | 3300048907 | Bacteria | 258184 |
| 589 | Ga0496105_0000080 | 3300048908 | Bacteria | 70744 |
| 590 | Ga0496105_0024202 | 3300048908 | Bacteria | 4933 |
| 591 | Ga0496115_0046563 | 3300048918 | Bacteria | 3467 |
| 592 | Ga0496117_0000446 | 3300048920 | Bacteria | 68559 |
| 593 | Ga0496117_0007110 | 3300048920 | Bacteria | 11062 |
| 594 | Ga0496117_0009840 | 3300048920 | Bacteria | 8807 |
| 595 | Ga0496117_0027061 | 3300048920 | Bacteria | 4475 |
| 596 | Ga0496118_0000435 | 3300048921 | Bacteria | 69378 |
| 597 | Ga0496118_0001105 | 3300048921 | Bacteria | 41869 |
| 598 | Ga0496118_0004555 | 3300048921 | Bacteria | 16345 |
| 599 | Ga0496118_0004683 | 3300048921 | Bacteria | 16037 |
| 600 | Ga0496118_0027406 | 3300048921 | Bacteria | 4822 |
| 601 | Ga0496118_0029257 | 3300048921 | Bacteria | 4623 |
| 602 | Ga0496119_0000070 | 3300048922 | Bacteria | 154395 |
| 603 | Ga0496119_0006544 | 3300048922 | Bacteria | 10745 |
| 604 | Ga0496119_0018802 | 3300048922 | Bacteria | 5121 |
| 605 | Ga0496119_0215629 | 3300048922 | Bacteria | 985 |
| 606 | Ga0496120_0000102 | 3300048923 | Bacteria | 142902 |
| 607 | Ga0496120_0002333 | 3300048923 | Bacteria | 19523 |
| 608 | Ga0496120_0004153 | 3300048923 | Bacteria | 12446 |
| 609 | Ga0496121_0001076 | 3300048924 | Bacteria | 48261 |
| 610 | Ga0496121_0114834 | 3300048924 | Bacteria | 2046 |
| 611 | Ga0496121_0125277 | 3300048924 | Bacteria | 1932 |
| 612 | Ga0496122_0000158 | 3300048925 | Bacteria | 159352 |
| 613 | Ga0496122_0011062 | 3300048925 | Bacteria | 9207 |
| 614 | Ga0496122_0140225 | 3300048925 | Bacteria | 1514 |
| 615 | Ga0496122_0222322 | 3300048925 | Bacteria | 1082 |
| 616 | Ga0496123_0000120 | 3300048926 | Bacteria | 159406 |
| 617 | Ga0496123_0010063 | 3300048926 | Bacteria | 8418 |
| 618 | Ga0496124_0000203 | 3300048927 | Bacteria | 117239 |
| 619 | Ga0496124_0000878 | 3300048927 | Bacteria | 48905 |
| 620 | Ga0496125_0012798 | 3300048928 | Bacteria | 8294 |
| 621 | Ga0496126_0004589 | 3300048929 | Bacteria | 16383 |
| 622 | Ga0496126_0007768 | 3300048929 | Bacteria | 11689 |
| 623 | Ga0496126_0021788 | 3300048929 | Bacteria | 6251 |
| 624 | Ga0496126_0347605 | 3300048929 | Bacteria | 1214 |
| 625 | Ga0496126_0460540 | 3300048929 | Bacteria | 1022 |
| 626 | Ga0495682_0000883 | 3300049460 | Bacteria | 18594 |
| 627 | Ga0501031_0005684 | 3300049568 | Bacteria | 8126 |
| 628 | Ga0501031_0014285 | 3300049568 | Bacteria | 5164 |
| 629 | Ga0501032_0008936 | 3300049569 | Bacteria | 7286 |
| 630 | Ga0501032_0105838 | 3300049569 | Bacteria | 1863 |
| 631 | Ga0501033_0006130 | 3300049570 | Bacteria | 9433 |
| 632 | Ga0501033_0033042 | 3300049570 | Bacteria | 3884 |
| 633 | Ga0501033_0166033 | 3300049570 | Bacteria | 1587 |
| 634 | Ga0501034_0003070 | 3300049571 | Bacteria | 19267 |
| 635 | Ga0501034_0071587 | 3300049571 | Bacteria | 3476 |
| 636 | Ga0501036_0005927 | 3300049572 | Bacteria | 9901 |
| 637 | Ga0501036_0019138 | 3300049572 | Bacteria | 5744 |
| 638 | Ga0501037_0037870 | 3300049573 | Bacteria | 3555 |
| 639 | Ga0501037_0175319 | 3300049573 | Bacteria | 1523 |
| 640 | Ga0501037_0219457 | 3300049573 | Bacteria | 1338 |
| 641 | Ga0501038_0008956 | 3300049574 | Bacteria | 9181 |
| 642 | Ga0501038_0133263 | 3300049574 | Bacteria | 2037 |
| 643 | Ga0501039_0004893 | 3300049575 | Bacteria | 10148 |
| 644 | Ga0501039_0107282 | 3300049575 | Bacteria | 2181 |
| 645 | Ga0501042_0118016 | 3300049578 | Bacteria | 1910 |
| 646 | Ga0501043_0004035 | 3300049579 | Bacteria | 12005 |
| 647 | Ga0501043_0090036 | 3300049579 | Bacteria | 2412 |
| 648 | Ga0501043_0240682 | 3300049579 | Bacteria | 1395 |
| 649 | Ga0501046_0020479 | 3300049580 | Bacteria | 5467 |
| 650 | Ga0501046_0022726 | 3300049580 | Bacteria | 5164 |
| 651 | Ga0501046_0213589 | 3300049580 | Bacteria | 1431 |
| 652 | Ga0501047_0004426 | 3300049581 | Bacteria | 13226 |
| 653 | Ga0501047_0014646 | 3300049581 | Bacteria | 7463 |
| 654 | Ga0501047_0019997 | 3300049581 | Bacteria | 6427 |
| 655 | Ga0501047_0198948 | 3300049581 | Bacteria | 1865 |
| 656 | Ga0501047_0276685 | 3300049581 | Bacteria | 1524 |
| 657 | Ga0501048_0042126 | 3300049582 | Bacteria | 3270 |
| 658 | Ga0501048_0115858 | 3300049582 | Bacteria | 1893 |
| 659 | Ga0501068_0016217 | 3300049584 | Bacteria | 4293 |
| 660 | Ga0501068_0028538 | 3300049584 | Bacteria | 3300 |
| 661 | Ga0501068_0136740 | 3300049584 | Bacteria | 1535 |
| 662 | Ga0501069_0000120 | 3300049585 | Bacteria | 34758 |
| 663 | Ga0501069_0014310 | 3300049585 | Bacteria | 4240 |
| 664 | Ga0501069_0031114 | 3300049585 | Bacteria | 2934 |
| 665 | Ga0501069_0054731 | 3300049585 | Bacteria | 2222 |
| 666 | Ga0501069_0107940 | 3300049585 | Bacteria | 1583 |
| 667 | Ga0501070_0005739 | 3300049586 | Bacteria | 10581 |
| 668 | Ga0501070_0012712 | 3300049586 | Bacteria | 7100 |
| 669 | Ga0501070_0030546 | 3300049586 | Bacteria | 4514 |
| 670 | Ga0501070_0044461 | 3300049586 | Bacteria | 3695 |
| 671 | Ga0501070_0078344 | 3300049586 | Bacteria | 2735 |
| 672 | Ga0501070_0087500 | 3300049586 | Bacteria | 2578 |
| 673 | Ga0501070_0105949 | 3300049586 | Bacteria | 2324 |
| 674 | Ga0501070_0190053 | 3300049586 | Bacteria | 1688 |
| 675 | Ga0501071_0005802 | 3300049587 | Bacteria | 7974 |
| 676 | Ga0501072_0144965 | 3300049588 | Bacteria | 1893 |
| 677 | Ga0501073_0004628 | 3300049589 | Bacteria | 10336 |
| 678 | Ga0501073_0015266 | 3300049589 | Bacteria | 5571 |
| 679 | Ga0501073_0048846 | 3300049589 | Bacteria | 2968 |
| 680 | Ga0501074_0020446 | 3300049590 | Bacteria | 4811 |
| 681 | Ga0501074_0020502 | 3300049590 | Bacteria | 4804 |
| 682 | Ga0501074_0070868 | 3300049590 | Bacteria | 2506 |
| 683 | Ga0501074_0086869 | 3300049590 | Bacteria | 2240 |
| 684 | Ga0501076_0681750 | 3300049592 | Bacteria | 848 |
| 685 | Ga0501077_0010912 | 3300049593 | Bacteria | 5662 |
| 686 | Ga0501079_0006186 | 3300049741 | Bacteria | 8980 |
| 687 | Ga0501079_0417240 | 3300049741 | Bacteria | 1053 |
| 688 | Ga0501080_0003327 | 3300049742 | Bacteria | 14184 |
| 689 | Ga0501080_0032118 | 3300049742 | Bacteria | 4895 |
| 690 | Ga0501080_0046531 | 3300049742 | Bacteria | 4039 |
| 691 | Ga0501081_0167331 | 3300049743 | Bacteria | 1586 |
| 692 | Ga0501083_0063007 | 3300049744 | Bacteria | 2473 |
| 693 | Ga0501035_0000839 | 3300049822 | Bacteria | 32838 |
| 694 | Ga0501035_0003668 | 3300049822 | Bacteria | 14634 |
| 695 | Ga0501035_0009875 | 3300049822 | Bacteria | 8859 |
| 696 | Ga0501035_0052844 | 3300049822 | Bacteria | 3635 |
| 697 | Ga0501035_0078624 | 3300049822 | Bacteria | 2913 |
| 698 | Ga0501044_0003741 | 3300049823 | Bacteria | 17097 |
| 699 | Ga0501044_0018253 | 3300049823 | Bacteria | 7521 |
| 700 | Ga0501044_0026766 | 3300049823 | Bacteria | 6102 |
| 701 | Ga0501044_0033082 | 3300049823 | Bacteria | 5433 |
| 702 | Ga0501044_0073925 | 3300049823 | Bacteria | 3464 |
| 703 | Ga0501044_0084393 | 3300049823 | Bacteria | 3210 |
| 704 | Ga0501044_0089730 | 3300049823 | Bacteria | 3102 |
| 705 | Ga0501044_0099647 | 3300049823 | Bacteria | 2924 |
| 706 | Ga0501044_0122112 | 3300049823 | Bacteria | 2604 |
| 707 | Ga0501044_0436214 | 3300049823 | Bacteria | 1218 |
| 708 | Ga0501045_0008353 | 3300049824 | Bacteria | 7212 |
| 709 | Ga0500610_0000123 | 3300053079 | Bacteria | 23259 |
| 710 | Ga0500644_0153792 | 3300053088 | Bacteria | 924 |
| 711 | Ga0500651_0000556 | 3300053093 | Bacteria | 18970 |
| 712 | Ga0500651_0215153 | 3300053093 | Bacteria | 1129 |
| 713 | Ga0500562_004594 | 3300053108 | Bacteria | 3487 |
| 714 | Ga0500577_0100013 | 3300053142 | Bacteria | 1184 |
| 715 | Ga0500588_0014325 | 3300053146 | Bacteria | 2007 |
| 716 | Ga0500634_0029993 | 3300053161 | Bacteria | 2963 |
| 717 | Ga0500645_000606 | 3300053730 | Bacteria | 22970 |
| 718 | Ga0501084_0015227 | 3300054114 | Bacteria | 6377 |
| 719 | Ga0501082_0206839 | 3300060353 | Bacteria | 1707 |
