F478423

General Info

Members Datasets Scaffolds Average Seq Length
738 298 720 242

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_004594|Ga0500562_004594_2133_2933
Length 266
Sequence MSPTMRNTMHSAPAPATPKREPSLQAERLSKSFLSGVVRVQVLQELSISIYPAELTLISGPSGCGKSTLLSLLSGLQPADSGHARALGEDLSKLNKRALERFRLKHTGFVFQGFNLFPALTAKEQVQLPLGYLGFDDKRSAARAMQALTEVGMTHRANAYPAQMSGGEKQRIAIARALAKEPELLFADEPTSALDADNGQKIIDILHGIARSHGTTVLCVSHDPRLVRHADRVLAMEDGAIRNDWQPSGHAPVRAERAALTADQHS

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
3 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
4 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
5 2721755523 Delftia sp. HK171 Isolate Unclassified
6 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
7 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
8 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
9 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
10 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
11 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
12 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
13 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
14 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
15 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
16 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
17 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
117 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
290 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
291 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
297 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
298 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 1.49
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.05
Nodule 0.27
Rhizoplane 1.22
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009123 3300001904 Bacteria 1641
2 JGI24741J21665_1001625 3300001915 Bacteria 6285
3 JGI24741J21665_1002187 3300001915 Bacteria 5191
4 JGI24741J21665_1009546 3300001915 Bacteria 1777
5 JGI24741J21665_1014773 3300001915 Bacteria 1298
6 JGI24740J21852_10002171 3300001979 Bacteria 8971
7 JGI24740J21852_10013580 3300001979 Bacteria 3032
8 JGI25156J39149_1002818 3300002705 Bacteria 6001
9 JGI25162J39368_1000605 3300002737 Bacteria 25839
10 JGI25162J39368_1001369 3300002737 Bacteria 13418
11 JGI25162J39368_1001619 3300002737 Bacteria 11287
12 JGI25157J39369_1001681 3300002741 Bacteria 7511
13 JGI25157J39369_1004324 3300002741 Bacteria 2618
14 JGI25164J39214_1000390 3300002772 Bacteria 25835
15 JGI25164J39214_1000439 3300002772 Bacteria 22628
16 JGI25165J46597_1000725 3300003214 Bacteria 25839
17 JGI25165J46597_1003866 3300003214 Bacteria 3477
18 rootH2_10177447 3300003320 Bacteria 1783
19 rootH1_10256714 3300003323 Bacteria 2426
20 Ga0055538_1000251 3300003751 Bacteria 28537
21 Ga0055539_1000286 3300003752 Bacteria 28537
22 Ga0055533_1000274 3300003756 Bacteria 28154
23 Ga0055532_1000316 3300003758 Bacteria 28537
24 Ga0055525_1000384 3300003759 Bacteria 28537
25 Ga0055526_1000012 3300003771 Bacteria 234368
26 Ga0055537_1000021 3300003773 Bacteria 116840
27 Ga0055524_1000037 3300003775 Bacteria 167140
28 Ga0055534_1000006 3300003784 Bacteria 234368
29 Ga0055528_1000006 3300003790 Bacteria 234368
30 Ga0055541_1000185 3300003841 Bacteria 28537
31 Ga0065165_1000566 3300005262 Bacteria 54948
32 Ga0070658_10240450 3300005327 Bacteria 1534
33 Ga0070658_10333580 3300005327 Bacteria 1296
34 Ga0070658_10352043 3300005327 Bacteria 1261
35 Ga0070676_10128970 3300005328 Bacteria 1597
36 Ga0070683_100010639 3300005329 Bacteria 7909
37 Ga0070683_100027521 3300005329 Bacteria 5128
38 Ga0070670_100002058 3300005331 Bacteria 16469
39 Ga0070670_100099592 3300005331 Bacteria 2501
40 Ga0068869_100436686 3300005334 Bacteria 1083
41 Ga0070666_10000350 3300005335 Bacteria 28941
42 Ga0070666_10009638 3300005335 Bacteria 6026
43 Ga0070666_10068370 3300005335 Bacteria 2414
44 Ga0070680_100000239 3300005336 Bacteria 36253
45 Ga0070680_100022260 3300005336 Bacteria 5045
46 Ga0070680_100054006 3300005336 Bacteria 3279
47 Ga0070680_100089125 3300005336 Bacteria 2553
48 Ga0070680_100193900 3300005336 Bacteria 1712
49 Ga0070682_100013760 3300005337 Bacteria 4664
50 Ga0070660_100051419 3300005339 Bacteria 3173
51 Ga0070660_100070368 3300005339 Bacteria 2730
52 Ga0070660_100073009 3300005339 Bacteria 2682
53 Ga0070660_100097751 3300005339 Bacteria 2323
54 Ga0070660_100294005 3300005339 Bacteria 1330
55 Ga0070660_100424355 3300005339 Bacteria 1101
56 Ga0070691_10000595 3300005341 Bacteria 13871
57 Ga0070691_10014457 3300005341 Bacteria 3622
58 Ga0070691_10059932 3300005341 Bacteria 1829
59 Ga0070691_10179881 3300005341 Bacteria 1100
60 Ga0070661_100011682 3300005344 Bacteria 6123
61 Ga0070661_100056566 3300005344 Bacteria 2874
62 Ga0070661_100063654 3300005344 Bacteria 2709
63 Ga0070661_100491766 3300005344 Bacteria 981
64 Ga0070692_10001558 3300005345 Bacteria 8418
65 Ga0070692_10003790 3300005345 Bacteria 6216
66 Ga0070692_10007323 3300005345 Bacteria 4858
67 Ga0070692_10175332 3300005345 Bacteria 1239
68 Ga0070668_100040519 3300005347 Bacteria 3564
69 Ga0070671_100335198 3300005355 Bacteria 1290
70 Ga0070659_100017881 3300005366 Bacteria 5341
71 Ga0070659_100047479 3300005366 Bacteria 3368
72 Ga0070659_100448990 3300005366 Bacteria 1093
73 Ga0070667_100045478 3300005367 Bacteria 3691
74 Ga0070667_100076928 3300005367 Bacteria 2849
75 Ga0070667_100145634 3300005367 Bacteria 2077
76 Ga0070714_100000030 3300005435 Bacteria 136610
77 Ga0070714_100002250 3300005435 Bacteria 14199
78 Ga0070714_100226350 3300005435 Bacteria 1721
79 Ga0070713_100001474 3300005436 Bacteria 15027
80 Ga0070710_10008440 3300005437 Bacteria 5014
81 Ga0070708_100132677 3300005445 Bacteria 2306
82 Ga0070663_100013292 3300005455 Bacteria 5243
83 Ga0070663_100016021 3300005455 Bacteria 4854
84 Ga0070663_100225189 3300005455 Bacteria 1474
85 Ga0070662_100211734 3300005457 Bacteria 1543
86 Ga0070681_10000066 3300005458 Bacteria 75733
87 Ga0070681_10001719 3300005458 Bacteria 19589
88 Ga0070681_10005052 3300005458 Bacteria 12723
89 Ga0070681_10169395 3300005458 Bacteria 2106
90 Ga0070681_10396294 3300005458 Bacteria 1292
91 Ga0068867_100164135 3300005459 Bacteria 1754
92 Ga0070685_10004579 3300005466 Bacteria 6995
93 Ga0070679_100000195 3300005530 Bacteria 49445
94 Ga0070679_100001729 3300005530 Bacteria 19684
95 Ga0070679_100036870 3300005530 Bacteria 4854
96 Ga0070679_100094144 3300005530 Bacteria 2983
97 Ga0070679_100109779 3300005530 Bacteria 2745
98 Ga0070679_100125623 3300005530 Bacteria 2548
99 Ga0070684_100010722 3300005535 Bacteria 7273
100 Ga0070684_100043440 3300005535 Bacteria 3881
101 Ga0068853_100000489 3300005539 Bacteria 27026
102 Ga0068853_100005468 3300005539 Bacteria 9953
103 Ga0068853_100012163 3300005539 Bacteria 6999
104 Ga0068853_100016535 3300005539 Bacteria 6074
105 Ga0068853_100017139 3300005539 Bacteria 5976
106 Ga0068853_100023369 3300005539 Bacteria 5174
107 Ga0068853_100109441 3300005539 Bacteria 2452
108 Ga0068853_100120411 3300005539 Bacteria 2340
109 Ga0068853_100504145 3300005539 Bacteria 1143
110 Ga0070696_100041401 3300005546 Bacteria 3182
111 Ga0070693_100027258 3300005547 Bacteria 3094
112 Ga0070693_100040304 3300005547 Bacteria 2621
113 Ga0070693_100045515 3300005547 Bacteria 2488
114 Ga0070693_100087149 3300005547 Bacteria 1875
115 Ga0070665_100000092 3300005548 Bacteria 174397
116 Ga0070665_100002383 3300005548 Bacteria 20737
117 Ga0070665_100192708 3300005548 Bacteria 2039
118 Ga0068855_100028055 3300005563 Bacteria 6733
119 Ga0068855_100053950 3300005563 Bacteria 4728
120 Ga0068855_100070522 3300005563 Bacteria 4065
121 Ga0068855_100113173 3300005563 Bacteria 3113
122 Ga0068855_100191537 3300005563 Bacteria 2306
123 Ga0068855_100286220 3300005563 Bacteria 1828
124 Ga0068855_100528314 3300005563 Bacteria 1279
125 Ga0070664_100093962 3300005564 Bacteria 2600
126 Ga0070664_100360793 3300005564 Bacteria 1323
127 Ga0070664_100459181 3300005564 Bacteria 1170
128 Ga0068857_100013171 3300005577 Bacteria 7206
129 Ga0068857_100013205 3300005577 Bacteria 7197
130 Ga0068857_100052780 3300005577 Bacteria 3606
131 Ga0068857_100067730 3300005577 Bacteria 3177
132 Ga0068857_100084313 3300005577 Bacteria 2839
133 Ga0068857_100170520 3300005577 Bacteria 1978
134 Ga0068857_100257199 3300005577 Bacteria 1602
135 Ga0068857_100259455 3300005577 Bacteria 1595
136 Ga0068854_100070811 3300005578 Bacteria 2549
137 Ga0068854_100098676 3300005578 Bacteria 2186
138 Ga0068856_100000616 3300005614 Bacteria 39024
139 Ga0068856_100002412 3300005614 Bacteria 19225
140 Ga0068856_100030997 3300005614 Bacteria 5230
141 Ga0068856_100136197 3300005614 Bacteria 2461
142 Ga0068856_100137069 3300005614 Bacteria 2453
143 Ga0068856_100178471 3300005614 Bacteria 2136
144 Ga0068856_100381721 3300005614 Bacteria 1428
145 Ga0068856_100631338 3300005614 Bacteria 1092
146 Ga0068852_100007256 3300005616 Bacteria 8083
147 Ga0068852_100040233 3300005616 Bacteria 3942
148 Ga0068852_100111931 3300005616 Bacteria 2483
149 Ga0068852_100136829 3300005616 Bacteria 2262
150 Ga0068852_100154976 3300005616 Bacteria 2133
151 Ga0068852_100351942 3300005616 Bacteria 1438
152 Ga0068859_100017309 3300005617 Bacteria 7239
153 Ga0068859_100035642 3300005617 Bacteria 4993
154 Ga0068864_100007613 3300005618 Bacteria 8917
155 Ga0068851_10000687 3300005834 Bacteria 14435
156 Ga0068851_10023061 3300005834 Bacteria 3039
157 Ga0068851_10025349 3300005834 Bacteria 2908
158 Ga0068863_100015047 3300005841 Bacteria 7434
159 Ga0068863_100161157 3300005841 Bacteria 2149
160 Ga0068858_100001419 3300005842 Bacteria 24633
161 Ga0068860_100003032 3300005843 Bacteria 17342
162 Ga0068860_100020529 3300005843 Bacteria 6398
163 Ga0068862_100000165 3300005844 Bacteria 73621
164 Ga0068862_100051763 3300005844 Bacteria 3512
165 Ga0075364_10008565 3300006051 Bacteria 6119
166 Ga0070712_100040456 3300006175 Bacteria 3196
167 Ga0097621_100099986 3300006237 Bacteria 2439
168 Ga0097621_100238628 3300006237 Bacteria 1589
169 Ga0068871_100572127 3300006358 Bacteria 1025
170 Ga0068871_100632371 3300006358 Bacteria 976
171 Ga0068865_100016347 3300006881 Bacteria 4747
172 Ga0068865_100257754 3300006881 Bacteria 1379
173 Ga0097620_100017309 3300006931 Bacteria 7239
174 Ga0097620_100035641 3300006931 Bacteria 4993
175 Ga0105251_10000872 3300009011 Bacteria 27050
176 Ga0105250_10000043 3300009092 Bacteria 129336
177 Ga0105240_10000315 3300009093 Bacteria 92923
178 Ga0105240_10002058 3300009093 Bacteria 32990
179 Ga0105240_10015231 3300009093 Bacteria 10462
180 Ga0105240_10029279 3300009093 Bacteria 7179
181 Ga0105240_10047100 3300009093 Bacteria 5458
182 Ga0105240_10074811 3300009093 Bacteria 4180
183 Ga0105240_10104490 3300009093 Bacteria 3440
184 Ga0105240_10276126 3300009093 Bacteria 1933
185 Ga0105240_10403121 3300009093 Bacteria 1540
186 Ga0105240_10960550 3300009093 Bacteria 916
187 Ga0105245_10157811 3300009098 Bacteria 2150
188 Ga0105243_10001046 3300009148 Bacteria 25338
189 Ga0105243_10030891 3300009148 Bacteria 4128
190 Ga0105241_10007584 3300009174 Bacteria 7977
191 Ga0105241_10009513 3300009174 Bacteria 7139
192 Ga0105241_10043966 3300009174 Bacteria 3384
193 Ga0105241_10113613 3300009174 Bacteria 2171
194 Ga0105242_10002824 3300009176 Bacteria 13606
195 Ga0105237_10000150 3300009545 Bacteria 97072
196 Ga0105237_10008060 3300009545 Bacteria 11456
197 Ga0105237_10014526 3300009545 Bacteria 8230
198 Ga0105237_10027131 3300009545 Bacteria 5849
199 Ga0105237_10107485 3300009545 Bacteria 2782
200 Ga0105237_10150781 3300009545 Bacteria 2321
201 Ga0105237_10193136 3300009545 Bacteria 2035
202 Ga0105237_10195930 3300009545 Bacteria 2020
203 Ga0105237_10234794 3300009545 Bacteria 1835
204 Ga0105237_10440428 3300009545 Bacteria 1309
205 Ga0105237_10480616 3300009545 Bacteria 1248
206 Ga0105238_10000270 3300009551 Bacteria 58093
207 Ga0105238_10002470 3300009551 Bacteria 18501
208 Ga0105238_10010010 3300009551 Bacteria 9512
209 Ga0105238_10011232 3300009551 Bacteria 9011
210 Ga0105238_10013764 3300009551 Bacteria 8176
211 Ga0105238_10171703 3300009551 Bacteria 2144
212 Ga0105238_10277919 3300009551 Bacteria 1655
213 Ga0105249_10031285 3300009553 Bacteria 4812
214 Ga0105249_10112226 3300009553 Bacteria 2578
215 Ga0105249_10268711 3300009553 Bacteria 1698
216 Ga0105239_10000023 3300010375 Bacteria 257478
217 Ga0105239_10004269 3300010375 Bacteria 17142
218 Ga0105239_10007220 3300010375 Bacteria 12763
219 Ga0105239_10010578 3300010375 Bacteria 10315
220 Ga0105239_10039813 3300010375 Bacteria 5150
221 Ga0105239_10235823 3300010375 Bacteria 2053
222 Ga0105239_10459569 3300010375 Bacteria 1445
223 Ga0105239_10907735 3300010375 Bacteria 1011
224 Ga0105246_10010675 3300011119 Bacteria 5689
225 Ga0157373_10009136 3300013100 Bacteria 7330
226 Ga0157373_10027507 3300013100 Bacteria 4103
227 Ga0157373_10073928 3300013100 Bacteria 2405
228 Ga0157373_10126849 3300013100 Bacteria 1795
229 Ga0157373_10158615 3300013100 Bacteria 1592
230 Ga0157373_10226940 3300013100 Bacteria 1318
231 Ga0157373_10330868 3300013100 Bacteria 1085
232 Ga0157371_10021396 3300013102 Bacteria 4749
233 Ga0157371_10037807 3300013102 Bacteria 3454
234 Ga0157371_10037988 3300013102 Bacteria 3445
235 Ga0157371_10077699 3300013102 Bacteria 2351
236 Ga0157371_10270309 3300013102 Bacteria 1227
237 Ga0157371_10308336 3300013102 Bacteria 1147
238 Ga0157370_10000662 3300013104 Bacteria 42848
239 Ga0157370_10001955 3300013104 Bacteria 25396
240 Ga0157370_10057105 3300013104 Bacteria 3713
241 Ga0157370_10072144 3300013104 Bacteria 3258
242 Ga0157370_10076915 3300013104 Bacteria 3144
243 Ga0157370_10077984 3300013104 Bacteria 3120
244 Ga0157370_10289452 3300013104 Bacteria 1513
245 Ga0157370_10358921 3300013104 Bacteria 1343
246 Ga0157370_10362185 3300013104 Bacteria 1336
247 Ga0157369_10000011 3300013105 Bacteria 271560
248 Ga0157369_10011883 3300013105 Bacteria 9890
249 Ga0157369_10015904 3300013105 Bacteria 8472
250 Ga0157369_10037435 3300013105 Bacteria 5311
251 Ga0157369_10062258 3300013105 Bacteria 4021
252 Ga0157369_10729521 3300013105 Bacteria 1020
253 Ga0157374_10435778 3300013296 Bacteria 1311
254 Ga0157378_10000742 3300013297 Bacteria 30520
255 Ga0163162_10000003 3300013306 Bacteria 698280
256 Ga0163162_10043255 3300013306 Bacteria 4510
257 Ga0157372_10001728 3300013307 Bacteria 23694
258 Ga0157372_10021015 3300013307 Bacteria 7047
259 Ga0157372_10031724 3300013307 Bacteria 5787
260 Ga0157372_10034240 3300013307 Bacteria 5583
261 Ga0157372_10058048 3300013307 Bacteria 4325
262 Ga0157372_10072613 3300013307 Bacteria 3878
263 Ga0157372_10084140 3300013307 Bacteria 3605
264 Ga0157372_10119838 3300013307 Bacteria 3021
265 Ga0157372_10262641 3300013307 Bacteria 2005
266 Ga0157372_10307719 3300013307 Bacteria 1844
267 Ga0157372_10327602 3300013307 Bacteria 1783
268 Ga0157372_10513176 3300013307 Bacteria 1397
269 Ga0157375_10000948 3300013308 Bacteria 25130
270 Ga0163163_10001486 3300014325 Bacteria 19850
271 Ga0163163_10004834 3300014325 Bacteria 11573
272 Ga0182008_10000325 3300014497 Bacteria 37641
273 Ga0182008_10002759 3300014497 Bacteria 10892
274 Ga0157379_10003069 3300014968 Bacteria 14127
275 Ga0157376_10006607 3300014969 Bacteria 8206
276 Ga0182006_1031084 3300015261 Bacteria 2154
277 Ga0182007_10013140 3300015262 Bacteria 3169
278 Ga0182005_1010993 3300015265 Bacteria 2591
279 Ga0183369_1020 3300015685 Bacteria 111322
280 Ga0183360_10002 3300015689 Bacteria 953821
281 Ga0206356_10169834 3300020070 Bacteria 2490
282 Ga0206356_10896713 3300020070 Bacteria 1497
283 Ga0206356_11346780 3300020070 Bacteria 2325
284 Ga0206354_10259504 3300020081 Bacteria 1293
285 Ga0206354_10264878 3300020081 Bacteria 4356
286 Ga0206353_10003797 3300020082 Bacteria 4820
287 Ga0206353_10103272 3300020082 Bacteria 2295
288 Ga0206353_10112387 3300020082 Bacteria 4221
289 Ga0206353_11359476 3300020082 Bacteria 2154
290 Ga0154015_1493589 3300020610 Bacteria 3005
291 Ga0154015_1604739 3300020610 Bacteria 1330
292 Ga0209435_100154 3300025206 Bacteria 22442
293 Ga0209784_100152 3300025224 Bacteria 63246
294 Ga0209566_100192 3300025225 Bacteria 63440
295 Ga0209674_100196 3300025226 Bacteria 63246
296 Ga0209674_103679 3300025226 Bacteria 2737
297 Ga0209147_100330 3300025229 Bacteria 35746
298 Ga0209563_100156 3300025230 Bacteria 63329
299 Ga0207427_100118 3300025231 Bacteria 102109
300 Ga0207427_100120 3300025231 Bacteria 101516
301 Ga0209437_100020 3300025233 Bacteria 656374
302 Ga0209437_100231 3300025233 Bacteria 94387
303 Ga0209437_101151 3300025233 Bacteria 7896
304 Ga0209258_100615 3300025242 Bacteria 28576
305 Ga0209646_1000332 3300025246 Bacteria 35552
306 Ga0209026_1000037 3300025250 Bacteria 282562
307 Ga0209026_1000122 3300025250 Bacteria 126140
308 Ga0209677_100152 3300025253 Bacteria 63540
309 Ga0209759_1002588 3300025256 Bacteria 7803
310 Ga0209759_1006503 3300025256 Bacteria 3916
311 Ga0209759_1016157 3300025256 Bacteria 1897
312 Ga0209233_1000020 3300025261 Bacteria 798224
313 Ga0209233_1000147 3300025261 Bacteria 186517
314 Ga0209565_1000002 3300025263 Bacteria 1423083
315 Ga0209565_1002845 3300025263 Bacteria 5954
316 Ga0209455_1000323 3300025272 Bacteria 47398
317 Ga0209673_1000002 3300025273 Bacteria 1423083
318 Ga0209675_1000002 3300025291 Bacteria 1423083
319 Ga0209564_1000004 3300025295 Bacteria 1424639
320 Ga0209256_1000004 3300025299 Bacteria 1424643
321 Ga0209051_1025716 3300025303 Bacteria 2388
322 Ga0207656_10000776 3300025321 Bacteria 10460
323 Ga0207656_10159007 3300025321 Bacteria 1074
324 Ga0207696_1000509 3300025711 Bacteria 32376
325 Ga0207713_1003587 3300025735 Bacteria 10480
326 Ga0207692_10005174 3300025898 Bacteria 5208
327 Ga0207680_10000092 3300025903 Bacteria 41687
328 Ga0207680_10037622 3300025903 Bacteria 2795
329 Ga0207680_10138706 3300025903 Bacteria 1610
330 Ga0207647_10000198 3300025904 Bacteria 49337
331 Ga0207647_10003544 3300025904 Bacteria 11709
332 Ga0207647_10006817 3300025904 Bacteria 8280
333 Ga0207647_10017679 3300025904 Bacteria 4843
334 Ga0207647_10074550 3300025904 Bacteria 2043
335 Ga0207645_10150881 3300025907 Bacteria 1517
336 Ga0207705_10001297 3300025909 Bacteria 20070
337 Ga0207705_10002953 3300025909 Bacteria 13000
338 Ga0207705_10005116 3300025909 Bacteria 9834
339 Ga0207705_10007645 3300025909 Bacteria 7949
340 Ga0207705_10143123 3300025909 Bacteria 1787
341 Ga0207705_10156987 3300025909 Bacteria 1707
342 Ga0207654_10026625 3300025911 Bacteria 3134
343 Ga0207654_10074837 3300025911 Bacteria 2022
344 Ga0207654_10189909 3300025911 Bacteria 1346
345 Ga0207707_10000065 3300025912 Bacteria 106546
346 Ga0207707_10000068 3300025912 Bacteria 103683
347 Ga0207707_10001385 3300025912 Bacteria 22524
348 Ga0207707_10003405 3300025912 Bacteria 14101
349 Ga0207707_10011701 3300025912 Bacteria 7635
350 Ga0207707_10030775 3300025912 Bacteria 4695
351 Ga0207707_10106782 3300025912 Bacteria 2447
352 Ga0207695_10000033 3300025913 Bacteria 507477
353 Ga0207695_10000256 3300025913 Bacteria 135850
354 Ga0207695_10001104 3300025913 Bacteria 46882
355 Ga0207695_10002140 3300025913 Bacteria 29914
356 Ga0207695_10004841 3300025913 Bacteria 18173
357 Ga0207695_10006519 3300025913 Bacteria 15111
358 Ga0207695_10022622 3300025913 Bacteria 7128
359 Ga0207695_10027834 3300025913 Bacteria 6285
360 Ga0207695_10028928 3300025913 Bacteria 6134
361 Ga0207695_10424073 3300025913 Bacteria 1214
362 Ga0207671_10000570 3300025914 Bacteria 49510
363 Ga0207671_10000716 3300025914 Bacteria 42402
364 Ga0207671_10009998 3300025914 Bacteria 7876
365 Ga0207671_10011245 3300025914 Bacteria 7302
366 Ga0207671_10054162 3300025914 Bacteria 2973
367 Ga0207671_10426611 3300025914 Bacteria 1055
368 Ga0207660_10000181 3300025917 Bacteria 40287
369 Ga0207660_10000502 3300025917 Bacteria 26090
370 Ga0207660_10001334 3300025917 Bacteria 16506
371 Ga0207660_10010540 3300025917 Bacteria 6003
372 Ga0207660_10013253 3300025917 Bacteria 5401
373 Ga0207660_10013765 3300025917 Bacteria 5309
374 Ga0207660_10048414 3300025917 Bacteria 3008
375 Ga0207660_10361322 3300025917 Bacteria 1165
376 Ga0207657_10018195 3300025919 Bacteria 6722
377 Ga0207657_10018263 3300025919 Bacteria 6706
378 Ga0207657_10021798 3300025919 Bacteria 6019
379 Ga0207657_10044192 3300025919 Bacteria 3918
380 Ga0207657_10086825 3300025919 Bacteria 2618
381 Ga0207657_10096034 3300025919 Bacteria 2466
382 Ga0207657_10105060 3300025919 Bacteria 2338
383 Ga0207657_10140928 3300025919 Bacteria 1970
384 Ga0207657_10324810 3300025919 Bacteria 1216
385 Ga0207649_10001915 3300025920 Bacteria 11887
386 Ga0207649_10009079 3300025920 Bacteria 5435
387 Ga0207649_10018624 3300025920 Bacteria 3953
388 Ga0207649_10048311 3300025920 Bacteria 2624
389 Ga0207649_10265800 3300025920 Bacteria 1241
390 Ga0207652_10000081 3300025921 Bacteria 103132
391 Ga0207652_10000213 3300025921 Bacteria 61477
392 Ga0207652_10002964 3300025921 Bacteria 14184
393 Ga0207652_10076647 3300025921 Bacteria 2917
394 Ga0207652_10079425 3300025921 Bacteria 2866
395 Ga0207652_10079522 3300025921 Bacteria 2864
396 Ga0207652_10110866 3300025921 Bacteria 2433
397 Ga0207694_10000267 3300025924 Bacteria 49520
398 Ga0207694_10002269 3300025924 Bacteria 15735
399 Ga0207694_10010172 3300025924 Bacteria 7089
400 Ga0207694_10019421 3300025924 Bacteria 5135
401 Ga0207694_10052125 3300025924 Bacteria 3172
402 Ga0207694_10219523 3300025924 Bacteria 1550
403 Ga0207694_10756646 3300025924 Bacteria 820
404 Ga0207650_10031088 3300025925 Bacteria 3853
405 Ga0207687_10079930 3300025927 Bacteria 2358
406 Ga0207700_10034895 3300025928 Bacteria 3616
407 Ga0207664_10000026 3300025929 Bacteria 194571
408 Ga0207664_10001232 3300025929 Bacteria 16942
409 Ga0207664_10050239 3300025929 Bacteria 3288
410 Ga0207644_10630627 3300025931 Bacteria 891
411 Ga0207690_10019820 3300025932 Bacteria 4145
412 Ga0207690_10022227 3300025932 Bacteria 3943
413 Ga0207690_10056684 3300025932 Bacteria 2644
414 Ga0207690_10091683 3300025932 Bacteria 2148
415 Ga0207690_10166837 3300025932 Bacteria 1646
416 Ga0207706_10014962 3300025933 Bacteria 7026
417 Ga0207706_10016229 3300025933 Bacteria 6730
418 Ga0207706_10035126 3300025933 Bacteria 4459
419 Ga0207706_10124565 3300025933 Bacteria 2267
420 Ga0207686_10004297 3300025934 Bacteria 7639
421 Ga0207709_10000070 3300025935 Bacteria 183020
422 Ga0207709_10068019 3300025935 Bacteria 2250
423 Ga0207704_10022179 3300025938 Bacteria 3397
424 Ga0207704_10316245 3300025938 Bacteria 1202
425 Ga0207661_10054426 3300025944 Bacteria 3205
426 Ga0207661_10061390 3300025944 Bacteria 3036
427 Ga0207667_10005041 3300025949 Bacteria 16131
428 Ga0207667_10015858 3300025949 Bacteria 8538
429 Ga0207667_10018972 3300025949 Bacteria 7691
430 Ga0207667_10030752 3300025949 Bacteria 5802
431 Ga0207667_10037324 3300025949 Bacteria 5194
432 Ga0207667_10044075 3300025949 Bacteria 4729
433 Ga0207667_10251073 3300025949 Bacteria 1809
434 Ga0207667_10508463 3300025949 Bacteria 1221
435 Ga0207667_10565938 3300025949 Bacteria 1148
436 Ga0207712_10000644 3300025961 Bacteria 27291
437 Ga0207712_10156560 3300025961 Bacteria 1765
438 Ga0207668_10238302 3300025972 Bacteria 1470
439 Ga0207640_10001690 3300025981 Bacteria 11828
440 Ga0207640_10006810 3300025981 Bacteria 6285
441 Ga0207640_10019057 3300025981 Bacteria 4046
442 Ga0207640_10040325 3300025981 Bacteria 2961
443 Ga0207640_10050429 3300025981 Bacteria 2700
444 Ga0207640_10058000 3300025981 Bacteria 2549
445 Ga0207640_10171350 3300025981 Bacteria 1618
446 Ga0207640_10321542 3300025981 Bacteria 1232
447 Ga0207658_10004134 3300025986 Bacteria 10122
448 Ga0207658_10846757 3300025986 Bacteria 831
449 Ga0207677_10038712 3300026023 Bacteria 3128
450 Ga0207677_10286619 3300026023 Bacteria 1354
451 Ga0207703_10000769 3300026035 Bacteria 31525
452 Ga0207703_10291821 3300026035 Bacteria 1484
453 Ga0207639_10000125 3300026041 Bacteria 56190
454 Ga0207639_10000240 3300026041 Bacteria 41113
455 Ga0207639_10003606 3300026041 Bacteria 10399
456 Ga0207639_10012868 3300026041 Bacteria 5838
457 Ga0207639_10013363 3300026041 Bacteria 5746
458 Ga0207639_10014688 3300026041 Bacteria 5515
459 Ga0207639_10032218 3300026041 Bacteria 3857
460 Ga0207639_10060096 3300026041 Bacteria 2931
461 Ga0207639_10084919 3300026041 Bacteria 2516
462 Ga0207639_10093507 3300026041 Bacteria 2411
463 Ga0207639_10107689 3300026041 Bacteria 2264
464 Ga0207639_10194346 3300026041 Bacteria 1735
465 Ga0207639_10196705 3300026041 Bacteria 1726
466 Ga0207639_10324537 3300026041 Bacteria 1368
467 Ga0207639_10558508 3300026041 Bacteria 1052
468 Ga0207678_10006481 3300026067 Bacteria 10384
469 Ga0207678_10008510 3300026067 Bacteria 9044
470 Ga0207678_10012413 3300026067 Bacteria 7478
471 Ga0207678_10017779 3300026067 Bacteria 6243
472 Ga0207678_10017867 3300026067 Bacteria 6230
473 Ga0207678_10052558 3300026067 Bacteria 3514
474 Ga0207678_10072036 3300026067 Bacteria 2961
475 Ga0207678_10170506 3300026067 Bacteria 1858
476 Ga0207678_10202868 3300026067 Bacteria 1696
477 Ga0207702_10000143 3300026078 Bacteria 84903
478 Ga0207702_10000321 3300026078 Bacteria 54950
479 Ga0207702_10000843 3300026078 Bacteria 32128
480 Ga0207702_10006583 3300026078 Bacteria 9986
481 Ga0207702_10010147 3300026078 Bacteria 7886
482 Ga0207702_10037018 3300026078 Bacteria 4082
483 Ga0207702_10104728 3300026078 Bacteria 2504
484 Ga0207702_10157551 3300026078 Bacteria 2071
485 Ga0207702_10859371 3300026078 Bacteria 898
486 Ga0207641_10013297 3300026088 Bacteria 6751
487 Ga0207641_10044183 3300026088 Bacteria 3746
488 Ga0207648_10026007 3300026089 Bacteria 5205
489 Ga0207676_10004232 3300026095 Bacteria 10136
490 Ga0207674_10013433 3300026116 Bacteria 9089
491 Ga0207674_10017769 3300026116 Bacteria 7753
492 Ga0207674_10019073 3300026116 Bacteria 7434
493 Ga0207674_10048121 3300026116 Bacteria 4366
494 Ga0207674_10063334 3300026116 Bacteria 3733
495 Ga0207674_10138751 3300026116 Bacteria 2392
496 Ga0207674_10147841 3300026116 Bacteria 2308
497 Ga0207674_10255320 3300026116 Bacteria 1700
498 Ga0207674_10264204 3300026116 Bacteria 1668
499 Ga0207674_10410559 3300026116 Bacteria 1309
500 Ga0207683_10198745 3300026121 Bacteria 1822
501 Ga0207698_10002432 3300026142 Bacteria 11029
502 Ga0207698_10010163 3300026142 Bacteria 6031
503 Ga0207698_10059655 3300026142 Bacteria 2963
504 Ga0207698_10103604 3300026142 Bacteria 2365
505 Ga0207698_10103707 3300026142 Bacteria 2364
506 Ga0207698_10208337 3300026142 Bacteria 1757
507 Ga0209281_1000029 3300027111 Bacteria 431495
508 Ga0268266_10000001 3300028379 Bacteria 4040580
509 Ga0268266_10000006 3300028379 Bacteria 1410021
510 Ga0268266_10402883 3300028379 Bacteria 1294
511 Ga0268265_10000203 3300028380 Bacteria 69132
512 Ga0268265_10160000 3300028380 Bacteria 1911
513 Ga0268264_10005067 3300028381 Bacteria 11155
514 Ga0268264_10031101 3300028381 Bacteria 4376
515 Ga0268264_10295045 3300028381 Bacteria 1524
516 Ga0265319_1005385 3300028563 Bacteria 6131
517 Ga0265332_10047995 3300031238 Bacteria 1837
518 Ga0265316_10111362 3300031344 Bacteria 2073
519 Ga0316575_10012645 3300031665 Bacteria 3143
520 Ga0316583_10029633 3300032133 Bacteria 1951
521 Ga0373944_0101318 3300035089 Bacteria 973
522 Ga0373953_0043343 3300035117 Bacteria 1796
523 Ga0373957_0050392 3300035120 Bacteria 1591
524 Ga0373933_0067021 3300035724 Bacteria 2177
525 Ga0373937_0178226 3300036401 Bacteria 1995
526 Ga0373937_0648871 3300036401 Bacteria 1001
527 Ga0395899_0020935 3300037312 Bacteria 4960
528 Ga0395899_0035784 3300037312 Bacteria 3726
529 Ga0395899_0046833 3300037312 Bacteria 3220
530 Ga0395899_0048433 3300037312 Bacteria 3163
531 Ga0395900_0000013 3300037418 Bacteria 388765
532 Ga0395900_0022037 3300037418 Bacteria 6515
533 Ga0395898_0047872 3300037466 Bacteria 4193
534 Ga0395898_0058393 3300037466 Bacteria 3755
535 Ga0395898_0069262 3300037466 Bacteria 3413
536 Ga0395898_0075288 3300037466 Bacteria 3260
537 Ga0395898_0170099 3300037466 Bacteria 2083
538 Ga0395898_0233893 3300037466 Bacteria 1752
539 Ga0395898_0659858 3300037466 Bacteria 988
540 Ga0395901_0002971 3300038443 Bacteria 17103
541 Ga0395901_0048209 3300038443 Bacteria 4423
542 Ga0395901_0079685 3300038443 Bacteria 3419
543 Ga0395901_0115202 3300038443 Bacteria 2823
544 Ga0395901_0180258 3300038443 Bacteria 2215
545 Ga0451793_0131431 3300041452 Bacteria 7707
546 Ga0451793_1859178 3300041452 Bacteria 3176
547 Ga0451802_0471939 3300041460 Bacteria 1284
548 Ga0451807_0042530 3300041486 Bacteria 1353
549 Ga0451853_3345382 3300041512 Bacteria 1757
550 Ga0439437_000473 3300042000 Bacteria 3961
551 Ga0439432_099717 3300042006 Bacteria 870
552 Ga0439459_0004955 3300042438 Bacteria 2166
553 Ga0466972_0000428 3300044658 Bacteria 21873
554 Ga0466972_0025123 3300044658 Bacteria 2955
555 Ga0466972_0176680 3300044658 Bacteria 1001
556 Ga0466982_0016592 3300044672 Bacteria 4069
557 Ga0466965_0021725 3300044683 Bacteria 3092
558 Ga0466965_0029584 3300044683 Bacteria 2666
559 Ga0466961_0039104 3300044693 Bacteria 3041
560 Ga0466971_0036019 3300044719 Bacteria 2219
561 Ga0466968_0053825 3300044735 Bacteria 1725
562 Ga0466970_0000215 3300044765 Bacteria 28327
563 Ga0466957_0015743 3300044842 Bacteria 4418
564 Ga0466957_0043009 3300044842 Bacteria 2734
565 Ga0466959_0004244 3300045049 Bacteria 9561
566 Ga0466959_0178873 3300045049 Bacteria 1484
567 Ga0495638_0000268 3300046460 Bacteria 70252
568 Ga0495580_0106478 3300046472 Bacteria 1948
569 Ga0495639_0031776 3300046475 Bacteria 2352
570 Ga0495585_0000243 3300046492 Bacteria 56533
571 Ga0495606_0026152 3300046507 Bacteria 4163
572 Ga0495631_0001374 3300046518 Bacteria 14834
573 Ga0495648_0000551 3300046524 Bacteria 40309
574 Ga0495665_0033925 3300046531 Bacteria 2729
575 Ga0495633_0000648 3300046558 Bacteria 32320
576 Ga0495661_0000731 3300046665 Bacteria 32210
577 Ga0495657_0095530 3300046675 Bacteria 1900
578 Ga0495646_0304090 3300046680 Bacteria 843
579 Ga0495647_0028894 3300046681 Bacteria 2047
580 Ga0495658_0002704 3300046683 Bacteria 8935
581 Ga0495600_0075557 3300046809 Bacteria 2200
582 Ga0495674_0195655 3300047319 Bacteria 1679
583 Ga0495672_0083241 3300047320 Bacteria 1778
584 Ga0495680_0255029 3300047322 Bacteria 1242
585 Ga0495684_0087873 3300047471 Bacteria 2356
586 Ga0495686_0101742 3300047472 Bacteria 1732
587 Ga0496101_0045149 3300048904 Bacteria 3155
588 Ga0496104_0000018 3300048907 Bacteria 258184
589 Ga0496105_0000080 3300048908 Bacteria 70744
590 Ga0496105_0024202 3300048908 Bacteria 4933
591 Ga0496115_0046563 3300048918 Bacteria 3467
592 Ga0496117_0000446 3300048920 Bacteria 68559
593 Ga0496117_0007110 3300048920 Bacteria 11062
594 Ga0496117_0009840 3300048920 Bacteria 8807
595 Ga0496117_0027061 3300048920 Bacteria 4475
596 Ga0496118_0000435 3300048921 Bacteria 69378
597 Ga0496118_0001105 3300048921 Bacteria 41869
598 Ga0496118_0004555 3300048921 Bacteria 16345
599 Ga0496118_0004683 3300048921 Bacteria 16037
600 Ga0496118_0027406 3300048921 Bacteria 4822
601 Ga0496118_0029257 3300048921 Bacteria 4623
602 Ga0496119_0000070 3300048922 Bacteria 154395
603 Ga0496119_0006544 3300048922 Bacteria 10745
604 Ga0496119_0018802 3300048922 Bacteria 5121
605 Ga0496119_0215629 3300048922 Bacteria 985
606 Ga0496120_0000102 3300048923 Bacteria 142902
607 Ga0496120_0002333 3300048923 Bacteria 19523
608 Ga0496120_0004153 3300048923 Bacteria 12446
609 Ga0496121_0001076 3300048924 Bacteria 48261
610 Ga0496121_0114834 3300048924 Bacteria 2046
611 Ga0496121_0125277 3300048924 Bacteria 1932
612 Ga0496122_0000158 3300048925 Bacteria 159352
613 Ga0496122_0011062 3300048925 Bacteria 9207
614 Ga0496122_0140225 3300048925 Bacteria 1514
615 Ga0496122_0222322 3300048925 Bacteria 1082
616 Ga0496123_0000120 3300048926 Bacteria 159406
617 Ga0496123_0010063 3300048926 Bacteria 8418
618 Ga0496124_0000203 3300048927 Bacteria 117239
619 Ga0496124_0000878 3300048927 Bacteria 48905
620 Ga0496125_0012798 3300048928 Bacteria 8294
621 Ga0496126_0004589 3300048929 Bacteria 16383
622 Ga0496126_0007768 3300048929 Bacteria 11689
623 Ga0496126_0021788 3300048929 Bacteria 6251
624 Ga0496126_0347605 3300048929 Bacteria 1214
625 Ga0496126_0460540 3300048929 Bacteria 1022
626 Ga0495682_0000883 3300049460 Bacteria 18594
627 Ga0501031_0005684 3300049568 Bacteria 8126
628 Ga0501031_0014285 3300049568 Bacteria 5164
629 Ga0501032_0008936 3300049569 Bacteria 7286
630 Ga0501032_0105838 3300049569 Bacteria 1863
631 Ga0501033_0006130 3300049570 Bacteria 9433
632 Ga0501033_0033042 3300049570 Bacteria 3884
633 Ga0501033_0166033 3300049570 Bacteria 1587
634 Ga0501034_0003070 3300049571 Bacteria 19267
635 Ga0501034_0071587 3300049571 Bacteria 3476
636 Ga0501036_0005927 3300049572 Bacteria 9901
637 Ga0501036_0019138 3300049572 Bacteria 5744
638 Ga0501037_0037870 3300049573 Bacteria 3555
639 Ga0501037_0175319 3300049573 Bacteria 1523
640 Ga0501037_0219457 3300049573 Bacteria 1338
641 Ga0501038_0008956 3300049574 Bacteria 9181
642 Ga0501038_0133263 3300049574 Bacteria 2037
643 Ga0501039_0004893 3300049575 Bacteria 10148
644 Ga0501039_0107282 3300049575 Bacteria 2181
645 Ga0501042_0118016 3300049578 Bacteria 1910
646 Ga0501043_0004035 3300049579 Bacteria 12005
647 Ga0501043_0090036 3300049579 Bacteria 2412
648 Ga0501043_0240682 3300049579 Bacteria 1395
649 Ga0501046_0020479 3300049580 Bacteria 5467
650 Ga0501046_0022726 3300049580 Bacteria 5164
651 Ga0501046_0213589 3300049580 Bacteria 1431
652 Ga0501047_0004426 3300049581 Bacteria 13226
653 Ga0501047_0014646 3300049581 Bacteria 7463
654 Ga0501047_0019997 3300049581 Bacteria 6427
655 Ga0501047_0198948 3300049581 Bacteria 1865
656 Ga0501047_0276685 3300049581 Bacteria 1524
657 Ga0501048_0042126 3300049582 Bacteria 3270
658 Ga0501048_0115858 3300049582 Bacteria 1893
659 Ga0501068_0016217 3300049584 Bacteria 4293
660 Ga0501068_0028538 3300049584 Bacteria 3300
661 Ga0501068_0136740 3300049584 Bacteria 1535
662 Ga0501069_0000120 3300049585 Bacteria 34758
663 Ga0501069_0014310 3300049585 Bacteria 4240
664 Ga0501069_0031114 3300049585 Bacteria 2934
665 Ga0501069_0054731 3300049585 Bacteria 2222
666 Ga0501069_0107940 3300049585 Bacteria 1583
667 Ga0501070_0005739 3300049586 Bacteria 10581
668 Ga0501070_0012712 3300049586 Bacteria 7100
669 Ga0501070_0030546 3300049586 Bacteria 4514
670 Ga0501070_0044461 3300049586 Bacteria 3695
671 Ga0501070_0078344 3300049586 Bacteria 2735
672 Ga0501070_0087500 3300049586 Bacteria 2578
673 Ga0501070_0105949 3300049586 Bacteria 2324
674 Ga0501070_0190053 3300049586 Bacteria 1688
675 Ga0501071_0005802 3300049587 Bacteria 7974
676 Ga0501072_0144965 3300049588 Bacteria 1893
677 Ga0501073_0004628 3300049589 Bacteria 10336
678 Ga0501073_0015266 3300049589 Bacteria 5571
679 Ga0501073_0048846 3300049589 Bacteria 2968
680 Ga0501074_0020446 3300049590 Bacteria 4811
681 Ga0501074_0020502 3300049590 Bacteria 4804
682 Ga0501074_0070868 3300049590 Bacteria 2506
683 Ga0501074_0086869 3300049590 Bacteria 2240
684 Ga0501076_0681750 3300049592 Bacteria 848
685 Ga0501077_0010912 3300049593 Bacteria 5662
686 Ga0501079_0006186 3300049741 Bacteria 8980
687 Ga0501079_0417240 3300049741 Bacteria 1053
688 Ga0501080_0003327 3300049742 Bacteria 14184
689 Ga0501080_0032118 3300049742 Bacteria 4895
690 Ga0501080_0046531 3300049742 Bacteria 4039
691 Ga0501081_0167331 3300049743 Bacteria 1586
692 Ga0501083_0063007 3300049744 Bacteria 2473
693 Ga0501035_0000839 3300049822 Bacteria 32838
694 Ga0501035_0003668 3300049822 Bacteria 14634
695 Ga0501035_0009875 3300049822 Bacteria 8859
696 Ga0501035_0052844 3300049822 Bacteria 3635
697 Ga0501035_0078624 3300049822 Bacteria 2913
698 Ga0501044_0003741 3300049823 Bacteria 17097
699 Ga0501044_0018253 3300049823 Bacteria 7521
700 Ga0501044_0026766 3300049823 Bacteria 6102
701 Ga0501044_0033082 3300049823 Bacteria 5433
702 Ga0501044_0073925 3300049823 Bacteria 3464
703 Ga0501044_0084393 3300049823 Bacteria 3210
704 Ga0501044_0089730 3300049823 Bacteria 3102
705 Ga0501044_0099647 3300049823 Bacteria 2924
706 Ga0501044_0122112 3300049823 Bacteria 2604
707 Ga0501044_0436214 3300049823 Bacteria 1218
708 Ga0501045_0008353 3300049824 Bacteria 7212
709 Ga0500610_0000123 3300053079 Bacteria 23259
710 Ga0500644_0153792 3300053088 Bacteria 924
711 Ga0500651_0000556 3300053093 Bacteria 18970
712 Ga0500651_0215153 3300053093 Bacteria 1129
713 Ga0500562_004594 3300053108 Bacteria 3487
714 Ga0500577_0100013 3300053142 Bacteria 1184
715 Ga0500588_0014325 3300053146 Bacteria 2007
716 Ga0500634_0029993 3300053161 Bacteria 2963
717 Ga0500645_000606 3300053730 Bacteria 22970
718 Ga0501084_0015227 3300054114 Bacteria 6377
719 Ga0501082_0206839 3300060353 Bacteria 1707
720 Ga0466962_0007471 3300061719 Bacteria 5244

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10352043 Ga0070658_103520432 199
2 3300013100 Ga0157373_10009136 Ga0157373_100091362 199
3 3300005262 Ga0065165_1000566 Ga0065165_100056645 207
4 3300044672 Ga0466982_0016592 Ga0466982_0016592_2979_3722 208
5 3300044842 Ga0466957_0043009 Ga0466957_0043009_520_1263 208
6 3300037466 Ga0395898_0047872 Ga0395898_0047872_3248_3997 210
7 3300037466 Ga0395898_0058393 Ga0395898_0058393_1895_2638 210
8 3300038443 Ga0395901_0048209 Ga0395901_0048209_3242_3985 210
9 3300038443 Ga0395901_0115202 Ga0395901_0115202_21_770 210
10 3300038443 Ga0395901_0180258 Ga0395901_0180258_1034_1777 210
11 3300048929 Ga0496126_0460540 Ga0496126_0460540_120_860 214
12 3300044658 Ga0466972_0176680 Ga0466972_0176680_13_672 217
13 3300053161 Ga0500634_0029993 Ga0500634_0029993_23_688 218
14 3300036401 Ga0373937_0648871 Ga0373937_0648871_317_982 219
15 3300013307 Ga0157372_10031724 Ga0157372_100317245 220
16 3300048927 Ga0496124_0000203 Ga0496124_0000203_39913_40677 223
17 3300049581 Ga0501047_0276685 Ga0501047_0276685_115_804 223
18 3300005577 Ga0068857_100013205 Ga0068857_1000132057 226
19 3300005614 Ga0068856_100136197 Ga0068856_1001361972 226
20 3300009093 Ga0105240_10002058 Ga0105240_100020585 226
21 3300010375 Ga0105239_10000023 Ga0105239_10000023192 226
22 3300025913 Ga0207695_10001104 Ga0207695_1000110427 226
23 3300026078 Ga0207702_10157551 Ga0207702_101575512 226
24 3300026116 Ga0207674_10013433 Ga0207674_100134336 226
25 3300037312 Ga0395899_0020935 Ga0395899_0020935_3517_4260 226
26 3300037418 Ga0395900_0022037 Ga0395900_0022037_2543_3286 226
27 3300037466 Ga0395898_0075288 Ga0395898_0075288_1280_2023 226
28 3300038443 Ga0395901_0079685 Ga0395901_0079685_829_1572 226
29 3300048904 Ga0496101_0045149 Ga0496101_0045149_961_1716 226
30 3300048908 Ga0496105_0024202 Ga0496105_0024202_2381_3136 226
31 3300048918 Ga0496115_0046563 Ga0496115_0046563_293_1048 226
32 3300048920 Ga0496117_0007110 Ga0496117_0007110_2827_3582 226
33 3300048920 Ga0496117_0009840 Ga0496117_0009840_2552_3307 226
34 3300048921 Ga0496118_0004555 Ga0496118_0004555_4280_5035 226
35 3300048921 Ga0496118_0004683 Ga0496118_0004683_11322_12077 226
36 3300048922 Ga0496119_0000070 Ga0496119_0000070_97157_97912 226
37 3300048922 Ga0496119_0018802 Ga0496119_0018802_3673_4431 226
38 3300048923 Ga0496120_0002333 Ga0496120_0002333_14424_15182 226
39 3300048923 Ga0496120_0004153 Ga0496120_0004153_4336_5091 226
40 3300048924 Ga0496121_0114834 Ga0496121_0114834_1237_1977 226
41 3300048924 Ga0496121_0125277 Ga0496121_0125277_596_1351 226
42 3300048929 Ga0496126_0004589 Ga0496126_0004589_11544_12299 226
43 3300009148 Ga0105243_10030891 Ga0105243_100308913 227
44 3300015265 Ga0182005_1010993 Ga0182005_10109933 227
45 3300025935 Ga0207709_10068019 Ga0207709_100680192 227
46 3300048921 Ga0496118_0029257 Ga0496118_0029257_865_1638 227
47 3300048929 Ga0496126_0007768 Ga0496126_0007768_6561_7334 227
48 3300049581 Ga0501047_0198948 Ga0501047_0198948_775_1458 227
49 3300049823 Ga0501044_0089730 Ga0501044_0089730_336_1019 227
50 3300047472 Ga0495686_0101742 Ga0495686_0101742_206_895 228
51 iso_pu_bacteria 2671180531 2673161525 228
52 3300005614 Ga0068856_100000616 Ga0068856_1000006162 229
53 3300013105 Ga0157369_10037435 Ga0157369_100374355 229
54 3300026078 Ga0207702_10000143 Ga0207702_1000014323 229
55 3300026078 Ga0207702_10000321 Ga0207702_1000032155 229
56 3300049584 Ga0501068_0136740 Ga0501068_0136740_225_959 229
57 3300049823 Ga0501044_0073925 Ga0501044_0073925_1104_1838 229
58 3300054114 Ga0501084_0015227 Ga0501084_0015227_1706_2431 229
59 3300028563 Ga0265319_1005385 Ga0265319_10053852 230
60 3300005331 Ga0070670_100099592 Ga0070670_1000995922 231
61 3300005347 Ga0070668_100040519 Ga0070668_1000405192 231
62 3300005367 Ga0070667_100076928 Ga0070667_1000769282 231
63 3300005539 Ga0068853_100000489 Ga0068853_1000004895 231
64 3300005548 Ga0070665_100000092 Ga0070665_1000000922 231
65 3300005563 Ga0068855_100053950 Ga0068855_1000539503 231
66 3300005577 Ga0068857_100013171 Ga0068857_1000131712 231
67 3300005617 Ga0068859_100017309 Ga0068859_1000173097 231
68 3300005844 Ga0068862_100000165 Ga0068862_10000016559 231
69 3300005844 Ga0068862_100051763 Ga0068862_1000517632 231
70 3300006931 Ga0097620_100017309 Ga0097620_1000173097 231
71 3300009545 Ga0105237_10193136 Ga0105237_101931362 231
72 3300010375 Ga0105239_10004269 Ga0105239_100042698 231
73 3300025303 Ga0209051_1025716 Ga0209051_10257164 231
74 3300025933 Ga0207706_10124565 Ga0207706_101245653 231
75 3300025949 Ga0207667_10251073 Ga0207667_102510732 231
76 3300025972 Ga0207668_10238302 Ga0207668_102383022 231
77 3300025986 Ga0207658_10004134 Ga0207658_100041346 231
78 3300025986 Ga0207658_10846757 Ga0207658_108467572 231
79 3300026041 Ga0207639_10003606 Ga0207639_100036067 231
80 3300026116 Ga0207674_10017769 Ga0207674_100177694 231
81 3300028379 Ga0268266_10000001 Ga0268266_100000013480 231
82 3300028380 Ga0268265_10000203 Ga0268265_1000020356 231
83 3300028380 Ga0268265_10160000 Ga0268265_101600002 231
84 3300046492 Ga0495585_0000243 Ga0495585_0000243_27198_27899 231
85 3300046518 Ga0495631_0001374 Ga0495631_0001374_1722_2423 231
86 3300046524 Ga0495648_0000551 Ga0495648_0000551_27170_27871 231
87 3300046558 Ga0495633_0000648 Ga0495633_0000648_6879_7607 231
88 3300046665 Ga0495661_0000731 Ga0495661_0000731_27084_27785 231
89 3300048920 Ga0496117_0027061 Ga0496117_0027061_1189_1893 231
90 3300048921 Ga0496118_0000435 Ga0496118_0000435_63276_63980 231
91 3300048925 Ga0496122_0011062 Ga0496122_0011062_924_1676 231
92 3300048925 Ga0496122_0222322 Ga0496122_0222322_266_970 231
93 3300048926 Ga0496123_0010063 Ga0496123_0010063_3218_3970 231
94 3300049460 Ga0495682_0000883 Ga0495682_0000883_14645_15346 231
95 3300049568 Ga0501031_0005684 Ga0501031_0005684_1280_1984 231
96 3300049568 Ga0501031_0014285 Ga0501031_0014285_2702_3403 231
97 3300049569 Ga0501032_0008936 Ga0501032_0008936_3494_4198 231
98 3300049569 Ga0501032_0105838 Ga0501032_0105838_715_1416 231
99 3300049570 Ga0501033_0006130 Ga0501033_0006130_6861_7565 231
100 3300049570 Ga0501033_0033042 Ga0501033_0033042_715_1416 231
101 3300049571 Ga0501034_0003070 Ga0501034_0003070_7419_8123 231
102 3300049571 Ga0501034_0071587 Ga0501034_0071587_1951_2652 231
103 3300049572 Ga0501036_0005927 Ga0501036_0005927_7270_7974 231
104 3300049572 Ga0501036_0019138 Ga0501036_0019138_3499_4200 231
105 3300049573 Ga0501037_0037870 Ga0501037_0037870_56_760 231
106 3300049574 Ga0501038_0008956 Ga0501038_0008956_1063_1767 231
107 3300049574 Ga0501038_0133263 Ga0501038_0133263_1004_1705 231
108 3300049575 Ga0501039_0004893 Ga0501039_0004893_4491_5195 231
109 3300049575 Ga0501039_0107282 Ga0501039_0107282_1009_1710 231
110 3300049578 Ga0501042_0118016 Ga0501042_0118016_1005_1706 231
111 3300049579 Ga0501043_0004035 Ga0501043_0004035_31_735 231
112 3300049579 Ga0501043_0240682 Ga0501043_0240682_333_1034 231
113 3300049580 Ga0501046_0020479 Ga0501046_0020479_1462_2163 231
114 3300049580 Ga0501046_0022726 Ga0501046_0022726_1062_1766 231
115 3300049581 Ga0501047_0004426 Ga0501047_0004426_5340_6044 231
116 3300049581 Ga0501047_0019997 Ga0501047_0019997_4601_5302 231
117 3300049582 Ga0501048_0042126 Ga0501048_0042126_1757_2461 231
118 3300049584 Ga0501068_0016217 Ga0501068_0016217_263_967 231
119 3300049584 Ga0501068_0028538 Ga0501068_0028538_2267_2968 231
120 3300049585 Ga0501069_0107940 Ga0501069_0107940_472_1173 231
121 3300049586 Ga0501070_0087500 Ga0501070_0087500_116_817 231
122 3300049586 Ga0501070_0105949 Ga0501070_0105949_423_1124 231
123 3300049587 Ga0501071_0005802 Ga0501071_0005802_5350_6051 231
124 3300049588 Ga0501072_0144965 Ga0501072_0144965_212_913 231
125 3300049589 Ga0501073_0004628 Ga0501073_0004628_2833_3537 231
126 3300049589 Ga0501073_0048846 Ga0501073_0048846_2203_2904 231
127 3300049590 Ga0501074_0086869 Ga0501074_0086869_393_1094 231
128 3300049592 Ga0501076_0681750 Ga0501076_0681750_33_734 231
129 3300049741 Ga0501079_0006186 Ga0501079_0006186_2357_3058 231
130 3300049742 Ga0501080_0003327 Ga0501080_0003327_2209_2913 231
131 3300049743 Ga0501081_0167331 Ga0501081_0167331_14_715 231
132 3300049744 Ga0501083_0063007 Ga0501083_0063007_687_1388 231
133 3300049822 Ga0501035_0003668 Ga0501035_0003668_7856_8560 231
134 3300049822 Ga0501035_0052844 Ga0501035_0052844_347_1048 231
135 3300049822 Ga0501035_0078624 Ga0501035_0078624_65_766 231
136 3300049823 Ga0501044_0018253 Ga0501044_0018253_2363_3067 231
137 3300049823 Ga0501044_0033082 Ga0501044_0033082_310_1011 231
138 3300049823 Ga0501044_0122112 Ga0501044_0122112_142_843 231
139 3300049824 Ga0501045_0008353 Ga0501045_0008353_2407_3108 231
140 3300053730 Ga0500645_000606 Ga0500645_000606_16506_17207 231
141 3300060353 Ga0501082_0206839 Ga0501082_0206839_305_1006 231
142 3300005345 Ga0070692_10175332 Ga0070692_101753322 232
143 3300005435 Ga0070714_100000030 Ga0070714_10000003049 232
144 3300005458 Ga0070681_10396294 Ga0070681_103962942 232
145 3300005547 Ga0070693_100087149 Ga0070693_1000871492 232
146 3300005564 Ga0070664_100459181 Ga0070664_1004591812 232
147 3300006051 Ga0075364_10008565 Ga0075364_100085653 232
148 3300009092 Ga0105250_10000043 Ga0105250_1000004384 232
149 3300009093 Ga0105240_10403121 Ga0105240_104031212 232
150 3300009148 Ga0105243_10001046 Ga0105243_100010469 232
151 3300009545 Ga0105237_10195930 Ga0105237_101959302 232
152 3300013105 Ga0157369_10729521 Ga0157369_107295211 232
153 3300025711 Ga0207696_1000509 Ga0207696_100050928 232
154 3300025904 Ga0207647_10017679 Ga0207647_100176796 232
155 3300025909 Ga0207705_10156987 Ga0207705_101569872 232
156 3300025912 Ga0207707_10030775 Ga0207707_100307752 232
157 3300025913 Ga0207695_10424073 Ga0207695_104240732 232
158 3300025919 Ga0207657_10105060 Ga0207657_101050603 232
159 3300025924 Ga0207694_10756646 Ga0207694_107566462 232
160 3300025929 Ga0207664_10000026 Ga0207664_10000026105 232
161 3300025933 Ga0207706_10016229 Ga0207706_100162292 232
162 3300025935 Ga0207709_10000070 Ga0207709_1000007042 232
163 3300026041 Ga0207639_10324537 Ga0207639_103245372 232
164 3300026067 Ga0207678_10202868 Ga0207678_102028682 232
165 3300027111 Ga0209281_1000029 Ga0209281_1000029191 232
166 3300042006 Ga0439432_099717 Ga0439432_099717_81_818 232
167 3300044683 Ga0466965_0029584 Ga0466965_0029584_1009_1758 232
168 3300044693 Ga0466961_0039104 Ga0466961_0039104_121_870 232
169 3300044719 Ga0466971_0036019 Ga0466971_0036019_1010_1759 232
170 3300044842 Ga0466957_0015743 Ga0466957_0015743_2280_3029 232
171 3300045049 Ga0466959_0178873 Ga0466959_0178873_56_805 232
172 3300048929 Ga0496126_0347605 Ga0496126_0347605_163_861 232
173 3300049573 Ga0501037_0219457 Ga0501037_0219457_206_904 232
174 3300049590 Ga0501074_0070868 Ga0501074_0070868_975_1673 232
175 3300049823 Ga0501044_0099647 Ga0501044_0099647_1739_2437 232
176 3300061719 Ga0466962_0007471 Ga0466962_0007471_2932_3681 232
177 iso_pu_bacteria 2721755523 2722880943 232
178 iso_pu_bacteria 2939611941 2939612609 232
179 3300001979 JGI24740J21852_10002171 JGI24740J21852_100021715 234
180 3300005329 Ga0070683_100010639 Ga0070683_1000106393 234
181 3300005336 Ga0070680_100054006 Ga0070680_1000540063 234
182 3300005339 Ga0070660_100073009 Ga0070660_1000730093 234
183 3300005341 Ga0070691_10179881 Ga0070691_101798812 234
184 3300005345 Ga0070692_10001558 Ga0070692_100015585 234
185 3300005535 Ga0070684_100010722 Ga0070684_1000107222 234
186 3300005577 Ga0068857_100084313 Ga0068857_1000843132 234
187 3300005616 Ga0068852_100111931 Ga0068852_1001119312 234
188 3300013100 Ga0157373_10027507 Ga0157373_100275072 234
189 3300013307 Ga0157372_10262641 Ga0157372_102626412 234
190 3300020070 Ga0206356_10169834 Ga0206356_101698342 234
191 3300020081 Ga0206354_10259504 Ga0206354_102595042 234
192 3300020082 Ga0206353_10112387 Ga0206353_101123874 234
193 3300020610 Ga0154015_1493589 Ga0154015_14935892 234
194 3300025904 Ga0207647_10003544 Ga0207647_100035445 234
195 3300025909 Ga0207705_10001297 Ga0207705_1000129721 234
196 3300025912 Ga0207707_10011701 Ga0207707_100117014 234
197 3300025913 Ga0207695_10027834 Ga0207695_100278343 234
198 3300025917 Ga0207660_10013253 Ga0207660_100132534 234
199 3300025919 Ga0207657_10044192 Ga0207657_100441922 234
200 3300025920 Ga0207649_10009079 Ga0207649_100090794 234
201 3300025921 Ga0207652_10079522 Ga0207652_100795223 234
202 3300025944 Ga0207661_10054426 Ga0207661_100544261 234
203 3300025949 Ga0207667_10044075 Ga0207667_100440754 234
204 3300025981 Ga0207640_10006810 Ga0207640_100068103 234
205 3300026067 Ga0207678_10017867 Ga0207678_100178674 234
206 3300026078 Ga0207702_10104728 Ga0207702_101047282 234
207 3300026116 Ga0207674_10063334 Ga0207674_100633343 234
208 3300026142 Ga0207698_10002432 Ga0207698_100024322 234
209 3300044658 Ga0466972_0000428 Ga0466972_0000428_15604_16317 234
210 3300044683 Ga0466965_0021725 Ga0466965_0021725_1594_2319 234
211 3300044765 Ga0466970_0000215 Ga0466970_0000215_22086_22799 234
212 3300046507 Ga0495606_0026152 Ga0495606_0026152_2150_2887 234
213 3300047320 Ga0495672_0083241 Ga0495672_0083241_263_1000 234
214 3300048922 Ga0496119_0215629 Ga0496119_0215629_199_912 234
215 3300048928 Ga0496125_0012798 Ga0496125_0012798_5635_6360 234
216 3300049581 Ga0501047_0014646 Ga0501047_0014646_6033_6752 234
217 3300049585 Ga0501069_0014310 Ga0501069_0014310_3489_4208 234
218 3300049586 Ga0501070_0012712 Ga0501070_0012712_285_1004 234
219 3300049586 Ga0501070_0030546 Ga0501070_0030546_1791_2510 234
220 3300049589 Ga0501073_0015266 Ga0501073_0015266_3881_4600 234
221 3300049590 Ga0501074_0020446 Ga0501074_0020446_414_1133 234
222 3300049741 Ga0501079_0417240 Ga0501079_0417240_226_945 234
223 3300049742 Ga0501080_0046531 Ga0501080_0046531_1791_2510 234
224 3300049823 Ga0501044_0003741 Ga0501044_0003741_2196_2915 234
225 3300049823 Ga0501044_0436214 Ga0501044_0436214_498_1208 234
226 iso_pu_bacteria 2974320154 2974322063 234
227 3300001915 JGI24741J21665_1001625 JGI24741J21665_10016253 235
228 3300001915 JGI24741J21665_1002187 JGI24741J21665_10021872 235
229 3300001915 JGI24741J21665_1009546 JGI24741J21665_10095462 235
230 3300001915 JGI24741J21665_1014773 JGI24741J21665_10147732 235
231 3300001979 JGI24740J21852_10013580 JGI24740J21852_100135803 235
232 3300003320 rootH2_10177447 rootH2_101774472 235
233 3300003751 Ga0055538_1000251 Ga0055538_100025120 235
234 3300003752 Ga0055539_1000286 Ga0055539_100028620 235
235 3300003756 Ga0055533_1000274 Ga0055533_100027420 235
236 3300003758 Ga0055532_1000316 Ga0055532_10003169 235
237 3300003759 Ga0055525_1000384 Ga0055525_100038420 235
238 3300003841 Ga0055541_1000185 Ga0055541_100018520 235
239 3300005327 Ga0070658_10333580 Ga0070658_103335802 235
240 3300005329 Ga0070683_100027521 Ga0070683_1000275214 235
241 3300005336 Ga0070680_100000239 Ga0070680_10000023930 235
242 3300005336 Ga0070680_100022260 Ga0070680_1000222604 235
243 3300005336 Ga0070680_100089125 Ga0070680_1000891252 235
244 3300005339 Ga0070660_100051419 Ga0070660_1000514193 235
245 3300005339 Ga0070660_100097751 Ga0070660_1000977512 235
246 3300005341 Ga0070691_10000595 Ga0070691_100005957 235
247 3300005341 Ga0070691_10014457 Ga0070691_100144573 235
248 3300005341 Ga0070691_10059932 Ga0070691_100599322 235
249 3300005344 Ga0070661_100011682 Ga0070661_1000116822 235
250 3300005344 Ga0070661_100491766 Ga0070661_1004917661 235
251 3300005345 Ga0070692_10003790 Ga0070692_100037902 235
252 3300005345 Ga0070692_10007323 Ga0070692_100073232 235
253 3300005366 Ga0070659_100017881 Ga0070659_1000178812 235
254 3300005445 Ga0070708_100132677 Ga0070708_1001326772 235
255 3300005455 Ga0070663_100013292 Ga0070663_1000132922 235
256 3300005458 Ga0070681_10000066 Ga0070681_100000665 235
257 3300005458 Ga0070681_10001719 Ga0070681_1000171911 235
258 3300005458 Ga0070681_10005052 Ga0070681_100050524 235
259 3300005530 Ga0070679_100000195 Ga0070679_10000019530 235
260 3300005530 Ga0070679_100001729 Ga0070679_1000017299 235
261 3300005530 Ga0070679_100036870 Ga0070679_1000368702 235
262 3300005530 Ga0070679_100094144 Ga0070679_1000941442 235
263 3300005535 Ga0070684_100043440 Ga0070684_1000434402 235
264 3300005539 Ga0068853_100005468 Ga0068853_1000054685 235
265 3300005539 Ga0068853_100023369 Ga0068853_1000233693 235
266 3300005539 Ga0068853_100120411 Ga0068853_1001204112 235
267 3300005547 Ga0070693_100027258 Ga0070693_1000272584 235
268 3300005563 Ga0068855_100028055 Ga0068855_1000280552 235
269 3300005563 Ga0068855_100113173 Ga0068855_1001131732 235
270 3300005563 Ga0068855_100286220 Ga0068855_1002862202 235
271 3300005563 Ga0068855_100528314 Ga0068855_1005283142 235
272 3300005564 Ga0070664_100093962 Ga0070664_1000939622 235
273 3300005564 Ga0070664_100360793 Ga0070664_1003607932 235
274 3300005577 Ga0068857_100052780 Ga0068857_1000527802 235
275 3300005577 Ga0068857_100257199 Ga0068857_1002571992 235
276 3300005614 Ga0068856_100137069 Ga0068856_1001370692 235
277 3300005614 Ga0068856_100381721 Ga0068856_1003817212 235
278 3300005616 Ga0068852_100040233 Ga0068852_1000402333 235
279 3300005616 Ga0068852_100154976 Ga0068852_1001549763 235
280 3300005834 Ga0068851_10023061 Ga0068851_100230613 235
281 3300005841 Ga0068863_100161157 Ga0068863_1001611572 235
282 3300009174 Ga0105241_10043966 Ga0105241_100439662 235
283 3300009545 Ga0105237_10440428 Ga0105237_104404282 235
284 3300009553 Ga0105249_10112226 Ga0105249_101122262 235
285 3300010375 Ga0105239_10010578 Ga0105239_100105783 235
286 3300013100 Ga0157373_10073928 Ga0157373_100739283 235
287 3300013100 Ga0157373_10158615 Ga0157373_101586152 235
288 3300013102 Ga0157371_10021396 Ga0157371_100213964 235
289 3300013102 Ga0157371_10077699 Ga0157371_100776992 235
290 3300013102 Ga0157371_10270309 Ga0157371_102703091 235
291 3300013104 Ga0157370_10001955 Ga0157370_1000195522 235
292 3300013104 Ga0157370_10057105 Ga0157370_100571052 235
293 3300013104 Ga0157370_10072144 Ga0157370_100721443 235
294 3300013105 Ga0157369_10062258 Ga0157369_100622582 235
295 3300013307 Ga0157372_10034240 Ga0157372_100342404 235
296 3300013307 Ga0157372_10084140 Ga0157372_100841403 235
297 3300013307 Ga0157372_10119838 Ga0157372_101198383 235
298 3300014497 Ga0182008_10002759 Ga0182008_100027597 235
299 3300020070 Ga0206356_10896713 Ga0206356_108967132 235
300 3300020070 Ga0206356_11346780 Ga0206356_113467802 235
301 3300020081 Ga0206354_10264878 Ga0206354_102648782 235
302 3300020082 Ga0206353_10003797 Ga0206353_100037973 235
303 3300020082 Ga0206353_10103272 Ga0206353_101032722 235
304 3300020610 Ga0154015_1604739 Ga0154015_16047392 235
305 3300025206 Ga0209435_100154 Ga0209435_1001542 235
306 3300025224 Ga0209784_100152 Ga0209784_10015243 235
307 3300025225 Ga0209566_100192 Ga0209566_10019243 235
308 3300025226 Ga0209674_100196 Ga0209674_10019643 235
309 3300025229 Ga0209147_100330 Ga0209147_1003309 235
310 3300025230 Ga0209563_100156 Ga0209563_10015643 235
311 3300025233 Ga0209437_101151 Ga0209437_10115110 235
312 3300025242 Ga0209258_100615 Ga0209258_1006159 235
313 3300025246 Ga0209646_1000332 Ga0209646_10003329 235
314 3300025253 Ga0209677_100152 Ga0209677_10015243 235
315 3300025256 Ga0209759_1002588 Ga0209759_10025886 235
316 3300025903 Ga0207680_10037622 Ga0207680_100376222 235
317 3300025909 Ga0207705_10002953 Ga0207705_100029539 235
318 3300025909 Ga0207705_10005116 Ga0207705_100051164 235
319 3300025909 Ga0207705_10007645 Ga0207705_100076454 235
320 3300025912 Ga0207707_10000065 Ga0207707_1000006560 235
321 3300025912 Ga0207707_10000068 Ga0207707_1000006891 235
322 3300025912 Ga0207707_10001385 Ga0207707_1000138510 235
323 3300025912 Ga0207707_10003405 Ga0207707_100034056 235
324 3300025912 Ga0207707_10106782 Ga0207707_101067822 235
325 3300025913 Ga0207695_10004841 Ga0207695_100048418 235
326 3300025914 Ga0207671_10426611 Ga0207671_104266112 235
327 3300025917 Ga0207660_10000181 Ga0207660_1000018126 235
328 3300025917 Ga0207660_10000502 Ga0207660_100005022 235
329 3300025917 Ga0207660_10001334 Ga0207660_1000133420 235
330 3300025917 Ga0207660_10010540 Ga0207660_100105406 235
331 3300025917 Ga0207660_10013765 Ga0207660_100137653 235
332 3300025919 Ga0207657_10018263 Ga0207657_100182634 235
333 3300025919 Ga0207657_10021798 Ga0207657_100217982 235
334 3300025919 Ga0207657_10086825 Ga0207657_100868252 235
335 3300025919 Ga0207657_10096034 Ga0207657_100960342 235
336 3300025920 Ga0207649_10018624 Ga0207649_100186242 235
337 3300025920 Ga0207649_10048311 Ga0207649_100483112 235
338 3300025921 Ga0207652_10000081 Ga0207652_1000008191 235
339 3300025921 Ga0207652_10000213 Ga0207652_1000021311 235
340 3300025921 Ga0207652_10002964 Ga0207652_100029646 235
341 3300025921 Ga0207652_10079425 Ga0207652_100794252 235
342 3300025921 Ga0207652_10110866 Ga0207652_101108662 235
343 3300025932 Ga0207690_10091683 Ga0207690_100916832 235
344 3300025932 Ga0207690_10166837 Ga0207690_101668372 235
345 3300025933 Ga0207706_10035126 Ga0207706_100351262 235
346 3300025944 Ga0207661_10061390 Ga0207661_100613902 235
347 3300025949 Ga0207667_10005041 Ga0207667_100050418 235
348 3300025949 Ga0207667_10018972 Ga0207667_100189724 235
349 3300025949 Ga0207667_10037324 Ga0207667_100373242 235
350 3300025949 Ga0207667_10565938 Ga0207667_105659381 235
351 3300025981 Ga0207640_10001690 Ga0207640_100016903 235
352 3300025981 Ga0207640_10058000 Ga0207640_100580002 235
353 3300025981 Ga0207640_10171350 Ga0207640_101713502 235
354 3300025981 Ga0207640_10321542 Ga0207640_103215422 235
355 3300026041 Ga0207639_10013363 Ga0207639_100133632 235
356 3300026041 Ga0207639_10014688 Ga0207639_100146885 235
357 3300026041 Ga0207639_10060096 Ga0207639_100600962 235
358 3300026041 Ga0207639_10084919 Ga0207639_100849192 235
359 3300026041 Ga0207639_10093507 Ga0207639_100935072 235
360 3300026041 Ga0207639_10558508 Ga0207639_105585082 235
361 3300026067 Ga0207678_10008510 Ga0207678_100085103 235
362 3300026067 Ga0207678_10017779 Ga0207678_100177794 235
363 3300026067 Ga0207678_10052558 Ga0207678_100525582 235
364 3300026067 Ga0207678_10072036 Ga0207678_100720363 235
365 3300026067 Ga0207678_10170506 Ga0207678_101705062 235
366 3300026078 Ga0207702_10037018 Ga0207702_100370184 235
367 3300026088 Ga0207641_10044183 Ga0207641_100441834 235
368 3300026116 Ga0207674_10019073 Ga0207674_100190734 235
369 3300026116 Ga0207674_10255320 Ga0207674_102553202 235
370 3300026142 Ga0207698_10059655 Ga0207698_100596553 235
371 3300026142 Ga0207698_10103604 Ga0207698_101036042 235
372 3300028381 Ga0268264_10295045 Ga0268264_102950452 235
373 3300031344 Ga0265316_10111362 Ga0265316_101113622 235
374 3300031665 Ga0316575_10012645 Ga0316575_100126452 235
375 3300037312 Ga0395899_0035784 Ga0395899_0035784_2307_3029 235
376 3300037312 Ga0395899_0046833 Ga0395899_0046833_2035_2757 235
377 3300037466 Ga0395898_0069262 Ga0395898_0069262_1201_1923 235
378 3300037466 Ga0395898_0170099 Ga0395898_0170099_874_1596 235
379 3300041452 Ga0451793_1859178 Ga0451793_1859178_1567_2283 235
380 3300041460 Ga0451802_0471939 Ga0451802_0471939_241_957 235
381 3300041486 Ga0451807_0042530 Ga0451807_0042530_598_1314 235
382 3300044658 Ga0466972_0025123 Ga0466972_0025123_175_897 235
383 3300044735 Ga0466968_0053825 Ga0466968_0053825_348_1070 235
384 3300045049 Ga0466959_0004244 Ga0466959_0004244_2799_3515 235
385 3300048921 Ga0496118_0001105 Ga0496118_0001105_2797_3513 235
386 3300048925 Ga0496122_0140225 Ga0496122_0140225_700_1452 235
387 3300048929 Ga0496126_0021788 Ga0496126_0021788_1372_2124 235
388 3300049573 Ga0501037_0175319 Ga0501037_0175319_552_1274 235
389 3300049579 Ga0501043_0090036 Ga0501043_0090036_1454_2176 235
390 3300049585 Ga0501069_0031114 Ga0501069_0031114_507_1229 235
391 3300049586 Ga0501070_0044461 Ga0501070_0044461_304_1026 235
392 3300049586 Ga0501070_0078344 Ga0501070_0078344_66_815 235
393 3300049586 Ga0501070_0190053 Ga0501070_0190053_823_1542 235
394 3300049590 Ga0501074_0020502 Ga0501074_0020502_1851_2573 235
395 3300049593 Ga0501077_0010912 Ga0501077_0010912_1880_2602 235
396 3300049742 Ga0501080_0032118 Ga0501080_0032118_2925_3653 235
397 3300049822 Ga0501035_0000839 Ga0501035_0000839_18268_18987 235
398 3300049823 Ga0501044_0026766 Ga0501044_0026766_1888_2610 235
399 3300053079 Ga0500610_0000123 Ga0500610_0000123_15640_16356 235
400 3300053093 Ga0500651_0000556 Ga0500651_0000556_16696_17412 235
401 3300053093 Ga0500651_0215153 Ga0500651_0215153_255_971 235
402 3300053146 Ga0500588_0014325 Ga0500588_0014325_783_1499 235
403 iso_pu_bacteria 2619619299 2621301627 235
404 iso_pu_bacteria 2738541265 2738672736 235
405 iso_pu_bacteria 2738541282 2738751129 235
406 iso_pu_bacteria 2738541303 2738860170 235
407 iso_pu_bacteria 2816332298 2817489011 235
408 3300002705 JGI25156J39149_1002818 JGI25156J39149_10028184 236
409 3300002741 JGI25157J39369_1001681 JGI25157J39369_10016816 236
410 3300005328 Ga0070676_10128970 Ga0070676_101289702 236
411 3300005335 Ga0070666_10068370 Ga0070666_100683702 236
412 3300005459 Ga0068867_100164135 Ga0068867_1001641352 236
413 3300005530 Ga0070679_100125623 Ga0070679_1001256233 236
414 3300005539 Ga0068853_100012163 Ga0068853_1000121636 236
415 3300005539 Ga0068853_100504145 Ga0068853_1005041452 236
416 3300005547 Ga0070693_100040304 Ga0070693_1000403042 236
417 3300005548 Ga0070665_100192708 Ga0070665_1001927082 236
418 3300005578 Ga0068854_100098676 Ga0068854_1000986763 236
419 3300005614 Ga0068856_100631338 Ga0068856_1006313382 236
420 3300005616 Ga0068852_100351942 Ga0068852_1003519422 236
421 3300005843 Ga0068860_100003032 Ga0068860_1000030326 236
422 3300006881 Ga0068865_100257754 Ga0068865_1002577542 236
423 3300009093 Ga0105240_10074811 Ga0105240_100748112 236
424 3300009093 Ga0105240_10104490 Ga0105240_101044902 236
425 3300009093 Ga0105240_10960550 Ga0105240_109605502 236
426 3300009174 Ga0105241_10007584 Ga0105241_100075843 236
427 3300009176 Ga0105242_10002824 Ga0105242_100028242 236
428 3300009545 Ga0105237_10000150 Ga0105237_1000015080 236
429 3300009545 Ga0105237_10014526 Ga0105237_100145263 236
430 3300009551 Ga0105238_10002470 Ga0105238_100024707 236
431 3300009553 Ga0105249_10268711 Ga0105249_102687112 236
432 3300010375 Ga0105239_10039813 Ga0105239_100398132 236
433 3300013104 Ga0157370_10362185 Ga0157370_103621852 236
434 3300013105 Ga0157369_10000011 Ga0157369_10000011105 236
435 3300013306 Ga0163162_10043255 Ga0163162_100432554 236
436 3300013307 Ga0157372_10021015 Ga0157372_100210154 236
437 3300013307 Ga0157372_10513176 Ga0157372_105131762 236
438 3300013308 Ga0157375_10000948 Ga0157375_1000094814 236
439 3300014969 Ga0157376_10006607 Ga0157376_100066077 236
440 3300025250 Ga0209026_1000122 Ga0209026_100012285 236
441 3300025256 Ga0209759_1006503 Ga0209759_10065033 236
442 3300025272 Ga0209455_1000323 Ga0209455_100032352 236
443 3300025904 Ga0207647_10074550 Ga0207647_100745502 236
444 3300025907 Ga0207645_10150881 Ga0207645_101508812 236
445 3300025911 Ga0207654_10074837 Ga0207654_100748372 236
446 3300025913 Ga0207695_10002140 Ga0207695_100021406 236
447 3300025913 Ga0207695_10006519 Ga0207695_100065194 236
448 3300025914 Ga0207671_10000570 Ga0207671_1000057052 236
449 3300025914 Ga0207671_10000716 Ga0207671_1000071634 236
450 3300025919 Ga0207657_10140928 Ga0207657_101409282 236
451 3300025921 Ga0207652_10076647 Ga0207652_100766473 236
452 3300025924 Ga0207694_10019421 Ga0207694_100194214 236
453 3300025934 Ga0207686_10004297 Ga0207686_100042974 236
454 3300025938 Ga0207704_10316245 Ga0207704_103162452 236
455 3300025961 Ga0207712_10156560 Ga0207712_101565602 236
456 3300025981 Ga0207640_10040325 Ga0207640_100403252 236
457 3300026023 Ga0207677_10286619 Ga0207677_102866192 236
458 3300026041 Ga0207639_10107689 Ga0207639_101076892 236
459 3300026041 Ga0207639_10196705 Ga0207639_101967052 236
460 3300026067 Ga0207678_10012413 Ga0207678_100124133 236
461 3300026078 Ga0207702_10859371 Ga0207702_108593711 236
462 3300026089 Ga0207648_10026007 Ga0207648_100260075 236
463 3300026121 Ga0207683_10198745 Ga0207683_101987451 236
464 3300026142 Ga0207698_10208337 Ga0207698_102083372 236
465 3300028379 Ga0268266_10402883 Ga0268266_104028832 236
466 3300028381 Ga0268264_10005067 Ga0268264_100050676 236
467 3300032133 Ga0316583_10029633 Ga0316583_100296331 236
468 3300035089 Ga0373944_0101318 Ga0373944_0101318_172_900 236
469 3300035117 Ga0373953_0043343 Ga0373953_0043343_409_1137 236
470 3300035120 Ga0373957_0050392 Ga0373957_0050392_112_840 236
471 3300035724 Ga0373933_0067021 Ga0373933_0067021_999_1727 236
472 3300036401 Ga0373937_0178226 Ga0373937_0178226_1099_1827 236
473 3300046472 Ga0495580_0106478 Ga0495580_0106478_127_855 236
474 3300046475 Ga0495639_0031776 Ga0495639_0031776_1524_2252 236
475 3300046531 Ga0495665_0033925 Ga0495665_0033925_325_1053 236
476 3300046675 Ga0495657_0095530 Ga0495657_0095530_1157_1888 236
477 3300046680 Ga0495646_0304090 Ga0495646_0304090_34_762 236
478 3300046681 Ga0495647_0028894 Ga0495647_0028894_1235_1963 236
479 3300046683 Ga0495658_0002704 Ga0495658_0002704_618_1346 236
480 3300046809 Ga0495600_0075557 Ga0495600_0075557_1223_1951 236
481 3300047319 Ga0495674_0195655 Ga0495674_0195655_216_944 236
482 3300047322 Ga0495680_0255029 Ga0495680_0255029_383_1111 236
483 3300047471 Ga0495684_0087873 Ga0495684_0087873_1377_2105 236
484 3300048907 Ga0496104_0000018 Ga0496104_0000018_131591_132319 236
485 3300048908 Ga0496105_0000080 Ga0496105_0000080_56835_57563 236
486 3300049570 Ga0501033_0166033 Ga0501033_0166033_801_1553 236
487 3300049585 Ga0501069_0054731 Ga0501069_0054731_164_895 236
488 3300049586 Ga0501070_0005739 Ga0501070_0005739_1825_2556 236
489 3300049822 Ga0501035_0009875 Ga0501035_0009875_6824_7582 236
490 3300049823 Ga0501044_0084393 Ga0501044_0084393_1138_1896 236
491 iso_pu_bacteria 2894023352 2894028069 236
492 iso_pu_bacteria 2932422444 2932424929 236
493 3300002737 JGI25162J39368_1000605 JGI25162J39368_100060512 237
494 3300002737 JGI25162J39368_1001369 JGI25162J39368_10013693 237
495 3300002737 JGI25162J39368_1001619 JGI25162J39368_10016196 237
496 3300002741 JGI25157J39369_1004324 JGI25157J39369_10043242 237
497 3300002772 JGI25164J39214_1000390 JGI25164J39214_100039015 237
498 3300002772 JGI25164J39214_1000439 JGI25164J39214_100043913 237
499 3300003214 JGI25165J46597_1000725 JGI25165J46597_100072515 237
500 3300003214 JGI25165J46597_1003866 JGI25165J46597_10038661 237
501 3300005331 Ga0070670_100002058 Ga0070670_10000205814 237
502 3300005336 Ga0070680_100193900 Ga0070680_1001939002 237
503 3300005337 Ga0070682_100013760 Ga0070682_1000137606 237
504 3300005339 Ga0070660_100294005 Ga0070660_1002940052 237
505 3300005339 Ga0070660_100424355 Ga0070660_1004243552 237
506 3300005366 Ga0070659_100047479 Ga0070659_1000474793 237
507 3300005366 Ga0070659_100448990 Ga0070659_1004489902 237
508 3300005435 Ga0070714_100002250 Ga0070714_1000022508 237
509 3300005435 Ga0070714_100226350 Ga0070714_1002263502 237
510 3300005436 Ga0070713_100001474 Ga0070713_10000147415 237
511 3300005437 Ga0070710_10008440 Ga0070710_100084403 237
512 3300005457 Ga0070662_100211734 Ga0070662_1002117342 237
513 3300005458 Ga0070681_10169395 Ga0070681_101693952 237
514 3300005530 Ga0070679_100109779 Ga0070679_1001097792 237
515 3300005539 Ga0068853_100017139 Ga0068853_1000171395 237
516 3300005546 Ga0070696_100041401 Ga0070696_1000414013 237
517 3300005547 Ga0070693_100045515 Ga0070693_1000455152 237
518 3300005577 Ga0068857_100067730 Ga0068857_1000677302 237
519 3300005577 Ga0068857_100259455 Ga0068857_1002594552 237
520 3300006175 Ga0070712_100040456 Ga0070712_1000404562 237
521 3300009011 Ga0105251_10000872 Ga0105251_100008723 237
522 3300009545 Ga0105237_10480616 Ga0105237_104806161 237
523 3300009551 Ga0105238_10277919 Ga0105238_102779192 237
524 3300013100 Ga0157373_10126849 Ga0157373_101268492 237
525 3300013100 Ga0157373_10226940 Ga0157373_102269402 237
526 3300013102 Ga0157371_10037807 Ga0157371_100378073 237
527 3300013102 Ga0157371_10037988 Ga0157371_100379883 237
528 3300013104 Ga0157370_10000662 Ga0157370_1000066215 237
529 3300013104 Ga0157370_10076915 Ga0157370_100769154 237
530 3300013104 Ga0157370_10077984 Ga0157370_100779843 237
531 3300013307 Ga0157372_10058048 Ga0157372_100580482 237
532 3300013307 Ga0157372_10072613 Ga0157372_100726134 237
533 3300014497 Ga0182008_10000325 Ga0182008_1000032525 237
534 3300015261 Ga0182006_1031084 Ga0182006_10310842 237
535 3300015262 Ga0182007_10013140 Ga0182007_100131402 237
536 3300015685 Ga0183369_1020 Ga0183369_102051 237
537 3300020082 Ga0206353_11359476 Ga0206353_113594762 237
538 3300025226 Ga0209674_103679 Ga0209674_1036792 237
539 3300025231 Ga0207427_100118 Ga0207427_10011876 237
540 3300025231 Ga0207427_100120 Ga0207427_10012025 237
541 3300025233 Ga0209437_100020 Ga0209437_100020490 237
542 3300025233 Ga0209437_100231 Ga0209437_10023112 237
543 3300025250 Ga0209026_1000037 Ga0209026_1000037212 237
544 3300025256 Ga0209759_1016157 Ga0209759_10161572 237
545 3300025261 Ga0209233_1000020 Ga0209233_1000020136 237
546 3300025261 Ga0209233_1000147 Ga0209233_1000147130 237
547 3300025735 Ga0207713_1003587 Ga0207713_10035877 237
548 3300025898 Ga0207692_10005174 Ga0207692_100051743 237
549 3300025917 Ga0207660_10048414 Ga0207660_100484143 237
550 3300025919 Ga0207657_10324810 Ga0207657_103248102 237
551 3300025924 Ga0207694_10052125 Ga0207694_100521255 237
552 3300025924 Ga0207694_10219523 Ga0207694_102195232 237
553 3300025925 Ga0207650_10031088 Ga0207650_100310883 237
554 3300025928 Ga0207700_10034895 Ga0207700_100348955 237
555 3300025929 Ga0207664_10001232 Ga0207664_100012326 237
556 3300025929 Ga0207664_10050239 Ga0207664_100502394 237
557 3300025932 Ga0207690_10022227 Ga0207690_100222274 237
558 3300025932 Ga0207690_10056684 Ga0207690_100566842 237
559 3300025949 Ga0207667_10030752 Ga0207667_100307522 237
560 3300026041 Ga0207639_10012868 Ga0207639_100128686 237
561 3300026041 Ga0207639_10194346 Ga0207639_101943462 237
562 3300026116 Ga0207674_10138751 Ga0207674_101387512 237
563 3300026116 Ga0207674_10264204 Ga0207674_102642041 237
564 3300026116 Ga0207674_10410559 Ga0207674_104105592 237
565 3300031238 Ga0265332_10047995 Ga0265332_100479952 237
566 3300037312 Ga0395899_0048433 Ga0395899_0048433_103_855 237
567 3300037466 Ga0395898_0659858 Ga0395898_0659858_147_899 237
568 3300038443 Ga0395901_0002971 Ga0395901_0002971_3781_4533 237
569 3300042000 Ga0439437_000473 Ga0439437_000473_2088_2840 237
570 3300048920 Ga0496117_0000446 Ga0496117_0000446_61978_62748 237
571 3300048921 Ga0496118_0027406 Ga0496118_0027406_2734_3504 237
572 3300048922 Ga0496119_0006544 Ga0496119_0006544_3812_4582 237
573 3300048923 Ga0496120_0000102 Ga0496120_0000102_47235_48005 237
574 3300048925 Ga0496122_0000158 Ga0496122_0000158_61148_61918 237
575 3300048926 Ga0496123_0000120 Ga0496123_0000120_97435_98205 237
576 3300048927 Ga0496124_0000878 Ga0496124_0000878_6174_6944 237
577 3300049580 Ga0501046_0213589 Ga0501046_0213589_237_995 237
578 3300049582 Ga0501048_0115858 Ga0501048_0115858_332_1078 237
579 3300049585 Ga0501069_0000120 Ga0501069_0000120_3458_4177 237
580 iso_pu_bacteria 2537561836 2538832175 237
581 iso_pu_bacteria 2687453130 2687583856 237
582 iso_pu_bacteria 2895395659 2895398032 237
583 iso_pu_bacteria 8021622325 8021623007 237
584 iso_pu_bacteria 8021626552 8021629917 237
585 iso_pu_bacteria 8021648035 8021650496 237
586 3300005327 Ga0070658_10240450 Ga0070658_102404502 238
587 3300005334 Ga0068869_100436686 Ga0068869_1004366861 238
588 3300005335 Ga0070666_10000350 Ga0070666_1000035017 238
589 3300005339 Ga0070660_100070368 Ga0070660_1000703682 238
590 3300005344 Ga0070661_100056566 Ga0070661_1000565662 238
591 3300005355 Ga0070671_100335198 Ga0070671_1003351982 238
592 3300005367 Ga0070667_100145634 Ga0070667_1001456342 238
593 3300005455 Ga0070663_100225189 Ga0070663_1002251892 238
594 3300005539 Ga0068853_100109441 Ga0068853_1001094412 238
595 3300005563 Ga0068855_100070522 Ga0068855_1000705224 238
596 3300005614 Ga0068856_100030997 Ga0068856_1000309976 238
597 3300005616 Ga0068852_100007256 Ga0068852_1000072562 238
598 3300005617 Ga0068859_100035642 Ga0068859_1000356426 238
599 3300005618 Ga0068864_100007613 Ga0068864_1000076136 238
600 3300005834 Ga0068851_10025349 Ga0068851_100253493 238
601 3300005841 Ga0068863_100015047 Ga0068863_1000150473 238
602 3300005843 Ga0068860_100020529 Ga0068860_1000205292 238
603 3300006237 Ga0097621_100238628 Ga0097621_1002386282 238
604 3300006931 Ga0097620_100035641 Ga0097620_1000356416 238
605 3300009093 Ga0105240_10029279 Ga0105240_100292795 238
606 3300009093 Ga0105240_10276126 Ga0105240_102761262 238
607 3300009098 Ga0105245_10157811 Ga0105245_101578112 238
608 3300009174 Ga0105241_10113613 Ga0105241_101136132 238
609 3300009545 Ga0105237_10008060 Ga0105237_100080607 238
610 3300009545 Ga0105237_10107485 Ga0105237_101074853 238
611 3300009551 Ga0105238_10011232 Ga0105238_100112328 238
612 3300009551 Ga0105238_10171703 Ga0105238_101717032 238
613 3300010375 Ga0105239_10007220 Ga0105239_100072203 238
614 3300011119 Ga0105246_10010675 Ga0105246_100106753 238
615 3300013100 Ga0157373_10330868 Ga0157373_103308681 238
616 3300013102 Ga0157371_10308336 Ga0157371_103083361 238
617 3300013104 Ga0157370_10289452 Ga0157370_102894522 238
618 3300013104 Ga0157370_10358921 Ga0157370_103589212 238
619 3300013105 Ga0157369_10011883 Ga0157369_100118837 238
620 3300013307 Ga0157372_10001728 Ga0157372_1000172811 238
621 3300013307 Ga0157372_10307719 Ga0157372_103077192 238
622 3300014325 Ga0163163_10001486 Ga0163163_100014863 238
623 3300014325 Ga0163163_10004834 Ga0163163_100048343 238
624 3300014968 Ga0157379_10003069 Ga0157379_100030696 238
625 3300025321 Ga0207656_10159007 Ga0207656_101590072 238
626 3300025903 Ga0207680_10000092 Ga0207680_100000926 238
627 3300025904 Ga0207647_10006817 Ga0207647_100068172 238
628 3300025909 Ga0207705_10143123 Ga0207705_101431232 238
629 3300025911 Ga0207654_10026625 Ga0207654_100266252 238
630 3300025913 Ga0207695_10000256 Ga0207695_100002565 238
631 3300025914 Ga0207671_10009998 Ga0207671_100099983 238
632 3300025917 Ga0207660_10361322 Ga0207660_103613222 238
633 3300025919 Ga0207657_10018195 Ga0207657_100181955 238
634 3300025920 Ga0207649_10001915 Ga0207649_100019156 238
635 3300025927 Ga0207687_10079930 Ga0207687_100799302 238
636 3300025931 Ga0207644_10630627 Ga0207644_106306271 238
637 3300025932 Ga0207690_10019820 Ga0207690_100198204 238
638 3300025933 Ga0207706_10014962 Ga0207706_100149626 238
639 3300025949 Ga0207667_10015858 Ga0207667_100158587 238
640 3300025949 Ga0207667_10508463 Ga0207667_105084632 238
641 3300025981 Ga0207640_10019057 Ga0207640_100190572 238
642 3300026035 Ga0207703_10291821 Ga0207703_102918211 238
643 3300026041 Ga0207639_10000240 Ga0207639_1000024017 238
644 3300026078 Ga0207702_10010147 Ga0207702_100101476 238
645 3300026088 Ga0207641_10013297 Ga0207641_100132978 238
646 3300026095 Ga0207676_10004232 Ga0207676_100042328 238
647 3300026116 Ga0207674_10048121 Ga0207674_100481214 238
648 3300026142 Ga0207698_10010163 Ga0207698_100101632 238
649 3300028381 Ga0268264_10031101 Ga0268264_100311012 238
650 3300037418 Ga0395900_0000013 Ga0395900_0000013_34064_34801 238
651 3300037466 Ga0395898_0233893 Ga0395898_0233893_236_973 238
652 3300003323 rootH1_10256714 rootH1_102567142 239
653 3300005614 Ga0068856_100002412 Ga0068856_1000024123 239
654 3300025263 Ga0209565_1002845 Ga0209565_10028454 239
655 3300026078 Ga0207702_10000843 Ga0207702_1000084337 239
656 3300003771 Ga0055526_1000012 Ga0055526_1000012185 240
657 3300003773 Ga0055537_1000021 Ga0055537_100002136 240
658 3300003775 Ga0055524_1000037 Ga0055524_1000037129 240
659 3300003784 Ga0055534_1000006 Ga0055534_1000006185 240
660 3300003790 Ga0055528_1000006 Ga0055528_1000006185 240
661 3300015689 Ga0183360_10002 Ga0183360_10002181 240
662 3300025263 Ga0209565_1000002 Ga0209565_1000002791 240
663 3300025273 Ga0209673_1000002 Ga0209673_1000002791 240
664 3300025291 Ga0209675_1000002 Ga0209675_1000002791 240
665 3300025295 Ga0209564_1000004 Ga0209564_1000004792 240
666 3300025299 Ga0209256_1000004 Ga0209256_1000004792 240
667 3300005539 Ga0068853_100016535 Ga0068853_1000165354 241
668 3300006237 Ga0097621_100099986 Ga0097621_1000999862 241
669 3300006358 Ga0068871_100632371 Ga0068871_1006323712 241
670 3300009551 Ga0105238_10010010 Ga0105238_100100103 241
671 3300010375 Ga0105239_10235823 Ga0105239_102358233 241
672 3300013297 Ga0157378_10000742 Ga0157378_1000074225 241
673 3300013306 Ga0163162_10000003 Ga0163162_10000003470 241
674 3300025924 Ga0207694_10010172 Ga0207694_100101723 241
675 3300026041 Ga0207639_10032218 Ga0207639_100322184 241
676 3300041452 Ga0451793_0131431 Ga0451793_0131431_2643_3404 241
677 3300042438 Ga0439459_0004955 Ga0439459_0004955_538_1296 241
678 3300046460 Ga0495638_0000268 Ga0495638_0000268_4145_4903 241
679 3300048924 Ga0496121_0001076 Ga0496121_0001076_45164_45946 241
680 3300053088 Ga0500644_0153792 Ga0500644_0153792_10_786 241
681 3300053108 Ga0500562_004594 Ga0500562_004594_2133_2933 241
682 3300053142 Ga0500577_0100013 Ga0500577_0100013_326_1126 241
683 iso_pu_bacteria 2941489479 2941494176 241
684 3300041512 Ga0451853_3345382 Ga0451853_3345382_817_1545 242
685 3300001904 JGI24736J21556_1009123 JGI24736J21556_10091232 243
686 3300005335 Ga0070666_10009638 Ga0070666_100096384 243
687 3300005344 Ga0070661_100063654 Ga0070661_1000636542 243
688 3300005367 Ga0070667_100045478 Ga0070667_1000454783 243
689 3300005455 Ga0070663_100016021 Ga0070663_1000160215 243
690 3300005466 Ga0070685_10004579 Ga0070685_100045794 243
691 3300005548 Ga0070665_100002383 Ga0070665_1000023834 243
692 3300005563 Ga0068855_100191537 Ga0068855_1001915372 243
693 3300005577 Ga0068857_100170520 Ga0068857_1001705202 243
694 3300005578 Ga0068854_100070811 Ga0068854_1000708112 243
695 3300005614 Ga0068856_100178471 Ga0068856_1001784713 243
696 3300005616 Ga0068852_100136829 Ga0068852_1001368292 243
697 3300005834 Ga0068851_10000687 Ga0068851_100006873 243
698 3300005842 Ga0068858_100001419 Ga0068858_1000014193 243
699 3300006358 Ga0068871_100572127 Ga0068871_1005721272 243
700 3300006881 Ga0068865_100016347 Ga0068865_1000163474 243
701 3300009093 Ga0105240_10000315 Ga0105240_1000031574 243
702 3300009093 Ga0105240_10015231 Ga0105240_100152313 243
703 3300009093 Ga0105240_10047100 Ga0105240_100471005 243
704 3300009174 Ga0105241_10009513 Ga0105241_100095132 243
705 3300009545 Ga0105237_10027131 Ga0105237_100271314 243
706 3300009545 Ga0105237_10150781 Ga0105237_101507812 243
707 3300009545 Ga0105237_10234794 Ga0105237_102347942 243
708 3300009551 Ga0105238_10000270 Ga0105238_100002706 243
709 3300009551 Ga0105238_10013764 Ga0105238_100137642 243
710 3300009553 Ga0105249_10031285 Ga0105249_100312853 243
711 3300010375 Ga0105239_10459569 Ga0105239_104595692 243
712 3300010375 Ga0105239_10907735 Ga0105239_109077352 243
713 3300013105 Ga0157369_10015904 Ga0157369_100159045 243
714 3300013296 Ga0157374_10435778 Ga0157374_104357782 243
715 3300013307 Ga0157372_10327602 Ga0157372_103276022 243
716 3300025321 Ga0207656_10000776 Ga0207656_100007763 243
717 3300025903 Ga0207680_10138706 Ga0207680_101387062 243
718 3300025904 Ga0207647_10000198 Ga0207647_100001989 243
719 3300025911 Ga0207654_10189909 Ga0207654_101899092 243
720 3300025913 Ga0207695_10000033 Ga0207695_1000003396 243
721 3300025913 Ga0207695_10022622 Ga0207695_100226226 243
722 3300025913 Ga0207695_10028928 Ga0207695_100289286 243
723 3300025914 Ga0207671_10011245 Ga0207671_100112454 243
724 3300025914 Ga0207671_10054162 Ga0207671_100541622 243
725 3300025920 Ga0207649_10265800 Ga0207649_102658002 243
726 3300025924 Ga0207694_10000267 Ga0207694_100002678 243
727 3300025924 Ga0207694_10002269 Ga0207694_100022697 243
728 3300025938 Ga0207704_10022179 Ga0207704_100221793 243
729 3300025961 Ga0207712_10000644 Ga0207712_1000064411 243
730 3300025981 Ga0207640_10050429 Ga0207640_100504292 243
731 3300026023 Ga0207677_10038712 Ga0207677_100387123 243
732 3300026035 Ga0207703_10000769 Ga0207703_1000076928 243
733 3300026041 Ga0207639_10000125 Ga0207639_1000012510 243
734 3300026067 Ga0207678_10006481 Ga0207678_1000648110 243
735 3300026078 Ga0207702_10006583 Ga0207702_100065833 243
736 3300026116 Ga0207674_10147841 Ga0207674_101478412 243
737 3300026142 Ga0207698_10103707 Ga0207698_101037072 243
738 3300028379 Ga0268266_10000006 Ga0268266_10000006244 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

192

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9715 4 227
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9597 1 228
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9581 3 226
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9563 3 220
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9555 1 228
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9682 1 221 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.968 32 228 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 1 215 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 1 227 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9639 1 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I4FC62-F1-model_v4 ABC-type lipoprotein export system, ATPase component 0.971 1 226 GO:0005524
GO:0005886
GO:0016887
AF-A0A174C2M7-F1-model_v4 deleted 0.9694 2 221
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9692 40 200 GO:0005524
GO:0005886
GO:0016887
AF-A0A7J0BSF2-F1-model_v4 ABC transporter ATP-binding protein 0.9676 2 227 GO:0005524
GO:0016887
AF-A0A838DTV6-F1-model_v4 ABC transporter ATP-binding protein 0.9644 4 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.26 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map