F478372

General Info

Members Datasets Scaffolds Average Seq Length
738 310 1476 137

Family's Representative Sequence

Representative Sequence 3300004801|Ga0058860_12090147|Ga0058860_120901471
Length 151
Sequence MAVDVQHAVEDDEAELNVSINTTPLVDVMLVMLIXXXXTIPVILKTVNLQLPTYRNIVTQTKPENIVIAVTTDETVYYNNIPIDQPTMLKNFVDALRAAAATGKPLPEVHIRGDKNVRFEAIGRVILACQRAGIQKVGFITEPHALEADSY

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
224 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
295 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
296 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
310 2842733646 Variovorax sp. R-72446 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.26
Metatranscriptomes 4.47
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 1.36
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_12090147 3300004801 Bacteria 663
2 JGI24741J21665_1000191 3300001915 Bacteria 17967
3 JGI25156J39149_1007374 3300002705 Bacteria 2898
4 JGI25165J46597_1000008 3300003214 Bacteria 478603
5 JGI25153J46596_10000320 3300003215 Bacteria 35306
6 Ga0007409J51694_1087344 3300003575 Bacteria 755
7 Ga0055538_1009058 3300003751 Bacteria 824
8 Ga0055533_1015694 3300003756 Bacteria 740
9 Ga0055532_1000328 3300003758 Bacteria 26494
10 Ga0055541_1001445 3300003841 Bacteria 5164
11 Ga0058863_11936284 3300004799 Bacteria 1213
12 Ga0058861_12018180 3300004800 Bacteria 1035
13 Ga0058862_10019839 3300004803 Bacteria 992
14 Ga0058862_10036443 3300004803 Bacteria 1025
15 Ga0058862_10104114 3300004803 Bacteria 668
16 Ga0058862_10145841 3300004803 Bacteria 1380
17 Ga0058862_12881293 3300004803 Bacteria 761
18 Ga0070658_10019494 3300005327 Bacteria 5431
19 Ga0070658_10115526 3300005327 Bacteria 2226
20 Ga0070658_10144098 3300005327 Bacteria 1991
21 Ga0070658_10222409 3300005327 Bacteria 1597
22 Ga0070658_10237621 3300005327 Bacteria 1544
23 Ga0070658_10546118 3300005327 Bacteria 1003
24 Ga0070676_10023715 3300005328 Bacteria 3450
25 Ga0070676_10363654 3300005328 Bacteria 998
26 Ga0070676_11245543 3300005328 Bacteria 567
27 Ga0070683_100624377 3300005329 Bacteria 1031
28 Ga0070683_100795223 3300005329 Bacteria 907
29 Ga0070690_100483159 3300005330 Bacteria 924
30 Ga0070670_100279865 3300005331 Bacteria 1457
31 Ga0070670_100740229 3300005331 Bacteria 885
32 Ga0070670_100814348 3300005331 Bacteria 844
33 Ga0070670_101220203 3300005331 Bacteria 687
34 Ga0068869_100247779 3300005334 Bacteria 1422
35 Ga0068869_100448814 3300005334 Bacteria 1069
36 Ga0068869_100826946 3300005334 Bacteria 798
37 Ga0068869_100885970 3300005334 Bacteria 772
38 Ga0070666_10012543 3300005335 Bacteria 5350
39 Ga0070666_10551008 3300005335 Bacteria 839
40 Ga0070680_100054464 3300005336 Bacteria 3266
41 Ga0070680_100972882 3300005336 Bacteria 733
42 Ga0070682_100114591 3300005337 Bacteria 1801
43 Ga0070682_100923864 3300005337 Bacteria 719
44 Ga0068868_100055839 3300005338 Bacteria 3117
45 Ga0068868_100067858 3300005338 Bacteria 2839
46 Ga0070660_100004785 3300005339 Bacteria 9361
47 Ga0070660_100081852 3300005339 Bacteria 2534
48 Ga0070660_100152016 3300005339 Bacteria 1861
49 Ga0070660_100832834 3300005339 Bacteria 777
50 Ga0070660_101710950 3300005339 Bacteria 536
51 Ga0070689_100163136 3300005340 Bacteria 1802
52 Ga0070689_100373274 3300005340 Bacteria 1201
53 Ga0070691_10498264 3300005341 Bacteria 704
54 Ga0070687_100986602 3300005343 Bacteria 610
55 Ga0070661_100004718 3300005344 Bacteria 9380
56 Ga0070661_100034946 3300005344 Bacteria 3648
57 Ga0070661_100997099 3300005344 Bacteria 695
58 Ga0070661_101077853 3300005344 Bacteria 669
59 Ga0070692_10831214 3300005345 Bacteria 633
60 Ga0070668_101170729 3300005347 Bacteria 696
61 Ga0070668_101395203 3300005347 Bacteria 639
62 Ga0070675_100073445 3300005354 Bacteria 2840
63 Ga0070675_100668809 3300005354 Bacteria 944
64 Ga0070675_100782175 3300005354 Bacteria 872
65 Ga0070671_100271492 3300005355 Bacteria 1441
66 Ga0070671_100579435 3300005355 Bacteria 969
67 Ga0070674_102044957 3300005356 Bacteria 522
68 Ga0070673_100066120 3300005364 Bacteria 2887
69 Ga0070673_101204175 3300005364 Bacteria 710
70 Ga0070688_100124684 3300005365 Bacteria 1730
71 Ga0070659_100007210 3300005366 Bacteria 8069
72 Ga0070659_101347440 3300005366 Bacteria 633
73 Ga0070667_100679626 3300005367 Bacteria 951
74 Ga0070709_10001616 3300005434 Bacteria 12183
75 Ga0070709_11085582 3300005434 Bacteria 640
76 Ga0070714_100089898 3300005435 Bacteria 2688
77 Ga0070714_100513624 3300005435 Bacteria 1144
78 Ga0070713_100000002 3300005436 Bacteria 245989
79 Ga0070713_100053808 3300005436 Bacteria 3337
80 Ga0070713_100744274 3300005436 Bacteria 937
81 Ga0070710_10020896 3300005437 Bacteria 3403
82 Ga0070710_10224853 3300005437 Bacteria 1196
83 Ga0070710_10349181 3300005437 Bacteria 979
84 Ga0070711_100097749 3300005439 Bacteria 2129
85 Ga0070711_100587671 3300005439 Bacteria 928
86 Ga0070711_100590485 3300005439 Bacteria 925
87 Ga0070694_100105354 3300005444 Bacteria 2001
88 Ga0070708_100496139 3300005445 Bacteria 1152
89 Ga0070678_100025365 3300005456 Bacteria 3986
90 Ga0070678_100067266 3300005456 Bacteria 2666
91 Ga0070678_100075793 3300005456 Bacteria 2532
92 Ga0070678_100884891 3300005456 Bacteria 815
93 Ga0070662_100072113 3300005457 Bacteria 2549
94 Ga0070681_10130601 3300005458 Bacteria 2444
95 Ga0070681_10173170 3300005458 Bacteria 2080
96 Ga0068867_100036538 3300005459 Bacteria 3566
97 Ga0068867_100050053 3300005459 Bacteria 3078
98 Ga0070685_10234879 3300005466 Bacteria 1208
99 Ga0070685_10364266 3300005466 Bacteria 992
100 Ga0070699_100195663 3300005518 Bacteria 1797
101 Ga0070679_100028841 3300005530 Bacteria 5474
102 Ga0070679_100104911 3300005530 Bacteria 2813
103 Ga0070679_100200003 3300005530 Bacteria 1965
104 Ga0070679_100329602 3300005530 Bacteria 1475
105 Ga0070684_100007159 3300005535 Bacteria 8668
106 Ga0070684_100364222 3300005535 Bacteria 1331
107 Ga0070684_101639422 3300005535 Bacteria 607
108 Ga0070697_100227030 3300005536 Bacteria 1592
109 Ga0068853_100134631 3300005539 Bacteria 2214
110 Ga0068853_100391868 3300005539 Bacteria 1299
111 Ga0068853_100465275 3300005539 Bacteria 1190
112 Ga0068853_101147814 3300005539 Bacteria 750
113 Ga0068853_101598931 3300005539 Bacteria 631
114 Ga0070672_100272761 3300005543 Bacteria 1429
115 Ga0070672_101011650 3300005543 Bacteria 737
116 Ga0070695_100367769 3300005545 Bacteria 1082
117 Ga0070696_101302772 3300005546 Bacteria 617
118 Ga0070693_100007390 3300005547 Bacteria 5368
119 Ga0070693_100018614 3300005547 Bacteria 3631
120 Ga0070693_100184882 3300005547 Bacteria 1344
121 Ga0070693_100360405 3300005547 Bacteria 998
122 Ga0070665_100000834 3300005548 Bacteria 40265
123 Ga0070665_100011790 3300005548 Bacteria 8829
124 Ga0070665_100049476 3300005548 Bacteria 4217
125 Ga0070665_100109277 3300005548 Bacteria 2768
126 Ga0070665_100148208 3300005548 Bacteria 2349
127 Ga0070665_101176859 3300005548 Bacteria 778
128 Ga0070665_101563875 3300005548 Bacteria 668
129 Ga0070665_101653561 3300005548 Bacteria 648
130 Ga0068855_100015050 3300005563 Bacteria 9315
131 Ga0068855_100025353 3300005563 Bacteria 7096
132 Ga0068855_100027521 3300005563 Bacteria 6800
133 Ga0068855_100036403 3300005563 Bacteria 5858
134 Ga0068855_100073866 3300005563 Bacteria 3961
135 Ga0068855_101404345 3300005563 Bacteria 719
136 Ga0068855_101473095 3300005563 Bacteria 700
137 Ga0070664_100119477 3300005564 Bacteria 2306
138 Ga0068857_100000594 3300005577 Bacteria 26512
139 Ga0068857_100173184 3300005577 Bacteria 1962
140 Ga0068857_100196980 3300005577 Bacteria 1836
141 Ga0068857_100815347 3300005577 Bacteria 892
142 Ga0068857_101168499 3300005577 Bacteria 745
143 Ga0068854_100153550 3300005578 Bacteria 1777
144 Ga0068854_100251323 3300005578 Bacteria 1412
145 Ga0068854_100601827 3300005578 Bacteria 939
146 Ga0068856_100010721 3300005614 Bacteria 8903
147 Ga0068856_100065992 3300005614 Bacteria 3576
148 Ga0068856_100355579 3300005614 Bacteria 1483
149 Ga0068856_101576597 3300005614 Bacteria 670
150 Ga0068856_101703890 3300005614 Bacteria 643
151 Ga0068852_100231494 3300005616 Bacteria 1761
152 Ga0068852_100234871 3300005616 Bacteria 1750
153 Ga0068852_100519799 3300005616 Bacteria 1187
154 Ga0068852_102000234 3300005616 Bacteria 602
155 Ga0068859_101186518 3300005617 Bacteria 841
156 Ga0068864_100090657 3300005618 Bacteria 2695
157 Ga0068864_100192987 3300005618 Bacteria 1868
158 Ga0068864_100382231 3300005618 Bacteria 1334
159 Ga0068864_100896487 3300005618 Bacteria 875
160 Ga0068861_100031576 3300005719 Bacteria 3891
161 Ga0068851_10113397 3300005834 Bacteria 1449
162 Ga0068870_10046306 3300005840 Bacteria 2280
163 Ga0068863_100385733 3300005841 Bacteria 1368
164 Ga0068858_100010394 3300005842 Bacteria 8819
165 Ga0068858_100024346 3300005842 Bacteria 5641
166 Ga0068858_100032668 3300005842 Bacteria 4832
167 Ga0068858_100160514 3300005842 Bacteria 2116
168 Ga0068858_100546219 3300005842 Bacteria 1121
169 Ga0068860_100111252 3300005843 Bacteria 2618
170 Ga0068860_100134246 3300005843 Bacteria 2376
171 Ga0068860_100270751 3300005843 Bacteria 1657
172 Ga0070715_10075548 3300006163 Bacteria 1516
173 Ga0070716_100119608 3300006173 Bacteria 1647
174 Ga0070712_100000549 3300006175 Bacteria 21722
175 Ga0070712_100002995 3300006175 Bacteria 10453
176 Ga0075366_10160025 3300006195 Bacteria 1364
177 Ga0097621_100000991 3300006237 Bacteria 19959
178 Ga0097621_100008509 3300006237 Bacteria 7388
179 Ga0097621_100011379 3300006237 Bacteria 6549
180 Ga0097621_100057184 3300006237 Bacteria 3189
181 Ga0097621_100127275 3300006237 Bacteria 2165
182 Ga0097621_100574576 3300006237 Bacteria 1028
183 Ga0097621_100822345 3300006237 Bacteria 862
184 Ga0068871_100001977 3300006358 Bacteria 13888
185 Ga0068871_100024272 3300006358 Bacteria 4699
186 Ga0068871_100035640 3300006358 Bacteria 3955
187 Ga0068871_100219202 3300006358 Bacteria 1648
188 Ga0068871_100316244 3300006358 Bacteria 1374
189 Ga0075434_100093861 3300006871 Bacteria 3004
190 Ga0068865_100009974 3300006881 Bacteria 5901
191 Ga0068865_100299407 3300006881 Bacteria 1287
192 Ga0068865_100515042 3300006881 Bacteria 999
193 Ga0075436_100001617 3300006914 Bacteria 15415
194 Ga0075436_101259672 3300006914 Bacteria 559
195 Ga0097620_101186508 3300006931 Bacteria 841
196 Ga0075435_100039026 3300007076 Bacteria 3789
197 Ga0105250_10324306 3300009092 Bacteria 670
198 Ga0105240_10005130 3300009093 Bacteria 19595
199 Ga0105240_10010954 3300009093 Bacteria 12704
200 Ga0105240_10085013 3300009093 Bacteria 3878
201 Ga0105240_10097878 3300009093 Bacteria 3574
202 Ga0105240_10441531 3300009093 Bacteria 1458
203 Ga0105240_10993429 3300009093 Bacteria 898
204 Ga0105240_12052984 3300009093 Bacteria 594
205 Ga0105240_12315720 3300009093 Bacteria 556
206 Ga0105245_10051792 3300009098 Bacteria 3680
207 Ga0105245_10061026 3300009098 Bacteria 3398
208 Ga0105245_10556284 3300009098 Bacteria 1169
209 Ga0105245_11995063 3300009098 Bacteria 634
210 Ga0105243_12283223 3300009148 Bacteria 578
211 Ga0105241_10016422 3300009174 Bacteria 5430
212 Ga0105241_10022495 3300009174 Bacteria 4670
213 Ga0105241_10131356 3300009174 Bacteria 2028
214 Ga0105241_10311392 3300009174 Bacteria 1354
215 Ga0105241_10327775 3300009174 Bacteria 1322
216 Ga0105241_10548528 3300009174 Bacteria 1037
217 Ga0105241_11061922 3300009174 Bacteria 761
218 Ga0105242_10128611 3300009176 Bacteria 2183
219 Ga0105242_10216916 3300009176 Bacteria 1708
220 Ga0105242_10248762 3300009176 Bacteria 1601
221 Ga0105242_10304716 3300009176 Bacteria 1455
222 Ga0105242_10536322 3300009176 Bacteria 1119
223 Ga0105242_12067353 3300009176 Bacteria 613
224 Ga0105248_10042943 3300009177 Bacteria 5070
225 Ga0105248_10414240 3300009177 Bacteria 1517
226 Ga0105248_10631348 3300009177 Bacteria 1209
227 Ga0105248_12063343 3300009177 Bacteria 648
228 Ga0105237_10006357 3300009545 Bacteria 13125
229 Ga0105237_10042267 3300009545 Bacteria 4597
230 Ga0105237_10131910 3300009545 Bacteria 2493
231 Ga0105237_10274935 3300009545 Bacteria 1687
232 Ga0105237_11321248 3300009545 Bacteria 727
233 Ga0105238_10002850 3300009551 Bacteria 17264
234 Ga0105238_10161372 3300009551 Bacteria 2217
235 Ga0105238_10481451 3300009551 Bacteria 1240
236 Ga0105238_10983761 3300009551 Bacteria 864
237 Ga0105238_11037815 3300009551 Bacteria 841
238 Ga0105238_11343619 3300009551 Bacteria 741
239 Ga0105249_10050236 3300009553 Bacteria 3802
240 Ga0105249_12589659 3300009553 Bacteria 579
241 Ga0105028_111009 3300009993 Bacteria 952
242 Ga0105239_10076366 3300010375 Bacteria 3684
243 Ga0105239_10078389 3300010375 Bacteria 3636
244 Ga0105239_10137848 3300010375 Bacteria 2717
245 Ga0105239_10380569 3300010375 Bacteria 1595
246 Ga0105239_10699982 3300010375 Bacteria 1158
247 Ga0105239_10800784 3300010375 Bacteria 1080
248 Ga0105239_10828643 3300010375 Bacteria 1060
249 Ga0105239_11556024 3300010375 Bacteria 764
250 Ga0105239_12126234 3300010375 Bacteria 652
251 Ga0105246_10013503 3300011119 Bacteria 5121
252 Ga0105246_10111134 3300011119 Bacteria 2013
253 Ga0105246_11063279 3300011119 Bacteria 737
254 Ga0105246_12348176 3300011119 Bacteria 522
255 Ga0157373_10001037 3300013100 Bacteria 21413
256 Ga0157373_10130463 3300013100 Bacteria 1768
257 Ga0157373_10662617 3300013100 Bacteria 763
258 Ga0157373_10680881 3300013100 Bacteria 753
259 Ga0157371_10856046 3300013102 Bacteria 687
260 Ga0157370_10004766 3300013104 Bacteria 15439
261 Ga0157370_10083716 3300013104 Bacteria 2999
262 Ga0157370_10219488 3300013104 Bacteria 1761
263 Ga0157370_10249176 3300013104 Bacteria 1643
264 Ga0157370_10385655 3300013104 Bacteria 1290
265 Ga0157370_10763456 3300013104 Bacteria 881
266 Ga0157370_10957804 3300013104 Bacteria 776
267 Ga0157369_10004645 3300013105 Bacteria 16136
268 Ga0157369_10175642 3300013105 Bacteria 2255
269 Ga0157369_10237078 3300013105 Bacteria 1906
270 Ga0157369_11379301 3300013105 Bacteria 718
271 Ga0157374_10027294 3300013296 Bacteria 5147
272 Ga0157374_10320758 3300013296 Bacteria 1535
273 Ga0157374_10367851 3300013296 Bacteria 1431
274 Ga0157374_10422678 3300013296 Bacteria 1332
275 Ga0157374_10797141 3300013296 Bacteria 960
276 Ga0157374_10969505 3300013296 Bacteria 869
277 Ga0157378_10084218 3300013297 Bacteria 2878
278 Ga0157378_10735505 3300013297 Bacteria 1008
279 Ga0157378_12550107 3300013297 Bacteria 563
280 Ga0163162_10060609 3300013306 Bacteria 3820
281 Ga0163162_10155158 3300013306 Bacteria 2409
282 Ga0163162_10488915 3300013306 Bacteria 1362
283 Ga0163162_10641065 3300013306 Bacteria 1186
284 Ga0157372_10016694 3300013307 Bacteria 7881
285 Ga0157372_10100183 3300013307 Bacteria 3306
286 Ga0157375_10029252 3300013308 Bacteria 5179
287 Ga0157375_10237679 3300013308 Bacteria 1981
288 Ga0163163_10000093 3300014325 Bacteria 95764
289 Ga0163163_10346038 3300014325 Bacteria 1542
290 Ga0163163_10454763 3300014325 Bacteria 1341
291 Ga0157380_10810225 3300014326 Bacteria 954
292 Ga0157377_10135028 3300014745 Bacteria 1511
293 Ga0157379_10007358 3300014968 Bacteria 9529
294 Ga0157379_10046119 3300014968 Bacteria 3890
295 Ga0157379_10080196 3300014968 Bacteria 2924
296 Ga0157379_10109702 3300014968 Bacteria 2479
297 Ga0157379_10266064 3300014968 Bacteria 1559
298 Ga0157379_10585913 3300014968 Bacteria 1040
299 Ga0157379_11535445 3300014968 Bacteria 649
300 Ga0157376_10014141 3300014969 Bacteria 5977
301 Ga0157376_10049885 3300014969 Bacteria 3469
302 Ga0157376_12671252 3300014969 Bacteria 539
303 Ga0163161_10039928 3300017792 Bacteria 3370
304 Ga0197907_10104652 3300020069 Bacteria 1195
305 Ga0206356_10584804 3300020070 Bacteria 1325
306 Ga0206356_11026429 3300020070 Bacteria 1412
307 Ga0206355_1487256 3300020076 Bacteria 942
308 Ga0206351_10562475 3300020077 Bacteria 844
309 Ga0206352_10097500 3300020078 Bacteria 945
310 Ga0206352_11183248 3300020078 Bacteria 846
311 Ga0206354_10125470 3300020081 Bacteria 986
312 Ga0154015_1488823 3300020610 Bacteria 588
313 Ga0213873_10060829 3300021358 Bacteria 1022
314 Ga0213876_10007201 3300021384 Bacteria 6064
315 Ga0213876_10052678 3300021384 Bacteria 2151
316 Ga0209233_1000006 3300025261 Bacteria 1473685
317 Ga0209758_1000032 3300025297 Bacteria 481623
318 Ga0207656_10065526 3300025321 Bacteria 1604
319 Ga0207682_10101858 3300025893 Bacteria 1256
320 Ga0207692_10023536 3300025898 Bacteria 2850
321 Ga0207680_10023811 3300025903 Bacteria 3350
322 Ga0207680_10281219 3300025903 Bacteria 1156
323 Ga0207647_10340160 3300025904 Bacteria 850
324 Ga0207647_10380065 3300025904 Bacteria 797
325 Ga0207699_10481609 3300025906 Bacteria 894
326 Ga0207645_10056597 3300025907 Bacteria 2503
327 Ga0207645_10536395 3300025907 Bacteria 793
328 Ga0207643_10071913 3300025908 Bacteria 1992
329 Ga0207705_10025773 3300025909 Bacteria 4195
330 Ga0207705_10040166 3300025909 Bacteria 3355
331 Ga0207705_10044087 3300025909 Bacteria 3205
332 Ga0207705_10301745 3300025909 Bacteria 1228
333 Ga0207705_10345509 3300025909 Bacteria 1146
334 Ga0207705_10354071 3300025909 Bacteria 1131
335 Ga0207705_10451693 3300025909 Bacteria 996
336 Ga0207705_11494968 3300025909 Bacteria 511
337 Ga0207654_10124007 3300025911 Bacteria 1626
338 Ga0207654_10222351 3300025911 Bacteria 1253
339 Ga0207654_10274867 3300025911 Bacteria 1138
340 Ga0207654_10297937 3300025911 Bacteria 1096
341 Ga0207654_11054803 3300025911 Bacteria 592
342 Ga0207707_10088798 3300025912 Bacteria 2701
343 Ga0207707_10658724 3300025912 Bacteria 882
344 Ga0207695_10004655 3300025913 Bacteria 18589
345 Ga0207695_10028171 3300025913 Bacteria 6236
346 Ga0207695_10098554 3300025913 Bacteria 2922
347 Ga0207695_10241255 3300025913 Bacteria 1709
348 Ga0207695_10426872 3300025913 Bacteria 1209
349 Ga0207695_10509254 3300025913 Bacteria 1086
350 Ga0207695_10561317 3300025913 Bacteria 1023
351 Ga0207671_10029035 3300025914 Bacteria 4132
352 Ga0207671_10223583 3300025914 Bacteria 1475
353 Ga0207671_10520295 3300025914 Bacteria 949
354 Ga0207693_10000739 3300025915 Bacteria 29436
355 Ga0207693_10000984 3300025915 Bacteria 25549
356 Ga0207663_10073277 3300025916 Bacteria 2215
357 Ga0207663_10090188 3300025916 Bacteria 2032
358 Ga0207663_10250718 3300025916 Bacteria 1303
359 Ga0207663_10473861 3300025916 Bacteria 969
360 Ga0207660_10087873 3300025917 Bacteria 2297
361 Ga0207660_10950655 3300025917 Bacteria 701
362 Ga0207657_10021054 3300025919 Bacteria 6148
363 Ga0207657_10025991 3300025919 Bacteria 5389
364 Ga0207657_10043003 3300025919 Bacteria 3983
365 Ga0207657_10186187 3300025919 Bacteria 1676
366 Ga0207649_10000632 3300025920 Bacteria 23589
367 Ga0207649_10157371 3300025920 Bacteria 1571
368 Ga0207649_10935752 3300025920 Bacteria 680
369 Ga0207652_10028759 3300025921 Bacteria 4640
370 Ga0207652_10047196 3300025921 Bacteria 3678
371 Ga0207652_10071678 3300025921 Bacteria 3011
372 Ga0207652_10959736 3300025921 Bacteria 753
373 Ga0207652_11189010 3300025921 Bacteria 664
374 Ga0207681_10785266 3300025923 Bacteria 795
375 Ga0207694_10025438 3300025924 Bacteria 4500
376 Ga0207694_10038969 3300025924 Bacteria 3655
377 Ga0207694_10152832 3300025924 Bacteria 1860
378 Ga0207694_10328135 3300025924 Bacteria 1264
379 Ga0207694_10622682 3300025924 Bacteria 908
380 Ga0207694_10713799 3300025924 Bacteria 846
381 Ga0207650_10513829 3300025925 Bacteria 1002
382 Ga0207659_10605039 3300025926 Bacteria 935
383 Ga0207659_10933358 3300025926 Bacteria 746
384 Ga0207687_10014573 3300025927 Bacteria 5145
385 Ga0207687_10066379 3300025927 Bacteria 2564
386 Ga0207687_10164696 3300025927 Bacteria 1705
387 Ga0207687_10638123 3300025927 Bacteria 900
388 Ga0207700_10000040 3300025928 Bacteria 99982
389 Ga0207700_10048044 3300025928 Bacteria 3166
390 Ga0207700_10156792 3300025928 Bacteria 1887
391 Ga0207664_10308059 3300025929 Bacteria 1395
392 Ga0207644_10122524 3300025931 Bacteria 1981
393 Ga0207644_10833410 3300025931 Bacteria 772
394 Ga0207644_10838948 3300025931 Bacteria 769
395 Ga0207690_10021898 3300025932 Bacteria 3970
396 Ga0207690_10723409 3300025932 Bacteria 819
397 Ga0207706_10072847 3300025933 Bacteria 3020
398 Ga0207686_10012045 3300025934 Bacteria 4750
399 Ga0207686_10037760 3300025934 Bacteria 2918
400 Ga0207686_10202363 3300025934 Bacteria 1423
401 Ga0207686_11302884 3300025934 Bacteria 596
402 Ga0207709_10015547 3300025935 Bacteria 4220
403 Ga0207670_10472016 3300025936 Bacteria 1015
404 Ga0207669_10161769 3300025937 Bacteria 1582
405 Ga0207704_10024686 3300025938 Bacteria 3266
406 Ga0207704_10058270 3300025938 Bacteria 2377
407 Ga0207665_10160130 3300025939 Bacteria 1618
408 Ga0207691_10708685 3300025940 Bacteria 848
409 Ga0207691_10727012 3300025940 Bacteria 836
410 Ga0207711_10016812 3300025941 Bacteria 6076
411 Ga0207711_10655567 3300025941 Bacteria 979
412 Ga0207711_11546719 3300025941 Bacteria 607
413 Ga0207689_10018498 3300025942 Bacteria 5879
414 Ga0207689_10487210 3300025942 Bacteria 1033
415 Ga0207661_10115180 3300025944 Bacteria 2280
416 Ga0207661_10141870 3300025944 Bacteria 2068
417 Ga0207679_10027625 3300025945 Bacteria 3927
418 Ga0207667_10012386 3300025949 Bacteria 9829
419 Ga0207667_10017280 3300025949 Bacteria 8126
420 Ga0207667_10030246 3300025949 Bacteria 5861
421 Ga0207667_10121559 3300025949 Bacteria 2691
422 Ga0207667_10588093 3300025949 Bacteria 1123
423 Ga0207667_10616007 3300025949 Bacteria 1093
424 Ga0207667_11497286 3300025949 Bacteria 646
425 Ga0207667_11709458 3300025949 Bacteria 595
426 Ga0207651_10031378 3300025960 Bacteria 3396
427 Ga0207712_10126357 3300025961 Bacteria 1942
428 Ga0207668_10092418 3300025972 Bacteria 2227
429 Ga0207640_10351661 3300025981 Bacteria 1184
430 Ga0207640_10353745 3300025981 Bacteria 1181
431 Ga0207640_10409097 3300025981 Bacteria 1107
432 Ga0207640_10841659 3300025981 Bacteria 798
433 Ga0207640_10912683 3300025981 Bacteria 768
434 Ga0207658_10569026 3300025986 Bacteria 1015
435 Ga0207658_11047905 3300025986 Bacteria 744
436 Ga0207677_10042613 3300026023 Bacteria 3011
437 Ga0207677_10058568 3300026023 Bacteria 2653
438 Ga0207677_10077720 3300026023 Bacteria 2368
439 Ga0207677_10414002 3300026023 Bacteria 1146
440 Ga0207703_10006959 3300026035 Bacteria 9001
441 Ga0207703_10035982 3300026035 Bacteria 3937
442 Ga0207703_10095922 3300026035 Bacteria 2503
443 Ga0207703_10360058 3300026035 Bacteria 1341
444 Ga0207703_11006116 3300026035 Bacteria 800
445 Ga0207703_11221466 3300026035 Bacteria 723
446 Ga0207703_11458394 3300026035 Bacteria 658
447 Ga0207639_10083711 3300026041 Bacteria 2532
448 Ga0207639_10166427 3300026041 Bacteria 1863
449 Ga0207639_10178675 3300026041 Bacteria 1804
450 Ga0207639_10182276 3300026041 Bacteria 1787
451 Ga0207702_10000007 3300026078 Bacteria 332551
452 Ga0207702_10000012 3300026078 Bacteria 269770
453 Ga0207702_10050896 3300026078 Bacteria 3498
454 Ga0207702_10151102 3300026078 Bacteria 2112
455 Ga0207702_10394630 3300026078 Bacteria 1333
456 Ga0207702_10715077 3300026078 Bacteria 987
457 Ga0207702_10885971 3300026078 Bacteria 884
458 Ga0207702_11864084 3300026078 Bacteria 593
459 Ga0207641_10011965 3300026088 Bacteria 7117
460 Ga0207641_11284666 3300026088 Bacteria 732
461 Ga0207648_10018211 3300026089 Bacteria 6362
462 Ga0207648_10097400 3300026089 Bacteria 2574
463 Ga0207676_10327559 3300026095 Bacteria 1408
464 Ga0207676_11211150 3300026095 Bacteria 748
465 Ga0207676_11529679 3300026095 Bacteria 664
466 Ga0207674_10000059 3300026116 Bacteria 112995
467 Ga0207674_10040636 3300026116 Bacteria 4817
468 Ga0207674_10070709 3300026116 Bacteria 3509
469 Ga0207674_10215413 3300026116 Bacteria 1869
470 Ga0207674_10418741 3300026116 Bacteria 1294
471 Ga0207674_11815079 3300026116 Bacteria 577
472 Ga0207675_100047309 3300026118 Bacteria 4017
473 Ga0207683_10048918 3300026121 Bacteria 3700
474 Ga0207683_10129204 3300026121 Bacteria 2272
475 Ga0207683_10418165 3300026121 Bacteria 1234
476 Ga0207683_11683441 3300026121 Bacteria 584
477 Ga0207698_10106588 3300026142 Bacteria 2337
478 Ga0207698_10232828 3300026142 Bacteria 1673
479 Ga0207698_10312713 3300026142 Bacteria 1467
480 Ga0207698_10983764 3300026142 Bacteria 854
481 Ga0207698_11991044 3300026142 Bacteria 595
482 Ga0268266_10000300 3300028379 Bacteria 79299
483 Ga0268266_10011865 3300028379 Bacteria 7548
484 Ga0268266_10096856 3300028379 Bacteria 2594
485 Ga0268266_10138758 3300028379 Bacteria 2180
486 Ga0268266_10247882 3300028379 Bacteria 1646
487 Ga0268266_10254417 3300028379 Bacteria 1625
488 Ga0268266_10923350 3300028379 Bacteria 844
489 Ga0268266_11201142 3300028379 Bacteria 733
490 Ga0268266_11501390 3300028379 Unclassified 649
491 Ga0268265_10219366 3300028380 Bacteria 1663
492 Ga0268264_10129743 3300028381 Bacteria 2233
493 Ga0268264_10618965 3300028381 Bacteria 1069
494 Ga0265318_10039495 3300028577 Bacteria 1800
495 Ga0265323_10060667 3300028653 Bacteria 1316
496 Ga0265338_10004962 3300028800 Bacteria 17627
497 Ga0265338_10047534 3300028800 Bacteria 3918
498 Ga0265324_10026263 3300029957 Bacteria 2062
499 Ga0265328_10015279 3300031239 Bacteria 3011
500 Ga0265328_10066911 3300031239 Bacteria 1320
501 Ga0265328_10112178 3300031239 Bacteria 1014
502 Ga0265329_10072017 3300031242 Bacteria 1094
503 Ga0265329_10266481 3300031242 Bacteria 574
504 Ga0265339_10072950 3300031249 Bacteria 1826
505 Ga0265331_10000002 3300031250 Bacteria 511481
506 Ga0265331_10000355 3300031250 Bacteria 48482
507 Ga0265331_10015228 3300031250 Bacteria 4068
508 Ga0265331_10048508 3300031250 Bacteria 2041
509 Ga0265327_10000033 3300031251 Bacteria 317182
510 Ga0265316_10005099 3300031344 Bacteria 12871
511 Ga0265316_10047586 3300031344 Bacteria 3392
512 Ga0265316_10106540 3300031344 Bacteria 2126
513 Ga0307513_10059502 3300031456 Bacteria 4055
514 Ga0265313_10002332 3300031595 Bacteria 16625
515 Ga0265313_10003291 3300031595 Bacteria 13262
516 Ga0265313_10046809 3300031595 Bacteria 2098
517 Ga0265314_10004887 3300031711 Bacteria 12255
518 Ga0265314_10006025 3300031711 Bacteria 10798
519 Ga0265314_10122170 3300031711 Bacteria 1637
520 Ga0265314_10147490 3300031711 Bacteria 1447
521 Ga0265314_10158067 3300031711 Bacteria 1382
522 Ga0265314_10292968 3300031711 Bacteria 916
523 Ga0265314_10509572 3300031711 Bacteria 632
524 Ga0265342_10014577 3300031712 Bacteria 5214
525 Ga0265342_10071490 3300031712 Bacteria 2021
526 Ga0265342_10088121 3300031712 Bacteria 1782
527 Ga0307516_10031741 3300031730 Bacteria 5324
528 Ga0307516_10097694 3300031730 Bacteria 2756
529 Ga0307409_100548053 3300031995 Bacteria 1135
530 Ga0307510_10419317 3300033180 Bacteria 781
531 Ga0373941_0130590 3300035115 Bacteria 905
532 Ga0373956_0106284 3300035119 Bacteria 1305
533 Ga0373957_0161172 3300035120 Bacteria 924
534 Ga0373955_0085734 3300035172 Bacteria 1788
535 Ga0373955_0209621 3300035172 Bacteria 1162
536 Ga0373955_0283791 3300035172 Bacteria 996
537 Ga0373942_0174790 3300035207 Bacteria 701
538 Ga0373931_0052318 3300035691 Bacteria 2177
539 Ga0373931_0708731 3300035691 Bacteria 665
540 Ga0373935_0336968 3300035692 Bacteria 1073
541 Ga0373933_0007200 3300035724 Bacteria 6064
542 Ga0373933_0313211 3300035724 Bacteria 1017
543 Ga0373937_0007526 3300036401 Bacteria 9428
544 Ga0373937_0947538 3300036401 Bacteria 809
545 Ga0373925_0162746 3300037068 Bacteria 1758
546 Ga0395899_0038147 3300037312 Bacteria 3600
547 Ga0395899_0300597 3300037312 Bacteria 1086
548 Ga0395900_0092934 3300037418 Bacteria 3099
549 Ga0395900_0130894 3300037418 Bacteria 2571
550 Ga0395900_0685934 3300037418 Bacteria 959
551 Ga0395898_0006454 3300037466 Bacteria 12529
552 Ga0395898_0020925 3300037466 Bacteria 6639
553 Ga0395898_0238174 3300037466 Bacteria 1736
554 Ga0395898_0700800 3300037466 Bacteria 954
555 Ga0395901_0021751 3300038443 Bacteria 6571
556 Ga0395901_0095286 3300038443 Bacteria 3119
557 Ga0436365_0372349 3300039437 Bacteria 2320
558 Ga0436365_1158121 3300039437 Bacteria 31439
559 Ga0436360_0412630 3300039438 Bacteria 1471
560 Ga0436361_0176829 3300039447 Bacteria 930
561 Ga0436363_0429168 3300039450 Bacteria 758
562 Ga0436363_0855093 3300039450 Bacteria 1495
563 Ga0436362_0351766 3300039453 Bacteria 1185
564 Ga0436362_0488953 3300039453 Bacteria 1291
565 Ga0436362_1003981 3300039453 Bacteria 4766
566 Ga0451789_0477115 3300041443 Bacteria 786
567 Ga0451793_0272761 3300041452 Bacteria 511
568 Ga0451793_1650269 3300041452 Bacteria 916
569 Ga0451807_1472424 3300041486 Bacteria 1129
570 Ga0451839_1102129 3300041496 Bacteria 579
571 Ga0451843_1216968 3300041509 Bacteria 506
572 Ga0466963_0074105 3300044694 Bacteria 2296
573 Ga0466971_0113482 3300044719 Bacteria 1252
574 Ga0466957_0145414 3300044842 Bacteria 1530
575 Ga0495592_0403084 3300046454 Bacteria 866
576 Ga0495607_0329440 3300046501 Bacteria 710
577 Ga0495608_0411095 3300046511 Bacteria 827
578 Ga0495618_0156972 3300046514 Bacteria 1452
579 Ga0495620_0349227 3300046515 Bacteria 561
580 Ga0495630_0704805 3300046517 Bacteria 772
581 Ga0495630_0771117 3300046517 Bacteria 735
582 Ga0495632_0323757 3300046519 Bacteria 681
583 Ga0495648_0074214 3300046524 Bacteria 1961
584 Ga0495648_0209641 3300046524 Bacteria 969
585 Ga0495642_0142297 3300046528 Bacteria 1036
586 Ga0495654_0266812 3300046530 Bacteria 708
587 Ga0495587_0318010 3300046536 Bacteria 869
588 Ga0495598_0317684 3300046537 Bacteria 593
589 Ga0495622_0001979 3300046557 Bacteria 10045
590 Ga0495667_0735693 3300046559 Bacteria 610
591 Ga0495668_0051955 3300046616 Bacteria 2269
592 Ga0495661_0234439 3300046665 Bacteria 945
593 Ga0495599_0135608 3300046678 Bacteria 1528
594 Ga0495623_0124872 3300046679 Bacteria 1546
595 Ga0495623_0156475 3300046679 Bacteria 1343
596 Ga0495670_0058903 3300046691 Bacteria 1928
597 Ga0495604_0156020 3300047317 Bacteria 1617
598 Ga0495604_0773980 3300047317 Bacteria 606
599 Ga0495674_0777337 3300047319 Bacteria 746
600 Ga0495680_1016684 3300047322 Bacteria 529
601 Ga0495683_0227860 3300047323 Bacteria 828
602 Ga0495681_0281832 3300047470 Bacteria 648
603 Ga0495602_0209071 3300048088 Bacteria 1483
604 Ga0495602_0377885 3300048088 Bacteria 1016
605 Ga0496100_0357704 3300048903 Bacteria 1104
606 Ga0496102_0873415 3300048905 Bacteria 821
607 Ga0496104_0484790 3300048907 Bacteria 1148
608 Ga0496107_0144451 3300048910 Bacteria 1759
609 Ga0496111_0288577 3300048914 Bacteria 1217
610 Ga0496121_0000465 3300048924 Bacteria 78967
611 Ga0501031_0011092 3300049568 Bacteria 5874
612 Ga0501031_0480780 3300049568 Bacteria 802
613 Ga0501032_0008815 3300049569 Bacteria 7337
614 Ga0501033_0006278 3300049570 Bacteria 9319
615 Ga0501033_0009798 3300049570 Bacteria 7356
616 Ga0501033_0028520 3300049570 Bacteria 4193
617 Ga0501033_0033281 3300049570 Bacteria 3870
618 Ga0501033_0091974 3300049570 Bacteria 2219
619 Ga0501033_0249425 3300049570 Bacteria 1258
620 Ga0501033_0995344 3300049570 Bacteria 560
621 Ga0501034_0007184 3300049571 Bacteria 11887
622 Ga0501034_0105769 3300049571 Bacteria 2807
623 Ga0501034_0150085 3300049571 Bacteria 2307
624 Ga0501034_0352041 3300049571 Bacteria 1401
625 Ga0501034_0565429 3300049571 Bacteria 1045
626 Ga0501034_0879691 3300049571 Bacteria 785
627 Ga0501034_0974228 3300049571 Bacteria 733
628 Ga0501036_0003669 3300049572 Bacteria 12281
629 Ga0501036_0553453 3300049572 Bacteria 956
630 Ga0501037_0003022 3300049573 Bacteria 12212
631 Ga0501037_0025520 3300049573 Bacteria 4366
632 Ga0501037_0133821 3300049573 Bacteria 1776
633 Ga0501038_0035277 3300049574 Bacteria 4392
634 Ga0501038_0088875 3300049574 Bacteria 2593
635 Ga0501038_0229625 3300049574 Bacteria 1477
636 Ga0501038_0263116 3300049574 Bacteria 1362
637 Ga0501038_0484714 3300049574 Bacteria 947
638 Ga0501039_0002592 3300049575 Bacteria 13512
639 Ga0501042_0048596 3300049578 Bacteria 3025
640 Ga0501043_0007594 3300049579 Bacteria 8597
641 Ga0501043_0049325 3300049579 Bacteria 3310
642 Ga0501043_0062467 3300049579 Bacteria 2924
643 Ga0501043_0631210 3300049579 Bacteria 788
644 Ga0501046_0001103 3300049580 Bacteria 26437
645 Ga0501046_0006077 3300049580 Bacteria 10744
646 Ga0501046_0684231 3300049580 Bacteria 723
647 Ga0501047_0010947 3300049581 Bacteria 8582
648 Ga0501047_0016454 3300049581 Bacteria 7060
649 Ga0501047_0029514 3300049581 Bacteria 5287
650 Ga0501047_0037070 3300049581 Bacteria 4714
651 Ga0501047_0045031 3300049581 Bacteria 4265
652 Ga0501047_0045809 3300049581 Bacteria 4228
653 Ga0501047_0116388 3300049581 Bacteria 2555
654 Ga0501047_0190478 3300049581 Bacteria 1915
655 Ga0501047_0384132 3300049581 Bacteria 1238
656 Ga0501048_0027765 3300049582 Bacteria 4109
657 Ga0501048_0167139 3300049582 Bacteria 1558
658 Ga0501067_0002155 3300049583 Bacteria 10846
659 Ga0501067_0030587 3300049583 Bacteria 2986
660 Ga0501067_0409285 3300049583 Bacteria 757
661 Ga0501068_0060922 3300049584 Bacteria 2292
662 Ga0501068_0215935 3300049584 Bacteria 1218
663 Ga0501068_0308636 3300049584 Bacteria 1013
664 Ga0501069_0003161 3300049585 Bacteria 8438
665 Ga0501069_0545554 3300049585 Bacteria 693
666 Ga0501070_0005453 3300049586 Bacteria 10859
667 Ga0501070_0034294 3300049586 Bacteria 4244
668 Ga0501070_0289212 3300049586 Bacteria 1336
669 Ga0501070_1136892 3300049586 Bacteria 601
670 Ga0501073_0003745 3300049589 Bacteria 11423
671 Ga0501073_0043046 3300049589 Bacteria 3185
672 Ga0501073_0055149 3300049589 Bacteria 2781
673 Ga0501073_0695442 3300049589 Bacteria 701
674 Ga0501074_0005025 3300049590 Bacteria 9493
675 Ga0501079_0003337 3300049741 Bacteria 11775
676 Ga0501080_0028698 3300049742 Bacteria 5179
677 Ga0501080_0255713 3300049742 Bacteria 1597
678 Ga0501080_0306611 3300049742 Bacteria 1439
679 Ga0501080_0424673 3300049742 Bacteria 1194
680 Ga0501080_1377288 3300049742 Bacteria 602
681 Ga0501083_0001440 3300049744 Bacteria 16247
682 Ga0501083_1038609 3300049744 Bacteria 533
683 Ga0501035_0012942 3300049822 Bacteria 7701
684 Ga0501035_0015308 3300049822 Bacteria 7077
685 Ga0501035_0020872 3300049822 Bacteria 6019
686 Ga0501035_0028442 3300049822 Bacteria 5101
687 Ga0501035_0043606 3300049822 Bacteria 4041
688 Ga0501035_0054541 3300049822 Bacteria 3572
689 Ga0501035_0057447 3300049822 Bacteria 3469
690 Ga0501035_0128740 3300049822 Bacteria 2208
691 Ga0501035_0242054 3300049822 Bacteria 1534
692 Ga0501035_0329995 3300049822 Bacteria 1280
693 Ga0501044_0019422 3300049823 Bacteria 7271
694 Ga0501044_0030857 3300049823 Bacteria 5644
695 Ga0501044_0031578 3300049823 Bacteria 5574
696 Ga0501044_0056440 3300049823 Bacteria 4032
697 Ga0501044_0059547 3300049823 Bacteria 3912
698 Ga0501044_0196733 3300049823 Bacteria 1975
699 Ga0501044_0488724 3300049823 Bacteria 1133
700 Ga0501044_0545762 3300049823 Bacteria 1057
701 Ga0501045_0028826 3300049824 Bacteria 4007
702 nmdc:mga0k408_153795_c2 3300050493 Bacteria 909
703 nmdc:mga0n895_113019_c1 3300050512 Bacteria 2733
704 nmdc:mga0n895_820045_c1 3300050512 Bacteria 920
705 nmdc:mga08x19_1186_c1 3300050514 Bacteria 16315
706 nmdc:mga08x19_72287_c1 3300050514 Bacteria 2250
707 Ga0500643_000023 3300053087 Bacteria 273090
708 Ga0500646_0063618 3300053090 Bacteria 1091
709 Ga0500641_0043497 3300053096 Bacteria 1823
710 Ga0500555_067064 3300053103 Bacteria 953
711 Ga0500595_000081 3300053119 Bacteria 66983
712 Ga0500595_033028 3300053119 Bacteria 1721
713 Ga0500559_0158729 3300053136 Bacteria 1062
714 Ga0500568_0009559 3300053139 Bacteria 4595
715 Ga0500568_0079149 3300053139 Bacteria 1249
716 Ga0500573_0000743 3300053140 Bacteria 14559
717 Ga0500604_0090179 3300053151 Bacteria 1000
718 Ga0500611_033730 3300053727 Bacteria 1079
719 Ga0501084_0006811 3300054114 Bacteria 9401
720 Ga0587093_036666 3300059478 Bacteria 728
721 Ga0587077_038313 3300059493 Bacteria 950
722 Ga0587077_228183 3300059493 Bacteria 528
723 Ga0587085_176327 3300059506 Bacteria 509
724 Ga0587091_023927 3300059511 Bacteria 1092
725 Ga0587091_088599 3300059511 Bacteria 707
726 Ga0587092_037424 3300059512 Bacteria 831
727 Ga0587072_085703 3300059643 Bacteria 687
728 Ga0587072_171275 3300059643 Bacteria 536
729 Ga0587076_056153 3300059645 Bacteria 782
730 Ga0587079_096774 3300059647 Bacteria 699
731 Ga0587102_039068 3300059649 Bacteria 607
732 Ga0587111_0021987 3300060346 Bacteria 1235
733 Ga0587111_0033676 3300060346 Bacteria 1060
734 Ga0587111_0068205 3300060346 Bacteria 825
735 Ga0501082_0011865 3300060353 Bacteria 7487
736 Ga0501082_0153394 3300060353 Bacteria 2001
737 2599445888 2599185178 Bacteria 5365746
738 2842736619 2842733646 Bacteria 5716726
739 Ga0058860_12090147
740 JGI24741J21665_1000191
741 JGI25156J39149_1007374
742 JGI25165J46597_1000008
743 JGI25153J46596_10000320
744 Ga0007409J51694_1087344
745 Ga0055538_1009058
746 Ga0055533_1015694
747 Ga0055532_1000328
748 Ga0055541_1001445
749 Ga0058863_11936284
750 Ga0058861_12018180
751 Ga0058862_10019839
752 Ga0058862_10036443
753 Ga0058862_10104114
754 Ga0058862_10145841
755 Ga0058862_12881293
756 Ga0070658_10019494
757 Ga0070658_10115526
758 Ga0070658_10144098
759 Ga0070658_10222409
760 Ga0070658_10237621
761 Ga0070658_10546118
762 Ga0070676_10023715
763 Ga0070676_10363654
764 Ga0070676_11245543
765 Ga0070683_100624377
766 Ga0070683_100795223
767 Ga0070690_100483159
768 Ga0070670_100279865
769 Ga0070670_100740229
770 Ga0070670_100814348
771 Ga0070670_101220203
772 Ga0068869_100247779
773 Ga0068869_100448814
774 Ga0068869_100826946
775 Ga0068869_100885970
776 Ga0070666_10012543
777 Ga0070666_10551008
778 Ga0070680_100054464
779 Ga0070680_100972882
780 Ga0070682_100114591
781 Ga0070682_100923864
782 Ga0068868_100055839
783 Ga0068868_100067858
784 Ga0070660_100004785
785 Ga0070660_100081852
786 Ga0070660_100152016
787 Ga0070660_100832834
788 Ga0070660_101710950
789 Ga0070689_100163136
790 Ga0070689_100373274
791 Ga0070691_10498264
792 Ga0070687_100986602
793 Ga0070661_100004718
794 Ga0070661_100034946
795 Ga0070661_100997099
796 Ga0070661_101077853
797 Ga0070692_10831214
798 Ga0070668_101170729
799 Ga0070668_101395203
800 Ga0070675_100073445
801 Ga0070675_100668809
802 Ga0070675_100782175
803 Ga0070671_100271492
804 Ga0070671_100579435
805 Ga0070674_102044957
806 Ga0070673_100066120
807 Ga0070673_101204175
808 Ga0070688_100124684
809 Ga0070659_100007210
810 Ga0070659_101347440
811 Ga0070667_100679626
812 Ga0070709_10001616
813 Ga0070709_11085582
814 Ga0070714_100089898
815 Ga0070714_100513624
816 Ga0070713_100000002
817 Ga0070713_100053808
818 Ga0070713_100744274
819 Ga0070710_10020896
820 Ga0070710_10224853
821 Ga0070710_10349181
822 Ga0070711_100097749
823 Ga0070711_100587671
824 Ga0070711_100590485
825 Ga0070694_100105354
826 Ga0070708_100496139
827 Ga0070678_100025365
828 Ga0070678_100067266
829 Ga0070678_100075793
830 Ga0070678_100884891
831 Ga0070662_100072113
832 Ga0070681_10130601
833 Ga0070681_10173170
834 Ga0068867_100036538
835 Ga0068867_100050053
836 Ga0070685_10234879
837 Ga0070685_10364266
838 Ga0070699_100195663
839 Ga0070679_100028841
840 Ga0070679_100104911
841 Ga0070679_100200003
842 Ga0070679_100329602
843 Ga0070684_100007159
844 Ga0070684_100364222
845 Ga0070684_101639422
846 Ga0070697_100227030
847 Ga0068853_100134631
848 Ga0068853_100391868
849 Ga0068853_100465275
850 Ga0068853_101147814
851 Ga0068853_101598931
852 Ga0070672_100272761
853 Ga0070672_101011650
854 Ga0070695_100367769
855 Ga0070696_101302772
856 Ga0070693_100007390
857 Ga0070693_100018614
858 Ga0070693_100184882
859 Ga0070693_100360405
860 Ga0070665_100000834
861 Ga0070665_100011790
862 Ga0070665_100049476
863 Ga0070665_100109277
864 Ga0070665_100148208
865 Ga0070665_101176859
866 Ga0070665_101563875
867 Ga0070665_101653561
868 Ga0068855_100015050
869 Ga0068855_100025353
870 Ga0068855_100027521
871 Ga0068855_100036403
872 Ga0068855_100073866
873 Ga0068855_101404345
874 Ga0068855_101473095
875 Ga0070664_100119477
876 Ga0068857_100000594
877 Ga0068857_100173184
878 Ga0068857_100196980
879 Ga0068857_100815347
880 Ga0068857_101168499
881 Ga0068854_100153550
882 Ga0068854_100251323
883 Ga0068854_100601827
884 Ga0068856_100010721
885 Ga0068856_100065992
886 Ga0068856_100355579
887 Ga0068856_101576597
888 Ga0068856_101703890
889 Ga0068852_100231494
890 Ga0068852_100234871
891 Ga0068852_100519799
892 Ga0068852_102000234
893 Ga0068859_101186518
894 Ga0068864_100090657
895 Ga0068864_100192987
896 Ga0068864_100382231
897 Ga0068864_100896487
898 Ga0068861_100031576
899 Ga0068851_10113397
900 Ga0068870_10046306
901 Ga0068863_100385733
902 Ga0068858_100010394
903 Ga0068858_100024346
904 Ga0068858_100032668
905 Ga0068858_100160514
906 Ga0068858_100546219
907 Ga0068860_100111252
908 Ga0068860_100134246
909 Ga0068860_100270751
910 Ga0070715_10075548
911 Ga0070716_100119608
912 Ga0070712_100000549
913 Ga0070712_100002995
914 Ga0075366_10160025
915 Ga0097621_100000991
916 Ga0097621_100008509
917 Ga0097621_100011379
918 Ga0097621_100057184
919 Ga0097621_100127275
920 Ga0097621_100574576
921 Ga0097621_100822345
922 Ga0068871_100001977
923 Ga0068871_100024272
924 Ga0068871_100035640
925 Ga0068871_100219202
926 Ga0068871_100316244
927 Ga0075434_100093861
928 Ga0068865_100009974
929 Ga0068865_100299407
930 Ga0068865_100515042
931 Ga0075436_100001617
932 Ga0075436_101259672
933 Ga0097620_101186508
934 Ga0075435_100039026
935 Ga0105250_10324306
936 Ga0105240_10005130
937 Ga0105240_10010954
938 Ga0105240_10085013
939 Ga0105240_10097878
940 Ga0105240_10441531
941 Ga0105240_10993429
942 Ga0105240_12052984
943 Ga0105240_12315720
944 Ga0105245_10051792
945 Ga0105245_10061026
946 Ga0105245_10556284
947 Ga0105245_11995063
948 Ga0105243_12283223
949 Ga0105241_10016422
950 Ga0105241_10022495
951 Ga0105241_10131356
952 Ga0105241_10311392
953 Ga0105241_10327775
954 Ga0105241_10548528
955 Ga0105241_11061922
956 Ga0105242_10128611
957 Ga0105242_10216916
958 Ga0105242_10248762
959 Ga0105242_10304716
960 Ga0105242_10536322
961 Ga0105242_12067353
962 Ga0105248_10042943
963 Ga0105248_10414240
964 Ga0105248_10631348
965 Ga0105248_12063343
966 Ga0105237_10006357
967 Ga0105237_10042267
968 Ga0105237_10131910
969 Ga0105237_10274935
970 Ga0105237_11321248
971 Ga0105238_10002850
972 Ga0105238_10161372
973 Ga0105238_10481451
974 Ga0105238_10983761
975 Ga0105238_11037815
976 Ga0105238_11343619
977 Ga0105249_10050236
978 Ga0105249_12589659
979 Ga0105028_111009
980 Ga0105239_10076366
981 Ga0105239_10078389
982 Ga0105239_10137848
983 Ga0105239_10380569
984 Ga0105239_10699982
985 Ga0105239_10800784
986 Ga0105239_10828643
987 Ga0105239_11556024
988 Ga0105239_12126234
989 Ga0105246_10013503
990 Ga0105246_10111134
991 Ga0105246_11063279
992 Ga0105246_12348176
993 Ga0157373_10001037
994 Ga0157373_10130463
995 Ga0157373_10662617
996 Ga0157373_10680881
997 Ga0157371_10856046
998 Ga0157370_10004766
999 Ga0157370_10083716
1000 Ga0157370_10219488
1001 Ga0157370_10249176
1002 Ga0157370_10385655
1003 Ga0157370_10763456
1004 Ga0157370_10957804
1005 Ga0157369_10004645
1006 Ga0157369_10175642
1007 Ga0157369_10237078
1008 Ga0157369_11379301
1009 Ga0157374_10027294
1010 Ga0157374_10320758
1011 Ga0157374_10367851
1012 Ga0157374_10422678
1013 Ga0157374_10797141
1014 Ga0157374_10969505
1015 Ga0157378_10084218
1016 Ga0157378_10735505
1017 Ga0157378_12550107
1018 Ga0163162_10060609
1019 Ga0163162_10155158
1020 Ga0163162_10488915
1021 Ga0163162_10641065
1022 Ga0157372_10016694
1023 Ga0157372_10100183
1024 Ga0157375_10029252
1025 Ga0157375_10237679
1026 Ga0163163_10000093
1027 Ga0163163_10346038
1028 Ga0163163_10454763
1029 Ga0157380_10810225
1030 Ga0157377_10135028
1031 Ga0157379_10007358
1032 Ga0157379_10046119
1033 Ga0157379_10080196
1034 Ga0157379_10109702
1035 Ga0157379_10266064
1036 Ga0157379_10585913
1037 Ga0157379_11535445
1038 Ga0157376_10014141
1039 Ga0157376_10049885
1040 Ga0157376_12671252
1041 Ga0163161_10039928
1042 Ga0197907_10104652
1043 Ga0206356_10584804
1044 Ga0206356_11026429
1045 Ga0206355_1487256
1046 Ga0206351_10562475
1047 Ga0206352_10097500
1048 Ga0206352_11183248
1049 Ga0206354_10125470
1050 Ga0154015_1488823
1051 Ga0213873_10060829
1052 Ga0213876_10007201
1053 Ga0213876_10052678
1054 Ga0209233_1000006
1055 Ga0209758_1000032
1056 Ga0207656_10065526
1057 Ga0207682_10101858
1058 Ga0207692_10023536
1059 Ga0207680_10023811
1060 Ga0207680_10281219
1061 Ga0207647_10340160
1062 Ga0207647_10380065
1063 Ga0207699_10481609
1064 Ga0207645_10056597
1065 Ga0207645_10536395
1066 Ga0207643_10071913
1067 Ga0207705_10025773
1068 Ga0207705_10040166
1069 Ga0207705_10044087
1070 Ga0207705_10301745
1071 Ga0207705_10345509
1072 Ga0207705_10354071
1073 Ga0207705_10451693
1074 Ga0207705_11494968
1075 Ga0207654_10124007
1076 Ga0207654_10222351
1077 Ga0207654_10274867
1078 Ga0207654_10297937
1079 Ga0207654_11054803
1080 Ga0207707_10088798
1081 Ga0207707_10658724
1082 Ga0207695_10004655
1083 Ga0207695_10028171
1084 Ga0207695_10098554
1085 Ga0207695_10241255
1086 Ga0207695_10426872
1087 Ga0207695_10509254
1088 Ga0207695_10561317
1089 Ga0207671_10029035
1090 Ga0207671_10223583
1091 Ga0207671_10520295
1092 Ga0207693_10000739
1093 Ga0207693_10000984
1094 Ga0207663_10073277
1095 Ga0207663_10090188
1096 Ga0207663_10250718
1097 Ga0207663_10473861
1098 Ga0207660_10087873
1099 Ga0207660_10950655
1100 Ga0207657_10021054
1101 Ga0207657_10025991
1102 Ga0207657_10043003
1103 Ga0207657_10186187
1104 Ga0207649_10000632
1105 Ga0207649_10157371
1106 Ga0207649_10935752
1107 Ga0207652_10028759
1108 Ga0207652_10047196
1109 Ga0207652_10071678
1110 Ga0207652_10959736
1111 Ga0207652_11189010
1112 Ga0207681_10785266
1113 Ga0207694_10025438
1114 Ga0207694_10038969
1115 Ga0207694_10152832
1116 Ga0207694_10328135
1117 Ga0207694_10622682
1118 Ga0207694_10713799
1119 Ga0207650_10513829
1120 Ga0207659_10605039
1121 Ga0207659_10933358
1122 Ga0207687_10014573
1123 Ga0207687_10066379
1124 Ga0207687_10164696
1125 Ga0207687_10638123
1126 Ga0207700_10000040
1127 Ga0207700_10048044
1128 Ga0207700_10156792
1129 Ga0207664_10308059
1130 Ga0207644_10122524
1131 Ga0207644_10833410
1132 Ga0207644_10838948
1133 Ga0207690_10021898
1134 Ga0207690_10723409
1135 Ga0207706_10072847
1136 Ga0207686_10012045
1137 Ga0207686_10037760
1138 Ga0207686_10202363
1139 Ga0207686_11302884
1140 Ga0207709_10015547
1141 Ga0207670_10472016
1142 Ga0207669_10161769
1143 Ga0207704_10024686
1144 Ga0207704_10058270
1145 Ga0207665_10160130
1146 Ga0207691_10708685
1147 Ga0207691_10727012
1148 Ga0207711_10016812
1149 Ga0207711_10655567
1150 Ga0207711_11546719
1151 Ga0207689_10018498
1152 Ga0207689_10487210
1153 Ga0207661_10115180
1154 Ga0207661_10141870
1155 Ga0207679_10027625
1156 Ga0207667_10012386
1157 Ga0207667_10017280
1158 Ga0207667_10030246
1159 Ga0207667_10121559
1160 Ga0207667_10588093
1161 Ga0207667_10616007
1162 Ga0207667_11497286
1163 Ga0207667_11709458
1164 Ga0207651_10031378
1165 Ga0207712_10126357
1166 Ga0207668_10092418
1167 Ga0207640_10351661
1168 Ga0207640_10353745
1169 Ga0207640_10409097
1170 Ga0207640_10841659
1171 Ga0207640_10912683
1172 Ga0207658_10569026
1173 Ga0207658_11047905
1174 Ga0207677_10042613
1175 Ga0207677_10058568
1176 Ga0207677_10077720
1177 Ga0207677_10414002
1178 Ga0207703_10006959
1179 Ga0207703_10035982
1180 Ga0207703_10095922
1181 Ga0207703_10360058
1182 Ga0207703_11006116
1183 Ga0207703_11221466
1184 Ga0207703_11458394
1185 Ga0207639_10083711
1186 Ga0207639_10166427
1187 Ga0207639_10178675
1188 Ga0207639_10182276
1189 Ga0207702_10000007
1190 Ga0207702_10000012
1191 Ga0207702_10050896
1192 Ga0207702_10151102
1193 Ga0207702_10394630
1194 Ga0207702_10715077
1195 Ga0207702_10885971
1196 Ga0207702_11864084
1197 Ga0207641_10011965
1198 Ga0207641_11284666
1199 Ga0207648_10018211
1200 Ga0207648_10097400
1201 Ga0207676_10327559
1202 Ga0207676_11211150
1203 Ga0207676_11529679
1204 Ga0207674_10000059
1205 Ga0207674_10040636
1206 Ga0207674_10070709
1207 Ga0207674_10215413
1208 Ga0207674_10418741
1209 Ga0207674_11815079
1210 Ga0207675_100047309
1211 Ga0207683_10048918
1212 Ga0207683_10129204
1213 Ga0207683_10418165
1214 Ga0207683_11683441
1215 Ga0207698_10106588
1216 Ga0207698_10232828
1217 Ga0207698_10312713
1218 Ga0207698_10983764
1219 Ga0207698_11991044
1220 Ga0268266_10000300
1221 Ga0268266_10011865
1222 Ga0268266_10096856
1223 Ga0268266_10138758
1224 Ga0268266_10247882
1225 Ga0268266_10254417
1226 Ga0268266_10923350
1227 Ga0268266_11201142
1228 Ga0268266_11501390
1229 Ga0268265_10219366
1230 Ga0268264_10129743
1231 Ga0268264_10618965
1232 Ga0265318_10039495
1233 Ga0265323_10060667
1234 Ga0265338_10004962
1235 Ga0265338_10047534
1236 Ga0265324_10026263
1237 Ga0265328_10015279
1238 Ga0265328_10066911
1239 Ga0265328_10112178
1240 Ga0265329_10072017
1241 Ga0265329_10266481
1242 Ga0265339_10072950
1243 Ga0265331_10000002
1244 Ga0265331_10000355
1245 Ga0265331_10015228
1246 Ga0265331_10048508
1247 Ga0265327_10000033
1248 Ga0265316_10005099
1249 Ga0265316_10047586
1250 Ga0265316_10106540
1251 Ga0307513_10059502
1252 Ga0265313_10002332
1253 Ga0265313_10003291
1254 Ga0265313_10046809
1255 Ga0265314_10004887
1256 Ga0265314_10006025
1257 Ga0265314_10122170
1258 Ga0265314_10147490
1259 Ga0265314_10158067
1260 Ga0265314_10292968
1261 Ga0265314_10509572
1262 Ga0265342_10014577
1263 Ga0265342_10071490
1264 Ga0265342_10088121
1265 Ga0307516_10031741
1266 Ga0307516_10097694
1267 Ga0307409_100548053
1268 Ga0307510_10419317
1269 Ga0373941_0130590
1270 Ga0373956_0106284
1271 Ga0373957_0161172
1272 Ga0373955_0085734
1273 Ga0373955_0209621
1274 Ga0373955_0283791
1275 Ga0373942_0174790
1276 Ga0373931_0052318
1277 Ga0373931_0708731
1278 Ga0373935_0336968
1279 Ga0373933_0007200
1280 Ga0373933_0313211
1281 Ga0373937_0007526
1282 Ga0373937_0947538
1283 Ga0373925_0162746
1284 Ga0395899_0038147
1285 Ga0395899_0300597
1286 Ga0395900_0092934
1287 Ga0395900_0130894
1288 Ga0395900_0685934
1289 Ga0395898_0006454
1290 Ga0395898_0020925
1291 Ga0395898_0238174
1292 Ga0395898_0700800
1293 Ga0395901_0021751
1294 Ga0395901_0095286
1295 Ga0436365_0372349
1296 Ga0436365_1158121
1297 Ga0436360_0412630
1298 Ga0436361_0176829
1299 Ga0436363_0429168
1300 Ga0436363_0855093
1301 Ga0436362_0351766
1302 Ga0436362_0488953
1303 Ga0436362_1003981
1304 Ga0451789_0477115
1305 Ga0451793_0272761
1306 Ga0451793_1650269
1307 Ga0451807_1472424
1308 Ga0451839_1102129
1309 Ga0451843_1216968
1310 Ga0466963_0074105
1311 Ga0466971_0113482
1312 Ga0466957_0145414
1313 Ga0495592_0403084
1314 Ga0495607_0329440
1315 Ga0495608_0411095
1316 Ga0495618_0156972
1317 Ga0495620_0349227
1318 Ga0495630_0704805
1319 Ga0495630_0771117
1320 Ga0495632_0323757
1321 Ga0495648_0074214
1322 Ga0495648_0209641
1323 Ga0495642_0142297
1324 Ga0495654_0266812
1325 Ga0495587_0318010
1326 Ga0495598_0317684
1327 Ga0495622_0001979
1328 Ga0495667_0735693
1329 Ga0495668_0051955
1330 Ga0495661_0234439
1331 Ga0495599_0135608
1332 Ga0495623_0124872
1333 Ga0495623_0156475
1334 Ga0495670_0058903
1335 Ga0495604_0156020
1336 Ga0495604_0773980
1337 Ga0495674_0777337
1338 Ga0495680_1016684
1339 Ga0495683_0227860
1340 Ga0495681_0281832
1341 Ga0495602_0209071
1342 Ga0495602_0377885
1343 Ga0496100_0357704
1344 Ga0496102_0873415
1345 Ga0496104_0484790
1346 Ga0496107_0144451
1347 Ga0496111_0288577
1348 Ga0496121_0000465
1349 Ga0501031_0011092
1350 Ga0501031_0480780
1351 Ga0501032_0008815
1352 Ga0501033_0006278
1353 Ga0501033_0009798
1354 Ga0501033_0028520
1355 Ga0501033_0033281
1356 Ga0501033_0091974
1357 Ga0501033_0249425
1358 Ga0501033_0995344
1359 Ga0501034_0007184
1360 Ga0501034_0105769
1361 Ga0501034_0150085
1362 Ga0501034_0352041
1363 Ga0501034_0565429
1364 Ga0501034_0879691
1365 Ga0501034_0974228
1366 Ga0501036_0003669
1367 Ga0501036_0553453
1368 Ga0501037_0003022
1369 Ga0501037_0025520
1370 Ga0501037_0133821
1371 Ga0501038_0035277
1372 Ga0501038_0088875
1373 Ga0501038_0229625
1374 Ga0501038_0263116
1375 Ga0501038_0484714
1376 Ga0501039_0002592
1377 Ga0501042_0048596
1378 Ga0501043_0007594
1379 Ga0501043_0049325
1380 Ga0501043_0062467
1381 Ga0501043_0631210
1382 Ga0501046_0001103
1383 Ga0501046_0006077
1384 Ga0501046_0684231
1385 Ga0501047_0010947
1386 Ga0501047_0016454
1387 Ga0501047_0029514
1388 Ga0501047_0037070
1389 Ga0501047_0045031
1390 Ga0501047_0045809
1391 Ga0501047_0116388
1392 Ga0501047_0190478
1393 Ga0501047_0384132
1394 Ga0501048_0027765
1395 Ga0501048_0167139
1396 Ga0501067_0002155
1397 Ga0501067_0030587
1398 Ga0501067_0409285
1399 Ga0501068_0060922
1400 Ga0501068_0215935
1401 Ga0501068_0308636
1402 Ga0501069_0003161
1403 Ga0501069_0545554
1404 Ga0501070_0005453
1405 Ga0501070_0034294
1406 Ga0501070_0289212
1407 Ga0501070_1136892
1408 Ga0501073_0003745
1409 Ga0501073_0043046
1410 Ga0501073_0055149
1411 Ga0501073_0695442
1412 Ga0501074_0005025
1413 Ga0501079_0003337
1414 Ga0501080_0028698
1415 Ga0501080_0255713
1416 Ga0501080_0306611
1417 Ga0501080_0424673
1418 Ga0501080_1377288
1419 Ga0501083_0001440
1420 Ga0501083_1038609
1421 Ga0501035_0012942
1422 Ga0501035_0015308
1423 Ga0501035_0020872
1424 Ga0501035_0028442
1425 Ga0501035_0043606
1426 Ga0501035_0054541
1427 Ga0501035_0057447
1428 Ga0501035_0128740
1429 Ga0501035_0242054
1430 Ga0501035_0329995
1431 Ga0501044_0019422
1432 Ga0501044_0030857
1433 Ga0501044_0031578
1434 Ga0501044_0056440
1435 Ga0501044_0059547
1436 Ga0501044_0196733
1437 Ga0501044_0488724
1438 Ga0501044_0545762
1439 Ga0501045_0028826
1440 nmdc:mga0k408_153795_c2
1441 nmdc:mga0n895_113019_c1
1442 nmdc:mga0n895_820045_c1
1443 nmdc:mga08x19_1186_c1
1444 nmdc:mga08x19_72287_c1
1445 Ga0500643_000023
1446 Ga0500646_0063618
1447 Ga0500641_0043497
1448 Ga0500555_067064
1449 Ga0500595_000081
1450 Ga0500595_033028
1451 Ga0500559_0158729
1452 Ga0500568_0009559
1453 Ga0500568_0079149
1454 Ga0500573_0000743
1455 Ga0500604_0090179
1456 Ga0500611_033730
1457 Ga0501084_0006811
1458 Ga0587093_036666
1459 Ga0587077_038313
1460 Ga0587077_228183
1461 Ga0587085_176327
1462 Ga0587091_023927
1463 Ga0587091_088599
1464 Ga0587092_037424
1465 Ga0587072_085703
1466 Ga0587072_171275
1467 Ga0587076_056153
1468 Ga0587079_096774
1469 Ga0587102_039068
1470 Ga0587111_0021987
1471 Ga0587111_0033676
1472 Ga0587111_0068205
1473 Ga0501082_0011865
1474 Ga0501082_0153394
1475 2599445888
1476 2842736619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

13

144

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8743 55 126
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8421 55 126
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.8248 55 121
7bvz-assembly1.cif.gz_A crystal structure of mreb5 of spiroplasma citri bound to adp 0.7691 73 129
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.7479 55 121
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8248 55 121 3.30.420.270
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.751 94 127 3.40.50.2020
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7479 55 121 3.30.420.270
af_Q9TXN7_507_676_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7403 75 127 3.40.50.2300
af_Q58803_167_347_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7247 74 127 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S9GU90-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9255 56 126 GO:0005886
GO:0015031
GO:0022857
AF-A0A3M1XDY6-F1-model_v4 Biopolymer transporter ExbD 0.9178 52 127
AF-A0A2S9WYI7-F1-model_v4 Biopolymer transporter ExbD 0.9115 52 126 GO:0005886
GO:0015031
GO:0022857
AF-A0A5C5WRB8-F1-model_v4 Biopolymer transport protein ExbD 0.9086 56 128 GO:0005886
GO:0015031
GO:0022857
AF-A0A2S8GGZ0-F1-model_v4 Biopolymer transporter ExbD 0.9047 55 130 GO:0005886
GO:0015031
GO:0022857

Map