| 720 | Ga0466962_0007471 | 3300061719 | Bacteria | 5244 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10352043 | Ga0070658_103520432 | 199 |
| 2 | 3300013100 | Ga0157373_10009136 | Ga0157373_100091362 | 199 |
| 3 | 3300005262 | Ga0065165_1000566 | Ga0065165_100056645 | 207 |
| 4 | 3300044672 | Ga0466982_0016592 | Ga0466982_0016592_2979_3722 | 208 |
| 5 | 3300044842 | Ga0466957_0043009 | Ga0466957_0043009_520_1263 | 208 |
| 6 | 3300037466 | Ga0395898_0047872 | Ga0395898_0047872_3248_3997 | 210 |
| 7 | 3300037466 | Ga0395898_0058393 | Ga0395898_0058393_1895_2638 | 210 |
| 8 | 3300038443 | Ga0395901_0048209 | Ga0395901_0048209_3242_3985 | 210 |
| 9 | 3300038443 | Ga0395901_0115202 | Ga0395901_0115202_21_770 | 210 |
| 10 | 3300038443 | Ga0395901_0180258 | Ga0395901_0180258_1034_1777 | 210 |
| 11 | 3300048929 | Ga0496126_0460540 | Ga0496126_0460540_120_860 | 214 |
| 12 | 3300044658 | Ga0466972_0176680 | Ga0466972_0176680_13_672 | 217 |
| 13 | 3300053161 | Ga0500634_0029993 | Ga0500634_0029993_23_688 | 218 |
| 14 | 3300036401 | Ga0373937_0648871 | Ga0373937_0648871_317_982 | 219 |
| 15 | 3300013307 | Ga0157372_10031724 | Ga0157372_100317245 | 220 |
| 16 | 3300048927 | Ga0496124_0000203 | Ga0496124_0000203_39913_40677 | 223 |
| 17 | 3300049581 | Ga0501047_0276685 | Ga0501047_0276685_115_804 | 223 |
| 18 | 3300005577 | Ga0068857_100013205 | Ga0068857_1000132057 | 226 |
| 19 | 3300005614 | Ga0068856_100136197 | Ga0068856_1001361972 | 226 |
| 20 | 3300009093 | Ga0105240_10002058 | Ga0105240_100020585 | 226 |
| 21 | 3300010375 | Ga0105239_10000023 | Ga0105239_10000023192 | 226 |
| 22 | 3300025913 | Ga0207695_10001104 | Ga0207695_1000110427 | 226 |
| 23 | 3300026078 | Ga0207702_10157551 | Ga0207702_101575512 | 226 |
| 24 | 3300026116 | Ga0207674_10013433 | Ga0207674_100134336 | 226 |
| 25 | 3300037312 | Ga0395899_0020935 | Ga0395899_0020935_3517_4260 | 226 |
| 26 | 3300037418 | Ga0395900_0022037 | Ga0395900_0022037_2543_3286 | 226 |
| 27 | 3300037466 | Ga0395898_0075288 | Ga0395898_0075288_1280_2023 | 226 |
| 28 | 3300038443 | Ga0395901_0079685 | Ga0395901_0079685_829_1572 | 226 |
| 29 | 3300048904 | Ga0496101_0045149 | Ga0496101_0045149_961_1716 | 226 |
| 30 | 3300048908 | Ga0496105_0024202 | Ga0496105_0024202_2381_3136 | 226 |
| 31 | 3300048918 | Ga0496115_0046563 | Ga0496115_0046563_293_1048 | 226 |
| 32 | 3300048920 | Ga0496117_0007110 | Ga0496117_0007110_2827_3582 | 226 |
| 33 | 3300048920 | Ga0496117_0009840 | Ga0496117_0009840_2552_3307 | 226 |
| 34 | 3300048921 | Ga0496118_0004555 | Ga0496118_0004555_4280_5035 | 226 |
| 35 | 3300048921 | Ga0496118_0004683 | Ga0496118_0004683_11322_12077 | 226 |
| 36 | 3300048922 | Ga0496119_0000070 | Ga0496119_0000070_97157_97912 | 226 |
| 37 | 3300048922 | Ga0496119_0018802 | Ga0496119_0018802_3673_4431 | 226 |
| 38 | 3300048923 | Ga0496120_0002333 | Ga0496120_0002333_14424_15182 | 226 |
| 39 | 3300048923 | Ga0496120_0004153 | Ga0496120_0004153_4336_5091 | 226 |
| 40 | 3300048924 | Ga0496121_0114834 | Ga0496121_0114834_1237_1977 | 226 |
| 41 | 3300048924 | Ga0496121_0125277 | Ga0496121_0125277_596_1351 | 226 |
| 42 | 3300048929 | Ga0496126_0004589 | Ga0496126_0004589_11544_12299 | 226 |
| 43 | 3300009148 | Ga0105243_10030891 | Ga0105243_100308913 | 227 |
| 44 | 3300015265 | Ga0182005_1010993 | Ga0182005_10109933 | 227 |
| 45 | 3300025935 | Ga0207709_10068019 | Ga0207709_100680192 | 227 |
| 46 | 3300048921 | Ga0496118_0029257 | Ga0496118_0029257_865_1638 | 227 |
| 47 | 3300048929 | Ga0496126_0007768 | Ga0496126_0007768_6561_7334 | 227 |
| 48 | 3300049581 | Ga0501047_0198948 | Ga0501047_0198948_775_1458 | 227 |
| 49 | 3300049823 | Ga0501044_0089730 | Ga0501044_0089730_336_1019 | 227 |
| 50 | 3300047472 | Ga0495686_0101742 | Ga0495686_0101742_206_895 | 228 |
| 51 | iso_pu_bacteria | 2671180531 | 2673161525 | 228 |
| 52 | 3300005614 | Ga0068856_100000616 | Ga0068856_1000006162 | 229 |
| 53 | 3300013105 | Ga0157369_10037435 | Ga0157369_100374355 | 229 |
| 54 | 3300026078 | Ga0207702_10000143 | Ga0207702_1000014323 | 229 |
| 55 | 3300026078 | Ga0207702_10000321 | Ga0207702_1000032155 | 229 |
| 56 | 3300049584 | Ga0501068_0136740 | Ga0501068_0136740_225_959 | 229 |
| 57 | 3300049823 | Ga0501044_0073925 | Ga0501044_0073925_1104_1838 | 229 |
| 58 | 3300054114 | Ga0501084_0015227 | Ga0501084_0015227_1706_2431 | 229 |
| 59 | 3300028563 | Ga0265319_1005385 | Ga0265319_10053852 | 230 |
| 60 | 3300005331 | Ga0070670_100099592 | Ga0070670_1000995922 | 231 |
| 61 | 3300005347 | Ga0070668_100040519 | Ga0070668_1000405192 | 231 |
| 62 | 3300005367 | Ga0070667_100076928 | Ga0070667_1000769282 | 231 |
| 63 | 3300005539 | Ga0068853_100000489 | Ga0068853_1000004895 | 231 |
| 64 | 3300005548 | Ga0070665_100000092 | Ga0070665_1000000922 | 231 |
| 65 | 3300005563 | Ga0068855_100053950 | Ga0068855_1000539503 | 231 |
| 66 | 3300005577 | Ga0068857_100013171 | Ga0068857_1000131712 | 231 |
| 67 | 3300005617 | Ga0068859_100017309 | Ga0068859_1000173097 | 231 |
| 68 | 3300005844 | Ga0068862_100000165 | Ga0068862_10000016559 | 231 |
| 69 | 3300005844 | Ga0068862_100051763 | Ga0068862_1000517632 | 231 |
| 70 | 3300006931 | Ga0097620_100017309 | Ga0097620_1000173097 | 231 |
| 71 | 3300009545 | Ga0105237_10193136 | Ga0105237_101931362 | 231 |
| 72 | 3300010375 | Ga0105239_10004269 | Ga0105239_100042698 | 231 |
| 73 | 3300025303 | Ga0209051_1025716 | Ga0209051_10257164 | 231 |
| 74 | 3300025933 | Ga0207706_10124565 | Ga0207706_101245653 | 231 |
| 75 | 3300025949 | Ga0207667_10251073 | Ga0207667_102510732 | 231 |
| 76 | 3300025972 | Ga0207668_10238302 | Ga0207668_102383022 | 231 |
| 77 | 3300025986 | Ga0207658_10004134 | Ga0207658_100041346 | 231 |
| 78 | 3300025986 | Ga0207658_10846757 | Ga0207658_108467572 | 231 |
| 79 | 3300026041 | Ga0207639_10003606 | Ga0207639_100036067 | 231 |
| 80 | 3300026116 | Ga0207674_10017769 | Ga0207674_100177694 | 231 |
| 81 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000013480 | 231 |
| 82 | 3300028380 | Ga0268265_10000203 | Ga0268265_1000020356 | 231 |
| 83 | 3300028380 | Ga0268265_10160000 | Ga0268265_101600002 | 231 |
| 84 | 3300046492 | Ga0495585_0000243 | Ga0495585_0000243_27198_27899 | 231 |
| 85 | 3300046518 | Ga0495631_0001374 | Ga0495631_0001374_1722_2423 | 231 |
| 86 | 3300046524 | Ga0495648_0000551 | Ga0495648_0000551_27170_27871 | 231 |
| 87 | 3300046558 | Ga0495633_0000648 | Ga0495633_0000648_6879_7607 | 231 |
| 88 | 3300046665 | Ga0495661_0000731 | Ga0495661_0000731_27084_27785 | 231 |
| 89 | 3300048920 | Ga0496117_0027061 | Ga0496117_0027061_1189_1893 | 231 |
| 90 | 3300048921 | Ga0496118_0000435 | Ga0496118_0000435_63276_63980 | 231 |
| 91 | 3300048925 | Ga0496122_0011062 | Ga0496122_0011062_924_1676 | 231 |
| 92 | 3300048925 | Ga0496122_0222322 | Ga0496122_0222322_266_970 | 231 |
| 93 | 3300048926 | Ga0496123_0010063 | Ga0496123_0010063_3218_3970 | 231 |
| 94 | 3300049460 | Ga0495682_0000883 | Ga0495682_0000883_14645_15346 | 231 |
| 95 | 3300049568 | Ga0501031_0005684 | Ga0501031_0005684_1280_1984 | 231 |
| 96 | 3300049568 | Ga0501031_0014285 | Ga0501031_0014285_2702_3403 | 231 |
| 97 | 3300049569 | Ga0501032_0008936 | Ga0501032_0008936_3494_4198 | 231 |
| 98 | 3300049569 | Ga0501032_0105838 | Ga0501032_0105838_715_1416 | 231 |
| 99 | 3300049570 | Ga0501033_0006130 | Ga0501033_0006130_6861_7565 | 231 |
| 100 | 3300049570 | Ga0501033_0033042 | Ga0501033_0033042_715_1416 | 231 |
| 101 | 3300049571 | Ga0501034_0003070 | Ga0501034_0003070_7419_8123 | 231 |
| 102 | 3300049571 | Ga0501034_0071587 | Ga0501034_0071587_1951_2652 | 231 |
| 103 | 3300049572 | Ga0501036_0005927 | Ga0501036_0005927_7270_7974 | 231 |
| 104 | 3300049572 | Ga0501036_0019138 | Ga0501036_0019138_3499_4200 | 231 |
| 105 | 3300049573 | Ga0501037_0037870 | Ga0501037_0037870_56_760 | 231 |
| 106 | 3300049574 | Ga0501038_0008956 | Ga0501038_0008956_1063_1767 | 231 |
| 107 | 3300049574 | Ga0501038_0133263 | Ga0501038_0133263_1004_1705 | 231 |
| 108 | 3300049575 | Ga0501039_0004893 | Ga0501039_0004893_4491_5195 | 231 |
| 109 | 3300049575 | Ga0501039_0107282 | Ga0501039_0107282_1009_1710 | 231 |
| 110 | 3300049578 | Ga0501042_0118016 | Ga0501042_0118016_1005_1706 | 231 |
| 111 | 3300049579 | Ga0501043_0004035 | Ga0501043_0004035_31_735 | 231 |
| 112 | 3300049579 | Ga0501043_0240682 | Ga0501043_0240682_333_1034 | 231 |
| 113 | 3300049580 | Ga0501046_0020479 | Ga0501046_0020479_1462_2163 | 231 |
| 114 | 3300049580 | Ga0501046_0022726 | Ga0501046_0022726_1062_1766 | 231 |
| 115 | 3300049581 | Ga0501047_0004426 | Ga0501047_0004426_5340_6044 | 231 |
| 116 | 3300049581 | Ga0501047_0019997 | Ga0501047_0019997_4601_5302 | 231 |
| 117 | 3300049582 | Ga0501048_0042126 | Ga0501048_0042126_1757_2461 | 231 |
| 118 | 3300049584 | Ga0501068_0016217 | Ga0501068_0016217_263_967 | 231 |
| 119 | 3300049584 | Ga0501068_0028538 | Ga0501068_0028538_2267_2968 | 231 |
| 120 | 3300049585 | Ga0501069_0107940 | Ga0501069_0107940_472_1173 | 231 |
| 121 | 3300049586 | Ga0501070_0087500 | Ga0501070_0087500_116_817 | 231 |
| 122 | 3300049586 | Ga0501070_0105949 | Ga0501070_0105949_423_1124 | 231 |
| 123 | 3300049587 | Ga0501071_0005802 | Ga0501071_0005802_5350_6051 | 231 |
| 124 | 3300049588 | Ga0501072_0144965 | Ga0501072_0144965_212_913 | 231 |
| 125 | 3300049589 | Ga0501073_0004628 | Ga0501073_0004628_2833_3537 | 231 |
| 126 | 3300049589 | Ga0501073_0048846 | Ga0501073_0048846_2203_2904 | 231 |
| 127 | 3300049590 | Ga0501074_0086869 | Ga0501074_0086869_393_1094 | 231 |
| 128 | 3300049592 | Ga0501076_0681750 | Ga0501076_0681750_33_734 | 231 |
| 129 | 3300049741 | Ga0501079_0006186 | Ga0501079_0006186_2357_3058 | 231 |
| 130 | 3300049742 | Ga0501080_0003327 | Ga0501080_0003327_2209_2913 | 231 |
| 131 | 3300049743 | Ga0501081_0167331 | Ga0501081_0167331_14_715 | 231 |
| 132 | 3300049744 | Ga0501083_0063007 | Ga0501083_0063007_687_1388 | 231 |
| 133 | 3300049822 | Ga0501035_0003668 | Ga0501035_0003668_7856_8560 | 231 |
| 134 | 3300049822 | Ga0501035_0052844 | Ga0501035_0052844_347_1048 | 231 |
| 135 | 3300049822 | Ga0501035_0078624 | Ga0501035_0078624_65_766 | 231 |
| 136 | 3300049823 | Ga0501044_0018253 | Ga0501044_0018253_2363_3067 | 231 |
| 137 | 3300049823 | Ga0501044_0033082 | Ga0501044_0033082_310_1011 | 231 |
| 138 | 3300049823 | Ga0501044_0122112 | Ga0501044_0122112_142_843 | 231 |
| 139 | 3300049824 | Ga0501045_0008353 | Ga0501045_0008353_2407_3108 | 231 |
| 140 | 3300053730 | Ga0500645_000606 | Ga0500645_000606_16506_17207 | 231 |
| 141 | 3300060353 | Ga0501082_0206839 | Ga0501082_0206839_305_1006 | 231 |
| 142 | 3300005345 | Ga0070692_10175332 | Ga0070692_101753322 | 232 |
| 143 | 3300005435 | Ga0070714_100000030 | Ga0070714_10000003049 | 232 |
| 144 | 3300005458 | Ga0070681_10396294 | Ga0070681_103962942 | 232 |
| 145 | 3300005547 | Ga0070693_100087149 | Ga0070693_1000871492 | 232 |
| 146 | 3300005564 | Ga0070664_100459181 | Ga0070664_1004591812 | 232 |
| 147 | 3300006051 | Ga0075364_10008565 | Ga0075364_100085653 | 232 |
| 148 | 3300009092 | Ga0105250_10000043 | Ga0105250_1000004384 | 232 |
| 149 | 3300009093 | Ga0105240_10403121 | Ga0105240_104031212 | 232 |
| 150 | 3300009148 | Ga0105243_10001046 | Ga0105243_100010469 | 232 |
| 151 | 3300009545 | Ga0105237_10195930 | Ga0105237_101959302 | 232 |
| 152 | 3300013105 | Ga0157369_10729521 | Ga0157369_107295211 | 232 |
| 153 | 3300025711 | Ga0207696_1000509 | Ga0207696_100050928 | 232 |
| 154 | 3300025904 | Ga0207647_10017679 | Ga0207647_100176796 | 232 |
| 155 | 3300025909 | Ga0207705_10156987 | Ga0207705_101569872 | 232 |
| 156 | 3300025912 | Ga0207707_10030775 | Ga0207707_100307752 | 232 |
| 157 | 3300025913 | Ga0207695_10424073 | Ga0207695_104240732 | 232 |
| 158 | 3300025919 | Ga0207657_10105060 | Ga0207657_101050603 | 232 |
| 159 | 3300025924 | Ga0207694_10756646 | Ga0207694_107566462 | 232 |
| 160 | 3300025929 | Ga0207664_10000026 | Ga0207664_10000026105 | 232 |
| 161 | 3300025933 | Ga0207706_10016229 | Ga0207706_100162292 | 232 |
| 162 | 3300025935 | Ga0207709_10000070 | Ga0207709_1000007042 | 232 |
| 163 | 3300026041 | Ga0207639_10324537 | Ga0207639_103245372 | 232 |
| 164 | 3300026067 | Ga0207678_10202868 | Ga0207678_102028682 | 232 |
| 165 | 3300027111 | Ga0209281_1000029 | Ga0209281_1000029191 | 232 |
| 166 | 3300042006 | Ga0439432_099717 | Ga0439432_099717_81_818 | 232 |
| 167 | 3300044683 | Ga0466965_0029584 | Ga0466965_0029584_1009_1758 | 232 |
| 168 | 3300044693 | Ga0466961_0039104 | Ga0466961_0039104_121_870 | 232 |
| 169 | 3300044719 | Ga0466971_0036019 | Ga0466971_0036019_1010_1759 | 232 |
| 170 | 3300044842 | Ga0466957_0015743 | Ga0466957_0015743_2280_3029 | 232 |
| 171 | 3300045049 | Ga0466959_0178873 | Ga0466959_0178873_56_805 | 232 |
| 172 | 3300048929 | Ga0496126_0347605 | Ga0496126_0347605_163_861 | 232 |
| 173 | 3300049573 | Ga0501037_0219457 | Ga0501037_0219457_206_904 | 232 |
| 174 | 3300049590 | Ga0501074_0070868 | Ga0501074_0070868_975_1673 | 232 |
| 175 | 3300049823 | Ga0501044_0099647 | Ga0501044_0099647_1739_2437 | 232 |
| 176 | 3300061719 | Ga0466962_0007471 | Ga0466962_0007471_2932_3681 | 232 |
| 177 | iso_pu_bacteria | 2721755523 | 2722880943 | 232 |
| 178 | iso_pu_bacteria | 2939611941 | 2939612609 | 232 |
| 179 | 3300001979 | JGI24740J21852_10002171 | JGI24740J21852_100021715 | 234 |
| 180 | 3300005329 | Ga0070683_100010639 | Ga0070683_1000106393 | 234 |
| 181 | 3300005336 | Ga0070680_100054006 | Ga0070680_1000540063 | 234 |
| 182 | 3300005339 | Ga0070660_100073009 | Ga0070660_1000730093 | 234 |
| 183 | 3300005341 | Ga0070691_10179881 | Ga0070691_101798812 | 234 |
| 184 | 3300005345 | Ga0070692_10001558 | Ga0070692_100015585 | 234 |
| 185 | 3300005535 | Ga0070684_100010722 | Ga0070684_1000107222 | 234 |
| 186 | 3300005577 | Ga0068857_100084313 | Ga0068857_1000843132 | 234 |
| 187 | 3300005616 | Ga0068852_100111931 | Ga0068852_1001119312 | 234 |
| 188 | 3300013100 | Ga0157373_10027507 | Ga0157373_100275072 | 234 |
| 189 | 3300013307 | Ga0157372_10262641 | Ga0157372_102626412 | 234 |
| 190 | 3300020070 | Ga0206356_10169834 | Ga0206356_101698342 | 234 |
| 191 | 3300020081 | Ga0206354_10259504 | Ga0206354_102595042 | 234 |
| 192 | 3300020082 | Ga0206353_10112387 | Ga0206353_101123874 | 234 |
| 193 | 3300020610 | Ga0154015_1493589 | Ga0154015_14935892 | 234 |
| 194 | 3300025904 | Ga0207647_10003544 | Ga0207647_100035445 | 234 |
| 195 | 3300025909 | Ga0207705_10001297 | Ga0207705_1000129721 | 234 |
| 196 | 3300025912 | Ga0207707_10011701 | Ga0207707_100117014 | 234 |
| 197 | 3300025913 | Ga0207695_10027834 | Ga0207695_100278343 | 234 |
| 198 | 3300025917 | Ga0207660_10013253 | Ga0207660_100132534 | 234 |
| 199 | 3300025919 | Ga0207657_10044192 | Ga0207657_100441922 | 234 |
| 200 | 3300025920 | Ga0207649_10009079 | Ga0207649_100090794 | 234 |
| 201 | 3300025921 | Ga0207652_10079522 | Ga0207652_100795223 | 234 |
| 202 | 3300025944 | Ga0207661_10054426 | Ga0207661_100544261 | 234 |
| 203 | 3300025949 | Ga0207667_10044075 | Ga0207667_100440754 | 234 |
| 204 | 3300025981 | Ga0207640_10006810 | Ga0207640_100068103 | 234 |
| 205 | 3300026067 | Ga0207678_10017867 | Ga0207678_100178674 | 234 |
| 206 | 3300026078 | Ga0207702_10104728 | Ga0207702_101047282 | 234 |
| 207 | 3300026116 | Ga0207674_10063334 | Ga0207674_100633343 | 234 |
| 208 | 3300026142 | Ga0207698_10002432 | Ga0207698_100024322 | 234 |
| 209 | 3300044658 | Ga0466972_0000428 | Ga0466972_0000428_15604_16317 | 234 |
| 210 | 3300044683 | Ga0466965_0021725 | Ga0466965_0021725_1594_2319 | 234 |
| 211 | 3300044765 | Ga0466970_0000215 | Ga0466970_0000215_22086_22799 | 234 |
| 212 | 3300046507 | Ga0495606_0026152 | Ga0495606_0026152_2150_2887 | 234 |
| 213 | 3300047320 | Ga0495672_0083241 | Ga0495672_0083241_263_1000 | 234 |
| 214 | 3300048922 | Ga0496119_0215629 | Ga0496119_0215629_199_912 | 234 |
| 215 | 3300048928 | Ga0496125_0012798 | Ga0496125_0012798_5635_6360 | 234 |
| 216 | 3300049581 | Ga0501047_0014646 | Ga0501047_0014646_6033_6752 | 234 |
| 217 | 3300049585 | Ga0501069_0014310 | Ga0501069_0014310_3489_4208 | 234 |
| 218 | 3300049586 | Ga0501070_0012712 | Ga0501070_0012712_285_1004 | 234 |
| 219 | 3300049586 | Ga0501070_0030546 | Ga0501070_0030546_1791_2510 | 234 |
| 220 | 3300049589 | Ga0501073_0015266 | Ga0501073_0015266_3881_4600 | 234 |
| 221 | 3300049590 | Ga0501074_0020446 | Ga0501074_0020446_414_1133 | 234 |
| 222 | 3300049741 | Ga0501079_0417240 | Ga0501079_0417240_226_945 | 234 |
| 223 | 3300049742 | Ga0501080_0046531 | Ga0501080_0046531_1791_2510 | 234 |
| 224 | 3300049823 | Ga0501044_0003741 | Ga0501044_0003741_2196_2915 | 234 |
| 225 | 3300049823 | Ga0501044_0436214 | Ga0501044_0436214_498_1208 | 234 |
| 226 | iso_pu_bacteria | 2974320154 | 2974322063 | 234 |
| 227 | 3300001915 | JGI24741J21665_1001625 | JGI24741J21665_10016253 | 235 |
| 228 | 3300001915 | JGI24741J21665_1002187 | JGI24741J21665_10021872 | 235 |
| 229 | 3300001915 | JGI24741J21665_1009546 | JGI24741J21665_10095462 | 235 |
| 230 | 3300001915 | JGI24741J21665_1014773 | JGI24741J21665_10147732 | 235 |
| 231 | 3300001979 | JGI24740J21852_10013580 | JGI24740J21852_100135803 | 235 |
| 232 | 3300003320 | rootH2_10177447 | rootH2_101774472 | 235 |
| 233 | 3300003751 | Ga0055538_1000251 | Ga0055538_100025120 | 235 |
| 234 | 3300003752 | Ga0055539_1000286 | Ga0055539_100028620 | 235 |
| 235 | 3300003756 | Ga0055533_1000274 | Ga0055533_100027420 | 235 |
| 236 | 3300003758 | Ga0055532_1000316 | Ga0055532_10003169 | 235 |
| 237 | 3300003759 | Ga0055525_1000384 | Ga0055525_100038420 | 235 |
| 238 | 3300003841 | Ga0055541_1000185 | Ga0055541_100018520 | 235 |
| 239 | 3300005327 | Ga0070658_10333580 | Ga0070658_103335802 | 235 |
| 240 | 3300005329 | Ga0070683_100027521 | Ga0070683_1000275214 | 235 |
| 241 | 3300005336 | Ga0070680_100000239 | Ga0070680_10000023930 | 235 |
| 242 | 3300005336 | Ga0070680_100022260 | Ga0070680_1000222604 | 235 |
| 243 | 3300005336 | Ga0070680_100089125 | Ga0070680_1000891252 | 235 |
| 244 | 3300005339 | Ga0070660_100051419 | Ga0070660_1000514193 | 235 |
| 245 | 3300005339 | Ga0070660_100097751 | Ga0070660_1000977512 | 235 |
| 246 | 3300005341 | Ga0070691_10000595 | Ga0070691_100005957 | 235 |
| 247 | 3300005341 | Ga0070691_10014457 | Ga0070691_100144573 | 235 |
| 248 | 3300005341 | Ga0070691_10059932 | Ga0070691_100599322 | 235 |
| 249 | 3300005344 | Ga0070661_100011682 | Ga0070661_1000116822 | 235 |
| 250 | 3300005344 | Ga0070661_100491766 | Ga0070661_1004917661 | 235 |
| 251 | 3300005345 | Ga0070692_10003790 | Ga0070692_100037902 | 235 |
| 252 | 3300005345 | Ga0070692_10007323 | Ga0070692_100073232 | 235 |
| 253 | 3300005366 | Ga0070659_100017881 | Ga0070659_1000178812 | 235 |
| 254 | 3300005445 | Ga0070708_100132677 | Ga0070708_1001326772 | 235 |
| 255 | 3300005455 | Ga0070663_100013292 | Ga0070663_1000132922 | 235 |
| 256 | 3300005458 | Ga0070681_10000066 | Ga0070681_100000665 | 235 |
| 257 | 3300005458 | Ga0070681_10001719 | Ga0070681_1000171911 | 235 |
| 258 | 3300005458 | Ga0070681_10005052 | Ga0070681_100050524 | 235 |
| 259 | 3300005530 | Ga0070679_100000195 | Ga0070679_10000019530 | 235 |
| 260 | 3300005530 | Ga0070679_100001729 | Ga0070679_1000017299 | 235 |
| 261 | 3300005530 | Ga0070679_100036870 | Ga0070679_1000368702 | 235 |
| 262 | 3300005530 | Ga0070679_100094144 | Ga0070679_1000941442 | 235 |
| 263 | 3300005535 | Ga0070684_100043440 | Ga0070684_1000434402 | 235 |
| 264 | 3300005539 | Ga0068853_100005468 | Ga0068853_1000054685 | 235 |
| 265 | 3300005539 | Ga0068853_100023369 | Ga0068853_1000233693 | 235 |
| 266 | 3300005539 | Ga0068853_100120411 | Ga0068853_1001204112 | 235 |
| 267 | 3300005547 | Ga0070693_100027258 | Ga0070693_1000272584 | 235 |
| 268 | 3300005563 | Ga0068855_100028055 | Ga0068855_1000280552 | 235 |
| 269 | 3300005563 | Ga0068855_100113173 | Ga0068855_1001131732 | 235 |
| 270 | 3300005563 | Ga0068855_100286220 | Ga0068855_1002862202 | 235 |
| 271 | 3300005563 | Ga0068855_100528314 | Ga0068855_1005283142 | 235 |
| 272 | 3300005564 | Ga0070664_100093962 | Ga0070664_1000939622 | 235 |
| 273 | 3300005564 | Ga0070664_100360793 | Ga0070664_1003607932 | 235 |
| 274 | 3300005577 | Ga0068857_100052780 | Ga0068857_1000527802 | 235 |
| 275 | 3300005577 | Ga0068857_100257199 | Ga0068857_1002571992 | 235 |
| 276 | 3300005614 | Ga0068856_100137069 | Ga0068856_1001370692 | 235 |
| 277 | 3300005614 | Ga0068856_100381721 | Ga0068856_1003817212 | 235 |
| 278 | 3300005616 | Ga0068852_100040233 | Ga0068852_1000402333 | 235 |
| 279 | 3300005616 | Ga0068852_100154976 | Ga0068852_1001549763 | 235 |
| 280 | 3300005834 | Ga0068851_10023061 | Ga0068851_100230613 | 235 |
| 281 | 3300005841 | Ga0068863_100161157 | Ga0068863_1001611572 | 235 |
| 282 | 3300009174 | Ga0105241_10043966 | Ga0105241_100439662 | 235 |
| 283 | 3300009545 | Ga0105237_10440428 | Ga0105237_104404282 | 235 |
| 284 | 3300009553 | Ga0105249_10112226 | Ga0105249_101122262 | 235 |
| 285 | 3300010375 | Ga0105239_10010578 | Ga0105239_100105783 | 235 |
| 286 | 3300013100 | Ga0157373_10073928 | Ga0157373_100739283 | 235 |
| 287 | 3300013100 | Ga0157373_10158615 | Ga0157373_101586152 | 235 |
| 288 | 3300013102 | Ga0157371_10021396 | Ga0157371_100213964 | 235 |
| 289 | 3300013102 | Ga0157371_10077699 | Ga0157371_100776992 | 235 |
| 290 | 3300013102 | Ga0157371_10270309 | Ga0157371_102703091 | 235 |
| 291 | 3300013104 | Ga0157370_10001955 | Ga0157370_1000195522 | 235 |
| 292 | 3300013104 | Ga0157370_10057105 | Ga0157370_100571052 | 235 |
| 293 | 3300013104 | Ga0157370_10072144 | Ga0157370_100721443 | 235 |
| 294 | 3300013105 | Ga0157369_10062258 | Ga0157369_100622582 | 235 |
| 295 | 3300013307 | Ga0157372_10034240 | Ga0157372_100342404 | 235 |
| 296 | 3300013307 | Ga0157372_10084140 | Ga0157372_100841403 | 235 |
| 297 | 3300013307 | Ga0157372_10119838 | Ga0157372_101198383 | 235 |
| 298 | 3300014497 | Ga0182008_10002759 | Ga0182008_100027597 | 235 |
| 299 | 3300020070 | Ga0206356_10896713 | Ga0206356_108967132 | 235 |
| 300 | 3300020070 | Ga0206356_11346780 | Ga0206356_113467802 | 235 |
| 301 | 3300020081 | Ga0206354_10264878 | Ga0206354_102648782 | 235 |
| 302 | 3300020082 | Ga0206353_10003797 | Ga0206353_100037973 | 235 |
| 303 | 3300020082 | Ga0206353_10103272 | Ga0206353_101032722 | 235 |
| 304 | 3300020610 | Ga0154015_1604739 | Ga0154015_16047392 | 235 |
| 305 | 3300025206 | Ga0209435_100154 | Ga0209435_1001542 | 235 |
| 306 | 3300025224 | Ga0209784_100152 | Ga0209784_10015243 | 235 |
| 307 | 3300025225 | Ga0209566_100192 | Ga0209566_10019243 | 235 |
| 308 | 3300025226 | Ga0209674_100196 | Ga0209674_10019643 | 235 |
| 309 | 3300025229 | Ga0209147_100330 | Ga0209147_1003309 | 235 |
| 310 | 3300025230 | Ga0209563_100156 | Ga0209563_10015643 | 235 |
| 311 | 3300025233 | Ga0209437_101151 | Ga0209437_10115110 | 235 |
| 312 | 3300025242 | Ga0209258_100615 | Ga0209258_1006159 | 235 |
| 313 | 3300025246 | Ga0209646_1000332 | Ga0209646_10003329 | 235 |
| 314 | 3300025253 | Ga0209677_100152 | Ga0209677_10015243 | 235 |
| 315 | 3300025256 | Ga0209759_1002588 | Ga0209759_10025886 | 235 |
| 316 | 3300025903 | Ga0207680_10037622 | Ga0207680_100376222 | 235 |
| 317 | 3300025909 | Ga0207705_10002953 | Ga0207705_100029539 | 235 |
| 318 | 3300025909 | Ga0207705_10005116 | Ga0207705_100051164 | 235 |
| 319 | 3300025909 | Ga0207705_10007645 | Ga0207705_100076454 | 235 |
| 320 | 3300025912 | Ga0207707_10000065 | Ga0207707_1000006560 | 235 |
| 321 | 3300025912 | Ga0207707_10000068 | Ga0207707_1000006891 | 235 |
| 322 | 3300025912 | Ga0207707_10001385 | Ga0207707_1000138510 | 235 |
| 323 | 3300025912 | Ga0207707_10003405 | Ga0207707_100034056 | 235 |
| 324 | 3300025912 | Ga0207707_10106782 | Ga0207707_101067822 | 235 |
| 325 | 3300025913 | Ga0207695_10004841 | Ga0207695_100048418 | 235 |
| 326 | 3300025914 | Ga0207671_10426611 | Ga0207671_104266112 | 235 |
| 327 | 3300025917 | Ga0207660_10000181 | Ga0207660_1000018126 | 235 |
| 328 | 3300025917 | Ga0207660_10000502 | Ga0207660_100005022 | 235 |
| 329 | 3300025917 | Ga0207660_10001334 | Ga0207660_1000133420 | 235 |
| 330 | 3300025917 | Ga0207660_10010540 | Ga0207660_100105406 | 235 |
| 331 | 3300025917 | Ga0207660_10013765 | Ga0207660_100137653 | 235 |
| 332 | 3300025919 | Ga0207657_10018263 | Ga0207657_100182634 | 235 |
| 333 | 3300025919 | Ga0207657_10021798 | Ga0207657_100217982 | 235 |
| 334 | 3300025919 | Ga0207657_10086825 | Ga0207657_100868252 | 235 |
| 335 | 3300025919 | Ga0207657_10096034 | Ga0207657_100960342 | 235 |
| 336 | 3300025920 | Ga0207649_10018624 | Ga0207649_100186242 | 235 |
| 337 | 3300025920 | Ga0207649_10048311 | Ga0207649_100483112 | 235 |
| 338 | 3300025921 | Ga0207652_10000081 | Ga0207652_1000008191 | 235 |
| 339 | 3300025921 | Ga0207652_10000213 | Ga0207652_1000021311 | 235 |
| 340 | 3300025921 | Ga0207652_10002964 | Ga0207652_100029646 | 235 |
| 341 | 3300025921 | Ga0207652_10079425 | Ga0207652_100794252 | 235 |
| 342 | 3300025921 | Ga0207652_10110866 | Ga0207652_101108662 | 235 |
| 343 | 3300025932 | Ga0207690_10091683 | Ga0207690_100916832 | 235 |
| 344 | 3300025932 | Ga0207690_10166837 | Ga0207690_101668372 | 235 |
| 345 | 3300025933 | Ga0207706_10035126 | Ga0207706_100351262 | 235 |
| 346 | 3300025944 | Ga0207661_10061390 | Ga0207661_100613902 | 235 |
| 347 | 3300025949 | Ga0207667_10005041 | Ga0207667_100050418 | 235 |
| 348 | 3300025949 | Ga0207667_10018972 | Ga0207667_100189724 | 235 |
| 349 | 3300025949 | Ga0207667_10037324 | Ga0207667_100373242 | 235 |
| 350 | 3300025949 | Ga0207667_10565938 | Ga0207667_105659381 | 235 |
| 351 | 3300025981 | Ga0207640_10001690 | Ga0207640_100016903 | 235 |
| 352 | 3300025981 | Ga0207640_10058000 | Ga0207640_100580002 | 235 |
| 353 | 3300025981 | Ga0207640_10171350 | Ga0207640_101713502 | 235 |
| 354 | 3300025981 | Ga0207640_10321542 | Ga0207640_103215422 | 235 |
| 355 | 3300026041 | Ga0207639_10013363 | Ga0207639_100133632 | 235 |
| 356 | 3300026041 | Ga0207639_10014688 | Ga0207639_100146885 | 235 |
| 357 | 3300026041 | Ga0207639_10060096 | Ga0207639_100600962 | 235 |
| 358 | 3300026041 | Ga0207639_10084919 | Ga0207639_100849192 | 235 |
| 359 | 3300026041 | Ga0207639_10093507 | Ga0207639_100935072 | 235 |
| 360 | 3300026041 | Ga0207639_10558508 | Ga0207639_105585082 | 235 |
| 361 | 3300026067 | Ga0207678_10008510 | Ga0207678_100085103 | 235 |
| 362 | 3300026067 | Ga0207678_10017779 | Ga0207678_100177794 | 235 |
| 363 | 3300026067 | Ga0207678_10052558 | Ga0207678_100525582 | 235 |
| 364 | 3300026067 | Ga0207678_10072036 | Ga0207678_100720363 | 235 |
| 365 | 3300026067 | Ga0207678_10170506 | Ga0207678_101705062 | 235 |
| 366 | 3300026078 | Ga0207702_10037018 | Ga0207702_100370184 | 235 |
| 367 | 3300026088 | Ga0207641_10044183 | Ga0207641_100441834 | 235 |
| 368 | 3300026116 | Ga0207674_10019073 | Ga0207674_100190734 | 235 |
| 369 | 3300026116 | Ga0207674_10255320 | Ga0207674_102553202 | 235 |
| 370 | 3300026142 | Ga0207698_10059655 | Ga0207698_100596553 | 235 |
| 371 | 3300026142 | Ga0207698_10103604 | Ga0207698_101036042 | 235 |
| 372 | 3300028381 | Ga0268264_10295045 | Ga0268264_102950452 | 235 |
| 373 | 3300031344 | Ga0265316_10111362 | Ga0265316_101113622 | 235 |
| 374 | 3300031665 | Ga0316575_10012645 | Ga0316575_100126452 | 235 |
| 375 | 3300037312 | Ga0395899_0035784 | Ga0395899_0035784_2307_3029 | 235 |
| 376 | 3300037312 | Ga0395899_0046833 | Ga0395899_0046833_2035_2757 | 235 |
| 377 | 3300037466 | Ga0395898_0069262 | Ga0395898_0069262_1201_1923 | 235 |
| 378 | 3300037466 | Ga0395898_0170099 | Ga0395898_0170099_874_1596 | 235 |
| 379 | 3300041452 | Ga0451793_1859178 | Ga0451793_1859178_1567_2283 | 235 |
| 380 | 3300041460 | Ga0451802_0471939 | Ga0451802_0471939_241_957 | 235 |
| 381 | 3300041486 | Ga0451807_0042530 | Ga0451807_0042530_598_1314 | 235 |
| 382 | 3300044658 | Ga0466972_0025123 | Ga0466972_0025123_175_897 | 235 |
| 383 | 3300044735 | Ga0466968_0053825 | Ga0466968_0053825_348_1070 | 235 |
| 384 | 3300045049 | Ga0466959_0004244 | Ga0466959_0004244_2799_3515 | 235 |
| 385 | 3300048921 | Ga0496118_0001105 | Ga0496118_0001105_2797_3513 | 235 |
| 386 | 3300048925 | Ga0496122_0140225 | Ga0496122_0140225_700_1452 | 235 |
| 387 | 3300048929 | Ga0496126_0021788 | Ga0496126_0021788_1372_2124 | 235 |
| 388 | 3300049573 | Ga0501037_0175319 | Ga0501037_0175319_552_1274 | 235 |
| 389 | 3300049579 | Ga0501043_0090036 | Ga0501043_0090036_1454_2176 | 235 |
| 390 | 3300049585 | Ga0501069_0031114 | Ga0501069_0031114_507_1229 | 235 |
| 391 | 3300049586 | Ga0501070_0044461 | Ga0501070_0044461_304_1026 | 235 |
| 392 | 3300049586 | Ga0501070_0078344 | Ga0501070_0078344_66_815 | 235 |
| 393 | 3300049586 | Ga0501070_0190053 | Ga0501070_0190053_823_1542 | 235 |
| 394 | 3300049590 | Ga0501074_0020502 | Ga0501074_0020502_1851_2573 | 235 |
| 395 | 3300049593 | Ga0501077_0010912 | Ga0501077_0010912_1880_2602 | 235 |
| 396 | 3300049742 | Ga0501080_0032118 | Ga0501080_0032118_2925_3653 | 235 |
| 397 | 3300049822 | Ga0501035_0000839 | Ga0501035_0000839_18268_18987 | 235 |
| 398 | 3300049823 | Ga0501044_0026766 | Ga0501044_0026766_1888_2610 | 235 |
| 399 | 3300053079 | Ga0500610_0000123 | Ga0500610_0000123_15640_16356 | 235 |
| 400 | 3300053093 | Ga0500651_0000556 | Ga0500651_0000556_16696_17412 | 235 |
| 401 | 3300053093 | Ga0500651_0215153 | Ga0500651_0215153_255_971 | 235 |
| 402 | 3300053146 | Ga0500588_0014325 | Ga0500588_0014325_783_1499 | 235 |
| 403 | iso_pu_bacteria | 2619619299 | 2621301627 | 235 |
| 404 | iso_pu_bacteria | 2738541265 | 2738672736 | 235 |
| 405 | iso_pu_bacteria | 2738541282 | 2738751129 | 235 |
| 406 | iso_pu_bacteria | 2738541303 | 2738860170 | 235 |
| 407 | iso_pu_bacteria | 2816332298 | 2817489011 | 235 |
| 408 | 3300002705 | JGI25156J39149_1002818 | JGI25156J39149_10028184 | 236 |
| 409 | 3300002741 | JGI25157J39369_1001681 | JGI25157J39369_10016816 | 236 |
| 410 | 3300005328 | Ga0070676_10128970 | Ga0070676_101289702 | 236 |
| 411 | 3300005335 | Ga0070666_10068370 | Ga0070666_100683702 | 236 |
| 412 | 3300005459 | Ga0068867_100164135 | Ga0068867_1001641352 | 236 |
| 413 | 3300005530 | Ga0070679_100125623 | Ga0070679_1001256233 | 236 |
| 414 | 3300005539 | Ga0068853_100012163 | Ga0068853_1000121636 | 236 |
| 415 | 3300005539 | Ga0068853_100504145 | Ga0068853_1005041452 | 236 |
| 416 | 3300005547 | Ga0070693_100040304 | Ga0070693_1000403042 | 236 |
| 417 | 3300005548 | Ga0070665_100192708 | Ga0070665_1001927082 | 236 |
| 418 | 3300005578 | Ga0068854_100098676 | Ga0068854_1000986763 | 236 |
| 419 | 3300005614 | Ga0068856_100631338 | Ga0068856_1006313382 | 236 |
| 420 | 3300005616 | Ga0068852_100351942 | Ga0068852_1003519422 | 236 |
| 421 | 3300005843 | Ga0068860_100003032 | Ga0068860_1000030326 | 236 |
| 422 | 3300006881 | Ga0068865_100257754 | Ga0068865_1002577542 | 236 |
| 423 | 3300009093 | Ga0105240_10074811 | Ga0105240_100748112 | 236 |
| 424 | 3300009093 | Ga0105240_10104490 | Ga0105240_101044902 | 236 |
| 425 | 3300009093 | Ga0105240_10960550 | Ga0105240_109605502 | 236 |
| 426 | 3300009174 | Ga0105241_10007584 | Ga0105241_100075843 | 236 |
| 427 | 3300009176 | Ga0105242_10002824 | Ga0105242_100028242 | 236 |
| 428 | 3300009545 | Ga0105237_10000150 | Ga0105237_1000015080 | 236 |
| 429 | 3300009545 | Ga0105237_10014526 | Ga0105237_100145263 | 236 |
| 430 | 3300009551 | Ga0105238_10002470 | Ga0105238_100024707 | 236 |
| 431 | 3300009553 | Ga0105249_10268711 | Ga0105249_102687112 | 236 |
| 432 | 3300010375 | Ga0105239_10039813 | Ga0105239_100398132 | 236 |
| 433 | 3300013104 | Ga0157370_10362185 | Ga0157370_103621852 | 236 |
| 434 | 3300013105 | Ga0157369_10000011 | Ga0157369_10000011105 | 236 |
| 435 | 3300013306 | Ga0163162_10043255 | Ga0163162_100432554 | 236 |
| 436 | 3300013307 | Ga0157372_10021015 | Ga0157372_100210154 | 236 |
| 437 | 3300013307 | Ga0157372_10513176 | Ga0157372_105131762 | 236 |
| 438 | 3300013308 | Ga0157375_10000948 | Ga0157375_1000094814 | 236 |
| 439 | 3300014969 | Ga0157376_10006607 | Ga0157376_100066077 | 236 |
| 440 | 3300025250 | Ga0209026_1000122 | Ga0209026_100012285 | 236 |
| 441 | 3300025256 | Ga0209759_1006503 | Ga0209759_10065033 | 236 |
| 442 | 3300025272 | Ga0209455_1000323 | Ga0209455_100032352 | 236 |
| 443 | 3300025904 | Ga0207647_10074550 | Ga0207647_100745502 | 236 |
| 444 | 3300025907 | Ga0207645_10150881 | Ga0207645_101508812 | 236 |
| 445 | 3300025911 | Ga0207654_10074837 | Ga0207654_100748372 | 236 |
| 446 | 3300025913 | Ga0207695_10002140 | Ga0207695_100021406 | 236 |
| 447 | 3300025913 | Ga0207695_10006519 | Ga0207695_100065194 | 236 |
| 448 | 3300025914 | Ga0207671_10000570 | Ga0207671_1000057052 | 236 |
| 449 | 3300025914 | Ga0207671_10000716 | Ga0207671_1000071634 | 236 |
| 450 | 3300025919 | Ga0207657_10140928 | Ga0207657_101409282 | 236 |
| 451 | 3300025921 | Ga0207652_10076647 | Ga0207652_100766473 | 236 |
| 452 | 3300025924 | Ga0207694_10019421 | Ga0207694_100194214 | 236 |
| 453 | 3300025934 | Ga0207686_10004297 | Ga0207686_100042974 | 236 |
| 454 | 3300025938 | Ga0207704_10316245 | Ga0207704_103162452 | 236 |
| 455 | 3300025961 | Ga0207712_10156560 | Ga0207712_101565602 | 236 |
| 456 | 3300025981 | Ga0207640_10040325 | Ga0207640_100403252 | 236 |
| 457 | 3300026023 | Ga0207677_10286619 | Ga0207677_102866192 | 236 |
| 458 | 3300026041 | Ga0207639_10107689 | Ga0207639_101076892 | 236 |
| 459 | 3300026041 | Ga0207639_10196705 | Ga0207639_101967052 | 236 |
| 460 | 3300026067 | Ga0207678_10012413 | Ga0207678_100124133 | 236 |
| 461 | 3300026078 | Ga0207702_10859371 | Ga0207702_108593711 | 236 |
| 462 | 3300026089 | Ga0207648_10026007 | Ga0207648_100260075 | 236 |
| 463 | 3300026121 | Ga0207683_10198745 | Ga0207683_101987451 | 236 |
| 464 | 3300026142 | Ga0207698_10208337 | Ga0207698_102083372 | 236 |
| 465 | 3300028379 | Ga0268266_10402883 | Ga0268266_104028832 | 236 |
| 466 | 3300028381 | Ga0268264_10005067 | Ga0268264_100050676 | 236 |
| 467 | 3300032133 | Ga0316583_10029633 | Ga0316583_100296331 | 236 |
| 468 | 3300035089 | Ga0373944_0101318 | Ga0373944_0101318_172_900 | 236 |
| 469 | 3300035117 | Ga0373953_0043343 | Ga0373953_0043343_409_1137 | 236 |
| 470 | 3300035120 | Ga0373957_0050392 | Ga0373957_0050392_112_840 | 236 |
| 471 | 3300035724 | Ga0373933_0067021 | Ga0373933_0067021_999_1727 | 236 |
| 472 | 3300036401 | Ga0373937_0178226 | Ga0373937_0178226_1099_1827 | 236 |
| 473 | 3300046472 | Ga0495580_0106478 | Ga0495580_0106478_127_855 | 236 |
| 474 | 3300046475 | Ga0495639_0031776 | Ga0495639_0031776_1524_2252 | 236 |
| 475 | 3300046531 | Ga0495665_0033925 | Ga0495665_0033925_325_1053 | 236 |
| 476 | 3300046675 | Ga0495657_0095530 | Ga0495657_0095530_1157_1888 | 236 |
| 477 | 3300046680 | Ga0495646_0304090 | Ga0495646_0304090_34_762 | 236 |
| 478 | 3300046681 | Ga0495647_0028894 | Ga0495647_0028894_1235_1963 | 236 |
| 479 | 3300046683 | Ga0495658_0002704 | Ga0495658_0002704_618_1346 | 236 |
| 480 | 3300046809 | Ga0495600_0075557 | Ga0495600_0075557_1223_1951 | 236 |
| 481 | 3300047319 | Ga0495674_0195655 | Ga0495674_0195655_216_944 | 236 |
| 482 | 3300047322 | Ga0495680_0255029 | Ga0495680_0255029_383_1111 | 236 |
| 483 | 3300047471 | Ga0495684_0087873 | Ga0495684_0087873_1377_2105 | 236 |
| 484 | 3300048907 | Ga0496104_0000018 | Ga0496104_0000018_131591_132319 | 236 |
| 485 | 3300048908 | Ga0496105_0000080 | Ga0496105_0000080_56835_57563 | 236 |
| 486 | 3300049570 | Ga0501033_0166033 | Ga0501033_0166033_801_1553 | 236 |
| 487 | 3300049585 | Ga0501069_0054731 | Ga0501069_0054731_164_895 | 236 |
| 488 | 3300049586 | Ga0501070_0005739 | Ga0501070_0005739_1825_2556 | 236 |
| 489 | 3300049822 | Ga0501035_0009875 | Ga0501035_0009875_6824_7582 | 236 |
| 490 | 3300049823 | Ga0501044_0084393 | Ga0501044_0084393_1138_1896 | 236 |
| 491 | iso_pu_bacteria | 2894023352 | 2894028069 | 236 |
| 492 | iso_pu_bacteria | 2932422444 | 2932424929 | 236 |
| 493 | 3300002737 | JGI25162J39368_1000605 | JGI25162J39368_100060512 | 237 |
| 494 | 3300002737 | JGI25162J39368_1001369 | JGI25162J39368_10013693 | 237 |
| 495 | 3300002737 | JGI25162J39368_1001619 | JGI25162J39368_10016196 | 237 |
| 496 | 3300002741 | JGI25157J39369_1004324 | JGI25157J39369_10043242 | 237 |
| 497 | 3300002772 | JGI25164J39214_1000390 | JGI25164J39214_100039015 | 237 |
| 498 | 3300002772 | JGI25164J39214_1000439 | JGI25164J39214_100043913 | 237 |
| 499 | 3300003214 | JGI25165J46597_1000725 | JGI25165J46597_100072515 | 237 |
| 500 | 3300003214 | JGI25165J46597_1003866 | JGI25165J46597_10038661 | 237 |
| 501 | 3300005331 | Ga0070670_100002058 | Ga0070670_10000205814 | 237 |
| 502 | 3300005336 | Ga0070680_100193900 | Ga0070680_1001939002 | 237 |
| 503 | 3300005337 | Ga0070682_100013760 | Ga0070682_1000137606 | 237 |
| 504 | 3300005339 | Ga0070660_100294005 | Ga0070660_1002940052 | 237 |
| 505 | 3300005339 | Ga0070660_100424355 | Ga0070660_1004243552 | 237 |
| 506 | 3300005366 | Ga0070659_100047479 | Ga0070659_1000474793 | 237 |
| 507 | 3300005366 | Ga0070659_100448990 | Ga0070659_1004489902 | 237 |
| 508 | 3300005435 | Ga0070714_100002250 | Ga0070714_1000022508 | 237 |
| 509 | 3300005435 | Ga0070714_100226350 | Ga0070714_1002263502 | 237 |
| 510 | 3300005436 | Ga0070713_100001474 | Ga0070713_10000147415 | 237 |
| 511 | 3300005437 | Ga0070710_10008440 | Ga0070710_100084403 | 237 |
| 512 | 3300005457 | Ga0070662_100211734 | Ga0070662_1002117342 | 237 |
| 513 | 3300005458 | Ga0070681_10169395 | Ga0070681_101693952 | 237 |
| 514 | 3300005530 | Ga0070679_100109779 | Ga0070679_1001097792 | 237 |
| 515 | 3300005539 | Ga0068853_100017139 | Ga0068853_1000171395 | 237 |
| 516 | 3300005546 | Ga0070696_100041401 | Ga0070696_1000414013 | 237 |
| 517 | 3300005547 | Ga0070693_100045515 | Ga0070693_1000455152 | 237 |
| 518 | 3300005577 | Ga0068857_100067730 | Ga0068857_1000677302 | 237 |
| 519 | 3300005577 | Ga0068857_100259455 | Ga0068857_1002594552 | 237 |
| 520 | 3300006175 | Ga0070712_100040456 | Ga0070712_1000404562 | 237 |
| 521 | 3300009011 | Ga0105251_10000872 | Ga0105251_100008723 | 237 |
| 522 | 3300009545 | Ga0105237_10480616 | Ga0105237_104806161 | 237 |
| 523 | 3300009551 | Ga0105238_10277919 | Ga0105238_102779192 | 237 |
| 524 | 3300013100 | Ga0157373_10126849 | Ga0157373_101268492 | 237 |
| 525 | 3300013100 | Ga0157373_10226940 | Ga0157373_102269402 | 237 |
| 526 | 3300013102 | Ga0157371_10037807 | Ga0157371_100378073 | 237 |
| 527 | 3300013102 | Ga0157371_10037988 | Ga0157371_100379883 | 237 |
| 528 | 3300013104 | Ga0157370_10000662 | Ga0157370_1000066215 | 237 |
| 529 | 3300013104 | Ga0157370_10076915 | Ga0157370_100769154 | 237 |
| 530 | 3300013104 | Ga0157370_10077984 | Ga0157370_100779843 | 237 |
| 531 | 3300013307 | Ga0157372_10058048 | Ga0157372_100580482 | 237 |
| 532 | 3300013307 | Ga0157372_10072613 | Ga0157372_100726134 | 237 |
| 533 | 3300014497 | Ga0182008_10000325 | Ga0182008_1000032525 | 237 |
| 534 | 3300015261 | Ga0182006_1031084 | Ga0182006_10310842 | 237 |
| 535 | 3300015262 | Ga0182007_10013140 | Ga0182007_100131402 | 237 |
| 536 | 3300015685 | Ga0183369_1020 | Ga0183369_102051 | 237 |
| 537 | 3300020082 | Ga0206353_11359476 | Ga0206353_113594762 | 237 |
| 538 | 3300025226 | Ga0209674_103679 | Ga0209674_1036792 | 237 |
| 539 | 3300025231 | Ga0207427_100118 | Ga0207427_10011876 | 237 |
| 540 | 3300025231 | Ga0207427_100120 | Ga0207427_10012025 | 237 |
| 541 | 3300025233 | Ga0209437_100020 | Ga0209437_100020490 | 237 |
| 542 | 3300025233 | Ga0209437_100231 | Ga0209437_10023112 | 237 |
| 543 | 3300025250 | Ga0209026_1000037 | Ga0209026_1000037212 | 237 |
| 544 | 3300025256 | Ga0209759_1016157 | Ga0209759_10161572 | 237 |
| 545 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020136 | 237 |
| 546 | 3300025261 | Ga0209233_1000147 | Ga0209233_1000147130 | 237 |
| 547 | 3300025735 | Ga0207713_1003587 | Ga0207713_10035877 | 237 |
| 548 | 3300025898 | Ga0207692_10005174 | Ga0207692_100051743 | 237 |
| 549 | 3300025917 | Ga0207660_10048414 | Ga0207660_100484143 | 237 |
| 550 | 3300025919 | Ga0207657_10324810 | Ga0207657_103248102 | 237 |
| 551 | 3300025924 | Ga0207694_10052125 | Ga0207694_100521255 | 237 |
| 552 | 3300025924 | Ga0207694_10219523 | Ga0207694_102195232 | 237 |
| 553 | 3300025925 | Ga0207650_10031088 | Ga0207650_100310883 | 237 |
| 554 | 3300025928 | Ga0207700_10034895 | Ga0207700_100348955 | 237 |
| 555 | 3300025929 | Ga0207664_10001232 | Ga0207664_100012326 | 237 |
| 556 | 3300025929 | Ga0207664_10050239 | Ga0207664_100502394 | 237 |
| 557 | 3300025932 | Ga0207690_10022227 | Ga0207690_100222274 | 237 |
| 558 | 3300025932 | Ga0207690_10056684 | Ga0207690_100566842 | 237 |
| 559 | 3300025949 | Ga0207667_10030752 | Ga0207667_100307522 | 237 |
| 560 | 3300026041 | Ga0207639_10012868 | Ga0207639_100128686 | 237 |
| 561 | 3300026041 | Ga0207639_10194346 | Ga0207639_101943462 | 237 |
| 562 | 3300026116 | Ga0207674_10138751 | Ga0207674_101387512 | 237 |
| 563 | 3300026116 | Ga0207674_10264204 | Ga0207674_102642041 | 237 |
| 564 | 3300026116 | Ga0207674_10410559 | Ga0207674_104105592 | 237 |
| 565 | 3300031238 | Ga0265332_10047995 | Ga0265332_100479952 | 237 |
| 566 | 3300037312 | Ga0395899_0048433 | Ga0395899_0048433_103_855 | 237 |
| 567 | 3300037466 | Ga0395898_0659858 | Ga0395898_0659858_147_899 | 237 |
| 568 | 3300038443 | Ga0395901_0002971 | Ga0395901_0002971_3781_4533 | 237 |
| 569 | 3300042000 | Ga0439437_000473 | Ga0439437_000473_2088_2840 | 237 |
| 570 | 3300048920 | Ga0496117_0000446 | Ga0496117_0000446_61978_62748 | 237 |
| 571 | 3300048921 | Ga0496118_0027406 | Ga0496118_0027406_2734_3504 | 237 |
| 572 | 3300048922 | Ga0496119_0006544 | Ga0496119_0006544_3812_4582 | 237 |
| 573 | 3300048923 | Ga0496120_0000102 | Ga0496120_0000102_47235_48005 | 237 |
| 574 | 3300048925 | Ga0496122_0000158 | Ga0496122_0000158_61148_61918 | 237 |
| 575 | 3300048926 | Ga0496123_0000120 | Ga0496123_0000120_97435_98205 | 237 |
| 576 | 3300048927 | Ga0496124_0000878 | Ga0496124_0000878_6174_6944 | 237 |
| 577 | 3300049580 | Ga0501046_0213589 | Ga0501046_0213589_237_995 | 237 |
| 578 | 3300049582 | Ga0501048_0115858 | Ga0501048_0115858_332_1078 | 237 |
| 579 | 3300049585 | Ga0501069_0000120 | Ga0501069_0000120_3458_4177 | 237 |
| 580 | iso_pu_bacteria | 2537561836 | 2538832175 | 237 |
| 581 | iso_pu_bacteria | 2687453130 | 2687583856 | 237 |
| 582 | iso_pu_bacteria | 2895395659 | 2895398032 | 237 |
| 583 | iso_pu_bacteria | 8021622325 | 8021623007 | 237 |
| 584 | iso_pu_bacteria | 8021626552 | 8021629917 | 237 |
| 585 | iso_pu_bacteria | 8021648035 | 8021650496 | 237 |
| 586 | 3300005327 | Ga0070658_10240450 | Ga0070658_102404502 | 238 |
| 587 | 3300005334 | Ga0068869_100436686 | Ga0068869_1004366861 | 238 |
| 588 | 3300005335 | Ga0070666_10000350 | Ga0070666_1000035017 | 238 |
| 589 | 3300005339 | Ga0070660_100070368 | Ga0070660_1000703682 | 238 |
| 590 | 3300005344 | Ga0070661_100056566 | Ga0070661_1000565662 | 238 |
| 591 | 3300005355 | Ga0070671_100335198 | Ga0070671_1003351982 | 238 |
| 592 | 3300005367 | Ga0070667_100145634 | Ga0070667_1001456342 | 238 |
| 593 | 3300005455 | Ga0070663_100225189 | Ga0070663_1002251892 | 238 |
| 594 | 3300005539 | Ga0068853_100109441 | Ga0068853_1001094412 | 238 |
| 595 | 3300005563 | Ga0068855_100070522 | Ga0068855_1000705224 | 238 |
| 596 | 3300005614 | Ga0068856_100030997 | Ga0068856_1000309976 | 238 |
| 597 | 3300005616 | Ga0068852_100007256 | Ga0068852_1000072562 | 238 |
| 598 | 3300005617 | Ga0068859_100035642 | Ga0068859_1000356426 | 238 |
| 599 | 3300005618 | Ga0068864_100007613 | Ga0068864_1000076136 | 238 |
| 600 | 3300005834 | Ga0068851_10025349 | Ga0068851_100253493 | 238 |
| 601 | 3300005841 | Ga0068863_100015047 | Ga0068863_1000150473 | 238 |
| 602 | 3300005843 | Ga0068860_100020529 | Ga0068860_1000205292 | 238 |
| 603 | 3300006237 | Ga0097621_100238628 | Ga0097621_1002386282 | 238 |
| 604 | 3300006931 | Ga0097620_100035641 | Ga0097620_1000356416 | 238 |
| 605 | 3300009093 | Ga0105240_10029279 | Ga0105240_100292795 | 238 |
| 606 | 3300009093 | Ga0105240_10276126 | Ga0105240_102761262 | 238 |
| 607 | 3300009098 | Ga0105245_10157811 | Ga0105245_101578112 | 238 |
| 608 | 3300009174 | Ga0105241_10113613 | Ga0105241_101136132 | 238 |
| 609 | 3300009545 | Ga0105237_10008060 | Ga0105237_100080607 | 238 |
| 610 | 3300009545 | Ga0105237_10107485 | Ga0105237_101074853 | 238 |
| 611 | 3300009551 | Ga0105238_10011232 | Ga0105238_100112328 | 238 |
| 612 | 3300009551 | Ga0105238_10171703 | Ga0105238_101717032 | 238 |
| 613 | 3300010375 | Ga0105239_10007220 | Ga0105239_100072203 | 238 |
| 614 | 3300011119 | Ga0105246_10010675 | Ga0105246_100106753 | 238 |
| 615 | 3300013100 | Ga0157373_10330868 | Ga0157373_103308681 | 238 |
| 616 | 3300013102 | Ga0157371_10308336 | Ga0157371_103083361 | 238 |
| 617 | 3300013104 | Ga0157370_10289452 | Ga0157370_102894522 | 238 |
| 618 | 3300013104 | Ga0157370_10358921 | Ga0157370_103589212 | 238 |
| 619 | 3300013105 | Ga0157369_10011883 | Ga0157369_100118837 | 238 |
| 620 | 3300013307 | Ga0157372_10001728 | Ga0157372_1000172811 | 238 |
| 621 | 3300013307 | Ga0157372_10307719 | Ga0157372_103077192 | 238 |
| 622 | 3300014325 | Ga0163163_10001486 | Ga0163163_100014863 | 238 |
| 623 | 3300014325 | Ga0163163_10004834 | Ga0163163_100048343 | 238 |
| 624 | 3300014968 | Ga0157379_10003069 | Ga0157379_100030696 | 238 |
| 625 | 3300025321 | Ga0207656_10159007 | Ga0207656_101590072 | 238 |
| 626 | 3300025903 | Ga0207680_10000092 | Ga0207680_100000926 | 238 |
| 627 | 3300025904 | Ga0207647_10006817 | Ga0207647_100068172 | 238 |
| 628 | 3300025909 | Ga0207705_10143123 | Ga0207705_101431232 | 238 |
| 629 | 3300025911 | Ga0207654_10026625 | Ga0207654_100266252 | 238 |
| 630 | 3300025913 | Ga0207695_10000256 | Ga0207695_100002565 | 238 |
| 631 | 3300025914 | Ga0207671_10009998 | Ga0207671_100099983 | 238 |
| 632 | 3300025917 | Ga0207660_10361322 | Ga0207660_103613222 | 238 |
| 633 | 3300025919 | Ga0207657_10018195 | Ga0207657_100181955 | 238 |
| 634 | 3300025920 | Ga0207649_10001915 | Ga0207649_100019156 | 238 |
| 635 | 3300025927 | Ga0207687_10079930 | Ga0207687_100799302 | 238 |
| 636 | 3300025931 | Ga0207644_10630627 | Ga0207644_106306271 | 238 |
| 637 | 3300025932 | Ga0207690_10019820 | Ga0207690_100198204 | 238 |
| 638 | 3300025933 | Ga0207706_10014962 | Ga0207706_100149626 | 238 |
| 639 | 3300025949 | Ga0207667_10015858 | Ga0207667_100158587 | 238 |
| 640 | 3300025949 | Ga0207667_10508463 | Ga0207667_105084632 | 238 |
| 641 | 3300025981 | Ga0207640_10019057 | Ga0207640_100190572 | 238 |
| 642 | 3300026035 | Ga0207703_10291821 | Ga0207703_102918211 | 238 |
| 643 | 3300026041 | Ga0207639_10000240 | Ga0207639_1000024017 | 238 |
| 644 | 3300026078 | Ga0207702_10010147 | Ga0207702_100101476 | 238 |
| 645 | 3300026088 | Ga0207641_10013297 | Ga0207641_100132978 | 238 |
| 646 | 3300026095 | Ga0207676_10004232 | Ga0207676_100042328 | 238 |
| 647 | 3300026116 | Ga0207674_10048121 | Ga0207674_100481214 | 238 |
| 648 | 3300026142 | Ga0207698_10010163 | Ga0207698_100101632 | 238 |
| 649 | 3300028381 | Ga0268264_10031101 | Ga0268264_100311012 | 238 |
| 650 | 3300037418 | Ga0395900_0000013 | Ga0395900_0000013_34064_34801 | 238 |
| 651 | 3300037466 | Ga0395898_0233893 | Ga0395898_0233893_236_973 | 238 |
| 652 | 3300003323 | rootH1_10256714 | rootH1_102567142 | 239 |
| 653 | 3300005614 | Ga0068856_100002412 | Ga0068856_1000024123 | 239 |
| 654 | 3300025263 | Ga0209565_1002845 | Ga0209565_10028454 | 239 |
| 655 | 3300026078 | Ga0207702_10000843 | Ga0207702_1000084337 | 239 |
| 656 | 3300003771 | Ga0055526_1000012 | Ga0055526_1000012185 | 240 |
| 657 | 3300003773 | Ga0055537_1000021 | Ga0055537_100002136 | 240 |
| 658 | 3300003775 | Ga0055524_1000037 | Ga0055524_1000037129 | 240 |
| 659 | 3300003784 | Ga0055534_1000006 | Ga0055534_1000006185 | 240 |
| 660 | 3300003790 | Ga0055528_1000006 | Ga0055528_1000006185 | 240 |
| 661 | 3300015689 | Ga0183360_10002 | Ga0183360_10002181 | 240 |
| 662 | 3300025263 | Ga0209565_1000002 | Ga0209565_1000002791 | 240 |
| 663 | 3300025273 | Ga0209673_1000002 | Ga0209673_1000002791 | 240 |
| 664 | 3300025291 | Ga0209675_1000002 | Ga0209675_1000002791 | 240 |
| 665 | 3300025295 | Ga0209564_1000004 | Ga0209564_1000004792 | 240 |
| 666 | 3300025299 | Ga0209256_1000004 | Ga0209256_1000004792 | 240 |
| 667 | 3300005539 | Ga0068853_100016535 | Ga0068853_1000165354 | 241 |
| 668 | 3300006237 | Ga0097621_100099986 | Ga0097621_1000999862 | 241 |
| 669 | 3300006358 | Ga0068871_100632371 | Ga0068871_1006323712 | 241 |
| 670 | 3300009551 | Ga0105238_10010010 | Ga0105238_100100103 | 241 |
| 671 | 3300010375 | Ga0105239_10235823 | Ga0105239_102358233 | 241 |
| 672 | 3300013297 | Ga0157378_10000742 | Ga0157378_1000074225 | 241 |
| 673 | 3300013306 | Ga0163162_10000003 | Ga0163162_10000003470 | 241 |
| 674 | 3300025924 | Ga0207694_10010172 | Ga0207694_100101723 | 241 |
| 675 | 3300026041 | Ga0207639_10032218 | Ga0207639_100322184 | 241 |
| 676 | 3300041452 | Ga0451793_0131431 | Ga0451793_0131431_2643_3404 | 241 |
| 677 | 3300042438 | Ga0439459_0004955 | Ga0439459_0004955_538_1296 | 241 |
| 678 | 3300046460 | Ga0495638_0000268 | Ga0495638_0000268_4145_4903 | 241 |
| 679 | 3300048924 | Ga0496121_0001076 | Ga0496121_0001076_45164_45946 | 241 |
| 680 | 3300053088 | Ga0500644_0153792 | Ga0500644_0153792_10_786 | 241 |
| 681 | 3300053108 | Ga0500562_004594 | Ga0500562_004594_2133_2933 | 241 |
| 682 | 3300053142 | Ga0500577_0100013 | Ga0500577_0100013_326_1126 | 241 |
| 683 | iso_pu_bacteria | 2941489479 | 2941494176 | 241 |
| 684 | 3300041512 | Ga0451853_3345382 | Ga0451853_3345382_817_1545 | 242 |
| 685 | 3300001904 | JGI24736J21556_1009123 | JGI24736J21556_10091232 | 243 |
| 686 | 3300005335 | Ga0070666_10009638 | Ga0070666_100096384 | 243 |
| 687 | 3300005344 | Ga0070661_100063654 | Ga0070661_1000636542 | 243 |
| 688 | 3300005367 | Ga0070667_100045478 | Ga0070667_1000454783 | 243 |
| 689 | 3300005455 | Ga0070663_100016021 | Ga0070663_1000160215 | 243 |
| 690 | 3300005466 | Ga0070685_10004579 | Ga0070685_100045794 | 243 |
| 691 | 3300005548 | Ga0070665_100002383 | Ga0070665_1000023834 | 243 |
| 692 | 3300005563 | Ga0068855_100191537 | Ga0068855_1001915372 | 243 |
| 693 | 3300005577 | Ga0068857_100170520 | Ga0068857_1001705202 | 243 |
| 694 | 3300005578 | Ga0068854_100070811 | Ga0068854_1000708112 | 243 |
| 695 | 3300005614 | Ga0068856_100178471 | Ga0068856_1001784713 | 243 |
| 696 | 3300005616 | Ga0068852_100136829 | Ga0068852_1001368292 | 243 |
| 697 | 3300005834 | Ga0068851_10000687 | Ga0068851_100006873 | 243 |
| 698 | 3300005842 | Ga0068858_100001419 | Ga0068858_1000014193 | 243 |
| 699 | 3300006358 | Ga0068871_100572127 | Ga0068871_1005721272 | 243 |
| 700 | 3300006881 | Ga0068865_100016347 | Ga0068865_1000163474 | 243 |
| 701 | 3300009093 | Ga0105240_10000315 | Ga0105240_1000031574 | 243 |
| 702 | 3300009093 | Ga0105240_10015231 | Ga0105240_100152313 | 243 |
| 703 | 3300009093 | Ga0105240_10047100 | Ga0105240_100471005 | 243 |
| 704 | 3300009174 | Ga0105241_10009513 | Ga0105241_100095132 | 243 |
| 705 | 3300009545 | Ga0105237_10027131 | Ga0105237_100271314 | 243 |
| 706 | 3300009545 | Ga0105237_10150781 | Ga0105237_101507812 | 243 |
| 707 | 3300009545 | Ga0105237_10234794 | Ga0105237_102347942 | 243 |
| 708 | 3300009551 | Ga0105238_10000270 | Ga0105238_100002706 | 243 |
| 709 | 3300009551 | Ga0105238_10013764 | Ga0105238_100137642 | 243 |
| 710 | 3300009553 | Ga0105249_10031285 | Ga0105249_100312853 | 243 |
| 711 | 3300010375 | Ga0105239_10459569 | Ga0105239_104595692 | 243 |
| 712 | 3300010375 | Ga0105239_10907735 | Ga0105239_109077352 | 243 |
| 713 | 3300013105 | Ga0157369_10015904 | Ga0157369_100159045 | 243 |
| 714 | 3300013296 | Ga0157374_10435778 | Ga0157374_104357782 | 243 |
| 715 | 3300013307 | Ga0157372_10327602 | Ga0157372_103276022 | 243 |
| 716 | 3300025321 | Ga0207656_10000776 | Ga0207656_100007763 | 243 |
| 717 | 3300025903 | Ga0207680_10138706 | Ga0207680_101387062 | 243 |
| 718 | 3300025904 | Ga0207647_10000198 | Ga0207647_100001989 | 243 |
| 719 | 3300025911 | Ga0207654_10189909 | Ga0207654_101899092 | 243 |
| 720 | 3300025913 | Ga0207695_10000033 | Ga0207695_1000003396 | 243 |
| 721 | 3300025913 | Ga0207695_10022622 | Ga0207695_100226226 | 243 |
| 722 | 3300025913 | Ga0207695_10028928 | Ga0207695_100289286 | 243 |
| 723 | 3300025914 | Ga0207671_10011245 | Ga0207671_100112454 | 243 |
| 724 | 3300025914 | Ga0207671_10054162 | Ga0207671_100541622 | 243 |
| 725 | 3300025920 | Ga0207649_10265800 | Ga0207649_102658002 | 243 |
| 726 | 3300025924 | Ga0207694_10000267 | Ga0207694_100002678 | 243 |
| 727 | 3300025924 | Ga0207694_10002269 | Ga0207694_100022697 | 243 |
| 728 | 3300025938 | Ga0207704_10022179 | Ga0207704_100221793 | 243 |
| 729 | 3300025961 | Ga0207712_10000644 | Ga0207712_1000064411 | 243 |
| 730 | 3300025981 | Ga0207640_10050429 | Ga0207640_100504292 | 243 |
| 731 | 3300026023 | Ga0207677_10038712 | Ga0207677_100387123 | 243 |
| 732 | 3300026035 | Ga0207703_10000769 | Ga0207703_1000076928 | 243 |
| 733 | 3300026041 | Ga0207639_10000125 | Ga0207639_1000012510 | 243 |
| 734 | 3300026067 | Ga0207678_10006481 | Ga0207678_1000648110 | 243 |
| 735 | 3300026078 | Ga0207702_10006583 | Ga0207702_100065833 | 243 |
| 736 | 3300026116 | Ga0207674_10147841 | Ga0207674_101478412 | 243 |
| 737 | 3300026142 | Ga0207698_10103707 | Ga0207698_101037072 | 243 |
| 738 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006244 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9715 | 4 | 227 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9597 | 1 | 228 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9581 | 3 | 226 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9563 | 3 | 220 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9555 | 1 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9682 | 1 | 221 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.968 | 32 | 228 | 3.40.50.300 |
| af_P9WQK5_1_219_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9667 | 1 | 215 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9664 | 1 | 227 | 3.40.50.300 |
| af_Q4DP20_46_317_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9639 | 1 | 228 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I4FC62-F1-model_v4 | ABC-type lipoprotein export system, ATPase component | 0.971 | 1 | 226 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A174C2M7-F1-model_v4 | deleted | 0.9694 | 2 | 221 |
|
| AF-A0A353M4F4-F1-model_v4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.9692 | 40 | 200 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7J0BSF2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9676 | 2 | 227 |
GO:0005524
GO:0016887 |
| AF-A0A838DTV6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9644 | 4 | 226 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar