F478405
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 414 | 720 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0026570|Ga0495672_0026570_757_1710 |
| Length | 317 |
| Sequence | VLANSIRWVGKGALLRAVPTRSPSRKVDAWANARDAVHASNASAGAFARPTGRVMDLMLKGRVAVITGPAKGMGAAITMAFAAEGARLSLVGRDTSAIEPVATQAKSAGSEAIVVPCDLTDPVQCEHAAQATKDAYGRIDILVNVAGGSGPIGKTGVETTPQEFDDIVTLNMHGCFHTMRGVLPTMMAQRYGKIVNVGGTFGMRGRAGRMAYSASKWGLRGITKSFALEVGAYNINVNCVAPGMVDGPRFRDKVCAGMAERLGITIDEAVERHAADYALKRVSSDVDVANACLFLASDASRQITGVDLPVDGGWAML |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 6 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 7 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 8 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 9 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 10 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 11 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 12 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 13 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 14 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 15 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 16 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 17 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 26 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 27 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 28 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 29 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 104 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 237 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 238 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 239 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 240 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 241 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 242 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 346 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 347 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 348 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 394 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 400 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 401 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 402 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.56 |
| Metatranscriptomes | 0 |
| Isolates | 2.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.72 |
| Nodule | 0.81 |
| Rhizoplane | 11.38 |
| Rhizosphere | 63.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000208 | 3300002067 | Bacteria | 20516 |
| 2 | JGI24735J21928_10002064 | 3300002067 | Bacteria | 7079 |
| 3 | JGI24738J21930_10006769 | 3300002075 | Bacteria | 2665 |
| 4 | JGI24749J21850_1002524 | 3300002076 | Bacteria | 2574 |
| 5 | JGI24744J21845_10005881 | 3300002077 | Bacteria | 2543 |
| 6 | JGI24034J26672_10017301 | 3300002239 | Bacteria | 1115 |
| 7 | JGI24742J22300_10003421 | 3300002244 | Bacteria | 2574 |
| 8 | JGI24742J22300_10011386 | 3300002244 | Bacteria | 1476 |
| 9 | JGI24751J29686_10005482 | 3300002459 | Bacteria | 2583 |
| 10 | JGI25152J39213_1000001 | 3300002773 | Bacteria | 224104 |
| 11 | JGI25152J39213_1000015 | 3300002773 | Bacteria | 120605 |
| 12 | JGI25150J39212_1000007 | 3300002774 | Bacteria | 253635 |
| 13 | JGI25151J46595_10000013 | 3300003187 | Bacteria | 253635 |
| 14 | JGI25151J46595_10000594 | 3300003187 | Bacteria | 32109 |
| 15 | JGI25153J46596_10002037 | 3300003215 | Bacteria | 11906 |
| 16 | Ga0055537_1000433 | 3300003773 | Bacteria | 27034 |
| 17 | Ga0055534_1000008 | 3300003784 | Bacteria | 211098 |
| 18 | Ga0055528_1013847 | 3300003790 | Bacteria | 3029 |
| 19 | Ga0055540_1000018 | 3300003792 | Bacteria | 218360 |
| 20 | Ga0055531_10004239 | 3300003794 | Bacteria | 8821 |
| 21 | Ga0070658_10003751 | 3300005327 | Bacteria | 12433 |
| 22 | Ga0070690_100055440 | 3300005330 | Bacteria | 2539 |
| 23 | Ga0068869_100045545 | 3300005334 | Bacteria | 3159 |
| 24 | Ga0068869_100064815 | 3300005334 | Bacteria | 2688 |
| 25 | Ga0070666_10062810 | 3300005335 | Bacteria | 2517 |
| 26 | Ga0070680_100007422 | 3300005336 | Bacteria | 8369 |
| 27 | Ga0070682_100116916 | 3300005337 | Bacteria | 1785 |
| 28 | Ga0068868_100005272 | 3300005338 | Bacteria | 9076 |
| 29 | Ga0070660_100004612 | 3300005339 | Bacteria | 9538 |
| 30 | Ga0070660_100107697 | 3300005339 | Bacteria | 2215 |
| 31 | Ga0070689_100019842 | 3300005340 | Bacteria | 4977 |
| 32 | Ga0070687_100001103 | 3300005343 | Bacteria | 9290 |
| 33 | Ga0070661_100039806 | 3300005344 | Bacteria | 3426 |
| 34 | Ga0070668_100196752 | 3300005347 | Bacteria | 1653 |
| 35 | Ga0070668_100231029 | 3300005347 | Bacteria | 1529 |
| 36 | Ga0070675_100004007 | 3300005354 | Bacteria | 11180 |
| 37 | Ga0070671_100004079 | 3300005355 | Bacteria | 11529 |
| 38 | Ga0070674_100024775 | 3300005356 | Bacteria | 3897 |
| 39 | Ga0070674_100099314 | 3300005356 | Bacteria | 2117 |
| 40 | Ga0070674_100106429 | 3300005356 | Bacteria | 2052 |
| 41 | Ga0070673_100109682 | 3300005364 | Bacteria | 2287 |
| 42 | Ga0070673_100479430 | 3300005364 | Bacteria | 1123 |
| 43 | Ga0070688_100002255 | 3300005365 | Bacteria | 9733 |
| 44 | Ga0070688_100192854 | 3300005365 | Bacteria | 1421 |
| 45 | Ga0070659_100020337 | 3300005366 | Bacteria | 5040 |
| 46 | Ga0070714_100039155 | 3300005435 | Bacteria | 3989 |
| 47 | Ga0070713_100001455 | 3300005436 | Bacteria | 15112 |
| 48 | Ga0070710_10070364 | 3300005437 | Bacteria | 2015 |
| 49 | Ga0070701_10032161 | 3300005438 | Bacteria | 2610 |
| 50 | Ga0070711_100098859 | 3300005439 | Unclassified | 2119 |
| 51 | Ga0070711_100377073 | 3300005439 | Bacteria | 1146 |
| 52 | Ga0070700_100072290 | 3300005441 | Bacteria | 2204 |
| 53 | Ga0070663_100009178 | 3300005455 | Bacteria | 6116 |
| 54 | Ga0070663_100096281 | 3300005455 | Bacteria | 2201 |
| 55 | Ga0070678_100142035 | 3300005456 | Bacteria | 1922 |
| 56 | Ga0070678_100147819 | 3300005456 | Bacteria | 1889 |
| 57 | Ga0070681_10006029 | 3300005458 | Bacteria | 11744 |
| 58 | Ga0068867_100005726 | 3300005459 | Bacteria | 8815 |
| 59 | Ga0070685_10033440 | 3300005466 | Bacteria | 2889 |
| 60 | Ga0070698_100030943 | 3300005471 | Bacteria | 5551 |
| 61 | Ga0070679_100021886 | 3300005530 | Bacteria | 6245 |
| 62 | Ga0070684_100085176 | 3300005535 | Bacteria | 2803 |
| 63 | Ga0070684_100228752 | 3300005535 | Bacteria | 1698 |
| 64 | Ga0070697_100095538 | 3300005536 | Bacteria | 2465 |
| 65 | Ga0068853_100055980 | 3300005539 | Bacteria | 3400 |
| 66 | Ga0070672_100008089 | 3300005543 | Bacteria | 7186 |
| 67 | Ga0070686_100008982 | 3300005544 | Bacteria | 5599 |
| 68 | Ga0070686_100043101 | 3300005544 | Bacteria | 2830 |
| 69 | Ga0070665_100025185 | 3300005548 | Bacteria | 5995 |
| 70 | Ga0070704_100049207 | 3300005549 | Bacteria | 2956 |
| 71 | Ga0068854_100048092 | 3300005578 | Bacteria | 3042 |
| 72 | Ga0068856_100032200 | 3300005614 | Bacteria | 5133 |
| 73 | Ga0070702_100010148 | 3300005615 | Bacteria | 4629 |
| 74 | Ga0068852_100001350 | 3300005616 | Bacteria | 16475 |
| 75 | Ga0068852_100082935 | 3300005616 | Bacteria | 2850 |
| 76 | Ga0068859_100020374 | 3300005617 | Bacteria | 6657 |
| 77 | Ga0068859_100407039 | 3300005617 | Bacteria | 1456 |
| 78 | Ga0068864_100055816 | 3300005618 | Bacteria | 3411 |
| 79 | Ga0068866_10058069 | 3300005718 | Bacteria | 1996 |
| 80 | Ga0068866_10118663 | 3300005718 | Bacteria | 1487 |
| 81 | Ga0068866_10228942 | 3300005718 | Bacteria | 1126 |
| 82 | Ga0068861_100011128 | 3300005719 | Bacteria | 6247 |
| 83 | Ga0068861_100033879 | 3300005719 | Bacteria | 3771 |
| 84 | Ga0068851_10044179 | 3300005834 | Bacteria | 2248 |
| 85 | Ga0068870_10038045 | 3300005840 | Bacteria | 2483 |
| 86 | Ga0068870_10129202 | 3300005840 | Bacteria | 1466 |
| 87 | Ga0068863_100088933 | 3300005841 | Bacteria | 2928 |
| 88 | Ga0068863_100175787 | 3300005841 | Bacteria | 2055 |
| 89 | Ga0068858_100056204 | 3300005842 | Bacteria | 3638 |
| 90 | Ga0068860_100012400 | 3300005843 | Bacteria | 8398 |
| 91 | Ga0068862_100030588 | 3300005844 | Bacteria | 4538 |
| 92 | Ga0081455_10144844 | 3300005937 | Bacteria | 1839 |
| 93 | Ga0081539_10000005 | 3300005985 | Bacteria | 549026 |
| 94 | Ga0081539_10001849 | 3300005985 | Bacteria | 33399 |
| 95 | Ga0075365_10077143 | 3300006038 | Bacteria | 2251 |
| 96 | Ga0075368_10027110 | 3300006042 | Bacteria | 2207 |
| 97 | Ga0075363_100010879 | 3300006048 | Bacteria | 4340 |
| 98 | Ga0075363_100096770 | 3300006048 | Bacteria | 1630 |
| 99 | Ga0075364_10006501 | 3300006051 | Bacteria | 6872 |
| 100 | Ga0075364_10040876 | 3300006051 | Bacteria | 3008 |
| 101 | Ga0075364_10052732 | 3300006051 | Bacteria | 2658 |
| 102 | Ga0075364_10060820 | 3300006051 | Bacteria | 2476 |
| 103 | Ga0075432_10002409 | 3300006058 | Bacteria | 6230 |
| 104 | Ga0070715_10020144 | 3300006163 | Bacteria | 2568 |
| 105 | Ga0070712_100003300 | 3300006175 | Bacteria | 9925 |
| 106 | Ga0070712_100111934 | 3300006175 | Bacteria | 2039 |
| 107 | Ga0075362_10027152 | 3300006177 | Bacteria | 2449 |
| 108 | Ga0075362_10080626 | 3300006177 | Bacteria | 1500 |
| 109 | Ga0075367_10022076 | 3300006178 | Bacteria | 3565 |
| 110 | Ga0075366_10003953 | 3300006195 | Bacteria | 7909 |
| 111 | Ga0075366_10019800 | 3300006195 | Bacteria | 3899 |
| 112 | Ga0075366_10120133 | 3300006195 | Bacteria | 1583 |
| 113 | Ga0075366_10208296 | 3300006195 | Bacteria | 1190 |
| 114 | Ga0075366_10243803 | 3300006195 | Bacteria | 1096 |
| 115 | Ga0097621_100097163 | 3300006237 | Bacteria | 2472 |
| 116 | Ga0097621_100362997 | 3300006237 | Bacteria | 1291 |
| 117 | Ga0075370_10005797 | 3300006353 | Bacteria | 6173 |
| 118 | Ga0075370_10093644 | 3300006353 | Bacteria | 1734 |
| 119 | Ga0075370_10101089 | 3300006353 | Bacteria | 1669 |
| 120 | Ga0075370_10267008 | 3300006353 | Bacteria | 1015 |
| 121 | Ga0075434_100075006 | 3300006871 | Unclassified | 3375 |
| 122 | Ga0075434_100333787 | 3300006871 | Bacteria | 1537 |
| 123 | Ga0068865_100048251 | 3300006881 | Bacteria | 2930 |
| 124 | Ga0097620_100020374 | 3300006931 | Bacteria | 6657 |
| 125 | Ga0097620_100407040 | 3300006931 | Bacteria | 1456 |
| 126 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 127 | Ga0099826_10000084 | 3300006948 | Bacteria | 46867 |
| 128 | Ga0075435_100045614 | 3300007076 | Unclassified | 3515 |
| 129 | Ga0075435_100346416 | 3300007076 | Bacteria | 1273 |
| 130 | Ga0099794_10011800 | 3300007265 | Bacteria | 3752 |
| 131 | Ga0105251_10002186 | 3300009011 | Bacteria | 15646 |
| 132 | Ga0111539_10034206 | 3300009094 | Bacteria | 6165 |
| 133 | Ga0111539_10611349 | 3300009094 | Bacteria | 1269 |
| 134 | Ga0105245_10101615 | 3300009098 | Bacteria | 2662 |
| 135 | Ga0105245_10261899 | 3300009098 | Bacteria | 1683 |
| 136 | Ga0105247_10075504 | 3300009101 | Bacteria | 2115 |
| 137 | Ga0105247_10281558 | 3300009101 | Bacteria | 1147 |
| 138 | Ga0114129_10084545 | 3300009147 | Bacteria | 4405 |
| 139 | Ga0105243_10060724 | 3300009148 | Bacteria | 3020 |
| 140 | Ga0105241_10036488 | 3300009174 | Bacteria | 3699 |
| 141 | Ga0105241_10134289 | 3300009174 | Bacteria | 2007 |
| 142 | Ga0105242_10123956 | 3300009176 | Bacteria | 2222 |
| 143 | Ga0105242_10389274 | 3300009176 | Unclassified | 1298 |
| 144 | Ga0105248_10013912 | 3300009177 | Bacteria | 8854 |
| 145 | Ga0105237_10175901 | 3300009545 | Bacteria | 2140 |
| 146 | Ga0105238_10037777 | 3300009551 | Bacteria | 4907 |
| 147 | Ga0105238_10043402 | 3300009551 | Bacteria | 4550 |
| 148 | Ga0099796_10013326 | 3300010159 | Bacteria | 2345 |
| 149 | Ga0105239_10116550 | 3300010375 | Bacteria | 2964 |
| 150 | Ga0105239_10700842 | 3300010375 | Bacteria | 1158 |
| 151 | Ga0105246_10023668 | 3300011119 | Bacteria | 3977 |
| 152 | Ga0105246_10035476 | 3300011119 | Bacteria | 3334 |
| 153 | Ga0157371_10156314 | 3300013102 | Bacteria | 1627 |
| 154 | Ga0157369_10143735 | 3300013105 | Unclassified | 2523 |
| 155 | Ga0157369_10251152 | 3300013105 | Bacteria | 1846 |
| 156 | Ga0157374_10095883 | 3300013296 | Bacteria | 2837 |
| 157 | Ga0157378_10024483 | 3300013297 | Bacteria | 5313 |
| 158 | Ga0163162_10156077 | 3300013306 | Bacteria | 2402 |
| 159 | Ga0157372_10129414 | 3300013307 | Bacteria | 2903 |
| 160 | Ga0157372_11039147 | 3300013307 | Bacteria | 948 |
| 161 | Ga0163163_10075159 | 3300014325 | Bacteria | 3372 |
| 162 | Ga0157380_10050050 | 3300014326 | Bacteria | 3298 |
| 163 | Ga0157377_10028829 | 3300014745 | Bacteria | 2991 |
| 164 | Ga0157377_10090256 | 3300014745 | Bacteria | 1808 |
| 165 | Ga0157379_10014125 | 3300014968 | Bacteria | 7001 |
| 166 | Ga0157376_10041793 | 3300014969 | Bacteria | 3756 |
| 167 | Ga0157376_10147363 | 3300014969 | Bacteria | 2119 |
| 168 | Ga0157376_11004333 | 3300014969 | Bacteria | 857 |
| 169 | Ga0163161_10015691 | 3300017792 | Bacteria | 5283 |
| 170 | Ga0213873_10010169 | 3300021358 | Bacteria | 1977 |
| 171 | Ga0213876_10199574 | 3300021384 | Bacteria | 1063 |
| 172 | Ga0213875_10000030 | 3300021388 | Bacteria | 178500 |
| 173 | Ga0207425_1000032 | 3300025245 | Bacteria | 253689 |
| 174 | Ga0209129_1000056 | 3300025258 | Bacteria | 253689 |
| 175 | Ga0209565_1000042 | 3300025263 | Bacteria | 239712 |
| 176 | Ga0209673_1000071 | 3300025273 | Bacteria | 239966 |
| 177 | Ga0209675_1000041 | 3300025291 | Bacteria | 239712 |
| 178 | Ga0209675_1015340 | 3300025291 | Bacteria | 2281 |
| 179 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 180 | Ga0209025_1000090 | 3300025294 | Bacteria | 253689 |
| 181 | Ga0209758_1000084 | 3300025297 | Bacteria | 256346 |
| 182 | Ga0209758_1000176 | 3300025297 | Bacteria | 143504 |
| 183 | Ga0209758_1001680 | 3300025297 | Bacteria | 24948 |
| 184 | Ga0209050_1000248 | 3300025298 | Bacteria | 116319 |
| 185 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 186 | Ga0207426_1001370 | 3300025302 | Bacteria | 20631 |
| 187 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 188 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 189 | Ga0207713_1007338 | 3300025735 | Bacteria | 6527 |
| 190 | Ga0207682_10000621 | 3300025893 | Bacteria | 16511 |
| 191 | Ga0207692_10062458 | 3300025898 | Unclassified | 1933 |
| 192 | Ga0207692_10146022 | 3300025898 | Bacteria | 1350 |
| 193 | Ga0207692_10167142 | 3300025898 | Bacteria | 1272 |
| 194 | Ga0207692_10281841 | 3300025898 | Bacteria | 1006 |
| 195 | Ga0207642_10016579 | 3300025899 | Bacteria | 2779 |
| 196 | Ga0207688_10002139 | 3300025901 | Bacteria | 10619 |
| 197 | Ga0207688_10042832 | 3300025901 | Bacteria | 2520 |
| 198 | Ga0207680_10016603 | 3300025903 | Bacteria | 3870 |
| 199 | Ga0207647_10028407 | 3300025904 | Unclassified | 3633 |
| 200 | Ga0207647_10039102 | 3300025904 | Bacteria | 2995 |
| 201 | Ga0207685_10047400 | 3300025905 | Bacteria | 1640 |
| 202 | Ga0207645_10119588 | 3300025907 | Bacteria | 1709 |
| 203 | Ga0207643_10003201 | 3300025908 | Bacteria | 8818 |
| 204 | Ga0207643_10027249 | 3300025908 | Bacteria | 3167 |
| 205 | Ga0207705_10005149 | 3300025909 | Bacteria | 9800 |
| 206 | Ga0207654_10068032 | 3300025911 | Bacteria | 2106 |
| 207 | Ga0207707_10008231 | 3300025912 | Bacteria | 9052 |
| 208 | Ga0207693_10004979 | 3300025915 | Bacteria | 11151 |
| 209 | Ga0207693_10175491 | 3300025915 | Bacteria | 1686 |
| 210 | Ga0207693_10404537 | 3300025915 | Bacteria | 1067 |
| 211 | Ga0207663_10117953 | 3300025916 | Bacteria | 1812 |
| 212 | Ga0207660_10038697 | 3300025917 | Bacteria | 3330 |
| 213 | Ga0207662_10031526 | 3300025918 | Bacteria | 3081 |
| 214 | Ga0207657_10014784 | 3300025919 | Bacteria | 7600 |
| 215 | Ga0207657_10111951 | 3300025919 | Bacteria | 2253 |
| 216 | Ga0207649_10089787 | 3300025920 | Bacteria | 2009 |
| 217 | Ga0207652_10047827 | 3300025921 | Bacteria | 3654 |
| 218 | Ga0207681_10200607 | 3300025923 | Bacteria | 1532 |
| 219 | Ga0207694_10023156 | 3300025924 | Bacteria | 4715 |
| 220 | Ga0207694_10160477 | 3300025924 | Bacteria | 1816 |
| 221 | Ga0207650_10074595 | 3300025925 | Bacteria | 2558 |
| 222 | Ga0207659_10038977 | 3300025926 | Bacteria | 3309 |
| 223 | Ga0207687_10012389 | 3300025927 | Bacteria | 5573 |
| 224 | Ga0207700_10035372 | 3300025928 | Unclassified | 3597 |
| 225 | Ga0207700_10079433 | 3300025928 | Bacteria | 2555 |
| 226 | Ga0207664_10053226 | 3300025929 | Bacteria | 3203 |
| 227 | Ga0207644_10005628 | 3300025931 | Bacteria | 8163 |
| 228 | Ga0207686_10005811 | 3300025934 | Bacteria | 6621 |
| 229 | Ga0207686_10218835 | 3300025934 | Unclassified | 1374 |
| 230 | Ga0207709_10025508 | 3300025935 | Bacteria | 3385 |
| 231 | Ga0207709_10107403 | 3300025935 | Bacteria | 1859 |
| 232 | Ga0207669_10003530 | 3300025937 | Bacteria | 6770 |
| 233 | Ga0207669_10005020 | 3300025937 | Bacteria | 5886 |
| 234 | Ga0207669_10091199 | 3300025937 | Bacteria | 1984 |
| 235 | Ga0207691_10005326 | 3300025940 | Bacteria | 12420 |
| 236 | Ga0207691_10018628 | 3300025940 | Bacteria | 6578 |
| 237 | Ga0207689_10003046 | 3300025942 | Bacteria | 15440 |
| 238 | Ga0207689_10012189 | 3300025942 | Bacteria | 7354 |
| 239 | Ga0207661_10298723 | 3300025944 | Bacteria | 1443 |
| 240 | Ga0207661_10315748 | 3300025944 | Bacteria | 1404 |
| 241 | Ga0207651_10008430 | 3300025960 | Bacteria | 5568 |
| 242 | Ga0207651_10027484 | 3300025960 | Bacteria | 3573 |
| 243 | Ga0207712_10094450 | 3300025961 | Bacteria | 2209 |
| 244 | Ga0207658_10009519 | 3300025986 | Bacteria | 6596 |
| 245 | Ga0207677_10086790 | 3300026023 | Bacteria | 2263 |
| 246 | Ga0207703_10005530 | 3300026035 | Bacteria | 10146 |
| 247 | Ga0207678_10007548 | 3300026067 | Bacteria | 9612 |
| 248 | Ga0207678_10040537 | 3300026067 | Bacteria | 4039 |
| 249 | Ga0207678_10565261 | 3300026067 | Bacteria | 995 |
| 250 | Ga0207708_10001550 | 3300026075 | Bacteria | 17154 |
| 251 | Ga0207702_10094872 | 3300026078 | Bacteria | 2620 |
| 252 | Ga0207641_10107194 | 3300026088 | Bacteria | 2471 |
| 253 | Ga0207648_10004523 | 3300026089 | Bacteria | 14252 |
| 254 | Ga0207648_10090818 | 3300026089 | Bacteria | 2669 |
| 255 | Ga0207676_10019699 | 3300026095 | Bacteria | 4926 |
| 256 | Ga0207676_10042616 | 3300026095 | Bacteria | 3491 |
| 257 | Ga0207674_10528919 | 3300026116 | Bacteria | 1139 |
| 258 | Ga0207675_100001799 | 3300026118 | Bacteria | 21467 |
| 259 | Ga0207683_10004652 | 3300026121 | Bacteria | 11827 |
| 260 | Ga0207683_10184766 | 3300026121 | Bacteria | 1891 |
| 261 | Ga0207698_10004646 | 3300026142 | Bacteria | 8390 |
| 262 | Ga0207698_10036580 | 3300026142 | Bacteria | 3605 |
| 263 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 264 | Ga0209282_1000112 | 3300027666 | Bacteria | 53120 |
| 265 | Ga0209813_10014021 | 3300027866 | Bacteria | 2150 |
| 266 | Ga0209813_10039208 | 3300027866 | Bacteria | 1435 |
| 267 | Ga0268266_10072091 | 3300028379 | Bacteria | 2994 |
| 268 | Ga0268266_10331785 | 3300028379 | Bacteria | 1426 |
| 269 | Ga0268265_10083743 | 3300028380 | Bacteria | 2526 |
| 270 | Ga0268264_10137354 | 3300028381 | Bacteria | 2175 |
| 271 | Ga0307515_10168986 | 3300028794 | Bacteria | 2190 |
| 272 | Ga0265332_10000200 | 3300031238 | Bacteria | 48645 |
| 273 | Ga0265320_10025830 | 3300031240 | Bacteria | 3082 |
| 274 | Ga0265325_10009226 | 3300031241 | Bacteria | 5771 |
| 275 | Ga0265325_10020834 | 3300031241 | Bacteria | 3609 |
| 276 | Ga0265329_10012715 | 3300031242 | Bacteria | 3017 |
| 277 | Ga0265340_10002605 | 3300031247 | Bacteria | 10250 |
| 278 | Ga0265340_10042783 | 3300031247 | Bacteria | 2222 |
| 279 | Ga0265340_10084233 | 3300031247 | Bacteria | 1493 |
| 280 | Ga0265339_10008083 | 3300031249 | Bacteria | 6722 |
| 281 | Ga0265331_10015480 | 3300031250 | Bacteria | 4025 |
| 282 | Ga0265331_10026948 | 3300031250 | Bacteria | 2885 |
| 283 | Ga0265316_10350333 | 3300031344 | Bacteria | 1069 |
| 284 | Ga0307408_100183955 | 3300031548 | Bacteria | 1678 |
| 285 | Ga0265313_10029322 | 3300031595 | Bacteria | 2848 |
| 286 | Ga0265314_10011634 | 3300031711 | Bacteria | 7243 |
| 287 | Ga0265314_10018040 | 3300031711 | Bacteria | 5518 |
| 288 | Ga0265314_10056807 | 3300031711 | Bacteria | 2692 |
| 289 | Ga0265342_10000024 | 3300031712 | Bacteria | 171500 |
| 290 | Ga0265342_10009337 | 3300031712 | Bacteria | 6922 |
| 291 | Ga0265342_10024382 | 3300031712 | Bacteria | 3819 |
| 292 | Ga0265342_10058169 | 3300031712 | Bacteria | 2285 |
| 293 | Ga0307405_10000595 | 3300031731 | Bacteria | 13880 |
| 294 | Ga0307413_10445785 | 3300031824 | Bacteria | 1026 |
| 295 | Ga0307518_10299835 | 3300031838 | Bacteria | 978 |
| 296 | Ga0307410_10206258 | 3300031852 | Bacteria | 1504 |
| 297 | Ga0307412_10008110 | 3300031911 | Bacteria | 5985 |
| 298 | Ga0307412_10260156 | 3300031911 | Bacteria | 1352 |
| 299 | Ga0307412_10418554 | 3300031911 | Bacteria | 1095 |
| 300 | Ga0307414_10397239 | 3300032004 | Bacteria | 1196 |
| 301 | Ga0307411_10004556 | 3300032005 | Bacteria | 6660 |
| 302 | Ga0316583_10010048 | 3300032133 | Bacteria | 3410 |
| 303 | Ga0316583_10047902 | 3300032133 | Bacteria | 1506 |
| 304 | Ga0373945_0005356 | 3300035116 | Bacteria | 4108 |
| 305 | Ga0316574_0002702 | 3300035398 | Bacteria | 8975 |
| 306 | Ga0373931_0036575 | 3300035691 | Bacteria | 2560 |
| 307 | Ga0373931_0174459 | 3300035691 | Bacteria | 1269 |
| 308 | Ga0373927_0043715 | 3300035695 | Bacteria | 2899 |
| 309 | Ga0373927_0106844 | 3300035695 | Bacteria | 1823 |
| 310 | Ga0373947_0077236 | 3300035725 | Bacteria | 2053 |
| 311 | Ga0373937_0225575 | 3300036401 | Bacteria | 1764 |
| 312 | Ga0373925_0095939 | 3300037068 | Bacteria | 2272 |
| 313 | Ga0373925_0097173 | 3300037068 | Bacteria | 2259 |
| 314 | Ga0395905_0413906 | 3300037471 | Bacteria | 1243 |
| 315 | Ga0436364_0199717 | 3300037853 | Bacteria | 1299 |
| 316 | Ga0436364_0686343 | 3300037853 | Bacteria | 7067 |
| 317 | Ga0436364_0720016 | 3300037853 | Bacteria | 1078 |
| 318 | Ga0436364_1313737 | 3300037853 | Bacteria | 1263 |
| 319 | Ga0242420_019841 | 3300038996 | Bacteria | 1192 |
| 320 | Ga0436365_0001406 | 3300039437 | Bacteria | 963 |
| 321 | Ga0436365_0029099 | 3300039437 | Bacteria | 3144 |
| 322 | Ga0436365_0392771 | 3300039437 | Bacteria | 2594 |
| 323 | Ga0436361_0860319 | 3300039447 | Bacteria | 1341 |
| 324 | Ga0436361_0943238 | 3300039447 | Bacteria | 4696 |
| 325 | Ga0436363_0452757 | 3300039450 | Bacteria | 986 |
| 326 | Ga0436363_1354593 | 3300039450 | Bacteria | 982 |
| 327 | Ga0436363_1412358 | 3300039450 | Bacteria | 935 |
| 328 | Ga0436362_0561730 | 3300039453 | Bacteria | 9368 |
| 329 | Ga0436362_1019396 | 3300039453 | Bacteria | 858 |
| 330 | Ga0439453_0011128 | 3300041408 | Bacteria | 1496 |
| 331 | Ga0439465_0061057 | 3300041413 | Bacteria | 1249 |
| 332 | Ga0451789_1320271 | 3300041443 | Bacteria | 1152 |
| 333 | Ga0439456_061525 | 3300042013 | Bacteria | 825 |
| 334 | Ga0450898_029343 | 3300042134 | Bacteria | 1003 |
| 335 | Ga0439435_0022795 | 3300042436 | Bacteria | 1638 |
| 336 | Ga0439464_0005219 | 3300042439 | Bacteria | 3350 |
| 337 | Ga0466966_0090439 | 3300044684 | Bacteria | 1901 |
| 338 | Ga0466959_0187628 | 3300045049 | Bacteria | 1444 |
| 339 | Ga0451576_0710777 | 3300045051 | Bacteria | 1056 |
| 340 | Ga0495592_0044218 | 3300046454 | Bacteria | 3329 |
| 341 | Ga0495603_0015821 | 3300046455 | Bacteria | 4560 |
| 342 | Ga0495603_0042996 | 3300046455 | Bacteria | 2699 |
| 343 | Ga0495590_0000786 | 3300046457 | Bacteria | 14413 |
| 344 | Ga0495629_0000936 | 3300046459 | Bacteria | 23510 |
| 345 | Ga0495629_0006237 | 3300046459 | Bacteria | 8846 |
| 346 | Ga0495629_0064142 | 3300046459 | Bacteria | 2565 |
| 347 | Ga0495638_0077917 | 3300046460 | Bacteria | 2017 |
| 348 | Ga0495638_0208153 | 3300046460 | Bacteria | 1100 |
| 349 | Ga0495641_0008499 | 3300046461 | Bacteria | 6245 |
| 350 | Ga0495641_0122407 | 3300046461 | Bacteria | 1161 |
| 351 | Ga0495651_0118196 | 3300046462 | Unclassified | 1951 |
| 352 | Ga0495651_0295318 | 3300046462 | Bacteria | 1089 |
| 353 | Ga0495653_0000639 | 3300046463 | Bacteria | 26668 |
| 354 | Ga0495653_0023842 | 3300046463 | Bacteria | 4940 |
| 355 | Ga0495653_0126186 | 3300046463 | Bacteria | 1817 |
| 356 | Ga0495650_0001639 | 3300046471 | Bacteria | 20791 |
| 357 | Ga0495580_0006609 | 3300046472 | Bacteria | 9423 |
| 358 | Ga0495580_0009219 | 3300046472 | Bacteria | 7776 |
| 359 | Ga0495580_0012735 | 3300046472 | Bacteria | 6447 |
| 360 | Ga0495580_0066348 | 3300046472 | Bacteria | 2526 |
| 361 | Ga0495582_0003268 | 3300046473 | Bacteria | 9100 |
| 362 | Ga0495582_0013585 | 3300046473 | Bacteria | 4483 |
| 363 | Ga0495582_0019388 | 3300046473 | Bacteria | 3718 |
| 364 | Ga0495639_0020000 | 3300046475 | Bacteria | 2923 |
| 365 | Ga0495639_0085453 | 3300046475 | Unclassified | 1475 |
| 366 | Ga0495662_0024375 | 3300046476 | Archaea | 2919 |
| 367 | Ga0495664_0011475 | 3300046477 | Bacteria | 4997 |
| 368 | Ga0495664_0044993 | 3300046477 | Plasmid | 2617 |
| 369 | Ga0495664_0142246 | 3300046477 | Bacteria | 1455 |
| 370 | Ga0495664_0271849 | 3300046477 | Bacteria | 1024 |
| 371 | Ga0495584_0080207 | 3300046491 | Bacteria | 1642 |
| 372 | Ga0495584_0229180 | 3300046491 | Bacteria | 944 |
| 373 | Ga0495585_0040563 | 3300046492 | Bacteria | 2614 |
| 374 | Ga0495585_0267785 | 3300046492 | Bacteria | 848 |
| 375 | Ga0495607_0114022 | 3300046501 | Unclassified | 1429 |
| 376 | Ga0495583_0006484 | 3300046506 | Bacteria | 7641 |
| 377 | Ga0495583_0114204 | 3300046506 | Bacteria | 1142 |
| 378 | Ga0495606_0002496 | 3300046507 | Bacteria | 21251 |
| 379 | Ga0495606_0107317 | 3300046507 | Bacteria | 1689 |
| 380 | Ga0495606_0155500 | 3300046507 | Bacteria | 1338 |
| 381 | Ga0495608_0180085 | 3300046511 | Unclassified | 1337 |
| 382 | Ga0495608_0288954 | 3300046511 | Bacteria | 1016 |
| 383 | Ga0495618_0105257 | 3300046514 | Bacteria | 1806 |
| 384 | Ga0495620_0004940 | 3300046515 | Bacteria | 7482 |
| 385 | Ga0495620_0011011 | 3300046515 | Bacteria | 4740 |
| 386 | Ga0495628_0001408 | 3300046516 | Bacteria | 22079 |
| 387 | Ga0495628_0050756 | 3300046516 | Bacteria | 3281 |
| 388 | Ga0495628_0330093 | 3300046516 | Bacteria | 1124 |
| 389 | Ga0495630_0008050 | 3300046517 | Bacteria | 7578 |
| 390 | Ga0495630_0022268 | 3300046517 | Bacteria | 4681 |
| 391 | Ga0495630_0092389 | 3300046517 | Bacteria | 2287 |
| 392 | Ga0495631_0051576 | 3300046518 | Bacteria | 1798 |
| 393 | Ga0495632_0192148 | 3300046519 | Bacteria | 932 |
| 394 | Ga0495637_0035473 | 3300046520 | Bacteria | 2178 |
| 395 | Ga0495643_0000049 | 3300046522 | Bacteria | 212242 |
| 396 | Ga0495643_0006723 | 3300046522 | Bacteria | 7526 |
| 397 | Ga0495643_0050853 | 3300046522 | Bacteria | 2231 |
| 398 | Ga0495643_0106249 | 3300046522 | Bacteria | 1433 |
| 399 | Ga0495648_0000402 | 3300046524 | Bacteria | 47633 |
| 400 | Ga0495648_0000404 | 3300046524 | Bacteria | 47523 |
| 401 | Ga0495648_0009623 | 3300046524 | Bacteria | 7456 |
| 402 | Ga0495648_0042834 | 3300046524 | Bacteria | 2845 |
| 403 | Ga0495663_0024519 | 3300046525 | Bacteria | 1754 |
| 404 | Ga0495666_0025761 | 3300046526 | Plasmid | 2904 |
| 405 | Ga0495666_0041745 | 3300046526 | Bacteria | 2220 |
| 406 | Ga0495666_0093426 | 3300046526 | Bacteria | 1419 |
| 407 | Ga0495642_0004269 | 3300046528 | Bacteria | 5556 |
| 408 | Ga0495652_0013910 | 3300046529 | Bacteria | 7234 |
| 409 | Ga0495652_0449084 | 3300046529 | Bacteria | 903 |
| 410 | Ga0495654_0037972 | 3300046530 | Unclassified | 2411 |
| 411 | Ga0495654_0066615 | 3300046530 | Bacteria | 1716 |
| 412 | Ga0495654_0162609 | 3300046530 | Bacteria | 979 |
| 413 | Ga0495665_0001474 | 3300046531 | Bacteria | 12622 |
| 414 | Ga0495665_0061840 | 3300046531 | Bacteria | 1977 |
| 415 | Ga0495665_0081414 | 3300046531 | Bacteria | 1702 |
| 416 | Ga0495640_0094295 | 3300046533 | Bacteria | 1971 |
| 417 | Ga0495586_0002698 | 3300046535 | Bacteria | 9600 |
| 418 | Ga0495587_0124389 | 3300046536 | Bacteria | 1476 |
| 419 | Ga0495587_0203792 | 3300046536 | Bacteria | 1118 |
| 420 | Ga0495598_0006421 | 3300046537 | Bacteria | 2657 |
| 421 | Ga0495598_0044071 | 3300046537 | Bacteria | 1316 |
| 422 | Ga0495609_0000014 | 3300046538 | Bacteria | 326023 |
| 423 | Ga0495597_0000309 | 3300046542 | Bacteria | 43860 |
| 424 | Ga0495597_0006152 | 3300046542 | Bacteria | 6239 |
| 425 | Ga0495597_0009005 | 3300046542 | Bacteria | 4967 |
| 426 | Ga0495597_0022383 | 3300046542 | Bacteria | 2932 |
| 427 | Ga0495645_0003302 | 3300046543 | Bacteria | 10928 |
| 428 | Ga0495645_0014571 | 3300046543 | Bacteria | 5581 |
| 429 | Ga0495622_0008986 | 3300046557 | Bacteria | 4630 |
| 430 | Ga0495667_0012570 | 3300046559 | Bacteria | 5741 |
| 431 | Ga0495667_0233493 | 3300046559 | Bacteria | 1173 |
| 432 | Ga0495656_0128477 | 3300046615 | Bacteria | 1204 |
| 433 | Ga0495668_0026053 | 3300046616 | Bacteria | 3320 |
| 434 | Ga0495668_0060458 | 3300046616 | Bacteria | 2090 |
| 435 | Ga0495668_0065981 | 3300046616 | Bacteria | 1992 |
| 436 | Ga0495634_0009197 | 3300046642 | Bacteria | 7295 |
| 437 | Ga0495634_0152402 | 3300046642 | Bacteria | 1461 |
| 438 | Ga0495625_0000052 | 3300046660 | Bacteria | 190656 |
| 439 | Ga0495635_0038358 | 3300046663 | Bacteria | 3317 |
| 440 | Ga0495659_0096811 | 3300046664 | Bacteria | 1139 |
| 441 | Ga0495661_0002942 | 3300046665 | Bacteria | 12869 |
| 442 | Ga0495661_0015241 | 3300046665 | Bacteria | 5131 |
| 443 | Ga0495588_0007606 | 3300046674 | Bacteria | 4943 |
| 444 | Ga0495588_0017092 | 3300046674 | Bacteria | 3516 |
| 445 | Ga0495657_0032075 | 3300046675 | Bacteria | 3669 |
| 446 | Ga0495623_0003273 | 3300046679 | Bacteria | 10693 |
| 447 | Ga0495623_0197916 | 3300046679 | Bacteria | 1157 |
| 448 | Ga0495646_0001045 | 3300046680 | Bacteria | 16027 |
| 449 | Ga0495646_0029437 | 3300046680 | Bacteria | 3433 |
| 450 | Ga0495646_0033103 | 3300046680 | Unclassified | 3214 |
| 451 | Ga0495647_0018887 | 3300046681 | Bacteria | 2461 |
| 452 | Ga0495658_0251393 | 3300046683 | Bacteria | 1112 |
| 453 | Ga0495613_0100065 | 3300046689 | Bacteria | 2094 |
| 454 | Ga0495624_0001307 | 3300046690 | Bacteria | 19560 |
| 455 | Ga0495624_0015089 | 3300046690 | Bacteria | 5228 |
| 456 | Ga0495624_0031153 | 3300046690 | Bacteria | 3471 |
| 457 | Ga0495670_0013820 | 3300046691 | Bacteria | 3969 |
| 458 | Ga0495670_0102105 | 3300046691 | Bacteria | 1477 |
| 459 | Ga0495649_0005770 | 3300046694 | Bacteria | 7802 |
| 460 | Ga0495649_0053132 | 3300046694 | Bacteria | 2194 |
| 461 | Ga0495649_0090611 | 3300046694 | Bacteria | 1630 |
| 462 | Ga0495600_0281817 | 3300046809 | Bacteria | 1052 |
| 463 | Ga0495660_0034567 | 3300046810 | Bacteria | 2828 |
| 464 | Ga0495581_0009026 | 3300047315 | Bacteria | 5769 |
| 465 | Ga0495581_0043299 | 3300047315 | Unclassified | 2604 |
| 466 | Ga0495581_0184148 | 3300047315 | Bacteria | 1222 |
| 467 | Ga0495604_0118385 | 3300047317 | Unclassified | 1920 |
| 468 | Ga0495604_0186186 | 3300047317 | Bacteria | 1449 |
| 469 | Ga0495604_0190634 | 3300047317 | Bacteria | 1429 |
| 470 | Ga0495604_0247021 | 3300047317 | Bacteria | 1218 |
| 471 | Ga0495674_0001217 | 3300047319 | Bacteria | 24942 |
| 472 | Ga0495674_0002253 | 3300047319 | Bacteria | 18965 |
| 473 | Ga0495674_0024544 | 3300047319 | Bacteria | 5537 |
| 474 | Ga0495672_0026570 | 3300047320 | Bacteria | 3692 |
| 475 | Ga0495672_0074065 | 3300047320 | Bacteria | 1919 |
| 476 | Ga0495672_0126233 | 3300047320 | Bacteria | 1352 |
| 477 | Ga0495676_0109860 | 3300047321 | Bacteria | 2025 |
| 478 | Ga0495680_0195937 | 3300047322 | Bacteria | 1451 |
| 479 | Ga0495680_0209268 | 3300047322 | Bacteria | 1397 |
| 480 | Ga0495680_0286308 | 3300047322 | Bacteria | 1160 |
| 481 | Ga0495683_0002371 | 3300047323 | Bacteria | 11427 |
| 482 | Ga0495687_000107 | 3300047443 | Bacteria | 127815 |
| 483 | Ga0495687_008885 | 3300047443 | Bacteria | 5690 |
| 484 | Ga0495687_010756 | 3300047443 | Bacteria | 4986 |
| 485 | Ga0495687_124672 | 3300047443 | Bacteria | 923 |
| 486 | Ga0495675_0002298 | 3300047444 | Bacteria | 11415 |
| 487 | Ga0495679_039141 | 3300047446 | Bacteria | 1480 |
| 488 | Ga0495673_0094919 | 3300047469 | Bacteria | 1214 |
| 489 | Ga0495681_0053485 | 3300047470 | Unclassified | 1890 |
| 490 | Ga0495681_0070392 | 3300047470 | Bacteria | 1586 |
| 491 | Ga0495686_0010674 | 3300047472 | Bacteria | 6521 |
| 492 | Ga0495593_0008065 | 3300047673 | Bacteria | 6126 |
| 493 | Ga0495593_0012169 | 3300047673 | Bacteria | 4922 |
| 494 | Ga0495602_0010482 | 3300048088 | Bacteria | 9618 |
| 495 | Ga0495602_0037297 | 3300048088 | Bacteria | 4514 |
| 496 | Ga0495614_0023276 | 3300048089 | Bacteria | 2672 |
| 497 | Ga0495615_0004228 | 3300048090 | Bacteria | 2487 |
| 498 | Ga0495615_0008289 | 3300048090 | Bacteria | 2004 |
| 499 | Ga0496100_0004204 | 3300048903 | Bacteria | 7599 |
| 500 | Ga0496100_0086394 | 3300048903 | Bacteria | 2130 |
| 501 | Ga0496100_0090947 | 3300048903 | Bacteria | 2082 |
| 502 | Ga0496100_0177591 | 3300048903 | Bacteria | 1538 |
| 503 | Ga0496100_0240445 | 3300048903 | Bacteria | 1336 |
| 504 | Ga0496100_0299408 | 3300048903 | Bacteria | 1203 |
| 505 | Ga0496101_0005882 | 3300048904 | Bacteria | 7853 |
| 506 | Ga0496101_0006354 | 3300048904 | Bacteria | 7607 |
| 507 | Ga0496101_0009272 | 3300048904 | Bacteria | 6462 |
| 508 | Ga0496101_0052607 | 3300048904 | Unclassified | 2937 |
| 509 | Ga0496101_0052797 | 3300048904 | Bacteria | 2931 |
| 510 | Ga0496101_0086148 | 3300048904 | Bacteria | 2329 |
| 511 | Ga0496101_0485336 | 3300048904 | Bacteria | 976 |
| 512 | Ga0496102_0001407 | 3300048905 | Bacteria | 21341 |
| 513 | Ga0496102_0001828 | 3300048905 | Bacteria | 18368 |
| 514 | Ga0496102_0028257 | 3300048905 | Bacteria | 5008 |
| 515 | Ga0496102_0382288 | 3300048905 | Bacteria | 1325 |
| 516 | Ga0496103_0001596 | 3300048906 | Bacteria | 14906 |
| 517 | Ga0496103_0002965 | 3300048906 | Bacteria | 10504 |
| 518 | Ga0496103_0160106 | 3300048906 | Bacteria | 1443 |
| 519 | Ga0496104_0007075 | 3300048907 | Bacteria | 9895 |
| 520 | Ga0496104_0008732 | 3300048907 | Bacteria | 9009 |
| 521 | Ga0496104_0024001 | 3300048907 | Bacteria | 5611 |
| 522 | Ga0496104_0027390 | 3300048907 | Bacteria | 5274 |
| 523 | Ga0496104_0083196 | 3300048907 | Bacteria | 3052 |
| 524 | Ga0496104_0192731 | 3300048907 | Bacteria | 1950 |
| 525 | Ga0496104_0538978 | 3300048907 | Bacteria | 1078 |
| 526 | Ga0496105_0007552 | 3300048908 | Bacteria | 8423 |
| 527 | Ga0496105_0034789 | 3300048908 | Bacteria | 4145 |
| 528 | Ga0496105_0345414 | 3300048908 | Bacteria | 1189 |
| 529 | Ga0496106_0002609 | 3300048909 | Bacteria | 13409 |
| 530 | Ga0496106_0015428 | 3300048909 | Bacteria | 5653 |
| 531 | Ga0496106_0090367 | 3300048909 | Unclassified | 2363 |
| 532 | Ga0496106_0090962 | 3300048909 | Bacteria | 2355 |
| 533 | Ga0496107_0007271 | 3300048910 | Bacteria | 7630 |
| 534 | Ga0496107_0012697 | 3300048910 | Bacteria | 5883 |
| 535 | Ga0496107_0253780 | 3300048910 | Bacteria | 1309 |
| 536 | Ga0496108_0005177 | 3300048911 | Bacteria | 10539 |
| 537 | Ga0496108_0017491 | 3300048911 | Bacteria | 5865 |
| 538 | Ga0496108_0156825 | 3300048911 | Bacteria | 1966 |
| 539 | Ga0496108_0188313 | 3300048911 | Bacteria | 1788 |
| 540 | Ga0496108_0279274 | 3300048911 | Bacteria | 1454 |
| 541 | Ga0496109_0004744 | 3300048912 | Bacteria | 11365 |
| 542 | Ga0496109_0020861 | 3300048912 | Bacteria | 5790 |
| 543 | Ga0496109_0043149 | 3300048912 | Bacteria | 4087 |
| 544 | Ga0496109_0142043 | 3300048912 | Bacteria | 2245 |
| 545 | Ga0496109_0264301 | 3300048912 | Bacteria | 1621 |
| 546 | Ga0496110_0003933 | 3300048913 | Bacteria | 11435 |
| 547 | Ga0496110_0005380 | 3300048913 | Bacteria | 10031 |
| 548 | Ga0496110_0023431 | 3300048913 | Bacteria | 5250 |
| 549 | Ga0496110_0047636 | 3300048913 | Bacteria | 3755 |
| 550 | Ga0496110_0128177 | 3300048913 | Bacteria | 2290 |
| 551 | Ga0496111_0001486 | 3300048914 | Bacteria | 13422 |
| 552 | Ga0496111_0007587 | 3300048914 | Bacteria | 7122 |
| 553 | Ga0496111_0040537 | 3300048914 | Bacteria | 3340 |
| 554 | Ga0496111_0058819 | 3300048914 | Bacteria | 2783 |
| 555 | Ga0496111_0273092 | 3300048914 | Bacteria | 1254 |
| 556 | Ga0496111_0280583 | 3300048914 | Bacteria | 1235 |
| 557 | Ga0496111_0566555 | 3300048914 | Bacteria | 833 |
| 558 | Ga0496112_0000459 | 3300048915 | Bacteria | 27229 |
| 559 | Ga0496112_0008231 | 3300048915 | Bacteria | 9328 |
| 560 | Ga0496112_0031616 | 3300048915 | Bacteria | 5135 |
| 561 | Ga0496112_0194530 | 3300048915 | Bacteria | 1989 |
| 562 | Ga0496112_0196071 | 3300048915 | Bacteria | 1980 |
| 563 | Ga0496113_0020447 | 3300048916 | Bacteria | 4653 |
| 564 | Ga0496113_0037400 | 3300048916 | Bacteria | 3561 |
| 565 | Ga0496113_0039227 | 3300048916 | Bacteria | 3485 |
| 566 | Ga0496113_0118140 | 3300048916 | Bacteria | 2071 |
| 567 | Ga0496114_0001872 | 3300048917 | Bacteria | 15942 |
| 568 | Ga0496114_0004482 | 3300048917 | Bacteria | 10835 |
| 569 | Ga0496114_0013007 | 3300048917 | Bacteria | 6669 |
| 570 | Ga0496114_0138680 | 3300048917 | Bacteria | 2104 |
| 571 | Ga0496114_0659081 | 3300048917 | Bacteria | 920 |
| 572 | Ga0496115_0004848 | 3300048918 | Bacteria | 9766 |
| 573 | Ga0496115_0012765 | 3300048918 | Bacteria | 6332 |
| 574 | Ga0496115_0020164 | 3300048918 | Bacteria | 5139 |
| 575 | Ga0496115_0027587 | 3300048918 | Bacteria | 4444 |
| 576 | Ga0496115_0036694 | 3300048918 | Bacteria | 3882 |
| 577 | Ga0496115_0068376 | 3300048918 | Bacteria | 2876 |
| 578 | Ga0496115_0116432 | 3300048918 | Bacteria | 2198 |
| 579 | Ga0496115_0138130 | 3300048918 | Bacteria | 2010 |
| 580 | Ga0496115_0206412 | 3300048918 | Unclassified | 1623 |
| 581 | Ga0496116_0004003 | 3300048919 | Bacteria | 14290 |
| 582 | Ga0496116_0007550 | 3300048919 | Bacteria | 9618 |
| 583 | Ga0496116_0084818 | 3300048919 | Bacteria | 1949 |
| 584 | Ga0496116_0114778 | 3300048919 | Bacteria | 1572 |
| 585 | Ga0496116_0166773 | 3300048919 | Bacteria | 1199 |
| 586 | Ga0496117_0001973 | 3300048920 | Bacteria | 27282 |
| 587 | Ga0496117_0015773 | 3300048920 | Bacteria | 6414 |
| 588 | Ga0496117_0015792 | 3300048920 | Bacteria | 6408 |
| 589 | Ga0496117_0069516 | 3300048920 | Bacteria | 2370 |
| 590 | Ga0496117_0219754 | 3300048920 | Bacteria | 1058 |
| 591 | Ga0496118_0018268 | 3300048921 | Bacteria | 6333 |
| 592 | Ga0496118_0101312 | 3300048921 | Bacteria | 1945 |
| 593 | Ga0496119_0013085 | 3300048922 | Bacteria | 6652 |
| 594 | Ga0496119_0015962 | 3300048922 | Bacteria | 5745 |
| 595 | Ga0496119_0082915 | 3300048922 | Bacteria | 1843 |
| 596 | Ga0496120_0032598 | 3300048923 | Bacteria | 3139 |
| 597 | Ga0496120_0244574 | 3300048923 | Bacteria | 845 |
| 598 | Ga0496121_0000138 | 3300048924 | Bacteria | 163543 |
| 599 | Ga0496121_0002067 | 3300048924 | Bacteria | 31783 |
| 600 | Ga0496121_0008456 | 3300048924 | Bacteria | 12088 |
| 601 | Ga0496121_0028634 | 3300048924 | Bacteria | 5180 |
| 602 | Ga0496121_0251918 | 3300048924 | Bacteria | 1224 |
| 603 | Ga0496122_0023201 | 3300048925 | Bacteria | 5481 |
| 604 | Ga0496122_0041332 | 3300048925 | Bacteria | 3647 |
| 605 | Ga0496122_0048180 | 3300048925 | Bacteria | 3280 |
| 606 | Ga0496122_0109679 | 3300048925 | Bacteria | 1816 |
| 607 | Ga0496123_0000026 | 3300048926 | Bacteria | 318040 |
| 608 | Ga0496123_0030007 | 3300048926 | Bacteria | 3989 |
| 609 | Ga0496124_0000275 | 3300048927 | Bacteria | 98848 |
| 610 | Ga0496124_0008181 | 3300048927 | Bacteria | 10972 |
| 611 | Ga0496124_0088183 | 3300048927 | Bacteria | 2536 |
| 612 | Ga0496124_0235532 | 3300048927 | Bacteria | 1365 |
| 613 | Ga0496125_0002495 | 3300048928 | Bacteria | 23806 |
| 614 | Ga0496125_0030654 | 3300048928 | Bacteria | 4807 |
| 615 | Ga0496125_0033095 | 3300048928 | Bacteria | 4581 |
| 616 | Ga0496125_0375145 | 3300048928 | Bacteria | 840 |
| 617 | Ga0496126_0008630 | 3300048929 | Bacteria | 10955 |
| 618 | Ga0496126_0036981 | 3300048929 | Bacteria | 4560 |
| 619 | Ga0496126_0053207 | 3300048929 | Bacteria | 3674 |
| 620 | Ga0496126_0209145 | 3300048929 | Bacteria | 1643 |
| 621 | Ga0496126_0308104 | 3300048929 | Bacteria | 1304 |
| 622 | Ga0496126_0385083 | 3300048929 | Bacteria | 1140 |
| 623 | Ga0501031_0141590 | 3300049568 | Bacteria | 1572 |
| 624 | Ga0501032_0084407 | 3300049569 | Bacteria | 2111 |
| 625 | Ga0501033_0073113 | 3300049570 | Bacteria | 2517 |
| 626 | Ga0501033_0087993 | 3300049570 | Bacteria | 2273 |
| 627 | Ga0501037_0046199 | 3300049573 | Bacteria | 3194 |
| 628 | Ga0501038_0498280 | 3300049574 | Bacteria | 932 |
| 629 | Ga0501043_0309752 | 3300049579 | Bacteria | 1205 |
| 630 | Ga0501047_0009465 | 3300049581 | Bacteria | 9206 |
| 631 | Ga0501047_0010950 | 3300049581 | Bacteria | 8580 |
| 632 | Ga0501068_0069978 | 3300049584 | Bacteria | 2140 |
| 633 | Ga0501072_0000592 | 3300049588 | Bacteria | 26142 |
| 634 | Ga0501073_0091908 | 3300049589 | Bacteria | 2109 |
| 635 | Ga0501073_0391962 | 3300049589 | Bacteria | 960 |
| 636 | Ga0501080_0041605 | 3300049742 | Bacteria | 4281 |
| 637 | Ga0501035_0006019 | 3300049822 | Bacteria | 11419 |
| 638 | Ga0501035_0075657 | 3300049822 | Bacteria | 2978 |
| 639 | Ga0501035_0424889 | 3300049822 | Bacteria | 1103 |
| 640 | Ga0501044_0133423 | 3300049823 | Bacteria | 2476 |
| 641 | Ga0501044_0233583 | 3300049823 | Bacteria | 1785 |
| 642 | nmdc:mga03683_25601_c1 | 3300050489 | Bacteria | 2320 |
| 643 | nmdc:mga03683_42659_c1 | 3300050489 | Bacteria | 1868 |
| 644 | nmdc:mga03683_70199_c1 | 3300050489 | Bacteria | 1496 |
| 645 | nmdc:mga03n38_1035_c1 | 3300050490 | Bacteria | 7648 |
| 646 | nmdc:mga03n38_70425_c1 | 3300050490 | Bacteria | 1617 |
| 647 | nmdc:mga00v17_11226_c1 | 3300050491 | Bacteria | 4920 |
| 648 | nmdc:mga00v17_38025_c1 | 3300050491 | Bacteria | 2876 |
| 649 | nmdc:mga00v17_61858_c1 | 3300050491 | Bacteria | 2302 |
| 650 | nmdc:mga0yw44_43068_c1 | 3300050492 | Bacteria | 2694 |
| 651 | nmdc:mga0yw44_50077_c1 | 3300050492 | Bacteria | 2524 |
| 652 | nmdc:mga0k408_162233_c1 | 3300050493 | Bacteria | 1332 |
| 653 | nmdc:mga0k408_232534_c1 | 3300050493 | Bacteria | 1100 |
| 654 | nmdc:mga0k408_26355_c1 | 3300050493 | Bacteria | 3295 |
| 655 | nmdc:mga0k408_6326_c1 | 3300050493 | Bacteria | 6319 |
| 656 | nmdc:mga0k408_66969_c1 | 3300050493 | Bacteria | 2092 |
| 657 | nmdc:mga0k408_78248_c1 | 3300050493 | Bacteria | 1934 |
| 658 | nmdc:mga06z11_164362_c1 | 3300050494 | Bacteria | 1271 |
| 659 | nmdc:mga06z11_394488_c1 | 3300050494 | Bacteria | 832 |
| 660 | nmdc:mga04h51_13907_c1 | 3300050495 | Bacteria | 2289 |
| 661 | nmdc:mga07m45_17396_c1 | 3300050496 | Bacteria | 3861 |
| 662 | nmdc:mga07m45_17758_c1 | 3300050496 | Bacteria | 3827 |
| 663 | nmdc:mga07m45_3577_c2 | 3300050496 | Bacteria | 3610 |
| 664 | nmdc:mga05p37_428123_c1 | 3300050507 | Bacteria | 1538 |
| 665 | nmdc:mga0n895_293160_c1 | 3300050512 | Bacteria | 1649 |
| 666 | nmdc:mga0rr50_159666_c1 | 3300050513 | Bacteria | 1829 |
| 667 | nmdc:mga0rr50_60515_c1 | 3300050513 | Unclassified | 2849 |
| 668 | Ga0495601_0021963 | 3300053077 | Bacteria | 3914 |
| 669 | Ga0495601_0035186 | 3300053077 | Bacteria | 3125 |
| 670 | Ga0495612_0064082 | 3300053078 | Bacteria | 1525 |
| 671 | Ga0495655_0005721 | 3300053083 | Bacteria | 2214 |
| 672 | Ga0495595_0086195 | 3300053084 | Bacteria | 1502 |
| 673 | Ga0495619_0144570 | 3300053085 | Bacteria | 1639 |
| 674 | Ga0500643_001421 | 3300053087 | Bacteria | 13818 |
| 675 | Ga0500644_0000877 | 3300053088 | Bacteria | 9814 |
| 676 | Ga0500644_0006259 | 3300053088 | Bacteria | 3040 |
| 677 | Ga0500583_0071192 | 3300053092 | Bacteria | 1663 |
| 678 | Ga0500651_0001657 | 3300053093 | Bacteria | 11350 |
| 679 | Ga0500651_0013136 | 3300053093 | Bacteria | 5036 |
| 680 | Ga0500651_0131202 | 3300053093 | Bacteria | 1515 |
| 681 | Ga0500651_0169046 | 3300053093 | Bacteria | 1304 |
| 682 | Ga0500566_0001628 | 3300053094 | Bacteria | 13224 |
| 683 | Ga0500566_0046686 | 3300053094 | Bacteria | 2488 |
| 684 | Ga0500641_0002932 | 3300053096 | Bacteria | 6048 |
| 685 | Ga0500641_0069567 | 3300053096 | Bacteria | 1479 |
| 686 | Ga0500650_0103442 | 3300053098 | Bacteria | 1332 |
| 687 | Ga0500654_109014 | 3300053099 | Bacteria | 1143 |
| 688 | Ga0500556_0000016 | 3300053104 | Bacteria | 194958 |
| 689 | Ga0500569_044264 | 3300053109 | Bacteria | 1317 |
| 690 | Ga0500592_001649 | 3300053116 | Bacteria | 3621 |
| 691 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 692 | Ga0500595_030115 | 3300053119 | Bacteria | 1833 |
| 693 | Ga0500608_000620 | 3300053122 | Bacteria | 13061 |
| 694 | Ga0500618_001279 | 3300053125 | Bacteria | 11621 |
| 695 | Ga0500618_011771 | 3300053125 | Bacteria | 2310 |
| 696 | Ga0500618_033542 | 3300053125 | Bacteria | 1197 |
| 697 | Ga0500626_000564 | 3300053128 | Bacteria | 9552 |
| 698 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 699 | Ga0500652_000306 | 3300053131 | Bacteria | 17755 |
| 700 | Ga0500652_046904 | 3300053131 | Bacteria | 1754 |
| 701 | Ga0500655_002708 | 3300053133 | Bacteria | 3211 |
| 702 | Ga0500658_0110056 | 3300053134 | Bacteria | 1212 |
| 703 | Ga0500559_0000572 | 3300053136 | Bacteria | 25257 |
| 704 | Ga0500559_0014992 | 3300053136 | Bacteria | 3276 |
| 705 | Ga0500568_0004897 | 3300053139 | Bacteria | 7051 |
| 706 | Ga0500588_0006795 | 3300053146 | Bacteria | 2613 |
| 707 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 708 | Ga0500616_0000169 | 3300053153 | Bacteria | 109205 |
| 709 | Ga0500616_0012053 | 3300053153 | Bacteria | 5073 |
| 710 | Ga0500616_0034423 | 3300053153 | Bacteria | 2759 |
| 711 | Ga0500616_0037001 | 3300053153 | Bacteria | 2645 |
| 712 | Ga0500616_0172058 | 3300053153 | Bacteria | 983 |
| 713 | Ga0500622_0011273 | 3300053156 | Bacteria | 4877 |
| 714 | Ga0500622_0038075 | 3300053156 | Bacteria | 2510 |
| 715 | Ga0500624_000121 | 3300053157 | Bacteria | 35470 |
| 716 | Ga0500636_0006403 | 3300053177 | Bacteria | 6757 |
| 717 | Ga0500570_000246 | 3300053724 | Bacteria | 18169 |
| 718 | Ga0500645_000226 | 3300053730 | Bacteria | 42982 |
| 719 | Ga0501084_0240942 | 3300054114 | Bacteria | 1527 |
| 720 | Ga0501082_0000074 | 3300060353 | Bacteria | 73246 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0659081 | Ga0496114_0659081_257_901 | 212 |
| 2 | 3300050494 | nmdc:mga06z11_394488_c1 | nmdc:mga06z11_394488_c1_26_769 | 212 |
| 3 | 3300006058 | Ga0075432_10002409 | Ga0075432_100024092 | 217 |
| 4 | 3300006353 | Ga0075370_10267008 | Ga0075370_102670082 | 217 |
| 5 | 3300046542 | Ga0495597_0000309 | Ga0495597_0000309_13142_13924 | 217 |
| 6 | 3300046642 | Ga0495634_0152402 | Ga0495634_0152402_37_699 | 220 |
| 7 | 3300006948 | Ga0099826_10000084 | Ga0099826_1000008440 | 226 |
| 8 | 3300027666 | Ga0209282_1000112 | Ga0209282_100011240 | 226 |
| 9 | 3300042439 | Ga0439464_0005219 | Ga0439464_0005219_404_1153 | 226 |
| 10 | 3300048924 | Ga0496121_0251918 | Ga0496121_0251918_20_784 | 226 |
| 11 | 3300049568 | Ga0501031_0141590 | Ga0501031_0141590_655_1419 | 226 |
| 12 | 3300049569 | Ga0501032_0084407 | Ga0501032_0084407_1041_1805 | 226 |
| 13 | 3300049570 | Ga0501033_0087993 | Ga0501033_0087993_665_1429 | 226 |
| 14 | 3300049573 | Ga0501037_0046199 | Ga0501037_0046199_2387_3151 | 226 |
| 15 | 3300049579 | Ga0501043_0309752 | Ga0501043_0309752_159_923 | 226 |
| 16 | 3300049584 | Ga0501068_0069978 | Ga0501068_0069978_378_1142 | 226 |
| 17 | 3300049589 | Ga0501073_0091908 | Ga0501073_0091908_502_1266 | 226 |
| 18 | 3300049742 | Ga0501080_0041605 | Ga0501080_0041605_425_1189 | 226 |
| 19 | 3300049822 | Ga0501035_0075657 | Ga0501035_0075657_409_1173 | 226 |
| 20 | 3300049822 | Ga0501035_0424889 | Ga0501035_0424889_274_1038 | 226 |
| 21 | 3300049823 | Ga0501044_0233583 | Ga0501044_0233583_40_804 | 226 |
| 22 | 3300054114 | Ga0501084_0240942 | Ga0501084_0240942_715_1479 | 226 |
| 23 | 3300003773 | Ga0055537_1000433 | Ga0055537_10004332 | 227 |
| 24 | 3300003784 | Ga0055534_1000008 | Ga0055534_100000850 | 227 |
| 25 | 3300003790 | Ga0055528_1013847 | Ga0055528_10138472 | 227 |
| 26 | 3300006353 | Ga0075370_10093644 | Ga0075370_100936442 | 227 |
| 27 | 3300025263 | Ga0209565_1000042 | Ga0209565_100004250 | 227 |
| 28 | 3300025273 | Ga0209673_1000071 | Ga0209673_1000071177 | 227 |
| 29 | 3300025291 | Ga0209675_1000041 | Ga0209675_1000041176 | 227 |
| 30 | 3300006048 | Ga0075363_100010879 | Ga0075363_1000108792 | 229 |
| 31 | 3300006177 | Ga0075362_10080626 | Ga0075362_100806262 | 229 |
| 32 | 3300050489 | nmdc:mga03683_70199_c1 | nmdc:mga03683_70199_c1_596_1375 | 229 |
| 33 | 3300050490 | nmdc:mga03n38_70425_c1 | nmdc:mga03n38_70425_c1_599_1378 | 229 |
| 34 | 3300046475 | Ga0495639_0020000 | Ga0495639_0020000_1803_2582 | 232 |
| 35 | 3300046674 | Ga0495588_0007606 | Ga0495588_0007606_120_899 | 232 |
| 36 | 3300010375 | Ga0105239_10700842 | Ga0105239_107008422 | 234 |
| 37 | 3300046536 | Ga0495587_0203792 | Ga0495587_0203792_114_887 | 234 |
| 38 | 3300048088 | Ga0495602_0037297 | Ga0495602_0037297_3386_4159 | 234 |
| 39 | 3300007076 | Ga0075435_100346416 | Ga0075435_1003464161 | 236 |
| 40 | 3300009176 | Ga0105242_10389274 | Ga0105242_103892741 | 236 |
| 41 | 3300021358 | Ga0213873_10010169 | Ga0213873_100101691 | 236 |
| 42 | 3300025934 | Ga0207686_10218835 | Ga0207686_102188352 | 236 |
| 43 | 3300039447 | Ga0436361_0860319 | Ga0436361_0860319_299_1072 | 236 |
| 44 | 3300039453 | Ga0436362_0561730 | Ga0436362_0561730_8409_9170 | 236 |
| 45 | 3300046506 | Ga0495583_0114204 | Ga0495583_0114204_332_1123 | 236 |
| 46 | 3300046522 | Ga0495643_0050853 | Ga0495643_0050853_482_1273 | 236 |
| 47 | 3300050513 | nmdc:mga0rr50_159666_c1 | nmdc:mga0rr50_159666_c1_129_893 | 236 |
| 48 | 3300053133 | Ga0500655_002708 | Ga0500655_002708_712_1503 | 236 |
| 49 | 3300046492 | Ga0495585_0267785 | Ga0495585_0267785_23_787 | 237 |
| 50 | 3300046522 | Ga0495643_0000049 | Ga0495643_0000049_87422_88213 | 237 |
| 51 | 3300046542 | Ga0495597_0022383 | Ga0495597_0022383_40_834 | 238 |
| 52 | 3300046616 | Ga0495668_0026053 | Ga0495668_0026053_2042_2836 | 238 |
| 53 | 3300048928 | Ga0496125_0375145 | Ga0496125_0375145_11_775 | 238 |
| 54 | 3300053093 | Ga0500651_0169046 | Ga0500651_0169046_451_1245 | 238 |
| 55 | 3300053156 | Ga0500622_0038075 | Ga0500622_0038075_1433_2227 | 238 |
| 56 | 3300037471 | Ga0395905_0413906 | Ga0395905_0413906_231_1010 | 240 |
| 57 | 3300035398 | Ga0316574_0002702 | Ga0316574_0002702_7681_8448 | 242 |
| 58 | iso_pu_bacteria | 2501025502 | 2501084493 | 242 |
| 59 | iso_pu_bacteria | 2585427594 | 2585846378 | 243 |
| 60 | iso_pu_bacteria | 2643221547 | 2643757025 | 243 |
| 61 | iso_pu_bacteria | 2738541293 | 2738801855 | 243 |
| 62 | iso_pu_bacteria | 2857524615 | 2857527596 | 243 |
| 63 | iso_pu_bacteria | 2893066018 | 2893067087 | 243 |
| 64 | iso_pu_bacteria | 2919073203 | 2919073448 | 243 |
| 65 | iso_pu_bacteria | 2929138655 | 2929143618 | 243 |
| 66 | iso_pu_bacteria | 2945984333 | 2945989066 | 243 |
| 67 | iso_pu_bacteria | 8054563764 | 8054565113 | 243 |
| 68 | 3300005536 | Ga0070697_100095538 | Ga0070697_1000955382 | 244 |
| 69 | 3300005985 | Ga0081539_10000005 | Ga0081539_100000054 | 244 |
| 70 | 3300005985 | Ga0081539_10001849 | Ga0081539_1000184912 | 244 |
| 71 | 3300046809 | Ga0495600_0281817 | Ga0495600_0281817_232_966 | 244 |
| 72 | 3300047470 | Ga0495681_0070392 | Ga0495681_0070392_218_1009 | 244 |
| 73 | 3300053125 | Ga0500618_033542 | Ga0500618_033542_326_1117 | 244 |
| 74 | 3300002075 | JGI24738J21930_10006769 | JGI24738J21930_100067693 | 245 |
| 75 | 3300002076 | JGI24749J21850_1002524 | JGI24749J21850_10025242 | 245 |
| 76 | 3300002077 | JGI24744J21845_10005881 | JGI24744J21845_100058812 | 245 |
| 77 | 3300002239 | JGI24034J26672_10017301 | JGI24034J26672_100173012 | 245 |
| 78 | 3300002244 | JGI24742J22300_10003421 | JGI24742J22300_100034213 | 245 |
| 79 | 3300002244 | JGI24742J22300_10011386 | JGI24742J22300_100113862 | 245 |
| 80 | 3300002459 | JGI24751J29686_10005482 | JGI24751J29686_100054822 | 245 |
| 81 | 3300002773 | JGI25152J39213_1000001 | JGI25152J39213_100000153 | 245 |
| 82 | 3300002773 | JGI25152J39213_1000015 | JGI25152J39213_100001555 | 245 |
| 83 | 3300002774 | JGI25150J39212_1000007 | JGI25150J39212_1000007179 | 245 |
| 84 | 3300003187 | JGI25151J46595_10000013 | JGI25151J46595_10000013180 | 245 |
| 85 | 3300003215 | JGI25153J46596_10002037 | JGI25153J46596_100020378 | 245 |
| 86 | 3300003792 | Ga0055540_1000018 | Ga0055540_100001831 | 245 |
| 87 | 3300003794 | Ga0055531_10004239 | Ga0055531_100042393 | 245 |
| 88 | 3300005327 | Ga0070658_10003751 | Ga0070658_100037515 | 245 |
| 89 | 3300005330 | Ga0070690_100055440 | Ga0070690_1000554402 | 245 |
| 90 | 3300005334 | Ga0068869_100045545 | Ga0068869_1000455452 | 245 |
| 91 | 3300005334 | Ga0068869_100064815 | Ga0068869_1000648153 | 245 |
| 92 | 3300005335 | Ga0070666_10062810 | Ga0070666_100628102 | 245 |
| 93 | 3300005336 | Ga0070680_100007422 | Ga0070680_10000742211 | 245 |
| 94 | 3300005337 | Ga0070682_100116916 | Ga0070682_1001169162 | 245 |
| 95 | 3300005338 | Ga0068868_100005272 | Ga0068868_1000052722 | 245 |
| 96 | 3300005339 | Ga0070660_100004612 | Ga0070660_10000461212 | 245 |
| 97 | 3300005339 | Ga0070660_100107697 | Ga0070660_1001076972 | 245 |
| 98 | 3300005340 | Ga0070689_100019842 | Ga0070689_1000198422 | 245 |
| 99 | 3300005343 | Ga0070687_100001103 | Ga0070687_1000011037 | 245 |
| 100 | 3300005344 | Ga0070661_100039806 | Ga0070661_1000398063 | 245 |
| 101 | 3300005347 | Ga0070668_100196752 | Ga0070668_1001967521 | 245 |
| 102 | 3300005347 | Ga0070668_100231029 | Ga0070668_1002310292 | 245 |
| 103 | 3300005354 | Ga0070675_100004007 | Ga0070675_10000400710 | 245 |
| 104 | 3300005355 | Ga0070671_100004079 | Ga0070671_1000040799 | 245 |
| 105 | 3300005356 | Ga0070674_100024775 | Ga0070674_1000247755 | 245 |
| 106 | 3300005356 | Ga0070674_100099314 | Ga0070674_1000993142 | 245 |
| 107 | 3300005356 | Ga0070674_100106429 | Ga0070674_1001064291 | 245 |
| 108 | 3300005364 | Ga0070673_100109682 | Ga0070673_1001096822 | 245 |
| 109 | 3300005364 | Ga0070673_100479430 | Ga0070673_1004794302 | 245 |
| 110 | 3300005365 | Ga0070688_100002255 | Ga0070688_1000022555 | 245 |
| 111 | 3300005365 | Ga0070688_100192854 | Ga0070688_1001928541 | 245 |
| 112 | 3300005366 | Ga0070659_100020337 | Ga0070659_1000203372 | 245 |
| 113 | 3300005435 | Ga0070714_100039155 | Ga0070714_1000391554 | 245 |
| 114 | 3300005436 | Ga0070713_100001455 | Ga0070713_1000014553 | 245 |
| 115 | 3300005437 | Ga0070710_10070364 | Ga0070710_100703642 | 245 |
| 116 | 3300005438 | Ga0070701_10032161 | Ga0070701_100321612 | 245 |
| 117 | 3300005439 | Ga0070711_100098859 | Ga0070711_1000988592 | 245 |
| 118 | 3300005439 | Ga0070711_100377073 | Ga0070711_1003770732 | 245 |
| 119 | 3300005441 | Ga0070700_100072290 | Ga0070700_1000722901 | 245 |
| 120 | 3300005455 | Ga0070663_100009178 | Ga0070663_1000091782 | 245 |
| 121 | 3300005455 | Ga0070663_100096281 | Ga0070663_1000962812 | 245 |
| 122 | 3300005456 | Ga0070678_100142035 | Ga0070678_1001420352 | 245 |
| 123 | 3300005456 | Ga0070678_100147819 | Ga0070678_1001478192 | 245 |
| 124 | 3300005458 | Ga0070681_10006029 | Ga0070681_100060296 | 245 |
| 125 | 3300005459 | Ga0068867_100005726 | Ga0068867_1000057264 | 245 |
| 126 | 3300005466 | Ga0070685_10033440 | Ga0070685_100334402 | 245 |
| 127 | 3300005471 | Ga0070698_100030943 | Ga0070698_1000309435 | 245 |
| 128 | 3300005530 | Ga0070679_100021886 | Ga0070679_1000218863 | 245 |
| 129 | 3300005535 | Ga0070684_100085176 | Ga0070684_1000851762 | 245 |
| 130 | 3300005535 | Ga0070684_100228752 | Ga0070684_1002287522 | 245 |
| 131 | 3300005539 | Ga0068853_100055980 | Ga0068853_1000559801 | 245 |
| 132 | 3300005543 | Ga0070672_100008089 | Ga0070672_1000080896 | 245 |
| 133 | 3300005544 | Ga0070686_100008982 | Ga0070686_1000089824 | 245 |
| 134 | 3300005544 | Ga0070686_100043101 | Ga0070686_1000431013 | 245 |
| 135 | 3300005548 | Ga0070665_100025185 | Ga0070665_1000251852 | 245 |
| 136 | 3300005549 | Ga0070704_100049207 | Ga0070704_1000492072 | 245 |
| 137 | 3300005578 | Ga0068854_100048092 | Ga0068854_1000480922 | 245 |
| 138 | 3300005614 | Ga0068856_100032200 | Ga0068856_1000322002 | 245 |
| 139 | 3300005615 | Ga0070702_100010148 | Ga0070702_1000101482 | 245 |
| 140 | 3300005616 | Ga0068852_100001350 | Ga0068852_1000013507 | 245 |
| 141 | 3300005616 | Ga0068852_100082935 | Ga0068852_1000829352 | 245 |
| 142 | 3300005617 | Ga0068859_100020374 | Ga0068859_1000203742 | 245 |
| 143 | 3300005617 | Ga0068859_100407039 | Ga0068859_1004070392 | 245 |
| 144 | 3300005618 | Ga0068864_100055816 | Ga0068864_1000558162 | 245 |
| 145 | 3300005718 | Ga0068866_10058069 | Ga0068866_100580692 | 245 |
| 146 | 3300005718 | Ga0068866_10118663 | Ga0068866_101186632 | 245 |
| 147 | 3300005718 | Ga0068866_10228942 | Ga0068866_102289422 | 245 |
| 148 | 3300005719 | Ga0068861_100011128 | Ga0068861_1000111286 | 245 |
| 149 | 3300005719 | Ga0068861_100033879 | Ga0068861_1000338794 | 245 |
| 150 | 3300005834 | Ga0068851_10044179 | Ga0068851_100441792 | 245 |
| 151 | 3300005840 | Ga0068870_10038045 | Ga0068870_100380452 | 245 |
| 152 | 3300005840 | Ga0068870_10129202 | Ga0068870_101292022 | 245 |
| 153 | 3300005841 | Ga0068863_100088933 | Ga0068863_1000889332 | 245 |
| 154 | 3300005841 | Ga0068863_100175787 | Ga0068863_1001757872 | 245 |
| 155 | 3300005842 | Ga0068858_100056204 | Ga0068858_1000562043 | 245 |
| 156 | 3300005843 | Ga0068860_100012400 | Ga0068860_1000124007 | 245 |
| 157 | 3300005844 | Ga0068862_100030588 | Ga0068862_1000305882 | 245 |
| 158 | 3300005937 | Ga0081455_10144844 | Ga0081455_101448442 | 245 |
| 159 | 3300006038 | Ga0075365_10077143 | Ga0075365_100771432 | 245 |
| 160 | 3300006042 | Ga0075368_10027110 | Ga0075368_100271102 | 245 |
| 161 | 3300006051 | Ga0075364_10006501 | Ga0075364_100065014 | 245 |
| 162 | 3300006051 | Ga0075364_10040876 | Ga0075364_100408762 | 245 |
| 163 | 3300006051 | Ga0075364_10052732 | Ga0075364_100527323 | 245 |
| 164 | 3300006051 | Ga0075364_10060820 | Ga0075364_100608202 | 245 |
| 165 | 3300006163 | Ga0070715_10020144 | Ga0070715_100201442 | 245 |
| 166 | 3300006175 | Ga0070712_100003300 | Ga0070712_1000033008 | 245 |
| 167 | 3300006175 | Ga0070712_100111934 | Ga0070712_1001119342 | 245 |
| 168 | 3300006177 | Ga0075362_10027152 | Ga0075362_100271523 | 245 |
| 169 | 3300006178 | Ga0075367_10022076 | Ga0075367_100220763 | 245 |
| 170 | 3300006195 | Ga0075366_10003953 | Ga0075366_100039537 | 245 |
| 171 | 3300006195 | Ga0075366_10019800 | Ga0075366_100198002 | 245 |
| 172 | 3300006195 | Ga0075366_10120133 | Ga0075366_101201332 | 245 |
| 173 | 3300006195 | Ga0075366_10243803 | Ga0075366_102438031 | 245 |
| 174 | 3300006237 | Ga0097621_100097163 | Ga0097621_1000971632 | 245 |
| 175 | 3300006237 | Ga0097621_100362997 | Ga0097621_1003629972 | 245 |
| 176 | 3300006353 | Ga0075370_10005797 | Ga0075370_100057974 | 245 |
| 177 | 3300006353 | Ga0075370_10101089 | Ga0075370_101010892 | 245 |
| 178 | 3300006871 | Ga0075434_100075006 | Ga0075434_1000750062 | 245 |
| 179 | 3300006871 | Ga0075434_100333787 | Ga0075434_1003337872 | 245 |
| 180 | 3300006881 | Ga0068865_100048251 | Ga0068865_1000482512 | 245 |
| 181 | 3300006931 | Ga0097620_100020374 | Ga0097620_1000203742 | 245 |
| 182 | 3300006931 | Ga0097620_100407040 | Ga0097620_1004070402 | 245 |
| 183 | 3300006946 | Ga0079104_1000012 | Ga0079104_1000012184 | 245 |
| 184 | 3300007076 | Ga0075435_100045614 | Ga0075435_1000456141 | 245 |
| 185 | 3300007265 | Ga0099794_10011800 | Ga0099794_100118003 | 245 |
| 186 | 3300009094 | Ga0111539_10034206 | Ga0111539_100342063 | 245 |
| 187 | 3300009094 | Ga0111539_10611349 | Ga0111539_106113492 | 245 |
| 188 | 3300009098 | Ga0105245_10101615 | Ga0105245_101016152 | 245 |
| 189 | 3300009101 | Ga0105247_10075504 | Ga0105247_100755042 | 245 |
| 190 | 3300009101 | Ga0105247_10281558 | Ga0105247_102815582 | 245 |
| 191 | 3300009147 | Ga0114129_10084545 | Ga0114129_100845453 | 245 |
| 192 | 3300009148 | Ga0105243_10060724 | Ga0105243_100607242 | 245 |
| 193 | 3300009174 | Ga0105241_10036488 | Ga0105241_100364883 | 245 |
| 194 | 3300009174 | Ga0105241_10134289 | Ga0105241_101342892 | 245 |
| 195 | 3300009176 | Ga0105242_10123956 | Ga0105242_101239562 | 245 |
| 196 | 3300009177 | Ga0105248_10013912 | Ga0105248_100139127 | 245 |
| 197 | 3300009545 | Ga0105237_10175901 | Ga0105237_101759012 | 245 |
| 198 | 3300009551 | Ga0105238_10043402 | Ga0105238_100434022 | 245 |
| 199 | 3300010159 | Ga0099796_10013326 | Ga0099796_100133262 | 245 |
| 200 | 3300010375 | Ga0105239_10116550 | Ga0105239_101165502 | 245 |
| 201 | 3300011119 | Ga0105246_10023668 | Ga0105246_100236683 | 245 |
| 202 | 3300011119 | Ga0105246_10035476 | Ga0105246_100354762 | 245 |
| 203 | 3300013102 | Ga0157371_10156314 | Ga0157371_101563142 | 245 |
| 204 | 3300013105 | Ga0157369_10251152 | Ga0157369_102511522 | 245 |
| 205 | 3300013296 | Ga0157374_10095883 | Ga0157374_100958832 | 245 |
| 206 | 3300013297 | Ga0157378_10024483 | Ga0157378_100244834 | 245 |
| 207 | 3300013306 | Ga0163162_10156077 | Ga0163162_101560772 | 245 |
| 208 | 3300013307 | Ga0157372_10129414 | Ga0157372_101294142 | 245 |
| 209 | 3300013307 | Ga0157372_11039147 | Ga0157372_110391471 | 245 |
| 210 | 3300014325 | Ga0163163_10075159 | Ga0163163_100751592 | 245 |
| 211 | 3300014326 | Ga0157380_10050050 | Ga0157380_100500503 | 245 |
| 212 | 3300014745 | Ga0157377_10028829 | Ga0157377_100288292 | 245 |
| 213 | 3300014745 | Ga0157377_10090256 | Ga0157377_100902562 | 245 |
| 214 | 3300014968 | Ga0157379_10014125 | Ga0157379_100141251 | 245 |
| 215 | 3300014969 | Ga0157376_10041793 | Ga0157376_100417934 | 245 |
| 216 | 3300014969 | Ga0157376_10147363 | Ga0157376_101473632 | 245 |
| 217 | 3300014969 | Ga0157376_11004333 | Ga0157376_110043331 | 245 |
| 218 | 3300021384 | Ga0213876_10199574 | Ga0213876_101995742 | 245 |
| 219 | 3300021388 | Ga0213875_10000030 | Ga0213875_10000030188 | 245 |
| 220 | 3300025245 | Ga0207425_1000032 | Ga0207425_1000032176 | 245 |
| 221 | 3300025258 | Ga0209129_1000056 | Ga0209129_1000056176 | 245 |
| 222 | 3300025291 | Ga0209675_1015340 | Ga0209675_10153403 | 245 |
| 223 | 3300025294 | Ga0209025_1000090 | Ga0209025_1000090176 | 245 |
| 224 | 3300025297 | Ga0209758_1000084 | Ga0209758_1000084176 | 245 |
| 225 | 3300025297 | Ga0209758_1000176 | Ga0209758_100017624 | 245 |
| 226 | 3300025297 | Ga0209758_1001680 | Ga0209758_10016804 | 245 |
| 227 | 3300025298 | Ga0209050_1000248 | Ga0209050_100024818 | 245 |
| 228 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030333 | 245 |
| 229 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004759 | 245 |
| 230 | 3300025304 | Ga0209257_1000063 | Ga0209257_1000063245 | 245 |
| 231 | 3300025893 | Ga0207682_10000621 | Ga0207682_1000062111 | 245 |
| 232 | 3300025898 | Ga0207692_10062458 | Ga0207692_100624582 | 245 |
| 233 | 3300025898 | Ga0207692_10146022 | Ga0207692_101460222 | 245 |
| 234 | 3300025898 | Ga0207692_10167142 | Ga0207692_101671422 | 245 |
| 235 | 3300025898 | Ga0207692_10281841 | Ga0207692_102818412 | 245 |
| 236 | 3300025899 | Ga0207642_10016579 | Ga0207642_100165793 | 245 |
| 237 | 3300025901 | Ga0207688_10002139 | Ga0207688_100021392 | 245 |
| 238 | 3300025901 | Ga0207688_10042832 | Ga0207688_100428322 | 245 |
| 239 | 3300025903 | Ga0207680_10016603 | Ga0207680_100166033 | 245 |
| 240 | 3300025905 | Ga0207685_10047400 | Ga0207685_100474002 | 245 |
| 241 | 3300025907 | Ga0207645_10119588 | Ga0207645_101195881 | 245 |
| 242 | 3300025908 | Ga0207643_10003201 | Ga0207643_100032012 | 245 |
| 243 | 3300025908 | Ga0207643_10027249 | Ga0207643_100272493 | 245 |
| 244 | 3300025909 | Ga0207705_10005149 | Ga0207705_100051495 | 245 |
| 245 | 3300025911 | Ga0207654_10068032 | Ga0207654_100680322 | 245 |
| 246 | 3300025912 | Ga0207707_10008231 | Ga0207707_100082316 | 245 |
| 247 | 3300025915 | Ga0207693_10004979 | Ga0207693_100049793 | 245 |
| 248 | 3300025915 | Ga0207693_10175491 | Ga0207693_101754912 | 245 |
| 249 | 3300025915 | Ga0207693_10404537 | Ga0207693_104045371 | 245 |
| 250 | 3300025916 | Ga0207663_10117953 | Ga0207663_101179532 | 245 |
| 251 | 3300025917 | Ga0207660_10038697 | Ga0207660_100386972 | 245 |
| 252 | 3300025918 | Ga0207662_10031526 | Ga0207662_100315262 | 245 |
| 253 | 3300025919 | Ga0207657_10014784 | Ga0207657_1001478410 | 245 |
| 254 | 3300025919 | Ga0207657_10111951 | Ga0207657_101119512 | 245 |
| 255 | 3300025920 | Ga0207649_10089787 | Ga0207649_100897871 | 245 |
| 256 | 3300025921 | Ga0207652_10047827 | Ga0207652_100478274 | 245 |
| 257 | 3300025923 | Ga0207681_10200607 | Ga0207681_102006072 | 245 |
| 258 | 3300025924 | Ga0207694_10023156 | Ga0207694_100231564 | 245 |
| 259 | 3300025925 | Ga0207650_10074595 | Ga0207650_100745952 | 245 |
| 260 | 3300025926 | Ga0207659_10038977 | Ga0207659_100389773 | 245 |
| 261 | 3300025927 | Ga0207687_10012389 | Ga0207687_100123894 | 245 |
| 262 | 3300025928 | Ga0207700_10035372 | Ga0207700_100353724 | 245 |
| 263 | 3300025928 | Ga0207700_10079433 | Ga0207700_100794333 | 245 |
| 264 | 3300025929 | Ga0207664_10053226 | Ga0207664_100532263 | 245 |
| 265 | 3300025931 | Ga0207644_10005628 | Ga0207644_100056287 | 245 |
| 266 | 3300025934 | Ga0207686_10005811 | Ga0207686_100058116 | 245 |
| 267 | 3300025935 | Ga0207709_10025508 | Ga0207709_100255082 | 245 |
| 268 | 3300025935 | Ga0207709_10107403 | Ga0207709_101074032 | 245 |
| 269 | 3300025937 | Ga0207669_10003530 | Ga0207669_100035306 | 245 |
| 270 | 3300025937 | Ga0207669_10005020 | Ga0207669_100050202 | 245 |
| 271 | 3300025937 | Ga0207669_10091199 | Ga0207669_100911992 | 245 |
| 272 | 3300025940 | Ga0207691_10005326 | Ga0207691_100053268 | 245 |
| 273 | 3300025940 | Ga0207691_10018628 | Ga0207691_100186282 | 245 |
| 274 | 3300025942 | Ga0207689_10003046 | Ga0207689_1000304612 | 245 |
| 275 | 3300025942 | Ga0207689_10012189 | Ga0207689_100121896 | 245 |
| 276 | 3300025944 | Ga0207661_10298723 | Ga0207661_102987232 | 245 |
| 277 | 3300025944 | Ga0207661_10315748 | Ga0207661_103157482 | 245 |
| 278 | 3300025960 | Ga0207651_10008430 | Ga0207651_100084306 | 245 |
| 279 | 3300025960 | Ga0207651_10027484 | Ga0207651_100274843 | 245 |
| 280 | 3300025961 | Ga0207712_10094450 | Ga0207712_100944502 | 245 |
| 281 | 3300025986 | Ga0207658_10009519 | Ga0207658_100095193 | 245 |
| 282 | 3300026023 | Ga0207677_10086790 | Ga0207677_100867902 | 245 |
| 283 | 3300026035 | Ga0207703_10005530 | Ga0207703_100055304 | 245 |
| 284 | 3300026067 | Ga0207678_10007548 | Ga0207678_100075487 | 245 |
| 285 | 3300026067 | Ga0207678_10040537 | Ga0207678_100405373 | 245 |
| 286 | 3300026067 | Ga0207678_10565261 | Ga0207678_105652612 | 245 |
| 287 | 3300026075 | Ga0207708_10001550 | Ga0207708_1000155010 | 245 |
| 288 | 3300026078 | Ga0207702_10094872 | Ga0207702_100948723 | 245 |
| 289 | 3300026088 | Ga0207641_10107194 | Ga0207641_101071942 | 245 |
| 290 | 3300026089 | Ga0207648_10004523 | Ga0207648_1000452310 | 245 |
| 291 | 3300026089 | Ga0207648_10090818 | Ga0207648_100908183 | 245 |
| 292 | 3300026095 | Ga0207676_10019699 | Ga0207676_100196992 | 245 |
| 293 | 3300026095 | Ga0207676_10042616 | Ga0207676_100426164 | 245 |
| 294 | 3300026116 | Ga0207674_10528919 | Ga0207674_105289192 | 245 |
| 295 | 3300026118 | Ga0207675_100001799 | Ga0207675_10000179916 | 245 |
| 296 | 3300026121 | Ga0207683_10004652 | Ga0207683_100046523 | 245 |
| 297 | 3300026121 | Ga0207683_10184766 | Ga0207683_101847662 | 245 |
| 298 | 3300026142 | Ga0207698_10004646 | Ga0207698_100046462 | 245 |
| 299 | 3300026142 | Ga0207698_10036580 | Ga0207698_100365803 | 245 |
| 300 | 3300027111 | Ga0209281_1000039 | Ga0209281_1000039143 | 245 |
| 301 | 3300027866 | Ga0209813_10014021 | Ga0209813_100140212 | 245 |
| 302 | 3300027866 | Ga0209813_10039208 | Ga0209813_100392082 | 245 |
| 303 | 3300028379 | Ga0268266_10072091 | Ga0268266_100720912 | 245 |
| 304 | 3300028380 | Ga0268265_10083743 | Ga0268265_100837432 | 245 |
| 305 | 3300028381 | Ga0268264_10137354 | Ga0268264_101373542 | 245 |
| 306 | 3300028794 | Ga0307515_10168986 | Ga0307515_101689862 | 245 |
| 307 | 3300031238 | Ga0265332_10000200 | Ga0265332_100002009 | 245 |
| 308 | 3300031240 | Ga0265320_10025830 | Ga0265320_100258302 | 245 |
| 309 | 3300031241 | Ga0265325_10009226 | Ga0265325_100092265 | 245 |
| 310 | 3300031241 | Ga0265325_10020834 | Ga0265325_100208343 | 245 |
| 311 | 3300031242 | Ga0265329_10012715 | Ga0265329_100127152 | 245 |
| 312 | 3300031247 | Ga0265340_10002605 | Ga0265340_100026053 | 245 |
| 313 | 3300031247 | Ga0265340_10042783 | Ga0265340_100427832 | 245 |
| 314 | 3300031247 | Ga0265340_10084233 | Ga0265340_100842332 | 245 |
| 315 | 3300031249 | Ga0265339_10008083 | Ga0265339_100080835 | 245 |
| 316 | 3300031250 | Ga0265331_10015480 | Ga0265331_100154802 | 245 |
| 317 | 3300031250 | Ga0265331_10026948 | Ga0265331_100269482 | 245 |
| 318 | 3300031344 | Ga0265316_10350333 | Ga0265316_103503332 | 245 |
| 319 | 3300031595 | Ga0265313_10029322 | Ga0265313_100293222 | 245 |
| 320 | 3300031711 | Ga0265314_10011634 | Ga0265314_100116348 | 245 |
| 321 | 3300031711 | Ga0265314_10018040 | Ga0265314_100180404 | 245 |
| 322 | 3300031711 | Ga0265314_10056807 | Ga0265314_100568072 | 245 |
| 323 | 3300031712 | Ga0265342_10000024 | Ga0265342_100000249 | 245 |
| 324 | 3300031712 | Ga0265342_10009337 | Ga0265342_100093375 | 245 |
| 325 | 3300031712 | Ga0265342_10024382 | Ga0265342_100243822 | 245 |
| 326 | 3300031712 | Ga0265342_10058169 | Ga0265342_100581692 | 245 |
| 327 | 3300031731 | Ga0307405_10000595 | Ga0307405_100005957 | 245 |
| 328 | 3300031838 | Ga0307518_10299835 | Ga0307518_102998351 | 245 |
| 329 | 3300031911 | Ga0307412_10008110 | Ga0307412_100081104 | 245 |
| 330 | 3300032133 | Ga0316583_10010048 | Ga0316583_100100481 | 245 |
| 331 | 3300032133 | Ga0316583_10047902 | Ga0316583_100479022 | 245 |
| 332 | 3300035116 | Ga0373945_0005356 | Ga0373945_0005356_753_1544 | 245 |
| 333 | 3300035691 | Ga0373931_0036575 | Ga0373931_0036575_296_1090 | 245 |
| 334 | 3300035691 | Ga0373931_0174459 | Ga0373931_0174459_336_1127 | 245 |
| 335 | 3300035695 | Ga0373927_0043715 | Ga0373927_0043715_699_1490 | 245 |
| 336 | 3300035695 | Ga0373927_0106844 | Ga0373927_0106844_790_1581 | 245 |
| 337 | 3300035725 | Ga0373947_0077236 | Ga0373947_0077236_686_1477 | 245 |
| 338 | 3300036401 | Ga0373937_0225575 | Ga0373937_0225575_897_1688 | 245 |
| 339 | 3300037068 | Ga0373925_0095939 | Ga0373925_0095939_978_1769 | 245 |
| 340 | 3300037068 | Ga0373925_0097173 | Ga0373925_0097173_664_1455 | 245 |
| 341 | 3300037853 | Ga0436364_0199717 | Ga0436364_0199717_75_866 | 245 |
| 342 | 3300037853 | Ga0436364_0686343 | Ga0436364_0686343_3457_4251 | 245 |
| 343 | 3300037853 | Ga0436364_0720016 | Ga0436364_0720016_67_861 | 245 |
| 344 | 3300037853 | Ga0436364_1313737 | Ga0436364_1313737_51_842 | 245 |
| 345 | 3300038996 | Ga0242420_019841 | Ga0242420_019841_254_1045 | 245 |
| 346 | 3300039437 | Ga0436365_0001406 | Ga0436365_0001406_109_900 | 245 |
| 347 | 3300039437 | Ga0436365_0029099 | Ga0436365_0029099_693_1487 | 245 |
| 348 | 3300039437 | Ga0436365_0392771 | Ga0436365_0392771_178_927 | 245 |
| 349 | 3300039447 | Ga0436361_0943238 | Ga0436361_0943238_2505_3296 | 245 |
| 350 | 3300039450 | Ga0436363_0452757 | Ga0436363_0452757_97_888 | 245 |
| 351 | 3300039450 | Ga0436363_1354593 | Ga0436363_1354593_76_867 | 245 |
| 352 | 3300039450 | Ga0436363_1412358 | Ga0436363_1412358_85_879 | 245 |
| 353 | 3300039453 | Ga0436362_1019396 | Ga0436362_1019396_25_819 | 245 |
| 354 | 3300041408 | Ga0439453_0011128 | Ga0439453_0011128_595_1386 | 245 |
| 355 | 3300041413 | Ga0439465_0061057 | Ga0439465_0061057_421_1212 | 245 |
| 356 | 3300041443 | Ga0451789_1320271 | Ga0451789_1320271_110_904 | 245 |
| 357 | 3300042013 | Ga0439456_061525 | Ga0439456_061525_16_807 | 245 |
| 358 | 3300042134 | Ga0450898_029343 | Ga0450898_029343_186_977 | 245 |
| 359 | 3300042436 | Ga0439435_0022795 | Ga0439435_0022795_609_1400 | 245 |
| 360 | 3300044684 | Ga0466966_0090439 | Ga0466966_0090439_154_948 | 245 |
| 361 | 3300045049 | Ga0466959_0187628 | Ga0466959_0187628_46_840 | 245 |
| 362 | 3300045051 | Ga0451576_0710777 | Ga0451576_0710777_242_1033 | 245 |
| 363 | 3300046455 | Ga0495603_0042996 | Ga0495603_0042996_1356_2147 | 245 |
| 364 | 3300046460 | Ga0495638_0077917 | Ga0495638_0077917_153_944 | 245 |
| 365 | 3300046460 | Ga0495638_0208153 | Ga0495638_0208153_10_804 | 245 |
| 366 | 3300046461 | Ga0495641_0008499 | Ga0495641_0008499_3277_4068 | 245 |
| 367 | 3300046462 | Ga0495651_0295318 | Ga0495651_0295318_248_1042 | 245 |
| 368 | 3300046473 | Ga0495582_0013585 | Ga0495582_0013585_3585_4376 | 245 |
| 369 | 3300046477 | Ga0495664_0142246 | Ga0495664_0142246_129_923 | 245 |
| 370 | 3300046491 | Ga0495584_0080207 | Ga0495584_0080207_233_1024 | 245 |
| 371 | 3300046492 | Ga0495585_0040563 | Ga0495585_0040563_1491_2282 | 245 |
| 372 | 3300046507 | Ga0495606_0002496 | Ga0495606_0002496_17255_18046 | 245 |
| 373 | 3300046507 | Ga0495606_0155500 | Ga0495606_0155500_50_844 | 245 |
| 374 | 3300046515 | Ga0495620_0011011 | Ga0495620_0011011_951_1877 | 245 |
| 375 | 3300046518 | Ga0495631_0051576 | Ga0495631_0051576_423_1214 | 245 |
| 376 | 3300046520 | Ga0495637_0035473 | Ga0495637_0035473_836_1627 | 245 |
| 377 | 3300046522 | Ga0495643_0106249 | Ga0495643_0106249_607_1401 | 245 |
| 378 | 3300046524 | Ga0495648_0000402 | Ga0495648_0000402_36499_37350 | 245 |
| 379 | 3300046524 | Ga0495648_0000404 | Ga0495648_0000404_29974_30765 | 245 |
| 380 | 3300046524 | Ga0495648_0042834 | Ga0495648_0042834_166_957 | 245 |
| 381 | 3300046525 | Ga0495663_0024519 | Ga0495663_0024519_902_1696 | 245 |
| 382 | 3300046526 | Ga0495666_0093426 | Ga0495666_0093426_168_959 | 245 |
| 383 | 3300046529 | Ga0495652_0449084 | Ga0495652_0449084_27_821 | 245 |
| 384 | 3300046530 | Ga0495654_0066615 | Ga0495654_0066615_605_1399 | 245 |
| 385 | 3300046533 | Ga0495640_0094295 | Ga0495640_0094295_24_761 | 245 |
| 386 | 3300046536 | Ga0495587_0124389 | Ga0495587_0124389_234_1025 | 245 |
| 387 | 3300046537 | Ga0495598_0006421 | Ga0495598_0006421_127_921 | 245 |
| 388 | 3300046537 | Ga0495598_0044071 | Ga0495598_0044071_240_1031 | 245 |
| 389 | 3300046538 | Ga0495609_0000014 | Ga0495609_0000014_104542_105333 | 245 |
| 390 | 3300046557 | Ga0495622_0008986 | Ga0495622_0008986_491_1285 | 245 |
| 391 | 3300046615 | Ga0495656_0128477 | Ga0495656_0128477_314_1108 | 245 |
| 392 | 3300046616 | Ga0495668_0065981 | Ga0495668_0065981_921_1712 | 245 |
| 393 | 3300046664 | Ga0495659_0096811 | Ga0495659_0096811_172_963 | 245 |
| 394 | 3300046665 | Ga0495661_0015241 | Ga0495661_0015241_3463_4389 | 245 |
| 395 | 3300046679 | Ga0495623_0197916 | Ga0495623_0197916_13_804 | 245 |
| 396 | 3300046681 | Ga0495647_0018887 | Ga0495647_0018887_276_1067 | 245 |
| 397 | 3300046683 | Ga0495658_0251393 | Ga0495658_0251393_18_809 | 245 |
| 398 | 3300046689 | Ga0495613_0100065 | Ga0495613_0100065_642_1433 | 245 |
| 399 | 3300046691 | Ga0495670_0013820 | Ga0495670_0013820_1667_2458 | 245 |
| 400 | 3300046691 | Ga0495670_0102105 | Ga0495670_0102105_22_816 | 245 |
| 401 | 3300046810 | Ga0495660_0034567 | Ga0495660_0034567_345_1139 | 245 |
| 402 | 3300047315 | Ga0495581_0184148 | Ga0495581_0184148_362_1153 | 245 |
| 403 | 3300047317 | Ga0495604_0190634 | Ga0495604_0190634_236_1027 | 245 |
| 404 | 3300047317 | Ga0495604_0247021 | Ga0495604_0247021_177_968 | 245 |
| 405 | 3300047320 | Ga0495672_0026570 | Ga0495672_0026570_757_1710 | 245 |
| 406 | 3300047320 | Ga0495672_0074065 | Ga0495672_0074065_713_1507 | 245 |
| 407 | 3300047320 | Ga0495672_0126233 | Ga0495672_0126233_536_1330 | 245 |
| 408 | 3300047322 | Ga0495680_0286308 | Ga0495680_0286308_191_982 | 245 |
| 409 | 3300047469 | Ga0495673_0094919 | Ga0495673_0094919_225_1019 | 245 |
| 410 | 3300047472 | Ga0495686_0010674 | Ga0495686_0010674_3651_4577 | 245 |
| 411 | 3300048090 | Ga0495615_0004228 | Ga0495615_0004228_244_1038 | 245 |
| 412 | 3300048090 | Ga0495615_0008289 | Ga0495615_0008289_952_1746 | 245 |
| 413 | 3300048903 | Ga0496100_0086394 | Ga0496100_0086394_1247_2038 | 245 |
| 414 | 3300048903 | Ga0496100_0090947 | Ga0496100_0090947_311_1102 | 245 |
| 415 | 3300048903 | Ga0496100_0177591 | Ga0496100_0177591_307_1098 | 245 |
| 416 | 3300048903 | Ga0496100_0240445 | Ga0496100_0240445_493_1284 | 245 |
| 417 | 3300048904 | Ga0496101_0006354 | Ga0496101_0006354_2064_2855 | 245 |
| 418 | 3300048904 | Ga0496101_0052607 | Ga0496101_0052607_1014_1808 | 245 |
| 419 | 3300048904 | Ga0496101_0052797 | Ga0496101_0052797_1607_2398 | 245 |
| 420 | 3300048904 | Ga0496101_0086148 | Ga0496101_0086148_841_1632 | 245 |
| 421 | 3300048904 | Ga0496101_0485336 | Ga0496101_0485336_18_809 | 245 |
| 422 | 3300048905 | Ga0496102_0028257 | Ga0496102_0028257_2396_3187 | 245 |
| 423 | 3300048905 | Ga0496102_0382288 | Ga0496102_0382288_349_1140 | 245 |
| 424 | 3300048906 | Ga0496103_0002965 | Ga0496103_0002965_5569_6360 | 245 |
| 425 | 3300048907 | Ga0496104_0007075 | Ga0496104_0007075_7119_7910 | 245 |
| 426 | 3300048907 | Ga0496104_0008732 | Ga0496104_0008732_46_837 | 245 |
| 427 | 3300048907 | Ga0496104_0024001 | Ga0496104_0024001_672_1463 | 245 |
| 428 | 3300048907 | Ga0496104_0192731 | Ga0496104_0192731_356_1147 | 245 |
| 429 | 3300048907 | Ga0496104_0538978 | Ga0496104_0538978_141_932 | 245 |
| 430 | 3300048908 | Ga0496105_0007552 | Ga0496105_0007552_2880_3671 | 245 |
| 431 | 3300048908 | Ga0496105_0034789 | Ga0496105_0034789_3273_4064 | 245 |
| 432 | 3300048909 | Ga0496106_0015428 | Ga0496106_0015428_2396_3187 | 245 |
| 433 | 3300048909 | Ga0496106_0090367 | Ga0496106_0090367_52_846 | 245 |
| 434 | 3300048909 | Ga0496106_0090962 | Ga0496106_0090962_1382_2173 | 245 |
| 435 | 3300048910 | Ga0496107_0012697 | Ga0496107_0012697_340_1131 | 245 |
| 436 | 3300048910 | Ga0496107_0253780 | Ga0496107_0253780_492_1283 | 245 |
| 437 | 3300048911 | Ga0496108_0005177 | Ga0496108_0005177_1037_1828 | 245 |
| 438 | 3300048911 | Ga0496108_0017491 | Ga0496108_0017491_645_1436 | 245 |
| 439 | 3300048911 | Ga0496108_0156825 | Ga0496108_0156825_625_1416 | 245 |
| 440 | 3300048911 | Ga0496108_0188313 | Ga0496108_0188313_148_939 | 245 |
| 441 | 3300048912 | Ga0496109_0004744 | Ga0496109_0004744_7698_8489 | 245 |
| 442 | 3300048912 | Ga0496109_0020861 | Ga0496109_0020861_86_877 | 245 |
| 443 | 3300048912 | Ga0496109_0043149 | Ga0496109_0043149_830_1621 | 245 |
| 444 | 3300048912 | Ga0496109_0264301 | Ga0496109_0264301_188_979 | 245 |
| 445 | 3300048913 | Ga0496110_0003933 | Ga0496110_0003933_8939_9730 | 245 |
| 446 | 3300048913 | Ga0496110_0005380 | Ga0496110_0005380_8920_9711 | 245 |
| 447 | 3300048913 | Ga0496110_0023431 | Ga0496110_0023431_4374_5165 | 245 |
| 448 | 3300048913 | Ga0496110_0047636 | Ga0496110_0047636_2723_3514 | 245 |
| 449 | 3300048914 | Ga0496111_0007587 | Ga0496111_0007587_1939_2730 | 245 |
| 450 | 3300048914 | Ga0496111_0040537 | Ga0496111_0040537_1405_2196 | 245 |
| 451 | 3300048914 | Ga0496111_0058819 | Ga0496111_0058819_649_1440 | 245 |
| 452 | 3300048914 | Ga0496111_0280583 | Ga0496111_0280583_98_889 | 245 |
| 453 | 3300048914 | Ga0496111_0566555 | Ga0496111_0566555_32_823 | 245 |
| 454 | 3300048915 | Ga0496112_0008231 | Ga0496112_0008231_2969_3760 | 245 |
| 455 | 3300048915 | Ga0496112_0031616 | Ga0496112_0031616_138_929 | 245 |
| 456 | 3300048915 | Ga0496112_0194530 | Ga0496112_0194530_135_884 | 245 |
| 457 | 3300048915 | Ga0496112_0196071 | Ga0496112_0196071_260_1054 | 245 |
| 458 | 3300048916 | Ga0496113_0037400 | Ga0496113_0037400_1950_2741 | 245 |
| 459 | 3300048916 | Ga0496113_0039227 | Ga0496113_0039227_1219_2010 | 245 |
| 460 | 3300048917 | Ga0496114_0001872 | Ga0496114_0001872_10095_10886 | 245 |
| 461 | 3300048917 | Ga0496114_0004482 | Ga0496114_0004482_8406_9197 | 245 |
| 462 | 3300048917 | Ga0496114_0138680 | Ga0496114_0138680_198_989 | 245 |
| 463 | 3300048918 | Ga0496115_0004848 | Ga0496115_0004848_2216_3007 | 245 |
| 464 | 3300048918 | Ga0496115_0012765 | Ga0496115_0012765_2198_2989 | 245 |
| 465 | 3300048918 | Ga0496115_0020164 | Ga0496115_0020164_1584_2375 | 245 |
| 466 | 3300048918 | Ga0496115_0027587 | Ga0496115_0027587_1503_2297 | 245 |
| 467 | 3300048918 | Ga0496115_0036694 | Ga0496115_0036694_1742_2533 | 245 |
| 468 | 3300048918 | Ga0496115_0116432 | Ga0496115_0116432_1029_1820 | 245 |
| 469 | 3300048918 | Ga0496115_0206412 | Ga0496115_0206412_686_1480 | 245 |
| 470 | 3300048919 | Ga0496116_0007550 | Ga0496116_0007550_2151_2945 | 245 |
| 471 | 3300048919 | Ga0496116_0084818 | Ga0496116_0084818_512_1303 | 245 |
| 472 | 3300048919 | Ga0496116_0114778 | Ga0496116_0114778_418_1209 | 245 |
| 473 | 3300048919 | Ga0496116_0166773 | Ga0496116_0166773_199_990 | 245 |
| 474 | 3300048920 | Ga0496117_0001973 | Ga0496117_0001973_9075_9866 | 245 |
| 475 | 3300048920 | Ga0496117_0015773 | Ga0496117_0015773_604_1395 | 245 |
| 476 | 3300048920 | Ga0496117_0069516 | Ga0496117_0069516_867_1661 | 245 |
| 477 | 3300048920 | Ga0496117_0219754 | Ga0496117_0219754_222_1016 | 245 |
| 478 | 3300048921 | Ga0496118_0101312 | Ga0496118_0101312_187_978 | 245 |
| 479 | 3300048922 | Ga0496119_0013085 | Ga0496119_0013085_4943_5734 | 245 |
| 480 | 3300048922 | Ga0496119_0015962 | Ga0496119_0015962_1181_1972 | 245 |
| 481 | 3300048923 | Ga0496120_0032598 | Ga0496120_0032598_34_828 | 245 |
| 482 | 3300048923 | Ga0496120_0244574 | Ga0496120_0244574_12_803 | 245 |
| 483 | 3300048924 | Ga0496121_0000138 | Ga0496121_0000138_82105_82896 | 245 |
| 484 | 3300048924 | Ga0496121_0002067 | Ga0496121_0002067_25772_26629 | 245 |
| 485 | 3300048924 | Ga0496121_0028634 | Ga0496121_0028634_1169_1960 | 245 |
| 486 | 3300048925 | Ga0496122_0041332 | Ga0496122_0041332_2833_3624 | 245 |
| 487 | 3300048925 | Ga0496122_0048180 | Ga0496122_0048180_1380_2174 | 245 |
| 488 | 3300048925 | Ga0496122_0109679 | Ga0496122_0109679_418_1209 | 245 |
| 489 | 3300048926 | Ga0496123_0000026 | Ga0496123_0000026_25708_26544 | 245 |
| 490 | 3300048927 | Ga0496124_0000275 | Ga0496124_0000275_82651_83442 | 245 |
| 491 | 3300048927 | Ga0496124_0088183 | Ga0496124_0088183_1311_2102 | 245 |
| 492 | 3300048927 | Ga0496124_0235532 | Ga0496124_0235532_113_904 | 245 |
| 493 | 3300048928 | Ga0496125_0002495 | Ga0496125_0002495_1020_1814 | 245 |
| 494 | 3300048928 | Ga0496125_0030654 | Ga0496125_0030654_3131_3925 | 245 |
| 495 | 3300048929 | Ga0496126_0008630 | Ga0496126_0008630_2771_3565 | 245 |
| 496 | 3300048929 | Ga0496126_0036981 | Ga0496126_0036981_903_1694 | 245 |
| 497 | 3300048929 | Ga0496126_0053207 | Ga0496126_0053207_2201_2992 | 245 |
| 498 | 3300048929 | Ga0496126_0209145 | Ga0496126_0209145_280_1074 | 245 |
| 499 | 3300048929 | Ga0496126_0308104 | Ga0496126_0308104_469_1263 | 245 |
| 500 | 3300048929 | Ga0496126_0385083 | Ga0496126_0385083_164_958 | 245 |
| 501 | 3300049574 | Ga0501038_0498280 | Ga0501038_0498280_97_888 | 245 |
| 502 | 3300049581 | Ga0501047_0010950 | Ga0501047_0010950_1192_1983 | 245 |
| 503 | 3300049588 | Ga0501072_0000592 | Ga0501072_0000592_14294_15088 | 245 |
| 504 | 3300049589 | Ga0501073_0391962 | Ga0501073_0391962_49_843 | 245 |
| 505 | 3300049823 | Ga0501044_0133423 | Ga0501044_0133423_1516_2307 | 245 |
| 506 | 3300050489 | nmdc:mga03683_25601_c1 | nmdc:mga03683_25601_c1_1479_2273 | 245 |
| 507 | 3300050489 | nmdc:mga03683_42659_c1 | nmdc:mga03683_42659_c1_886_1680 | 245 |
| 508 | 3300050490 | nmdc:mga03n38_1035_c1 | nmdc:mga03n38_1035_c1_3815_4609 | 245 |
| 509 | 3300050491 | nmdc:mga00v17_11226_c1 | nmdc:mga00v17_11226_c1_1071_1862 | 245 |
| 510 | 3300050491 | nmdc:mga00v17_38025_c1 | nmdc:mga00v17_38025_c1_1573_2367 | 245 |
| 511 | 3300050491 | nmdc:mga00v17_61858_c1 | nmdc:mga00v17_61858_c1_1328_2122 | 245 |
| 512 | 3300050492 | nmdc:mga0yw44_43068_c1 | nmdc:mga0yw44_43068_c1_745_1539 | 245 |
| 513 | 3300050492 | nmdc:mga0yw44_50077_c1 | nmdc:mga0yw44_50077_c1_842_1633 | 245 |
| 514 | 3300050493 | nmdc:mga0k408_162233_c1 | nmdc:mga0k408_162233_c1_87_881 | 245 |
| 515 | 3300050493 | nmdc:mga0k408_232534_c1 | nmdc:mga0k408_232534_c1_265_1056 | 245 |
| 516 | 3300050493 | nmdc:mga0k408_26355_c1 | nmdc:mga0k408_26355_c1_1268_2059 | 245 |
| 517 | 3300050493 | nmdc:mga0k408_6326_c1 | nmdc:mga0k408_6326_c1_4399_5190 | 245 |
| 518 | 3300050493 | nmdc:mga0k408_66969_c1 | nmdc:mga0k408_66969_c1_1138_1932 | 245 |
| 519 | 3300050494 | nmdc:mga06z11_164362_c1 | nmdc:mga06z11_164362_c1_285_1079 | 245 |
| 520 | 3300050495 | nmdc:mga04h51_13907_c1 | nmdc:mga04h51_13907_c1_455_1249 | 245 |
| 521 | 3300050496 | nmdc:mga07m45_17396_c1 | nmdc:mga07m45_17396_c1_1522_2316 | 245 |
| 522 | 3300050496 | nmdc:mga07m45_17758_c1 | nmdc:mga07m45_17758_c1_509_1303 | 245 |
| 523 | 3300050496 | nmdc:mga07m45_3577_c2 | nmdc:mga07m45_3577_c2_60_854 | 245 |
| 524 | 3300050507 | nmdc:mga05p37_428123_c1 | nmdc:mga05p37_428123_c1_495_1289 | 245 |
| 525 | 3300050512 | nmdc:mga0n895_293160_c1 | nmdc:mga0n895_293160_c1_709_1500 | 245 |
| 526 | 3300050513 | nmdc:mga0rr50_60515_c1 | nmdc:mga0rr50_60515_c1_1648_2442 | 245 |
| 527 | 3300053077 | Ga0495601_0021963 | Ga0495601_0021963_2702_3493 | 245 |
| 528 | 3300053077 | Ga0495601_0035186 | Ga0495601_0035186_1632_2423 | 245 |
| 529 | 3300053078 | Ga0495612_0064082 | Ga0495612_0064082_614_1405 | 245 |
| 530 | 3300053083 | Ga0495655_0005721 | Ga0495655_0005721_1157_1948 | 245 |
| 531 | 3300053084 | Ga0495595_0086195 | Ga0495595_0086195_65_856 | 245 |
| 532 | 3300053085 | Ga0495619_0144570 | Ga0495619_0144570_826_1617 | 245 |
| 533 | 3300053087 | Ga0500643_001421 | Ga0500643_001421_10704_11495 | 245 |
| 534 | 3300053088 | Ga0500644_0000877 | Ga0500644_0000877_1844_2638 | 245 |
| 535 | 3300053088 | Ga0500644_0006259 | Ga0500644_0006259_1809_2600 | 245 |
| 536 | 3300053092 | Ga0500583_0071192 | Ga0500583_0071192_300_1094 | 245 |
| 537 | 3300053093 | Ga0500651_0001657 | Ga0500651_0001657_8359_9150 | 245 |
| 538 | 3300053093 | Ga0500651_0013136 | Ga0500651_0013136_2137_2931 | 245 |
| 539 | 3300053093 | Ga0500651_0131202 | Ga0500651_0131202_39_833 | 245 |
| 540 | 3300053094 | Ga0500566_0001628 | Ga0500566_0001628_6628_7422 | 245 |
| 541 | 3300053094 | Ga0500566_0046686 | Ga0500566_0046686_1678_2469 | 245 |
| 542 | 3300053096 | Ga0500641_0002932 | Ga0500641_0002932_2075_2869 | 245 |
| 543 | 3300053096 | Ga0500641_0069567 | Ga0500641_0069567_564_1358 | 245 |
| 544 | 3300053098 | Ga0500650_0103442 | Ga0500650_0103442_388_1182 | 245 |
| 545 | 3300053099 | Ga0500654_109014 | Ga0500654_109014_12_806 | 245 |
| 546 | 3300053104 | Ga0500556_0000016 | Ga0500556_0000016_54991_55785 | 245 |
| 547 | 3300053109 | Ga0500569_044264 | Ga0500569_044264_93_1019 | 245 |
| 548 | 3300053116 | Ga0500592_001649 | Ga0500592_001649_816_1610 | 245 |
| 549 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_400704_401495 | 245 |
| 550 | 3300053119 | Ga0500595_030115 | Ga0500595_030115_392_1186 | 245 |
| 551 | 3300053122 | Ga0500608_000620 | Ga0500608_000620_11155_11949 | 245 |
| 552 | 3300053125 | Ga0500618_001279 | Ga0500618_001279_6875_7666 | 245 |
| 553 | 3300053125 | Ga0500618_011771 | Ga0500618_011771_1306_2100 | 245 |
| 554 | 3300053130 | Ga0500642_0000009 | Ga0500642_0000009_109024_109818 | 245 |
| 555 | 3300053131 | Ga0500652_000306 | Ga0500652_000306_2263_3057 | 245 |
| 556 | 3300053131 | Ga0500652_046904 | Ga0500652_046904_103_894 | 245 |
| 557 | 3300053134 | Ga0500658_0110056 | Ga0500658_0110056_152_943 | 245 |
| 558 | 3300053136 | Ga0500559_0000572 | Ga0500559_0000572_5799_6593 | 245 |
| 559 | 3300053136 | Ga0500559_0014992 | Ga0500559_0014992_446_1240 | 245 |
| 560 | 3300053139 | Ga0500568_0004897 | Ga0500568_0004897_3106_3900 | 245 |
| 561 | 3300053146 | Ga0500588_0006795 | Ga0500588_0006795_177_1103 | 245 |
| 562 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1587319_1588110 | 245 |
| 563 | 3300053153 | Ga0500616_0000169 | Ga0500616_0000169_11297_12223 | 245 |
| 564 | 3300053153 | Ga0500616_0012053 | Ga0500616_0012053_501_1292 | 245 |
| 565 | 3300053153 | Ga0500616_0034423 | Ga0500616_0034423_250_1041 | 245 |
| 566 | 3300053153 | Ga0500616_0037001 | Ga0500616_0037001_1441_2232 | 245 |
| 567 | 3300053153 | Ga0500616_0172058 | Ga0500616_0172058_38_829 | 245 |
| 568 | 3300053156 | Ga0500622_0011273 | Ga0500622_0011273_813_1607 | 245 |
| 569 | 3300053157 | Ga0500624_000121 | Ga0500624_000121_13560_14351 | 245 |
| 570 | 3300053177 | Ga0500636_0006403 | Ga0500636_0006403_2062_2856 | 245 |
| 571 | 3300053724 | Ga0500570_000246 | Ga0500570_000246_11911_12825 | 245 |
| 572 | 3300053730 | Ga0500645_000226 | Ga0500645_000226_24324_25115 | 245 |
| 573 | 3300060353 | Ga0501082_0000074 | Ga0501082_0000074_16045_16839 | 245 |
| 574 | iso_pu_bacteria | 2602042107 | 2603858205 | 245 |
| 575 | 3300046462 | Ga0495651_0118196 | Ga0495651_0118196_1159_1899 | 246 |
| 576 | 3300046472 | Ga0495580_0006609 | Ga0495580_0006609_8612_9352 | 246 |
| 577 | 3300046472 | Ga0495580_0012735 | Ga0495580_0012735_5195_5935 | 246 |
| 578 | 3300046517 | Ga0495630_0008050 | Ga0495630_0008050_373_1113 | 246 |
| 579 | 3300046517 | Ga0495630_0092389 | Ga0495630_0092389_1030_1770 | 246 |
| 580 | 3300046526 | Ga0495666_0041745 | Ga0495666_0041745_115_855 | 246 |
| 581 | 3300046690 | Ga0495624_0015089 | Ga0495624_0015089_4117_4857 | 246 |
| 582 | 3300047315 | Ga0495581_0043299 | Ga0495581_0043299_413_1153 | 246 |
| 583 | 3300047317 | Ga0495604_0186186 | Ga0495604_0186186_356_1096 | 246 |
| 584 | 3300047322 | Ga0495680_0195937 | Ga0495680_0195937_125_865 | 246 |
| 585 | 3300047322 | Ga0495680_0209268 | Ga0495680_0209268_22_762 | 246 |
| 586 | 3300048089 | Ga0495614_0023276 | Ga0495614_0023276_1604_2344 | 246 |
| 587 | 3300046463 | Ga0495653_0126186 | Ga0495653_0126186_189_932 | 247 |
| 588 | iso_pu_bacteria | 2510917013 | 2511092934 | 249 |
| 589 | iso_pu_bacteria | 2856287931 | 2856288506 | 249 |
| 590 | iso_pu_bacteria | 2857357740 | 2857367067 | 249 |
| 591 | iso_pu_bacteria | 2990703756 | 2990710862 | 249 |
| 592 | 3300006048 | Ga0075363_100096770 | Ga0075363_1000967702 | 252 |
| 593 | 3300006195 | Ga0075366_10208296 | Ga0075366_102082962 | 252 |
| 594 | 3300050493 | nmdc:mga0k408_78248_c1 | nmdc:mga0k408_78248_c1_1043_1831 | 252 |
| 595 | 3300002067 | JGI24735J21928_10000208 | JGI24735J21928_100002086 | 253 |
| 596 | 3300002067 | JGI24735J21928_10002064 | JGI24735J21928_100020645 | 253 |
| 597 | 3300003187 | JGI25151J46595_10000594 | JGI25151J46595_100005946 | 253 |
| 598 | 3300009011 | Ga0105251_10002186 | Ga0105251_100021862 | 253 |
| 599 | 3300009098 | Ga0105245_10261899 | Ga0105245_102618992 | 253 |
| 600 | 3300009551 | Ga0105238_10037777 | Ga0105238_100377775 | 253 |
| 601 | 3300013105 | Ga0157369_10143735 | Ga0157369_101437352 | 253 |
| 602 | 3300017792 | Ga0163161_10015691 | Ga0163161_100156912 | 253 |
| 603 | 3300025294 | Ga0209025_1000026 | Ga0209025_1000026269 | 253 |
| 604 | 3300025302 | Ga0207426_1001370 | Ga0207426_10013706 | 253 |
| 605 | 3300025735 | Ga0207713_1007338 | Ga0207713_10073385 | 253 |
| 606 | 3300025904 | Ga0207647_10028407 | Ga0207647_100284072 | 253 |
| 607 | 3300025904 | Ga0207647_10039102 | Ga0207647_100391022 | 253 |
| 608 | 3300025924 | Ga0207694_10160477 | Ga0207694_101604772 | 253 |
| 609 | 3300028379 | Ga0268266_10331785 | Ga0268266_103317852 | 253 |
| 610 | 3300031548 | Ga0307408_100183955 | Ga0307408_1001839552 | 253 |
| 611 | 3300031824 | Ga0307413_10445785 | Ga0307413_104457851 | 253 |
| 612 | 3300031852 | Ga0307410_10206258 | Ga0307410_102062582 | 253 |
| 613 | 3300031911 | Ga0307412_10260156 | Ga0307412_102601562 | 253 |
| 614 | 3300031911 | Ga0307412_10418554 | Ga0307412_104185542 | 253 |
| 615 | 3300032004 | Ga0307414_10397239 | Ga0307414_103972392 | 253 |
| 616 | 3300032005 | Ga0307411_10004556 | Ga0307411_100045566 | 253 |
| 617 | 3300046454 | Ga0495592_0044218 | Ga0495592_0044218_384_1145 | 253 |
| 618 | 3300046455 | Ga0495603_0015821 | Ga0495603_0015821_468_1229 | 253 |
| 619 | 3300046457 | Ga0495590_0000786 | Ga0495590_0000786_2301_3062 | 253 |
| 620 | 3300046459 | Ga0495629_0000936 | Ga0495629_0000936_3674_4435 | 253 |
| 621 | 3300046459 | Ga0495629_0006237 | Ga0495629_0006237_3182_3943 | 253 |
| 622 | 3300046459 | Ga0495629_0064142 | Ga0495629_0064142_18_779 | 253 |
| 623 | 3300046461 | Ga0495641_0122407 | Ga0495641_0122407_36_797 | 253 |
| 624 | 3300046463 | Ga0495653_0000639 | Ga0495653_0000639_1988_2749 | 253 |
| 625 | 3300046463 | Ga0495653_0023842 | Ga0495653_0023842_3343_4104 | 253 |
| 626 | 3300046471 | Ga0495650_0001639 | Ga0495650_0001639_3329_4090 | 253 |
| 627 | 3300046472 | Ga0495580_0009219 | Ga0495580_0009219_4344_5105 | 253 |
| 628 | 3300046472 | Ga0495580_0066348 | Ga0495580_0066348_142_903 | 253 |
| 629 | 3300046473 | Ga0495582_0003268 | Ga0495582_0003268_1681_2442 | 253 |
| 630 | 3300046473 | Ga0495582_0019388 | Ga0495582_0019388_2156_2917 | 253 |
| 631 | 3300046475 | Ga0495639_0085453 | Ga0495639_0085453_646_1407 | 253 |
| 632 | 3300046476 | Ga0495662_0024375 | Ga0495662_0024375_321_1082 | 253 |
| 633 | 3300046477 | Ga0495664_0011475 | Ga0495664_0011475_1728_2489 | 253 |
| 634 | 3300046477 | Ga0495664_0044993 | Ga0495664_0044993_112_873 | 253 |
| 635 | 3300046477 | Ga0495664_0271849 | Ga0495664_0271849_90_851 | 253 |
| 636 | 3300046491 | Ga0495584_0229180 | Ga0495584_0229180_58_819 | 253 |
| 637 | 3300046501 | Ga0495607_0114022 | Ga0495607_0114022_348_1109 | 253 |
| 638 | 3300046506 | Ga0495583_0006484 | Ga0495583_0006484_4995_5756 | 253 |
| 639 | 3300046507 | Ga0495606_0107317 | Ga0495606_0107317_750_1511 | 253 |
| 640 | 3300046511 | Ga0495608_0180085 | Ga0495608_0180085_327_1088 | 253 |
| 641 | 3300046511 | Ga0495608_0288954 | Ga0495608_0288954_19_780 | 253 |
| 642 | 3300046514 | Ga0495618_0105257 | Ga0495618_0105257_389_1150 | 253 |
| 643 | 3300046515 | Ga0495620_0004940 | Ga0495620_0004940_111_872 | 253 |
| 644 | 3300046516 | Ga0495628_0001408 | Ga0495628_0001408_7103_7864 | 253 |
| 645 | 3300046516 | Ga0495628_0050756 | Ga0495628_0050756_379_1140 | 253 |
| 646 | 3300046516 | Ga0495628_0330093 | Ga0495628_0330093_163_924 | 253 |
| 647 | 3300046517 | Ga0495630_0022268 | Ga0495630_0022268_442_1203 | 253 |
| 648 | 3300046519 | Ga0495632_0192148 | Ga0495632_0192148_110_871 | 253 |
| 649 | 3300046522 | Ga0495643_0006723 | Ga0495643_0006723_1566_2327 | 253 |
| 650 | 3300046524 | Ga0495648_0009623 | Ga0495648_0009623_2325_3086 | 253 |
| 651 | 3300046526 | Ga0495666_0025761 | Ga0495666_0025761_1684_2445 | 253 |
| 652 | 3300046528 | Ga0495642_0004269 | Ga0495642_0004269_120_881 | 253 |
| 653 | 3300046529 | Ga0495652_0013910 | Ga0495652_0013910_4764_5525 | 253 |
| 654 | 3300046530 | Ga0495654_0037972 | Ga0495654_0037972_584_1345 | 253 |
| 655 | 3300046530 | Ga0495654_0162609 | Ga0495654_0162609_190_951 | 253 |
| 656 | 3300046531 | Ga0495665_0001474 | Ga0495665_0001474_11435_12196 | 253 |
| 657 | 3300046531 | Ga0495665_0061840 | Ga0495665_0061840_552_1313 | 253 |
| 658 | 3300046531 | Ga0495665_0081414 | Ga0495665_0081414_160_921 | 253 |
| 659 | 3300046535 | Ga0495586_0002698 | Ga0495586_0002698_2648_3409 | 253 |
| 660 | 3300046542 | Ga0495597_0006152 | Ga0495597_0006152_2234_2995 | 253 |
| 661 | 3300046542 | Ga0495597_0009005 | Ga0495597_0009005_1479_2240 | 253 |
| 662 | 3300046543 | Ga0495645_0003302 | Ga0495645_0003302_7905_8666 | 253 |
| 663 | 3300046543 | Ga0495645_0014571 | Ga0495645_0014571_3078_3839 | 253 |
| 664 | 3300046559 | Ga0495667_0012570 | Ga0495667_0012570_1123_1884 | 253 |
| 665 | 3300046559 | Ga0495667_0233493 | Ga0495667_0233493_67_828 | 253 |
| 666 | 3300046616 | Ga0495668_0060458 | Ga0495668_0060458_31_792 | 253 |
| 667 | 3300046642 | Ga0495634_0009197 | Ga0495634_0009197_3664_4425 | 253 |
| 668 | 3300046660 | Ga0495625_0000052 | Ga0495625_0000052_145109_145888 | 253 |
| 669 | 3300046663 | Ga0495635_0038358 | Ga0495635_0038358_349_1110 | 253 |
| 670 | 3300046665 | Ga0495661_0002942 | Ga0495661_0002942_5928_6689 | 253 |
| 671 | 3300046674 | Ga0495588_0017092 | Ga0495588_0017092_1032_1793 | 253 |
| 672 | 3300046675 | Ga0495657_0032075 | Ga0495657_0032075_1100_1861 | 253 |
| 673 | 3300046679 | Ga0495623_0003273 | Ga0495623_0003273_3688_4449 | 253 |
| 674 | 3300046680 | Ga0495646_0001045 | Ga0495646_0001045_2166_2927 | 253 |
| 675 | 3300046680 | Ga0495646_0029437 | Ga0495646_0029437_1081_1842 | 253 |
| 676 | 3300046680 | Ga0495646_0033103 | Ga0495646_0033103_1421_2182 | 253 |
| 677 | 3300046690 | Ga0495624_0001307 | Ga0495624_0001307_3674_4435 | 253 |
| 678 | 3300046690 | Ga0495624_0031153 | Ga0495624_0031153_1702_2463 | 253 |
| 679 | 3300046694 | Ga0495649_0005770 | Ga0495649_0005770_3590_4351 | 253 |
| 680 | 3300046694 | Ga0495649_0053132 | Ga0495649_0053132_1377_2138 | 253 |
| 681 | 3300046694 | Ga0495649_0090611 | Ga0495649_0090611_245_1006 | 253 |
| 682 | 3300047315 | Ga0495581_0009026 | Ga0495581_0009026_830_1591 | 253 |
| 683 | 3300047317 | Ga0495604_0118385 | Ga0495604_0118385_638_1399 | 253 |
| 684 | 3300047319 | Ga0495674_0001217 | Ga0495674_0001217_16989_17750 | 253 |
| 685 | 3300047319 | Ga0495674_0002253 | Ga0495674_0002253_3674_4435 | 253 |
| 686 | 3300047319 | Ga0495674_0024544 | Ga0495674_0024544_3091_3852 | 253 |
| 687 | 3300047321 | Ga0495676_0109860 | Ga0495676_0109860_442_1203 | 253 |
| 688 | 3300047323 | Ga0495683_0002371 | Ga0495683_0002371_9145_9906 | 253 |
| 689 | 3300047443 | Ga0495687_000107 | Ga0495687_000107_98359_99120 | 253 |
| 690 | 3300047443 | Ga0495687_008885 | Ga0495687_008885_3536_4297 | 253 |
| 691 | 3300047443 | Ga0495687_010756 | Ga0495687_010756_58_819 | 253 |
| 692 | 3300047443 | Ga0495687_124672 | Ga0495687_124672_89_850 | 253 |
| 693 | 3300047444 | Ga0495675_0002298 | Ga0495675_0002298_1933_2694 | 253 |
| 694 | 3300047446 | Ga0495679_039141 | Ga0495679_039141_707_1468 | 253 |
| 695 | 3300047470 | Ga0495681_0053485 | Ga0495681_0053485_847_1608 | 253 |
| 696 | 3300047673 | Ga0495593_0008065 | Ga0495593_0008065_1720_2481 | 253 |
| 697 | 3300047673 | Ga0495593_0012169 | Ga0495593_0012169_2302_3063 | 253 |
| 698 | 3300048088 | Ga0495602_0010482 | Ga0495602_0010482_8508_9269 | 253 |
| 699 | 3300048903 | Ga0496100_0004204 | Ga0496100_0004204_5239_6000 | 253 |
| 700 | 3300048903 | Ga0496100_0299408 | Ga0496100_0299408_114_893 | 253 |
| 701 | 3300048904 | Ga0496101_0005882 | Ga0496101_0005882_2965_3726 | 253 |
| 702 | 3300048904 | Ga0496101_0009272 | Ga0496101_0009272_831_1610 | 253 |
| 703 | 3300048905 | Ga0496102_0001407 | Ga0496102_0001407_15125_15886 | 253 |
| 704 | 3300048905 | Ga0496102_0001828 | Ga0496102_0001828_2406_3185 | 253 |
| 705 | 3300048906 | Ga0496103_0001596 | Ga0496103_0001596_10192_10953 | 253 |
| 706 | 3300048906 | Ga0496103_0160106 | Ga0496103_0160106_61_840 | 253 |
| 707 | 3300048907 | Ga0496104_0027390 | Ga0496104_0027390_2933_3694 | 253 |
| 708 | 3300048907 | Ga0496104_0083196 | Ga0496104_0083196_1747_2526 | 253 |
| 709 | 3300048908 | Ga0496105_0345414 | Ga0496105_0345414_171_932 | 253 |
| 710 | 3300048909 | Ga0496106_0002609 | Ga0496106_0002609_10546_11307 | 253 |
| 711 | 3300048910 | Ga0496107_0007271 | Ga0496107_0007271_6305_7066 | 253 |
| 712 | 3300048911 | Ga0496108_0279274 | Ga0496108_0279274_317_1078 | 253 |
| 713 | 3300048912 | Ga0496109_0142043 | Ga0496109_0142043_744_1505 | 253 |
| 714 | 3300048913 | Ga0496110_0128177 | Ga0496110_0128177_756_1535 | 253 |
| 715 | 3300048914 | Ga0496111_0001486 | Ga0496111_0001486_1387_2148 | 253 |
| 716 | 3300048914 | Ga0496111_0273092 | Ga0496111_0273092_186_965 | 253 |
| 717 | 3300048915 | Ga0496112_0000459 | Ga0496112_0000459_19278_20039 | 253 |
| 718 | 3300048916 | Ga0496113_0020447 | Ga0496113_0020447_2162_2923 | 253 |
| 719 | 3300048916 | Ga0496113_0118140 | Ga0496113_0118140_1129_1908 | 253 |
| 720 | 3300048917 | Ga0496114_0013007 | Ga0496114_0013007_2725_3486 | 253 |
| 721 | 3300048918 | Ga0496115_0068376 | Ga0496115_0068376_1924_2685 | 253 |
| 722 | 3300048918 | Ga0496115_0138130 | Ga0496115_0138130_227_988 | 253 |
| 723 | 3300048919 | Ga0496116_0004003 | Ga0496116_0004003_10752_11513 | 253 |
| 724 | 3300048920 | Ga0496117_0015792 | Ga0496117_0015792_3285_4046 | 253 |
| 725 | 3300048921 | Ga0496118_0018268 | Ga0496118_0018268_3399_4160 | 253 |
| 726 | 3300048922 | Ga0496119_0082915 | Ga0496119_0082915_572_1333 | 253 |
| 727 | 3300048924 | Ga0496121_0008456 | Ga0496121_0008456_9510_10271 | 253 |
| 728 | 3300048925 | Ga0496122_0023201 | Ga0496122_0023201_364_1125 | 253 |
| 729 | 3300048926 | Ga0496123_0030007 | Ga0496123_0030007_687_1448 | 253 |
| 730 | 3300048927 | Ga0496124_0008181 | Ga0496124_0008181_5466_6227 | 253 |
| 731 | 3300048928 | Ga0496125_0033095 | Ga0496125_0033095_3238_3999 | 253 |
| 732 | 3300049570 | Ga0501033_0073113 | Ga0501033_0073113_1229_2050 | 253 |
| 733 | 3300049581 | Ga0501047_0009465 | Ga0501047_0009465_7642_8463 | 253 |
| 734 | 3300049822 | Ga0501035_0006019 | Ga0501035_0006019_6310_7131 | 253 |
| 735 | 3300053128 | Ga0500626_000564 | Ga0500626_000564_2754_3533 | 253 |
| 736 | iso_pu_bacteria | 2855730933 | 2855732249 | 253 |
| 737 | iso_pu_bacteria | 2855767633 | 2855768957 | 253 |
| 738 | iso_pu_bacteria | 2881412998 | 2881415098 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nbr-assembly1.cif.gz_A | crystal structure of 3-oxoacyl-[acyl-carrier protein] reductase from brucella melitensis atcc 23457 | 0.955 | 2 | 253 |
| 4wk6-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9542 | 2 | 251 |
| 5ts3-assembly1.cif.gz_B-2 | crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase with bound nad from brucella melitensis | 0.9538 | 2 | 253 |
| 5itv-assembly3.cif.gz_D | crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh | 0.9528 | 3 | 250 |
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.952 | 1 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ts3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9538 | 2 | 253 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9528 | 3 | 250 | 3.40.50.720 |
| af_Q0JEC9_1_74_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9493 | 4 | 60 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9478 | 2 | 251 | 3.40.50.720 |
| 2hq1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9471 | 1 | 249 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A261VF46-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase | 0.9699 | 2 | 251 |
GO:0016616
|
| AF-A0A1W6YZ98-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase | 0.9629 | 2 | 253 |
GO:0016491
|
| AF-A0A6A7LRF9-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9604 | 1 | 146 |
GO:0016491
|
| AF-A0A1M4LFM7-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9562 | 2 | 253 |
GO:0016616
|
| AF-C0G9X2-F1-model_v4 | Short chain dehydrogenase | 0.9559 | 2 | 253 |
GO:0016616
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar