F478384

General Info

Members Datasets Scaffolds Average Seq Length
738 283 1476 325

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10071557|Ga0105238_100715573
Length 349
Sequence MQKLLRFADISIADRTGASMITLTSFARASRAFVCALAVAAAATPAVAQDAYPSKPVRIIVPFAAGGPADVYARFLAERLQQSMGQTFIVDDRPGAGSIIGTDAVAKSAPDGYTLLLMSNTHTVNESLIANKPFQLMRDFAPIAPINSSDLVLVARRSLPVSTVHELIAAAKAKPGAMTYASSGPGTPYHMAGELFKALAGVSILHIPYKGSSGARTDVLGGQVDLMFDAVTTMTEHVRQGKVKALGTTGKTRSEVMPDVPTIAEAGVPGYEATIWLGLMAPKNTPAQIVSRLNAEVGKIVGQPEVVKAWRVQGAVPMTMSVAEFTKYLNDDIVKWARIVKVSGAKPEQ

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10071557 3300009551 Bacteria 3465
2 Ga0070658_10038972 3300005327 Bacteria 3833
3 Ga0070658_10069095 3300005327 Bacteria 2889
4 Ga0070658_10178290 3300005327 Bacteria 1788
5 Ga0070676_10006626 3300005328 Bacteria 6197
6 Ga0070676_10010777 3300005328 Bacteria 4961
7 Ga0070676_10021963 3300005328 Bacteria 3576
8 Ga0070676_10219195 3300005328 Bacteria 1256
9 Ga0070683_100007182 3300005329 Bacteria 9391
10 Ga0070683_100030885 3300005329 Bacteria 4867
11 Ga0070683_100039556 3300005329 Bacteria 4330
12 Ga0070690_100013351 3300005330 Bacteria 4849
13 Ga0070690_100041543 3300005330 Bacteria 2912
14 Ga0070690_100042787 3300005330 Bacteria 2869
15 Ga0070670_100008462 3300005331 Bacteria 8777
16 Ga0070670_100013351 3300005331 Bacteria 7034
17 Ga0070670_100051505 3300005331 Bacteria 3535
18 Ga0070670_100072433 3300005331 Bacteria 2959
19 Ga0070670_100277101 3300005331 Bacteria 1464
20 Ga0070677_10002013 3300005333 Bacteria 6459
21 Ga0070677_10039117 3300005333 Bacteria 1860
22 Ga0068869_100002941 3300005334 Bacteria 10343
23 Ga0068869_100008210 3300005334 Bacteria 6718
24 Ga0068869_100015759 3300005334 Bacteria 5080
25 Ga0070666_10002937 3300005335 Bacteria 10314
26 Ga0070666_10003117 3300005335 Bacteria 10072
27 Ga0070666_10006093 3300005335 Bacteria 7411
28 Ga0070666_10033038 3300005335 Bacteria 3421
29 Ga0070666_10230815 3300005335 Bacteria 1307
30 Ga0070680_100194013 3300005336 Bacteria 1712
31 Ga0070680_100330288 3300005336 Bacteria 1295
32 Ga0070682_100024784 3300005337 Bacteria 3574
33 Ga0068868_100006024 3300005338 Bacteria 8563
34 Ga0068868_100043259 3300005338 Bacteria 3518
35 Ga0068868_100112766 3300005338 Bacteria 2211
36 Ga0068868_100112875 3300005338 Bacteria 2209
37 Ga0068868_100255747 3300005338 Bacteria 1475
38 Ga0070660_100015941 3300005339 Bacteria 5443
39 Ga0070689_100007815 3300005340 Bacteria 7494
40 Ga0070689_100010101 3300005340 Bacteria 6720
41 Ga0070689_100034823 3300005340 Bacteria 3843
42 Ga0070689_100112561 3300005340 Bacteria 2166
43 Ga0070689_100264698 3300005340 Bacteria 1422
44 Ga0070661_100001163 3300005344 Bacteria 18546
45 Ga0070661_100002517 3300005344 Bacteria 12548
46 Ga0070661_100004458 3300005344 Bacteria 9655
47 Ga0070661_100020742 3300005344 Bacteria 4688
48 Ga0070661_100032933 3300005344 Bacteria 3754
49 Ga0070661_100050297 3300005344 Bacteria 3049
50 Ga0070661_100114099 3300005344 Bacteria 2020
51 Ga0070668_100006563 3300005347 Bacteria 8619
52 Ga0070668_100017926 3300005347 Bacteria 5310
53 Ga0070668_100089486 3300005347 Bacteria 2425
54 Ga0070669_100000703 3300005353 Bacteria 24519
55 Ga0070669_100010671 3300005353 Bacteria 6519
56 Ga0070669_100017967 3300005353 Bacteria 5051
57 Ga0070669_100025112 3300005353 Bacteria 4278
58 Ga0070669_100075027 3300005353 Bacteria 2507
59 Ga0070669_100082373 3300005353 Bacteria 2398
60 Ga0070669_100135105 3300005353 Bacteria 1896
61 Ga0070669_100163088 3300005353 Bacteria 1733
62 Ga0070669_100278085 3300005353 Bacteria 1340
63 Ga0070675_100008358 3300005354 Bacteria 8033
64 Ga0070675_100015033 3300005354 Bacteria 6114
65 Ga0070675_100019752 3300005354 Bacteria 5372
66 Ga0070675_100040486 3300005354 Bacteria 3804
67 Ga0070675_100050125 3300005354 Bacteria 3428
68 Ga0070675_100057458 3300005354 Bacteria 3208
69 Ga0070675_100407801 3300005354 Bacteria 1213
70 Ga0070671_100002148 3300005355 Bacteria 15230
71 Ga0070671_100002779 3300005355 Bacteria 13599
72 Ga0070671_100004213 3300005355 Bacteria 11377
73 Ga0070671_100005567 3300005355 Bacteria 10036
74 Ga0070671_100024596 3300005355 Bacteria 4932
75 Ga0070671_100054814 3300005355 Bacteria 3316
76 Ga0070671_100054877 3300005355 Bacteria 3314
77 Ga0070671_100058361 3300005355 Bacteria 3213
78 Ga0070671_100159378 3300005355 Bacteria 1907
79 Ga0070671_100185377 3300005355 Bacteria 1763
80 Ga0070674_100001675 3300005356 Bacteria 11979
81 Ga0070674_100009858 3300005356 Bacteria 5745
82 Ga0070674_100108214 3300005356 Bacteria 2037
83 Ga0070674_100194891 3300005356 Bacteria 1560
84 Ga0070673_100004285 3300005364 Bacteria 9005
85 Ga0070673_100007461 3300005364 Bacteria 7213
86 Ga0070673_100058265 3300005364 Bacteria 3053
87 Ga0070673_100108377 3300005364 Bacteria 2300
88 Ga0070673_100108608 3300005364 Bacteria 2297
89 Ga0070673_100132910 3300005364 Bacteria 2090
90 Ga0070673_100410746 3300005364 Bacteria 1212
91 Ga0070659_100030369 3300005366 Bacteria 4183
92 Ga0070659_100192578 3300005366 Bacteria 1676
93 Ga0070667_100002963 3300005367 Bacteria 14593
94 Ga0070667_100003662 3300005367 Bacteria 13081
95 Ga0070667_100006668 3300005367 Bacteria 9598
96 Ga0070667_100007802 3300005367 Bacteria 8874
97 Ga0070667_100013595 3300005367 Bacteria 6726
98 Ga0070667_100099996 3300005367 Bacteria 2504
99 Ga0070709_10008703 3300005434 Bacteria 5584
100 Ga0070709_10035113 3300005434 Bacteria 3045
101 Ga0070709_10068902 3300005434 Bacteria 2277
102 Ga0070709_10076840 3300005434 Bacteria 2169
103 Ga0070709_10084055 3300005434 Bacteria 2084
104 Ga0070714_100014948 3300005435 Bacteria 6240
105 Ga0070714_100033506 3300005435 Bacteria 4294
106 Ga0070714_100132569 3300005435 Bacteria 2228
107 Ga0070713_100004952 3300005436 Bacteria 9043
108 Ga0070713_100125784 3300005436 Bacteria 2254
109 Ga0070713_100186705 3300005436 Bacteria 1866
110 Ga0070710_10002378 3300005437 Bacteria 8909
111 Ga0070701_10052732 3300005438 Bacteria 2114
112 Ga0070700_100022620 3300005441 Bacteria 3669
113 Ga0070700_100131993 3300005441 Bacteria 1687
114 Ga0070663_100002838 3300005455 Bacteria 9844
115 Ga0070663_100010680 3300005455 Bacteria 5730
116 Ga0070663_100122677 3300005455 Bacteria 1964
117 Ga0070678_100004327 3300005456 Bacteria 8034
118 Ga0070678_100014019 3300005456 Bacteria 5041
119 Ga0070678_100077605 3300005456 Bacteria 2506
120 Ga0070678_100144515 3300005456 Bacteria 1907
121 Ga0070678_100184737 3300005456 Bacteria 1710
122 Ga0070662_100000827 3300005457 Bacteria 19059
123 Ga0070662_100003262 3300005457 Bacteria 10093
124 Ga0070662_100012595 3300005457 Bacteria 5610
125 Ga0070662_100019182 3300005457 Bacteria 4640
126 Ga0070662_100199012 3300005457 Bacteria 1589
127 Ga0070681_10006174 3300005458 Bacteria 11640
128 Ga0070681_10008534 3300005458 Bacteria 10033
129 Ga0070681_10022228 3300005458 Bacteria 6366
130 Ga0068867_100001658 3300005459 Bacteria 15497
131 Ga0068867_100002428 3300005459 Bacteria 13095
132 Ga0068867_100004893 3300005459 Bacteria 9428
133 Ga0068867_100007088 3300005459 Bacteria 7922
134 Ga0068867_100029241 3300005459 Bacteria 3970
135 Ga0068867_100214604 3300005459 Bacteria 1547
136 Ga0068867_100245561 3300005459 Bacteria 1453
137 Ga0070685_10056628 3300005466 Bacteria 2279
138 Ga0070699_100017505 3300005518 Bacteria 6150
139 Ga0070679_100003587 3300005530 Bacteria 14196
140 Ga0070679_100188447 3300005530 Bacteria 2032
141 Ga0070679_100204541 3300005530 Bacteria 1939
142 Ga0070684_100074081 3300005535 Bacteria 3001
143 Ga0070684_100116544 3300005535 Bacteria 2399
144 Ga0068853_100017860 3300005539 Bacteria 5860
145 Ga0068853_100144640 3300005539 Bacteria 2136
146 Ga0068853_100281595 3300005539 Bacteria 1533
147 Ga0070672_100001237 3300005543 Bacteria 15684
148 Ga0070672_100002999 3300005543 Bacteria 10878
149 Ga0070672_100015202 3300005543 Bacteria 5473
150 Ga0070672_100031023 3300005543 Bacteria 4020
151 Ga0070672_100038186 3300005543 Bacteria 3667
152 Ga0070672_100046661 3300005543 Bacteria 3357
153 Ga0070672_100090681 3300005543 Bacteria 2465
154 Ga0070672_100168707 3300005543 Bacteria 1819
155 Ga0070672_100304933 3300005543 Bacteria 1351
156 Ga0070693_100027970 3300005547 Bacteria 3062
157 Ga0070665_100034048 3300005548 Bacteria 5123
158 Ga0070665_100073195 3300005548 Bacteria 3433
159 Ga0070665_100080552 3300005548 Bacteria 3262
160 Ga0070665_100113254 3300005548 Bacteria 2715
161 Ga0070665_100570285 3300005548 Bacteria 1144
162 Ga0068855_100004781 3300005563 Bacteria 16532
163 Ga0068855_100048925 3300005563 Bacteria 4988
164 Ga0068855_100062803 3300005563 Bacteria 4335
165 Ga0068855_100075008 3300005563 Bacteria 3927
166 Ga0068855_100158356 3300005563 Bacteria 2572
167 Ga0070664_100000152 3300005564 Bacteria 47795
168 Ga0070664_100006501 3300005564 Bacteria 9420
169 Ga0070664_100046254 3300005564 Bacteria 3676
170 Ga0070664_100057608 3300005564 Bacteria 3303
171 Ga0070664_100129450 3300005564 Bacteria 2216
172 Ga0068857_100034689 3300005577 Bacteria 4462
173 Ga0068857_100098900 3300005577 Bacteria 2617
174 Ga0068857_100114033 3300005577 Bacteria 2430
175 Ga0068857_100133405 3300005577 Bacteria 2241
176 Ga0068857_100444974 3300005577 Bacteria 1211
177 Ga0068854_100013085 3300005578 Bacteria 5439
178 Ga0068856_100000093 3300005614 Bacteria 84752
179 Ga0068856_100018144 3300005614 Bacteria 6822
180 Ga0068856_100034204 3300005614 Bacteria 4978
181 Ga0068856_100039961 3300005614 Bacteria 4606
182 Ga0068856_100043551 3300005614 Bacteria 4416
183 Ga0068856_100210731 3300005614 Bacteria 1958
184 Ga0070702_100259425 3300005615 Bacteria 1182
185 Ga0068852_100002316 3300005616 Bacteria 13089
186 Ga0068852_100007090 3300005616 Bacteria 8165
187 Ga0068852_100018088 3300005616 Bacteria 5545
188 Ga0068852_100072473 3300005616 Bacteria 3027
189 Ga0068852_100377612 3300005616 Bacteria 1390
190 Ga0068859_100008717 3300005617 Bacteria 10248
191 Ga0068859_100097646 3300005617 Bacteria 2991
192 Ga0068859_100105275 3300005617 Bacteria 2880
193 Ga0068859_100214803 3300005617 Bacteria 2010
194 Ga0068864_100001297 3300005618 Bacteria 20799
195 Ga0068864_100001959 3300005618 Bacteria 16928
196 Ga0068864_100020907 3300005618 Bacteria 5478
197 Ga0068864_100024057 3300005618 Bacteria 5120
198 Ga0068864_100044371 3300005618 Bacteria 3810
199 Ga0068864_100049557 3300005618 Bacteria 3614
200 Ga0068864_100057582 3300005618 Bacteria 3358
201 Ga0068864_100069289 3300005618 Bacteria 3067
202 Ga0068866_10005854 3300005718 Bacteria 5104
203 Ga0068866_10011312 3300005718 Bacteria 3857
204 Ga0068866_10071157 3300005718 Bacteria 1839
205 Ga0068861_100003125 3300005719 Bacteria 10939
206 Ga0068861_100026691 3300005719 Bacteria 4201
207 Ga0068861_100058140 3300005719 Bacteria 2956
208 Ga0068861_100148460 3300005719 Bacteria 1921
209 Ga0068851_10002770 3300005834 Bacteria 7725
210 Ga0068851_10005190 3300005834 Bacteria 5913
211 Ga0068851_10038242 3300005834 Bacteria 2406
212 Ga0068851_10051815 3300005834 Bacteria 2086
213 Ga0068851_10112432 3300005834 Bacteria 1455
214 Ga0068870_10031559 3300005840 Bacteria 2685
215 Ga0068870_10152355 3300005840 Bacteria 1363
216 Ga0068863_100002914 3300005841 Bacteria 16966
217 Ga0068863_100011402 3300005841 Bacteria 8600
218 Ga0068863_100023298 3300005841 Bacteria 5915
219 Ga0068863_100025750 3300005841 Bacteria 5611
220 Ga0068863_100082868 3300005841 Bacteria 3039
221 Ga0068863_100097888 3300005841 Bacteria 2786
222 Ga0068863_100133660 3300005841 Bacteria 2369
223 Ga0068863_100559558 3300005841 Bacteria 1130
224 Ga0068858_100000729 3300005842 Bacteria 34410
225 Ga0068858_100003258 3300005842 Bacteria 16181
226 Ga0068858_100007127 3300005842 Bacteria 10858
227 Ga0068858_100010459 3300005842 Bacteria 8789
228 Ga0068858_100029114 3300005842 Bacteria 5128
229 Ga0068858_100056819 3300005842 Bacteria 3617
230 Ga0068858_100134991 3300005842 Bacteria 2315
231 Ga0068860_100004309 3300005843 Bacteria 14547
232 Ga0068860_100020088 3300005843 Bacteria 6471
233 Ga0068860_100036517 3300005843 Bacteria 4707
234 Ga0068860_100039107 3300005843 Bacteria 4537
235 Ga0068862_100187360 3300005844 Bacteria 1860
236 Ga0068862_100240530 3300005844 Bacteria 1646
237 Ga0081455_10002056 3300005937 Bacteria 24066
238 Ga0081540_1000313 3300005983 Bacteria 50236
239 Ga0070717_10259098 3300006028 Bacteria 1538
240 Ga0075365_10118008 3300006038 Bacteria 1828
241 Ga0070715_10038775 3300006163 Bacteria 1980
242 Ga0075367_10002955 3300006178 Bacteria 7942
243 Ga0075367_10036455 3300006178 Bacteria 2852
244 Ga0075366_10000957 3300006195 Bacteria 14080
245 Ga0097621_100027028 3300006237 Bacteria 4508
246 Ga0097621_100385941 3300006237 Bacteria 1252
247 Ga0068871_100009333 3300006358 Bacteria 7103
248 Ga0068871_100016446 3300006358 Bacteria 5571
249 Ga0068871_100063765 3300006358 Bacteria 3015
250 Ga0068871_100177611 3300006358 Bacteria 1828
251 Ga0075428_100014820 3300006844 Bacteria 8663
252 Ga0075430_100044473 3300006846 Bacteria 3754
253 Ga0075431_100015583 3300006847 Bacteria 7704
254 Ga0075434_100066222 3300006871 Bacteria 3598
255 Ga0075429_100000003 3300006880 Bacteria 130377
256 Ga0068865_100000968 3300006881 Bacteria 16397
257 Ga0068865_100025566 3300006881 Bacteria 3885
258 Ga0097620_100008717 3300006931 Bacteria 10248
259 Ga0097620_100097646 3300006931 Bacteria 2991
260 Ga0097620_100105274 3300006931 Bacteria 2880
261 Ga0097620_100214795 3300006931 Bacteria 2010
262 Ga0105240_10002702 3300009093 Bacteria 28208
263 Ga0105240_10006429 3300009093 Bacteria 17273
264 Ga0111539_10683744 3300009094 Bacteria 1195
265 Ga0111539_10696005 3300009094 Bacteria 1183
266 Ga0105245_10017282 3300009098 Bacteria 6294
267 Ga0105245_10118338 3300009098 Bacteria 2472
268 Ga0105247_10021696 3300009101 Bacteria 3864
269 Ga0114129_10005359 3300009147 Bacteria 18104
270 Ga0114129_10183640 3300009147 Bacteria 2844
271 Ga0105243_10020478 3300009148 Bacteria 5014
272 Ga0105243_10086073 3300009148 Bacteria 2577
273 Ga0105243_10189703 3300009148 Bacteria 1794
274 Ga0105241_10001154 3300009174 Bacteria 20103
275 Ga0105241_10059857 3300009174 Bacteria 2929
276 Ga0105241_10402513 3300009174 Bacteria 1201
277 Ga0105242_10014088 3300009176 Bacteria 6189
278 Ga0105248_10007025 3300009177 Bacteria 12334
279 Ga0105248_10010702 3300009177 Bacteria 10123
280 Ga0105248_10016915 3300009177 Bacteria 8030
281 Ga0105248_10021738 3300009177 Bacteria 7108
282 Ga0105237_10040115 3300009545 Bacteria 4722
283 Ga0105237_10093770 3300009545 Bacteria 2991
284 Ga0105237_10099157 3300009545 Bacteria 2905
285 Ga0105237_10198199 3300009545 Bacteria 2007
286 Ga0105238_10003012 3300009551 Bacteria 16820
287 Ga0105238_10049052 3300009551 Bacteria 4254
288 Ga0105238_10144516 3300009551 Bacteria 2355
289 Ga0105239_10357501 3300010375 Bacteria 1649
290 Ga0105239_10420440 3300010375 Bacteria 1514
291 Ga0105246_10083596 3300011119 Bacteria 2282
292 Ga0157373_10005664 3300013100 Bacteria 9360
293 Ga0157373_10020608 3300013100 Bacteria 4790
294 Ga0157373_10030761 3300013100 Bacteria 3863
295 Ga0157373_10154523 3300013100 Bacteria 1614
296 Ga0157371_10000696 3300013102 Bacteria 39564
297 Ga0157370_10004239 3300013104 Bacteria 16583
298 Ga0157370_10007103 3300013104 Bacteria 12223
299 Ga0157370_10034563 3300013104 Bacteria 4919
300 Ga0157370_10036749 3300013104 Bacteria 4751
301 Ga0157370_10242582 3300013104 Bacteria 1667
302 Ga0157369_10033319 3300013105 Bacteria 5662
303 Ga0157369_10079192 3300013105 Bacteria 3519
304 Ga0157369_10105602 3300013105 Bacteria 2998
305 Ga0157369_10240825 3300013105 Bacteria 1890
306 Ga0157374_10015544 3300013296 Bacteria 6677
307 Ga0157374_10074601 3300013296 Bacteria 3204
308 Ga0157378_10005031 3300013297 Bacteria 11605
309 Ga0157378_10009099 3300013297 Bacteria 8647
310 Ga0157378_10156425 3300013297 Bacteria 2128
311 Ga0157378_10200607 3300013297 Bacteria 1887
312 Ga0163162_10006321 3300013306 Bacteria 11471
313 Ga0163162_10012725 3300013306 Bacteria 8217
314 Ga0163162_10019386 3300013306 Bacteria 6671
315 Ga0163162_10040663 3300013306 Bacteria 4650
316 Ga0163162_10069143 3300013306 Bacteria 3583
317 Ga0163162_10236441 3300013306 Bacteria 1957
318 Ga0163162_10438558 3300013306 Bacteria 1438
319 Ga0157372_10006652 3300013307 Bacteria 12300
320 Ga0157372_10017050 3300013307 Bacteria 7798
321 Ga0157372_10020731 3300013307 Bacteria 7096
322 Ga0157372_10039214 3300013307 Bacteria 5228
323 Ga0157372_10257305 3300013307 Bacteria 2027
324 Ga0157372_10257905 3300013307 Bacteria 2024
325 Ga0157375_10011280 3300013308 Bacteria 7889
326 Ga0157375_10046064 3300013308 Bacteria 4249
327 Ga0157375_10061788 3300013308 Bacteria 3721
328 Ga0157375_10070170 3300013308 Bacteria 3513
329 Ga0157375_10115633 3300013308 Bacteria 2786
330 Ga0157375_10355364 3300013308 Bacteria 1631
331 Ga0163163_10005612 3300014325 Bacteria 10872
332 Ga0157380_10051443 3300014326 Bacteria 3258
333 Ga0157380_10076156 3300014326 Bacteria 2729
334 Ga0157380_10126496 3300014326 Bacteria 2173
335 Ga0157380_10326050 3300014326 Bacteria 1426
336 Ga0157380_10444018 3300014326 Bacteria 1244
337 Ga0157377_10030418 3300014745 Bacteria 2925
338 Ga0157377_10113807 3300014745 Bacteria 1630
339 Ga0157379_10004210 3300014968 Bacteria 12286
340 Ga0157379_10012185 3300014968 Bacteria 7511
341 Ga0157379_10027063 3300014968 Bacteria 5104
342 Ga0157379_10027423 3300014968 Bacteria 5072
343 Ga0157379_10048460 3300014968 Bacteria 3792
344 Ga0157379_10063062 3300014968 Bacteria 3314
345 Ga0157379_10350138 3300014968 Bacteria 1352
346 Ga0157376_10032082 3300014969 Bacteria 4214
347 Ga0157376_10042780 3300014969 Bacteria 3714
348 Ga0163161_10014345 3300017792 Bacteria 5515
349 Ga0163161_10016630 3300017792 Bacteria 5137
350 Ga0163161_10151608 3300017792 Bacteria 1762
351 Ga0163161_10219535 3300017792 Bacteria 1472
352 Ga0213875_10055598 3300021388 Bacteria 1854
353 Ga0207697_10005139 3300025315 Bacteria 6117
354 Ga0207656_10026749 3300025321 Bacteria 2354
355 Ga0207656_10034710 3300025321 Bacteria 2107
356 Ga0207656_10041790 3300025321 Bacteria 1949
357 Ga0207682_10003194 3300025893 Bacteria 7171
358 Ga0207682_10003662 3300025893 Bacteria 6632
359 Ga0207682_10005486 3300025893 Bacteria 5165
360 Ga0207682_10042845 3300025893 Bacteria 1850
361 Ga0207692_10029153 3300025898 Bacteria 2619
362 Ga0207692_10125477 3300025898 Bacteria 1443
363 Ga0207642_10017417 3300025899 Bacteria 2732
364 Ga0207642_10091773 3300025899 Bacteria 1502
365 Ga0207710_10012681 3300025900 Bacteria 3547
366 Ga0207688_10036655 3300025901 Bacteria 2719
367 Ga0207688_10086011 3300025901 Bacteria 1801
368 Ga0207680_10001451 3300025903 Bacteria 11248
369 Ga0207680_10006222 3300025903 Bacteria 5760
370 Ga0207647_10188483 3300025904 Bacteria 1196
371 Ga0207699_10004274 3300025906 Bacteria 6831
372 Ga0207699_10013825 3300025906 Bacteria 4143
373 Ga0207699_10073449 3300025906 Bacteria 2098
374 Ga0207699_10151573 3300025906 Bacteria 1534
375 Ga0207645_10000930 3300025907 Bacteria 24267
376 Ga0207645_10013116 3300025907 Bacteria 5598
377 Ga0207645_10015439 3300025907 Bacteria 5072
378 Ga0207645_10147256 3300025907 Bacteria 1536
379 Ga0207654_10230110 3300025911 Bacteria 1234
380 Ga0207707_10008674 3300025912 Bacteria 8822
381 Ga0207707_10041031 3300025912 Bacteria 4041
382 Ga0207707_10143737 3300025912 Bacteria 2085
383 Ga0207695_10076155 3300025913 Bacteria 3412
384 Ga0207671_10046808 3300025914 Bacteria 3200
385 Ga0207671_10165688 3300025914 Bacteria 1713
386 Ga0207671_10241857 3300025914 Bacteria 1418
387 Ga0207693_10004943 3300025915 Bacteria 11203
388 Ga0207660_10002422 3300025917 Bacteria 12251
389 Ga0207660_10127395 3300025917 Bacteria 1935
390 Ga0207660_10335885 3300025917 Bacteria 1209
391 Ga0207660_10424668 3300025917 Bacteria 1073
392 Ga0207662_10006278 3300025918 Bacteria 6402
393 Ga0207657_10000045 3300025919 Bacteria 114661
394 Ga0207657_10008538 3300025919 Bacteria 10388
395 Ga0207657_10015160 3300025919 Bacteria 7485
396 Ga0207657_10046535 3300025919 Bacteria 3799
397 Ga0207657_10076083 3300025919 Bacteria 2832
398 Ga0207657_10104022 3300025919 Bacteria 2353
399 Ga0207649_10002175 3300025920 Bacteria 11083
400 Ga0207649_10021178 3300025920 Bacteria 3738
401 Ga0207649_10028095 3300025920 Bacteria 3309
402 Ga0207652_10028914 3300025921 Bacteria 4627
403 Ga0207652_10034707 3300025921 Bacteria 4252
404 Ga0207652_10066886 3300025921 Bacteria 3115
405 Ga0207652_10166294 3300025921 Bacteria 1978
406 Ga0207652_10208730 3300025921 Bacteria 1758
407 Ga0207681_10008494 3300025923 Bacteria 6276
408 Ga0207681_10016331 3300025923 Bacteria 4642
409 Ga0207681_10018436 3300025923 Bacteria 4397
410 Ga0207681_10064768 3300025923 Bacteria 2525
411 Ga0207681_10085109 3300025923 Bacteria 2243
412 Ga0207681_10153744 3300025923 Bacteria 1727
413 Ga0207694_10021014 3300025924 Bacteria 4941
414 Ga0207694_10080374 3300025924 Bacteria 2558
415 Ga0207694_10116776 3300025924 Bacteria 2127
416 Ga0207650_10003438 3300025925 Bacteria 10883
417 Ga0207650_10005120 3300025925 Bacteria 8945
418 Ga0207650_10019766 3300025925 Bacteria 4737
419 Ga0207650_10053216 3300025925 Bacteria 3000
420 Ga0207650_10235668 3300025925 Bacteria 1478
421 Ga0207659_10002463 3300025926 Bacteria 11038
422 Ga0207659_10013645 3300025926 Bacteria 5212
423 Ga0207659_10013858 3300025926 Bacteria 5182
424 Ga0207659_10025053 3300025926 Bacteria 4004
425 Ga0207659_10026817 3300025926 Bacteria 3893
426 Ga0207659_10272011 3300025926 Bacteria 1382
427 Ga0207687_10055910 3300025927 Bacteria 2766
428 Ga0207687_10059337 3300025927 Bacteria 2695
429 Ga0207687_10121380 3300025927 Bacteria 1955
430 Ga0207700_10195097 3300025928 Bacteria 1703
431 Ga0207664_10006610 3300025929 Bacteria 7985
432 Ga0207664_10034959 3300025929 Unclassified 3874
433 Ga0207664_10073502 3300025929 Bacteria 2759
434 Ga0207664_10139257 3300025929 Bacteria 2051
435 Ga0207644_10000899 3300025931 Bacteria 18825
436 Ga0207644_10006192 3300025931 Bacteria 7803
437 Ga0207644_10008628 3300025931 Bacteria 6668
438 Ga0207644_10010401 3300025931 Bacteria 6130
439 Ga0207644_10011430 3300025931 Bacteria 5874
440 Ga0207644_10015764 3300025931 Bacteria 5080
441 Ga0207644_10017295 3300025931 Bacteria 4867
442 Ga0207644_10029367 3300025931 Bacteria 3814
443 Ga0207644_10030228 3300025931 Bacteria 3764
444 Ga0207644_10060211 3300025931 Bacteria 2747
445 Ga0207644_10108880 3300025931 Bacteria 2092
446 Ga0207690_10008126 3300025932 Bacteria 6225
447 Ga0207706_10000149 3300025933 Bacteria 76532
448 Ga0207706_10004918 3300025933 Bacteria 12497
449 Ga0207706_10063073 3300025933 Bacteria 3263
450 Ga0207706_10197542 3300025933 Bacteria 1764
451 Ga0207670_10007087 3300025936 Bacteria 6243
452 Ga0207669_10002834 3300025937 Bacteria 7429
453 Ga0207669_10005706 3300025937 Bacteria 5614
454 Ga0207669_10008202 3300025937 Bacteria 4893
455 Ga0207669_10094153 3300025937 Bacteria 1959
456 Ga0207669_10145510 3300025937 Bacteria 1652
457 Ga0207704_10011475 3300025938 Bacteria 4362
458 Ga0207704_10018556 3300025938 Bacteria 3634
459 Ga0207704_10075417 3300025938 Bacteria 2156
460 Ga0207704_10252369 3300025938 Bacteria 1325
461 Ga0207704_10274919 3300025938 Bacteria 1277
462 Ga0207691_10000229 3300025940 Bacteria 54461
463 Ga0207691_10000427 3300025940 Bacteria 41828
464 Ga0207691_10002230 3300025940 Bacteria 18966
465 Ga0207691_10012281 3300025940 Bacteria 8210
466 Ga0207691_10023136 3300025940 Bacteria 5850
467 Ga0207691_10098557 3300025940 Bacteria 2611
468 Ga0207691_10143168 3300025940 Bacteria 2105
469 Ga0207691_10290176 3300025940 Bacteria 1407
470 Ga0207711_10062825 3300025941 Bacteria 3204
471 Ga0207711_10099325 3300025941 Bacteria 2573
472 Ga0207711_10173222 3300025941 Bacteria 1959
473 Ga0207711_10336826 3300025941 Bacteria 1396
474 Ga0207689_10000534 3300025942 Bacteria 36072
475 Ga0207689_10014374 3300025942 Bacteria 6734
476 Ga0207689_10020977 3300025942 Bacteria 5492
477 Ga0207689_10022098 3300025942 Bacteria 5350
478 Ga0207661_10042690 3300025944 Bacteria 3576
479 Ga0207679_10007689 3300025945 Bacteria 6847
480 Ga0207679_10030294 3300025945 Bacteria 3776
481 Ga0207679_10037851 3300025945 Bacteria 3433
482 Ga0207679_10050669 3300025945 Bacteria 3035
483 Ga0207679_10109357 3300025945 Bacteria 2178
484 Ga0207667_10006125 3300025949 Bacteria 14614
485 Ga0207667_10009172 3300025949 Bacteria 11683
486 Ga0207667_10066614 3300025949 Bacteria 3753
487 Ga0207667_10110217 3300025949 Bacteria 2840
488 Ga0207651_10000426 3300025960 Bacteria 17948
489 Ga0207651_10003355 3300025960 Bacteria 7852
490 Ga0207651_10014425 3300025960 Bacteria 4562
491 Ga0207651_10042232 3300025960 Bacteria 3033
492 Ga0207651_10109840 3300025960 Bacteria 2067
493 Ga0207651_10394827 3300025960 Bacteria 1175
494 Ga0207712_10113305 3300025961 Bacteria 2038
495 Ga0207668_10006200 3300025972 Bacteria 7059
496 Ga0207668_10023509 3300025972 Bacteria 3963
497 Ga0207668_10034913 3300025972 Bacteria 3344
498 Ga0207640_10008111 3300025981 Bacteria 5813
499 Ga0207640_10036740 3300025981 Bacteria 3077
500 Ga0207640_10127115 3300025981 Bacteria 1837
501 Ga0207658_10014038 3300025986 Bacteria 5482
502 Ga0207658_10016118 3300025986 Bacteria 5134
503 Ga0207658_10042566 3300025986 Bacteria 3295
504 Ga0207658_10054412 3300025986 Bacteria 2961
505 Ga0207677_10001186 3300026023 Bacteria 14157
506 Ga0207677_10090607 3300026023 Bacteria 2222
507 Ga0207677_10140060 3300026023 Bacteria 1851
508 Ga0207703_10006732 3300026035 Bacteria 9167
509 Ga0207703_10008279 3300026035 Bacteria 8211
510 Ga0207703_10011058 3300026035 Bacteria 7032
511 Ga0207703_10024049 3300026035 Bacteria 4793
512 Ga0207703_10028143 3300026035 Bacteria 4427
513 Ga0207639_10067425 3300026041 Bacteria 2784
514 Ga0207639_10070474 3300026041 Bacteria 2730
515 Ga0207639_10075376 3300026041 Bacteria 2652
516 Ga0207639_10268590 3300026041 Bacteria 1495
517 Ga0207678_10003299 3300026067 Bacteria 14542
518 Ga0207678_10005357 3300026067 Bacteria 11489
519 Ga0207678_10077448 3300026067 Bacteria 2848
520 Ga0207678_10243294 3300026067 Bacteria 1541
521 Ga0207708_10059652 3300026075 Bacteria 2913
522 Ga0207702_10002780 3300026078 Bacteria 16396
523 Ga0207702_10024915 3300026078 Bacteria 4964
524 Ga0207702_10030260 3300026078 Bacteria 4511
525 Ga0207702_10034801 3300026078 Bacteria 4213
526 Ga0207641_10005867 3300026088 Bacteria 10421
527 Ga0207641_10007082 3300026088 Bacteria 9366
528 Ga0207641_10012653 3300026088 Bacteria 6918
529 Ga0207641_10044089 3300026088 Bacteria 3749
530 Ga0207641_10071896 3300026088 Bacteria 2977
531 Ga0207641_10138801 3300026088 Bacteria 2190
532 Ga0207641_10175007 3300026088 Bacteria 1962
533 Ga0207648_10007896 3300026089 Bacteria 10380
534 Ga0207648_10009020 3300026089 Bacteria 9592
535 Ga0207648_10015197 3300026089 Bacteria 7086
536 Ga0207648_10026307 3300026089 Bacteria 5173
537 Ga0207648_10054752 3300026089 Bacteria 3483
538 Ga0207676_10000572 3300026095 Bacteria 30479
539 Ga0207676_10008732 3300026095 Bacteria 7207
540 Ga0207676_10024429 3300026095 Bacteria 4471
541 Ga0207676_10029091 3300026095 Bacteria 4133
542 Ga0207676_10032079 3300026095 Bacteria 3956
543 Ga0207676_10053510 3300026095 Bacteria 3160
544 Ga0207676_10060766 3300026095 Bacteria 2990
545 Ga0207676_10230755 3300026095 Bacteria 1654
546 Ga0207676_10348655 3300026095 Bacteria 1368
547 Ga0207674_10000020 3300026116 Bacteria 162474
548 Ga0207674_10005781 3300026116 Bacteria 14669
549 Ga0207674_10016690 3300026116 Bacteria 8025
550 Ga0207674_10026116 3300026116 Bacteria 6213
551 Ga0207674_10055498 3300026116 Bacteria 4027
552 Ga0207674_10200449 3300026116 Bacteria 1945
553 Ga0207675_100000977 3300026118 Bacteria 28393
554 Ga0207675_100095977 3300026118 Bacteria 2791
555 Ga0207675_100142898 3300026118 Bacteria 2274
556 Ga0207675_100176299 3300026118 Bacteria 2045
557 Ga0207683_10000255 3300026121 Bacteria 47453
558 Ga0207683_10009517 3300026121 Bacteria 8284
559 Ga0207683_10009854 3300026121 Bacteria 8149
560 Ga0207683_10012448 3300026121 Bacteria 7261
561 Ga0207683_10103230 3300026121 Bacteria 2546
562 Ga0207683_10183269 3300026121 Bacteria 1899
563 Ga0207683_10247104 3300026121 Bacteria 1628
564 Ga0207698_10000678 3300026142 Bacteria 19757
565 Ga0207698_10040085 3300026142 Bacteria 3476
566 Ga0207698_10096091 3300026142 Bacteria 2441
567 Ga0207698_10156733 3300026142 Bacteria 1985
568 Ga0207698_10163891 3300026142 Bacteria 1948
569 Ga0209969_1004367 3300027360 Bacteria 1976
570 Ga0209981_1009139 3300027378 Bacteria 1353
571 Ga0210000_1000587 3300027462 Bacteria 4982
572 Ga0209995_1002182 3300027471 Bacteria 3075
573 Ga0209999_1003367 3300027543 Bacteria 2854
574 Ga0209970_1014656 3300027614 Bacteria 1302
575 Ga0209983_1015547 3300027665 Bacteria 1570
576 Ga0209971_1008724 3300027682 Bacteria 2404
577 Ga0209974_10005410 3300027876 Bacteria 4494
578 Ga0268266_10030810 3300028379 Bacteria 4555
579 Ga0268266_10220163 3300028379 Bacteria 1744
580 Ga0268265_10059617 3300028380 Bacteria 2921
581 Ga0268265_10184664 3300028380 Bacteria 1795
582 Ga0268265_10204180 3300028380 Bacteria 1717
583 Ga0268264_10003403 3300028381 Bacteria 13736
584 Ga0268264_10004892 3300028381 Bacteria 11351
585 Ga0268264_10023821 3300028381 Bacteria 4994
586 Ga0268264_10024856 3300028381 Bacteria 4894
587 Ga0268264_10204319 3300028381 Bacteria 1809
588 Ga0265334_10011495 3300028573 Bacteria 3727
589 Ga0307517_10029255 3300028786 Bacteria 6516
590 Ga0307515_10027818 3300028794 Bacteria 9641
591 Ga0307515_10045696 3300028794 Bacteria 6718
592 Ga0265763_1000043 3300030763 Bacteria 4926
593 Ga0265332_10004952 3300031238 Bacteria 6191
594 Ga0265329_10006218 3300031242 Bacteria 4756
595 Ga0265340_10037750 3300031247 Bacteria 2392
596 Ga0265331_10002953 3300031250 Bacteria 11208
597 Ga0265316_10011908 3300031344 Bacteria 7820
598 Ga0307513_10002039 3300031456 Bacteria 28431
599 Ga0307513_10091844 3300031456 Bacteria 3092
600 Ga0307509_10003320 3300031507 Bacteria 24618
601 Ga0307509_10015069 3300031507 Bacteria 9054
602 Ga0307509_10049191 3300031507 Bacteria 4522
603 Ga0307509_10323607 3300031507 Bacteria 1277
604 Ga0307508_10013319 3300031616 Bacteria 7520
605 Ga0307508_10035587 3300031616 Bacteria 4487
606 Ga0307508_10088128 3300031616 Bacteria 2687
607 Ga0265314_10000675 3300031711 Bacteria 41616
608 Ga0307405_10078564 3300031731 Bacteria 2148
609 Ga0307412_10009961 3300031911 Bacteria 5467
610 Ga0307409_100019238 3300031995 Bacteria 4617
611 Ga0307409_100175482 3300031995 Bacteria 1891
612 Ga0307416_100003082 3300032002 Bacteria 9747
613 Ga0307416_100021079 3300032002 Bacteria 4669
614 Ga0307414_10105381 3300032004 Bacteria 2132
615 Ga0307414_10223272 3300032004 Bacteria 1548
616 Ga0307415_100006914 3300032126 Bacteria 6160
617 Ga0307507_10038308 3300033179 Bacteria 4864
618 Ga0307510_10004077 3300033180 Bacteria 17138
619 Ga0373932_0008285 3300035112 Bacteria 2483
620 Ga0373954_0031280 3300035118 Bacteria 2457
621 Ga0373955_0161011 3300035172 Bacteria 1325
622 Ga0373931_0011481 3300035691 Bacteria 4281
623 Ga0373931_0116909 3300035691 Bacteria 1520
624 Ga0373931_0215223 3300035691 Bacteria 1154
625 Ga0373935_0309779 3300035692 Bacteria 1118
626 Ga0373927_0006163 3300035695 Bacteria 8196
627 Ga0373937_0063736 3300036401 Bacteria 3390
628 Ga0373937_0272260 3300036401 Bacteria 1598
629 Ga0373925_0055592 3300037068 Bacteria 2964
630 Ga0373925_0288195 3300037068 Bacteria 1324
631 Ga0395899_0035008 3300037312 Bacteria 3771
632 Ga0395900_0042602 3300037418 Bacteria 4678
633 Ga0395900_0178929 3300037418 Bacteria 2156
634 Ga0395898_0350567 3300037466 Bacteria 1408
635 Ga0395905_0119984 3300037471 Bacteria 2471
636 Ga0395901_0047820 3300038443 Bacteria 4442
637 Ga0395901_0309598 3300038443 Bacteria 1636
638 Ga0436363_0039369 3300039450 Bacteria 2254
639 Ga0436363_1432274 3300039450 Bacteria 3391
640 Ga0439460_0014745 3300042461 Bacteria 2057
641 Ga0451577_0087317 3300042876 Bacteria 2783
642 Ga0453683_0002604 3300044673 Bacteria 13836
643 Ga0466957_0015486 3300044842 Bacteria 4454
644 Ga0451576_0000958 3300045051 Bacteria 54063
645 Ga0451576_0021618 3300045051 Bacteria 6990
646 Ga0451576_0261011 3300045051 Bacteria 1811
647 Ga0466958_0054661 3300045836 Unclassified 2421
648 Ga0466967_0060948 3300045976 Bacteria 3346
649 Ga0466967_0345095 3300045976 Bacteria 1440
650 Ga0495592_0000091 3300046454 Bacteria 79692
651 Ga0495629_0000119 3300046459 Bacteria 69922
652 Ga0495629_0325573 3300046459 Bacteria 1050
653 Ga0495638_0002000 3300046460 Bacteria 17405
654 Ga0495641_0036929 3300046461 Bacteria 2293
655 Ga0495641_0159846 3300046461 Bacteria 1008
656 Ga0495653_0000105 3300046463 Bacteria 69642
657 Ga0495650_0008654 3300046471 Bacteria 5898
658 Ga0495580_0037962 3300046472 Bacteria 3453
659 Ga0495580_0284869 3300046472 Bacteria 1127
660 Ga0495582_0006122 3300046473 Bacteria 6697
661 Ga0495582_0194811 3300046473 Bacteria 1157
662 Ga0495605_0004840 3300046474 Bacteria 7875
663 Ga0495639_0039657 3300046475 Bacteria 2118
664 Ga0495596_0013806 3300046500 Bacteria 3416
665 Ga0495583_0014674 3300046506 Bacteria 4307
666 Ga0495618_0138351 3300046514 Bacteria 1557
667 Ga0495620_0025057 3300046515 Bacteria 2828
668 Ga0495628_0065838 3300046516 Bacteria 2833
669 Ga0495630_0006184 3300046517 Bacteria 8493
670 Ga0495632_0027203 3300046519 Bacteria 2998
671 Ga0495648_0062567 3300046524 Bacteria 2203
672 Ga0495648_0070644 3300046524 Bacteria 2027
673 Ga0495642_0029869 3300046528 Bacteria 2179
674 Ga0495642_0059778 3300046528 Bacteria 1580
675 Ga0495598_0003719 3300046537 Bacteria 3258
676 Ga0495621_0150695 3300046539 Bacteria 915
677 Ga0495597_0049496 3300046542 Bacteria 1857
678 Ga0495645_0084567 3300046543 Bacteria 2272
679 Ga0495656_0012291 3300046615 Bacteria 3156
680 Ga0495668_0025062 3300046616 Bacteria 3391
681 Ga0495611_0006324 3300046648 Bacteria 5046
682 Ga0495658_0020138 3300046683 Bacteria 3496
683 Ga0495613_0088270 3300046689 Bacteria 2247
684 Ga0495613_0110946 3300046689 Bacteria 1976
685 Ga0495624_0008327 3300046690 Bacteria 7247
686 Ga0495636_0081213 3300047318 Bacteria 1396
687 Ga0495674_0140882 3300047319 Bacteria 2027
688 Ga0495676_0022853 3300047321 Bacteria 5434
689 Ga0495687_041223 3300047443 Bacteria 2027
690 Ga0495675_0192687 3300047444 Bacteria 1244
691 Ga0495677_0030820 3300047445 Bacteria 1952
692 Ga0495679_000036 3300047446 Bacteria 161473
693 Ga0495673_0053985 3300047469 Bacteria 1749
694 Ga0495673_0068673 3300047469 Bacteria 1497
695 Ga0495686_0209793 3300047472 Bacteria 1113
696 Ga0495593_0006473 3300047673 Bacteria 6862
697 Ga0495593_0042344 3300047673 Bacteria 2444
698 Ga0495602_0067890 3300048088 Bacteria 3065
699 Ga0495615_0005970 3300048090 Bacteria 2226
700 Ga0496100_0193290 3300048903 Bacteria 1479
701 Ga0496100_0340207 3300048903 Bacteria 1131
702 Ga0496101_0109186 3300048904 Bacteria 2081
703 Ga0496102_0018172 3300048905 Bacteria 6171
704 Ga0496102_0026199 3300048905 Bacteria 5198
705 Ga0496102_0189230 3300048905 Bacteria 1939
706 Ga0496102_0568276 3300048905 Bacteria 1057
707 Ga0496104_0010876 3300048907 Bacteria 8139
708 Ga0496104_0047214 3300048907 Bacteria 4058
709 Ga0496104_0275556 3300048907 Bacteria 1595
710 Ga0496105_0005406 3300048908 Bacteria 9693
711 Ga0496106_0005880 3300048909 Bacteria 9071
712 Ga0496106_0093215 3300048909 Bacteria 2327
713 Ga0496107_0146360 3300048910 Bacteria 1747
714 Ga0496108_0055598 3300048911 Bacteria 3324
715 Ga0496108_0122521 3300048911 Bacteria 2231
716 Ga0496108_0143712 3300048911 Bacteria 2056
717 Ga0496109_0097929 3300048912 Bacteria 2719
718 Ga0496110_0429548 3300048913 Bacteria 1204
719 Ga0496112_0142010 3300048915 Bacteria 2370
720 Ga0496113_0052135 3300048916 Bacteria 3054
721 Ga0496114_0090010 3300048917 Bacteria 2605
722 Ga0496121_0016679 3300048924 Bacteria 7560
723 Ga0496126_0016483 3300048929 Bacteria 7385
724 Ga0496126_0172501 3300048929 Bacteria 1842
725 nmdc:mga0yw44_131089_c1 3300050492 Bacteria 1623
726 nmdc:mga0k408_185355_c1 3300050493 Bacteria 1241
727 nmdc:mga0k408_2166_c1 3300050493 Bacteria 10537
728 nmdc:mga06z11_7758_c1 3300050494 Bacteria 4435
729 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
730 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
731 nmdc:mga0qj67_1823_c1 3300050509 Bacteria 15086
732 nmdc:mga06r32_288860_c1 3300050510 Bacteria 1627
733 nmdc:mga06r32_4881_c1 3300050510 Bacteria 12079
734 nmdc:mga0n895_344162_c1 3300050512 Bacteria 1510
735 Ga0495601_0060369 3300053077 Bacteria 2406
736 Ga0495612_0075047 3300053078 Bacteria 1415
737 Ga0495619_0164616 3300053085 Bacteria 1532
738 Ga0500641_0002176 3300053096 Bacteria 6942
739 Ga0105238_10071557
740 Ga0070658_10038972
741 Ga0070658_10069095
742 Ga0070658_10178290
743 Ga0070676_10006626
744 Ga0070676_10010777
745 Ga0070676_10021963
746 Ga0070676_10219195
747 Ga0070683_100007182
748 Ga0070683_100030885
749 Ga0070683_100039556
750 Ga0070690_100013351
751 Ga0070690_100041543
752 Ga0070690_100042787
753 Ga0070670_100008462
754 Ga0070670_100013351
755 Ga0070670_100051505
756 Ga0070670_100072433
757 Ga0070670_100277101
758 Ga0070677_10002013
759 Ga0070677_10039117
760 Ga0068869_100002941
761 Ga0068869_100008210
762 Ga0068869_100015759
763 Ga0070666_10002937
764 Ga0070666_10003117
765 Ga0070666_10006093
766 Ga0070666_10033038
767 Ga0070666_10230815
768 Ga0070680_100194013
769 Ga0070680_100330288
770 Ga0070682_100024784
771 Ga0068868_100006024
772 Ga0068868_100043259
773 Ga0068868_100112766
774 Ga0068868_100112875
775 Ga0068868_100255747
776 Ga0070660_100015941
777 Ga0070689_100007815
778 Ga0070689_100010101
779 Ga0070689_100034823
780 Ga0070689_100112561
781 Ga0070689_100264698
782 Ga0070661_100001163
783 Ga0070661_100002517
784 Ga0070661_100004458
785 Ga0070661_100020742
786 Ga0070661_100032933
787 Ga0070661_100050297
788 Ga0070661_100114099
789 Ga0070668_100006563
790 Ga0070668_100017926
791 Ga0070668_100089486
792 Ga0070669_100000703
793 Ga0070669_100010671
794 Ga0070669_100017967
795 Ga0070669_100025112
796 Ga0070669_100075027
797 Ga0070669_100082373
798 Ga0070669_100135105
799 Ga0070669_100163088
800 Ga0070669_100278085
801 Ga0070675_100008358
802 Ga0070675_100015033
803 Ga0070675_100019752
804 Ga0070675_100040486
805 Ga0070675_100050125
806 Ga0070675_100057458
807 Ga0070675_100407801
808 Ga0070671_100002148
809 Ga0070671_100002779
810 Ga0070671_100004213
811 Ga0070671_100005567
812 Ga0070671_100024596
813 Ga0070671_100054814
814 Ga0070671_100054877
815 Ga0070671_100058361
816 Ga0070671_100159378
817 Ga0070671_100185377
818 Ga0070674_100001675
819 Ga0070674_100009858
820 Ga0070674_100108214
821 Ga0070674_100194891
822 Ga0070673_100004285
823 Ga0070673_100007461
824 Ga0070673_100058265
825 Ga0070673_100108377
826 Ga0070673_100108608
827 Ga0070673_100132910
828 Ga0070673_100410746
829 Ga0070659_100030369
830 Ga0070659_100192578
831 Ga0070667_100002963
832 Ga0070667_100003662
833 Ga0070667_100006668
834 Ga0070667_100007802
835 Ga0070667_100013595
836 Ga0070667_100099996
837 Ga0070709_10008703
838 Ga0070709_10035113
839 Ga0070709_10068902
840 Ga0070709_10076840
841 Ga0070709_10084055
842 Ga0070714_100014948
843 Ga0070714_100033506
844 Ga0070714_100132569
845 Ga0070713_100004952
846 Ga0070713_100125784
847 Ga0070713_100186705
848 Ga0070710_10002378
849 Ga0070701_10052732
850 Ga0070700_100022620
851 Ga0070700_100131993
852 Ga0070663_100002838
853 Ga0070663_100010680
854 Ga0070663_100122677
855 Ga0070678_100004327
856 Ga0070678_100014019
857 Ga0070678_100077605
858 Ga0070678_100144515
859 Ga0070678_100184737
860 Ga0070662_100000827
861 Ga0070662_100003262
862 Ga0070662_100012595
863 Ga0070662_100019182
864 Ga0070662_100199012
865 Ga0070681_10006174
866 Ga0070681_10008534
867 Ga0070681_10022228
868 Ga0068867_100001658
869 Ga0068867_100002428
870 Ga0068867_100004893
871 Ga0068867_100007088
872 Ga0068867_100029241
873 Ga0068867_100214604
874 Ga0068867_100245561
875 Ga0070685_10056628
876 Ga0070699_100017505
877 Ga0070679_100003587
878 Ga0070679_100188447
879 Ga0070679_100204541
880 Ga0070684_100074081
881 Ga0070684_100116544
882 Ga0068853_100017860
883 Ga0068853_100144640
884 Ga0068853_100281595
885 Ga0070672_100001237
886 Ga0070672_100002999
887 Ga0070672_100015202
888 Ga0070672_100031023
889 Ga0070672_100038186
890 Ga0070672_100046661
891 Ga0070672_100090681
892 Ga0070672_100168707
893 Ga0070672_100304933
894 Ga0070693_100027970
895 Ga0070665_100034048
896 Ga0070665_100073195
897 Ga0070665_100080552
898 Ga0070665_100113254
899 Ga0070665_100570285
900 Ga0068855_100004781
901 Ga0068855_100048925
902 Ga0068855_100062803
903 Ga0068855_100075008
904 Ga0068855_100158356
905 Ga0070664_100000152
906 Ga0070664_100006501
907 Ga0070664_100046254
908 Ga0070664_100057608
909 Ga0070664_100129450
910 Ga0068857_100034689
911 Ga0068857_100098900
912 Ga0068857_100114033
913 Ga0068857_100133405
914 Ga0068857_100444974
915 Ga0068854_100013085
916 Ga0068856_100000093
917 Ga0068856_100018144
918 Ga0068856_100034204
919 Ga0068856_100039961
920 Ga0068856_100043551
921 Ga0068856_100210731
922 Ga0070702_100259425
923 Ga0068852_100002316
924 Ga0068852_100007090
925 Ga0068852_100018088
926 Ga0068852_100072473
927 Ga0068852_100377612
928 Ga0068859_100008717
929 Ga0068859_100097646
930 Ga0068859_100105275
931 Ga0068859_100214803
932 Ga0068864_100001297
933 Ga0068864_100001959
934 Ga0068864_100020907
935 Ga0068864_100024057
936 Ga0068864_100044371
937 Ga0068864_100049557
938 Ga0068864_100057582
939 Ga0068864_100069289
940 Ga0068866_10005854
941 Ga0068866_10011312
942 Ga0068866_10071157
943 Ga0068861_100003125
944 Ga0068861_100026691
945 Ga0068861_100058140
946 Ga0068861_100148460
947 Ga0068851_10002770
948 Ga0068851_10005190
949 Ga0068851_10038242
950 Ga0068851_10051815
951 Ga0068851_10112432
952 Ga0068870_10031559
953 Ga0068870_10152355
954 Ga0068863_100002914
955 Ga0068863_100011402
956 Ga0068863_100023298
957 Ga0068863_100025750
958 Ga0068863_100082868
959 Ga0068863_100097888
960 Ga0068863_100133660
961 Ga0068863_100559558
962 Ga0068858_100000729
963 Ga0068858_100003258
964 Ga0068858_100007127
965 Ga0068858_100010459
966 Ga0068858_100029114
967 Ga0068858_100056819
968 Ga0068858_100134991
969 Ga0068860_100004309
970 Ga0068860_100020088
971 Ga0068860_100036517
972 Ga0068860_100039107
973 Ga0068862_100187360
974 Ga0068862_100240530
975 Ga0081455_10002056
976 Ga0081540_1000313
977 Ga0070717_10259098
978 Ga0075365_10118008
979 Ga0070715_10038775
980 Ga0075367_10002955
981 Ga0075367_10036455
982 Ga0075366_10000957
983 Ga0097621_100027028
984 Ga0097621_100385941
985 Ga0068871_100009333
986 Ga0068871_100016446
987 Ga0068871_100063765
988 Ga0068871_100177611
989 Ga0075428_100014820
990 Ga0075430_100044473
991 Ga0075431_100015583
992 Ga0075434_100066222
993 Ga0075429_100000003
994 Ga0068865_100000968
995 Ga0068865_100025566
996 Ga0097620_100008717
997 Ga0097620_100097646
998 Ga0097620_100105274
999 Ga0097620_100214795
1000 Ga0105240_10002702
1001 Ga0105240_10006429
1002 Ga0111539_10683744
1003 Ga0111539_10696005
1004 Ga0105245_10017282
1005 Ga0105245_10118338
1006 Ga0105247_10021696
1007 Ga0114129_10005359
1008 Ga0114129_10183640
1009 Ga0105243_10020478
1010 Ga0105243_10086073
1011 Ga0105243_10189703
1012 Ga0105241_10001154
1013 Ga0105241_10059857
1014 Ga0105241_10402513
1015 Ga0105242_10014088
1016 Ga0105248_10007025
1017 Ga0105248_10010702
1018 Ga0105248_10016915
1019 Ga0105248_10021738
1020 Ga0105237_10040115
1021 Ga0105237_10093770
1022 Ga0105237_10099157
1023 Ga0105237_10198199
1024 Ga0105238_10003012
1025 Ga0105238_10049052
1026 Ga0105238_10144516
1027 Ga0105239_10357501
1028 Ga0105239_10420440
1029 Ga0105246_10083596
1030 Ga0157373_10005664
1031 Ga0157373_10020608
1032 Ga0157373_10030761
1033 Ga0157373_10154523
1034 Ga0157371_10000696
1035 Ga0157370_10004239
1036 Ga0157370_10007103
1037 Ga0157370_10034563
1038 Ga0157370_10036749
1039 Ga0157370_10242582
1040 Ga0157369_10033319
1041 Ga0157369_10079192
1042 Ga0157369_10105602
1043 Ga0157369_10240825
1044 Ga0157374_10015544
1045 Ga0157374_10074601
1046 Ga0157378_10005031
1047 Ga0157378_10009099
1048 Ga0157378_10156425
1049 Ga0157378_10200607
1050 Ga0163162_10006321
1051 Ga0163162_10012725
1052 Ga0163162_10019386
1053 Ga0163162_10040663
1054 Ga0163162_10069143
1055 Ga0163162_10236441
1056 Ga0163162_10438558
1057 Ga0157372_10006652
1058 Ga0157372_10017050
1059 Ga0157372_10020731
1060 Ga0157372_10039214
1061 Ga0157372_10257305
1062 Ga0157372_10257905
1063 Ga0157375_10011280
1064 Ga0157375_10046064
1065 Ga0157375_10061788
1066 Ga0157375_10070170
1067 Ga0157375_10115633
1068 Ga0157375_10355364
1069 Ga0163163_10005612
1070 Ga0157380_10051443
1071 Ga0157380_10076156
1072 Ga0157380_10126496
1073 Ga0157380_10326050
1074 Ga0157380_10444018
1075 Ga0157377_10030418
1076 Ga0157377_10113807
1077 Ga0157379_10004210
1078 Ga0157379_10012185
1079 Ga0157379_10027063
1080 Ga0157379_10027423
1081 Ga0157379_10048460
1082 Ga0157379_10063062
1083 Ga0157379_10350138
1084 Ga0157376_10032082
1085 Ga0157376_10042780
1086 Ga0163161_10014345
1087 Ga0163161_10016630
1088 Ga0163161_10151608
1089 Ga0163161_10219535
1090 Ga0213875_10055598
1091 Ga0207697_10005139
1092 Ga0207656_10026749
1093 Ga0207656_10034710
1094 Ga0207656_10041790
1095 Ga0207682_10003194
1096 Ga0207682_10003662
1097 Ga0207682_10005486
1098 Ga0207682_10042845
1099 Ga0207692_10029153
1100 Ga0207692_10125477
1101 Ga0207642_10017417
1102 Ga0207642_10091773
1103 Ga0207710_10012681
1104 Ga0207688_10036655
1105 Ga0207688_10086011
1106 Ga0207680_10001451
1107 Ga0207680_10006222
1108 Ga0207647_10188483
1109 Ga0207699_10004274
1110 Ga0207699_10013825
1111 Ga0207699_10073449
1112 Ga0207699_10151573
1113 Ga0207645_10000930
1114 Ga0207645_10013116
1115 Ga0207645_10015439
1116 Ga0207645_10147256
1117 Ga0207654_10230110
1118 Ga0207707_10008674
1119 Ga0207707_10041031
1120 Ga0207707_10143737
1121 Ga0207695_10076155
1122 Ga0207671_10046808
1123 Ga0207671_10165688
1124 Ga0207671_10241857
1125 Ga0207693_10004943
1126 Ga0207660_10002422
1127 Ga0207660_10127395
1128 Ga0207660_10335885
1129 Ga0207660_10424668
1130 Ga0207662_10006278
1131 Ga0207657_10000045
1132 Ga0207657_10008538
1133 Ga0207657_10015160
1134 Ga0207657_10046535
1135 Ga0207657_10076083
1136 Ga0207657_10104022
1137 Ga0207649_10002175
1138 Ga0207649_10021178
1139 Ga0207649_10028095
1140 Ga0207652_10028914
1141 Ga0207652_10034707
1142 Ga0207652_10066886
1143 Ga0207652_10166294
1144 Ga0207652_10208730
1145 Ga0207681_10008494
1146 Ga0207681_10016331
1147 Ga0207681_10018436
1148 Ga0207681_10064768
1149 Ga0207681_10085109
1150 Ga0207681_10153744
1151 Ga0207694_10021014
1152 Ga0207694_10080374
1153 Ga0207694_10116776
1154 Ga0207650_10003438
1155 Ga0207650_10005120
1156 Ga0207650_10019766
1157 Ga0207650_10053216
1158 Ga0207650_10235668
1159 Ga0207659_10002463
1160 Ga0207659_10013645
1161 Ga0207659_10013858
1162 Ga0207659_10025053
1163 Ga0207659_10026817
1164 Ga0207659_10272011
1165 Ga0207687_10055910
1166 Ga0207687_10059337
1167 Ga0207687_10121380
1168 Ga0207700_10195097
1169 Ga0207664_10006610
1170 Ga0207664_10034959
1171 Ga0207664_10073502
1172 Ga0207664_10139257
1173 Ga0207644_10000899
1174 Ga0207644_10006192
1175 Ga0207644_10008628
1176 Ga0207644_10010401
1177 Ga0207644_10011430
1178 Ga0207644_10015764
1179 Ga0207644_10017295
1180 Ga0207644_10029367
1181 Ga0207644_10030228
1182 Ga0207644_10060211
1183 Ga0207644_10108880
1184 Ga0207690_10008126
1185 Ga0207706_10000149
1186 Ga0207706_10004918
1187 Ga0207706_10063073
1188 Ga0207706_10197542
1189 Ga0207670_10007087
1190 Ga0207669_10002834
1191 Ga0207669_10005706
1192 Ga0207669_10008202
1193 Ga0207669_10094153
1194 Ga0207669_10145510
1195 Ga0207704_10011475
1196 Ga0207704_10018556
1197 Ga0207704_10075417
1198 Ga0207704_10252369
1199 Ga0207704_10274919
1200 Ga0207691_10000229
1201 Ga0207691_10000427
1202 Ga0207691_10002230
1203 Ga0207691_10012281
1204 Ga0207691_10023136
1205 Ga0207691_10098557
1206 Ga0207691_10143168
1207 Ga0207691_10290176
1208 Ga0207711_10062825
1209 Ga0207711_10099325
1210 Ga0207711_10173222
1211 Ga0207711_10336826
1212 Ga0207689_10000534
1213 Ga0207689_10014374
1214 Ga0207689_10020977
1215 Ga0207689_10022098
1216 Ga0207661_10042690
1217 Ga0207679_10007689
1218 Ga0207679_10030294
1219 Ga0207679_10037851
1220 Ga0207679_10050669
1221 Ga0207679_10109357
1222 Ga0207667_10006125
1223 Ga0207667_10009172
1224 Ga0207667_10066614
1225 Ga0207667_10110217
1226 Ga0207651_10000426
1227 Ga0207651_10003355
1228 Ga0207651_10014425
1229 Ga0207651_10042232
1230 Ga0207651_10109840
1231 Ga0207651_10394827
1232 Ga0207712_10113305
1233 Ga0207668_10006200
1234 Ga0207668_10023509
1235 Ga0207668_10034913
1236 Ga0207640_10008111
1237 Ga0207640_10036740
1238 Ga0207640_10127115
1239 Ga0207658_10014038
1240 Ga0207658_10016118
1241 Ga0207658_10042566
1242 Ga0207658_10054412
1243 Ga0207677_10001186
1244 Ga0207677_10090607
1245 Ga0207677_10140060
1246 Ga0207703_10006732
1247 Ga0207703_10008279
1248 Ga0207703_10011058
1249 Ga0207703_10024049
1250 Ga0207703_10028143
1251 Ga0207639_10067425
1252 Ga0207639_10070474
1253 Ga0207639_10075376
1254 Ga0207639_10268590
1255 Ga0207678_10003299
1256 Ga0207678_10005357
1257 Ga0207678_10077448
1258 Ga0207678_10243294
1259 Ga0207708_10059652
1260 Ga0207702_10002780
1261 Ga0207702_10024915
1262 Ga0207702_10030260
1263 Ga0207702_10034801
1264 Ga0207641_10005867
1265 Ga0207641_10007082
1266 Ga0207641_10012653
1267 Ga0207641_10044089
1268 Ga0207641_10071896
1269 Ga0207641_10138801
1270 Ga0207641_10175007
1271 Ga0207648_10007896
1272 Ga0207648_10009020
1273 Ga0207648_10015197
1274 Ga0207648_10026307
1275 Ga0207648_10054752
1276 Ga0207676_10000572
1277 Ga0207676_10008732
1278 Ga0207676_10024429
1279 Ga0207676_10029091
1280 Ga0207676_10032079
1281 Ga0207676_10053510
1282 Ga0207676_10060766
1283 Ga0207676_10230755
1284 Ga0207676_10348655
1285 Ga0207674_10000020
1286 Ga0207674_10005781
1287 Ga0207674_10016690
1288 Ga0207674_10026116
1289 Ga0207674_10055498
1290 Ga0207674_10200449
1291 Ga0207675_100000977
1292 Ga0207675_100095977
1293 Ga0207675_100142898
1294 Ga0207675_100176299
1295 Ga0207683_10000255
1296 Ga0207683_10009517
1297 Ga0207683_10009854
1298 Ga0207683_10012448
1299 Ga0207683_10103230
1300 Ga0207683_10183269
1301 Ga0207683_10247104
1302 Ga0207698_10000678
1303 Ga0207698_10040085
1304 Ga0207698_10096091
1305 Ga0207698_10156733
1306 Ga0207698_10163891
1307 Ga0209969_1004367
1308 Ga0209981_1009139
1309 Ga0210000_1000587
1310 Ga0209995_1002182
1311 Ga0209999_1003367
1312 Ga0209970_1014656
1313 Ga0209983_1015547
1314 Ga0209971_1008724
1315 Ga0209974_10005410
1316 Ga0268266_10030810
1317 Ga0268266_10220163
1318 Ga0268265_10059617
1319 Ga0268265_10184664
1320 Ga0268265_10204180
1321 Ga0268264_10003403
1322 Ga0268264_10004892
1323 Ga0268264_10023821
1324 Ga0268264_10024856
1325 Ga0268264_10204319
1326 Ga0265334_10011495
1327 Ga0307517_10029255
1328 Ga0307515_10027818
1329 Ga0307515_10045696
1330 Ga0265763_1000043
1331 Ga0265332_10004952
1332 Ga0265329_10006218
1333 Ga0265340_10037750
1334 Ga0265331_10002953
1335 Ga0265316_10011908
1336 Ga0307513_10002039
1337 Ga0307513_10091844
1338 Ga0307509_10003320
1339 Ga0307509_10015069
1340 Ga0307509_10049191
1341 Ga0307509_10323607
1342 Ga0307508_10013319
1343 Ga0307508_10035587
1344 Ga0307508_10088128
1345 Ga0265314_10000675
1346 Ga0307405_10078564
1347 Ga0307412_10009961
1348 Ga0307409_100019238
1349 Ga0307409_100175482
1350 Ga0307416_100003082
1351 Ga0307416_100021079
1352 Ga0307414_10105381
1353 Ga0307414_10223272
1354 Ga0307415_100006914
1355 Ga0307507_10038308
1356 Ga0307510_10004077
1357 Ga0373932_0008285
1358 Ga0373954_0031280
1359 Ga0373955_0161011
1360 Ga0373931_0011481
1361 Ga0373931_0116909
1362 Ga0373931_0215223
1363 Ga0373935_0309779
1364 Ga0373927_0006163
1365 Ga0373937_0063736
1366 Ga0373937_0272260
1367 Ga0373925_0055592
1368 Ga0373925_0288195
1369 Ga0395899_0035008
1370 Ga0395900_0042602
1371 Ga0395900_0178929
1372 Ga0395898_0350567
1373 Ga0395905_0119984
1374 Ga0395901_0047820
1375 Ga0395901_0309598
1376 Ga0436363_0039369
1377 Ga0436363_1432274
1378 Ga0439460_0014745
1379 Ga0451577_0087317
1380 Ga0453683_0002604
1381 Ga0466957_0015486
1382 Ga0451576_0000958
1383 Ga0451576_0021618
1384 Ga0451576_0261011
1385 Ga0466958_0054661
1386 Ga0466967_0060948
1387 Ga0466967_0345095
1388 Ga0495592_0000091
1389 Ga0495629_0000119
1390 Ga0495629_0325573
1391 Ga0495638_0002000
1392 Ga0495641_0036929
1393 Ga0495641_0159846
1394 Ga0495653_0000105
1395 Ga0495650_0008654
1396 Ga0495580_0037962
1397 Ga0495580_0284869
1398 Ga0495582_0006122
1399 Ga0495582_0194811
1400 Ga0495605_0004840
1401 Ga0495639_0039657
1402 Ga0495596_0013806
1403 Ga0495583_0014674
1404 Ga0495618_0138351
1405 Ga0495620_0025057
1406 Ga0495628_0065838
1407 Ga0495630_0006184
1408 Ga0495632_0027203
1409 Ga0495648_0062567
1410 Ga0495648_0070644
1411 Ga0495642_0029869
1412 Ga0495642_0059778
1413 Ga0495598_0003719
1414 Ga0495621_0150695
1415 Ga0495597_0049496
1416 Ga0495645_0084567
1417 Ga0495656_0012291
1418 Ga0495668_0025062
1419 Ga0495611_0006324
1420 Ga0495658_0020138
1421 Ga0495613_0088270
1422 Ga0495613_0110946
1423 Ga0495624_0008327
1424 Ga0495636_0081213
1425 Ga0495674_0140882
1426 Ga0495676_0022853
1427 Ga0495687_041223
1428 Ga0495675_0192687
1429 Ga0495677_0030820
1430 Ga0495679_000036
1431 Ga0495673_0053985
1432 Ga0495673_0068673
1433 Ga0495686_0209793
1434 Ga0495593_0006473
1435 Ga0495593_0042344
1436 Ga0495602_0067890
1437 Ga0495615_0005970
1438 Ga0496100_0193290
1439 Ga0496100_0340207
1440 Ga0496101_0109186
1441 Ga0496102_0018172
1442 Ga0496102_0026199
1443 Ga0496102_0189230
1444 Ga0496102_0568276
1445 Ga0496104_0010876
1446 Ga0496104_0047214
1447 Ga0496104_0275556
1448 Ga0496105_0005406
1449 Ga0496106_0005880
1450 Ga0496106_0093215
1451 Ga0496107_0146360
1452 Ga0496108_0055598
1453 Ga0496108_0122521
1454 Ga0496108_0143712
1455 Ga0496109_0097929
1456 Ga0496110_0429548
1457 Ga0496112_0142010
1458 Ga0496113_0052135
1459 Ga0496114_0090010
1460 Ga0496121_0016679
1461 Ga0496126_0016483
1462 Ga0496126_0172501
1463 nmdc:mga0yw44_131089_c1
1464 nmdc:mga0k408_185355_c1
1465 nmdc:mga0k408_2166_c1
1466 nmdc:mga06z11_7758_c1
1467 nmdc:mga05p37_77_c1
1468 nmdc:mga09592_140_c1
1469 nmdc:mga0qj67_1823_c1
1470 nmdc:mga06r32_288860_c1
1471 nmdc:mga06r32_4881_c1
1472 nmdc:mga0n895_344162_c1
1473 Ga0495601_0060369
1474 Ga0495612_0075047
1475 Ga0495619_0164616
1476 Ga0500641_0002176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

72

345

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9636 28 320
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9625 23 318
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.95 23 318
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9497 24 312
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9469 24 320
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9455 123 244 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.945 123 240 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9356 123 241 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.934 123 244 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9282 24 320 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9984 61 314
AF-A0A536YZ85-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.998 24 320
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9817 49 316
AF-A0A1B2R9E2-F1-model_v4 LacI family transcriptional regulator 0.9791 22 318
AF-A0A096FIP4-F1-model_v4 MFS transporter 0.9786 22 320

Map