F478318
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 737 | 314 | 728 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100112407|Ga0070665_1001124071 |
| Length | 411 |
| Sequence | LLGTKEPGTGRKQDQTKDSVPHIQPSSSSYNFFLTLPSQLVKWVVKALSLFLRNMKFRNFKMVGYVVYGRGSFNQLDEIIEPHRKADDPMIFLVDYFFEKKPLINRIPLRGHDKIVFADVTYEPKTTLVDKLAQQLKDEFGRVSGIIGIGGGSTMDLAKAVSLMMNNPGSSADYQGWDLVKFPGVYKVGIPTLSGTGAEVSRTCVLTGPTKKLGMNSDFTPFDQIVLDPELTTNAPVNQRFYTGMDCYIHCIESLNGTYLNEFSKSYGEKALQLCRKVFVEKKQWDDESDDQLMMASYAGGMSIAYSQVGVAHAVSYGLSYLLGTKHGIGNCIVFDKLEEYYPEGVREFKYMVEKNKIDIPQNITKGLSDEQFDTMINVSMGMKPLWENALGKDWEKVMTREKLRKLFNSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 5 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 6 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 7 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 8 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 9 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 10 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 187 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 188 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 189 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 194 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 202 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 259 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 260 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 261 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 262 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 263 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 267 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 268 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 271 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 272 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 279 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 284 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 292 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 294 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 295 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 298 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 299 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 300 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 302 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 305 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 306 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 307 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 310 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 0 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.6 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 87.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1886170 | 2162886007 | Bacteria | 206362 |
| 2 | JGI24740J21852_10000359 | 3300001979 | Bacteria | 19514 |
| 3 | JGI24740J21852_10004944 | 3300001979 | Bacteria | 5668 |
| 4 | JGI24751J29686_10002525 | 3300002459 | Bacteria | 3685 |
| 5 | JGI25154J39366_1000023 | 3300002738 | Bacteria | 219569 |
| 6 | JGI25153J46596_10017854 | 3300003215 | Bacteria | 2777 |
| 7 | JGI25153J46596_10023624 | 3300003215 | Bacteria | 2236 |
| 8 | rootH1_10132364 | 3300003316 | Bacteria | 4196 |
| 9 | rootH2_10003346 | 3300003320 | Bacteria | 29041 |
| 10 | rootH2_10088824 | 3300003320 | Bacteria | 4549 |
| 11 | rootH2_10128231 | 3300003320 | Bacteria | 7245 |
| 12 | rootL2_10200643 | 3300003322 | Bacteria | 3184 |
| 13 | rootH1_10042049 | 3300003323 | Bacteria | 15171 |
| 14 | rootH1_10114166 | 3300003323 | Bacteria | 4087 |
| 15 | JGI25160J50197_1000375 | 3300003354 | Bacteria | 29260 |
| 16 | JGI25160J50197_1006556 | 3300003354 | Bacteria | 4693 |
| 17 | Ga0055526_1019922 | 3300003771 | Bacteria | 2417 |
| 18 | Ga0055528_1003039 | 3300003790 | Bacteria | 8643 |
| 19 | Ga0055530_10000118 | 3300003791 | Bacteria | 68596 |
| 20 | Ga0055531_10000054 | 3300003794 | Bacteria | 123684 |
| 21 | Ga0055531_10031787 | 3300003794 | Bacteria | 1739 |
| 22 | Ga0055543_1012077 | 3300004625 | Bacteria | 1748 |
| 23 | Ga0065165_1000027 | 3300005262 | Bacteria | 228507 |
| 24 | Ga0065714_10083974 | 3300005288 | Bacteria | 2222 |
| 25 | Ga0065704_10070159 | 3300005289 | Bacteria | 207348 |
| 26 | Ga0065704_10077260 | 3300005289 | Bacteria | 4798 |
| 27 | Ga0070658_10032464 | 3300005327 | Bacteria | 4197 |
| 28 | Ga0070676_10000167 | 3300005328 | Bacteria | 26643 |
| 29 | Ga0070683_100018391 | 3300005329 | Bacteria | 6189 |
| 30 | Ga0070683_100034680 | 3300005329 | Bacteria | 4611 |
| 31 | Ga0070683_100054475 | 3300005329 | Bacteria | 3708 |
| 32 | Ga0070690_100010364 | 3300005330 | Bacteria | 5423 |
| 33 | Ga0070690_100041885 | 3300005330 | Unclassified | 2900 |
| 34 | Ga0070670_100038146 | 3300005331 | Bacteria | 4131 |
| 35 | Ga0070670_100038347 | 3300005331 | Bacteria | 4120 |
| 36 | Ga0070670_100049111 | 3300005331 | Bacteria | 3629 |
| 37 | Ga0070670_100123093 | 3300005331 | Unclassified | 2238 |
| 38 | Ga0070670_100277949 | 3300005331 | Bacteria | 1462 |
| 39 | Ga0068869_100036022 | 3300005334 | Unclassified | 3512 |
| 40 | Ga0068869_100046132 | 3300005334 | Unclassified | 3141 |
| 41 | Ga0068869_100095335 | 3300005334 | Unclassified | 2245 |
| 42 | Ga0068869_100133282 | 3300005334 | Unclassified | 1912 |
| 43 | Ga0068869_100236831 | 3300005334 | Bacteria | 1453 |
| 44 | Ga0070666_10000030 | 3300005335 | Bacteria | 137543 |
| 45 | Ga0070666_10000512 | 3300005335 | Bacteria | 23407 |
| 46 | Ga0070666_10083175 | 3300005335 | Bacteria | 2189 |
| 47 | Ga0070680_100023108 | 3300005336 | Bacteria | 4956 |
| 48 | Ga0070682_100000012 | 3300005337 | Bacteria | 265658 |
| 49 | Ga0070682_100004319 | 3300005337 | Bacteria | 7892 |
| 50 | Ga0070682_100007939 | 3300005337 | Bacteria | 5971 |
| 51 | Ga0070682_100295233 | 3300005337 | Bacteria | 1187 |
| 52 | Ga0068868_100004051 | 3300005338 | Bacteria | 10214 |
| 53 | Ga0068868_100005213 | 3300005338 | Bacteria | 9122 |
| 54 | Ga0068868_100010790 | 3300005338 | Bacteria | 6626 |
| 55 | Ga0068868_100142518 | 3300005338 | Bacteria | 1968 |
| 56 | Ga0068868_100332150 | 3300005338 | Bacteria | 1298 |
| 57 | Ga0070660_100063106 | 3300005339 | Bacteria | 2880 |
| 58 | Ga0070660_100401809 | 3300005339 | Unclassified | 1133 |
| 59 | Ga0070661_100015588 | 3300005344 | Bacteria | 5364 |
| 60 | Ga0070661_100136899 | 3300005344 | Bacteria | 1843 |
| 61 | Ga0070661_100216540 | 3300005344 | Bacteria | 1467 |
| 62 | Ga0070668_100032723 | 3300005347 | Bacteria | 3956 |
| 63 | Ga0070669_100096255 | 3300005353 | Bacteria | 2227 |
| 64 | Ga0070675_100067860 | 3300005354 | Bacteria | 2952 |
| 65 | Ga0070675_100102206 | 3300005354 | Bacteria | 2415 |
| 66 | Ga0070671_100025809 | 3300005355 | Bacteria | 4824 |
| 67 | Ga0070671_100032138 | 3300005355 | Bacteria | 4340 |
| 68 | Ga0070671_100127806 | 3300005355 | Unclassified | 2140 |
| 69 | Ga0070671_100262268 | 3300005355 | Bacteria | 1468 |
| 70 | Ga0070674_100009484 | 3300005356 | Bacteria | 5827 |
| 71 | Ga0070674_100136108 | 3300005356 | Unclassified | 1837 |
| 72 | Ga0070674_100184860 | 3300005356 | Unclassified | 1599 |
| 73 | Ga0070673_100003256 | 3300005364 | Bacteria | 10073 |
| 74 | Ga0070673_100033458 | 3300005364 | Unclassified | 3882 |
| 75 | Ga0070673_100116177 | 3300005364 | Unclassified | 2226 |
| 76 | Ga0070673_100240982 | 3300005364 | Bacteria | 1572 |
| 77 | Ga0070688_100006998 | 3300005365 | Bacteria | 6062 |
| 78 | Ga0070688_100033042 | 3300005365 | Bacteria | 3125 |
| 79 | Ga0070659_100012764 | 3300005366 | Bacteria | 6237 |
| 80 | Ga0070659_100078396 | 3300005366 | Bacteria | 2635 |
| 81 | Ga0070659_100086851 | 3300005366 | Bacteria | 2504 |
| 82 | Ga0070667_100029965 | 3300005367 | Bacteria | 4538 |
| 83 | Ga0070700_100070715 | 3300005441 | Unclassified | 2226 |
| 84 | Ga0070663_100116211 | 3300005455 | Bacteria | 2016 |
| 85 | Ga0070678_100021913 | 3300005456 | Unclassified | 4223 |
| 86 | Ga0070662_100021196 | 3300005457 | Bacteria | 4435 |
| 87 | Ga0070662_100022881 | 3300005457 | Bacteria | 4286 |
| 88 | Ga0070662_100046357 | 3300005457 | Bacteria | 3123 |
| 89 | Ga0070681_10013527 | 3300005458 | Bacteria | 8114 |
| 90 | Ga0070681_10099291 | 3300005458 | Bacteria | 2857 |
| 91 | Ga0068867_100021839 | 3300005459 | Bacteria | 4570 |
| 92 | Ga0068867_100085236 | 3300005459 | Bacteria | 2388 |
| 93 | Ga0068867_100156571 | 3300005459 | Unclassified | 1794 |
| 94 | Ga0068867_100237520 | 3300005459 | Bacteria | 1476 |
| 95 | Ga0070685_10014160 | 3300005466 | Bacteria | 4219 |
| 96 | Ga0070685_10025057 | 3300005466 | Bacteria | 3283 |
| 97 | Ga0070679_100028777 | 3300005530 | Bacteria | 5480 |
| 98 | Ga0070679_100039559 | 3300005530 | Bacteria | 4686 |
| 99 | Ga0070679_100099324 | 3300005530 | Bacteria | 2898 |
| 100 | Ga0070684_100012657 | 3300005535 | Bacteria | 6767 |
| 101 | Ga0070684_100013984 | 3300005535 | Bacteria | 6488 |
| 102 | Ga0070684_100068101 | 3300005535 | Bacteria | 3128 |
| 103 | Ga0068853_100000773 | 3300005539 | Bacteria | 22203 |
| 104 | Ga0068853_100008684 | 3300005539 | Bacteria | 8172 |
| 105 | Ga0068853_100010271 | 3300005539 | Bacteria | 7572 |
| 106 | Ga0068853_100019862 | 3300005539 | Bacteria | 5581 |
| 107 | Ga0068853_100040412 | 3300005539 | Bacteria | 3979 |
| 108 | Ga0068853_100061769 | 3300005539 | Bacteria | 3241 |
| 109 | Ga0068853_100069992 | 3300005539 | Bacteria | 3053 |
| 110 | Ga0068853_100214130 | 3300005539 | Bacteria | 1757 |
| 111 | Ga0070672_100000310 | 3300005543 | Bacteria | 27579 |
| 112 | Ga0070672_100028044 | 3300005543 | Unclassified | 4207 |
| 113 | Ga0070672_100028517 | 3300005543 | Unclassified | 4177 |
| 114 | Ga0070672_100051522 | 3300005543 | Unclassified | 3211 |
| 115 | Ga0070686_100189809 | 3300005544 | Bacteria | 1466 |
| 116 | Ga0070693_100010763 | 3300005547 | Bacteria | 4589 |
| 117 | Ga0070665_100000047 | 3300005548 | Bacteria | 269702 |
| 118 | Ga0070665_100007830 | 3300005548 | Bacteria | 10838 |
| 119 | Ga0070665_100112407 | 3300005548 | Bacteria | 2726 |
| 120 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 121 | Ga0068855_100004683 | 3300005563 | Bacteria | 16718 |
| 122 | Ga0068855_100018949 | 3300005563 | Bacteria | 8273 |
| 123 | Ga0068855_100030104 | 3300005563 | Bacteria | 6492 |
| 124 | Ga0068855_100043093 | 3300005563 | Bacteria | 5347 |
| 125 | Ga0068855_100385955 | 3300005563 | Bacteria | 1537 |
| 126 | Ga0070664_100002738 | 3300005564 | Bacteria | 14221 |
| 127 | Ga0070664_100008778 | 3300005564 | Bacteria | 8186 |
| 128 | Ga0070664_100008826 | 3300005564 | Bacteria | 8168 |
| 129 | Ga0070664_100129710 | 3300005564 | Bacteria | 2214 |
| 130 | Ga0070664_100164639 | 3300005564 | Unclassified | 1964 |
| 131 | Ga0068857_100003167 | 3300005577 | Bacteria | 13643 |
| 132 | Ga0068857_100011324 | 3300005577 | Bacteria | 7759 |
| 133 | Ga0068857_100026193 | 3300005577 | Bacteria | 5138 |
| 134 | Ga0068857_100037069 | 3300005577 | Bacteria | 4318 |
| 135 | Ga0068857_100155672 | 3300005577 | Bacteria | 2072 |
| 136 | Ga0068854_100105255 | 3300005578 | Unclassified | 2121 |
| 137 | Ga0068856_100007849 | 3300005614 | Bacteria | 10422 |
| 138 | Ga0068856_100011188 | 3300005614 | Bacteria | 8709 |
| 139 | Ga0068856_100050886 | 3300005614 | Bacteria | 4085 |
| 140 | Ga0068856_100275438 | 3300005614 | Bacteria | 1699 |
| 141 | Ga0068856_100329230 | 3300005614 | Bacteria | 1545 |
| 142 | Ga0070702_100084942 | 3300005615 | Unclassified | 1905 |
| 143 | Ga0068852_100001636 | 3300005616 | Bacteria | 15296 |
| 144 | Ga0068852_100002835 | 3300005616 | Bacteria | 12020 |
| 145 | Ga0068852_100012225 | 3300005616 | Bacteria | 6508 |
| 146 | Ga0068852_100053908 | 3300005616 | Bacteria | 3464 |
| 147 | Ga0068852_100071802 | 3300005616 | Bacteria | 3041 |
| 148 | Ga0068852_100074402 | 3300005616 | Bacteria | 2992 |
| 149 | Ga0068852_100079150 | 3300005616 | Unclassified | 2911 |
| 150 | Ga0068852_100299596 | 3300005616 | Bacteria | 1556 |
| 151 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 152 | Ga0068859_100000461 | 3300005617 | Bacteria | 40272 |
| 153 | Ga0068859_100034447 | 3300005617 | Bacteria | 5082 |
| 154 | Ga0068859_100040903 | 3300005617 | Bacteria | 4656 |
| 155 | Ga0068859_100119465 | 3300005617 | Unclassified | 2702 |
| 156 | Ga0068864_100001741 | 3300005618 | Bacteria | 17886 |
| 157 | Ga0068864_100005856 | 3300005618 | Bacteria | 10073 |
| 158 | Ga0068864_100063881 | 3300005618 | Bacteria | 3191 |
| 159 | Ga0068861_100003203 | 3300005719 | Bacteria | 10829 |
| 160 | Ga0068861_100043733 | 3300005719 | Bacteria | 3364 |
| 161 | Ga0068851_10002509 | 3300005834 | Bacteria | 8069 |
| 162 | Ga0068851_10004484 | 3300005834 | Bacteria | 6300 |
| 163 | Ga0068851_10010113 | 3300005834 | Bacteria | 4396 |
| 164 | Ga0068870_10022268 | 3300005840 | Unclassified | 3112 |
| 165 | Ga0068870_10101189 | 3300005840 | Bacteria | 1629 |
| 166 | Ga0068863_100002398 | 3300005841 | Bacteria | 18634 |
| 167 | Ga0068863_100119217 | 3300005841 | Bacteria | 2515 |
| 168 | Ga0068863_100307456 | 3300005841 | Bacteria | 1538 |
| 169 | Ga0068858_100007027 | 3300005842 | Bacteria | 10938 |
| 170 | Ga0068858_100036435 | 3300005842 | Bacteria | 4561 |
| 171 | Ga0068858_100041442 | 3300005842 | Bacteria | 4268 |
| 172 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 173 | Ga0068860_100002247 | 3300005843 | Bacteria | 20332 |
| 174 | Ga0068860_100003895 | 3300005843 | Bacteria | 15334 |
| 175 | Ga0068860_100010764 | 3300005843 | Bacteria | 9028 |
| 176 | Ga0068860_100041220 | 3300005843 | Bacteria | 4410 |
| 177 | Ga0081540_1017589 | 3300005983 | Bacteria | 4418 |
| 178 | Ga0081539_10000604 | 3300005985 | Bacteria | 73040 |
| 179 | Ga0081539_10013564 | 3300005985 | Bacteria | 6129 |
| 180 | Ga0075366_10164700 | 3300006195 | Bacteria | 1344 |
| 181 | Ga0097621_100000352 | 3300006237 | Bacteria | 31757 |
| 182 | Ga0097621_100007236 | 3300006237 | Bacteria | 7923 |
| 183 | Ga0097621_100018563 | 3300006237 | Bacteria | 5316 |
| 184 | Ga0097621_100042232 | 3300006237 | Bacteria | 3672 |
| 185 | Ga0097621_100149100 | 3300006237 | Bacteria | 2005 |
| 186 | Ga0097621_100354913 | 3300006237 | Bacteria | 1305 |
| 187 | Ga0068871_100001720 | 3300006358 | Bacteria | 14724 |
| 188 | Ga0068871_100003843 | 3300006358 | Bacteria | 10352 |
| 189 | Ga0068871_100011203 | 3300006358 | Bacteria | 6571 |
| 190 | Ga0068871_100040832 | 3300006358 | Bacteria | 3717 |
| 191 | Ga0068871_100043801 | 3300006358 | Bacteria | 3596 |
| 192 | Ga0068871_100045786 | 3300006358 | Bacteria | 3522 |
| 193 | Ga0068871_100118440 | 3300006358 | Bacteria | 2234 |
| 194 | Ga0075431_100009229 | 3300006847 | Bacteria | 9899 |
| 195 | Ga0075434_100205454 | 3300006871 | Bacteria | 1990 |
| 196 | Ga0075429_100004600 | 3300006880 | Bacteria | 11863 |
| 197 | Ga0068865_100104292 | 3300006881 | Bacteria | 2081 |
| 198 | Ga0068865_100198911 | 3300006881 | Bacteria | 1555 |
| 199 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 200 | Ga0097620_100000461 | 3300006931 | Bacteria | 40272 |
| 201 | Ga0097620_100034448 | 3300006931 | Bacteria | 5082 |
| 202 | Ga0097620_100040903 | 3300006931 | Bacteria | 4656 |
| 203 | Ga0097620_100119477 | 3300006931 | Unclassified | 2702 |
| 204 | Ga0105240_10000445 | 3300009093 | Bacteria | 76036 |
| 205 | Ga0105240_10000597 | 3300009093 | Bacteria | 67036 |
| 206 | Ga0105240_10003084 | 3300009093 | Bacteria | 26189 |
| 207 | Ga0105240_10003774 | 3300009093 | Bacteria | 23401 |
| 208 | Ga0105240_10008651 | 3300009093 | Bacteria | 14544 |
| 209 | Ga0105240_10064971 | 3300009093 | Bacteria | 4531 |
| 210 | Ga0105240_10073572 | 3300009093 | Bacteria | 4219 |
| 211 | Ga0105240_10214817 | 3300009093 | Bacteria | 2245 |
| 212 | Ga0111539_10024898 | 3300009094 | Bacteria | 7337 |
| 213 | Ga0111539_10132349 | 3300009094 | Unclassified | 2920 |
| 214 | Ga0105247_10000331 | 3300009101 | Bacteria | 41671 |
| 215 | Ga0105247_10027687 | 3300009101 | Bacteria | 3427 |
| 216 | Ga0105247_10079899 | 3300009101 | Bacteria | 2059 |
| 217 | Ga0114129_10021302 | 3300009147 | Bacteria | 9203 |
| 218 | Ga0114129_10037600 | 3300009147 | Bacteria | 6834 |
| 219 | Ga0105241_10000180 | 3300009174 | Bacteria | 47089 |
| 220 | Ga0105241_10000564 | 3300009174 | Bacteria | 27971 |
| 221 | Ga0105241_10004810 | 3300009174 | Bacteria | 9949 |
| 222 | Ga0105241_10180324 | 3300009174 | Bacteria | 1751 |
| 223 | Ga0105241_10190581 | 3300009174 | Bacteria | 1706 |
| 224 | Ga0105241_10209427 | 3300009174 | Bacteria | 1633 |
| 225 | Ga0105241_10354331 | 3300009174 | Bacteria | 1275 |
| 226 | Ga0105242_10025384 | 3300009176 | Bacteria | 4690 |
| 227 | Ga0105242_10146321 | 3300009176 | Unclassified | 2056 |
| 228 | Ga0105242_10213857 | 3300009176 | Bacteria | 1719 |
| 229 | Ga0105248_10053027 | 3300009177 | Bacteria | 4551 |
| 230 | Ga0105237_10000294 | 3300009545 | Bacteria | 69126 |
| 231 | Ga0105237_10000759 | 3300009545 | Bacteria | 44278 |
| 232 | Ga0105237_10009804 | 3300009545 | Bacteria | 10240 |
| 233 | Ga0105237_10010515 | 3300009545 | Bacteria | 9832 |
| 234 | Ga0105237_10015867 | 3300009545 | Bacteria | 7832 |
| 235 | Ga0105237_10057800 | 3300009545 | Unclassified | 3881 |
| 236 | Ga0105238_10001087 | 3300009551 | Bacteria | 27427 |
| 237 | Ga0105238_10075882 | 3300009551 | Bacteria | 3353 |
| 238 | Ga0105238_10154523 | 3300009551 | Unclassified | 2269 |
| 239 | Ga0105238_10320965 | 3300009551 | Bacteria | 1535 |
| 240 | Ga0105249_10003321 | 3300009553 | Bacteria | 13936 |
| 241 | Ga0105249_10016126 | 3300009553 | Bacteria | 6624 |
| 242 | Ga0105249_10022846 | 3300009553 | Bacteria | 5606 |
| 243 | Ga0105249_10031545 | 3300009553 | Bacteria | 4792 |
| 244 | Ga0105249_10045937 | 3300009553 | Bacteria | 3974 |
| 245 | Ga0105249_10177950 | 3300009553 | Bacteria | 2067 |
| 246 | Ga0105249_10234009 | 3300009553 | Unclassified | 1813 |
| 247 | Ga0105239_10000628 | 3300010375 | Bacteria | 50293 |
| 248 | Ga0105239_10005401 | 3300010375 | Bacteria | 14995 |
| 249 | Ga0105239_10011209 | 3300010375 | Bacteria | 10003 |
| 250 | Ga0105239_10012135 | 3300010375 | Bacteria | 9608 |
| 251 | Ga0105239_10035013 | 3300010375 | Bacteria | 5514 |
| 252 | Ga0105239_10073535 | 3300010375 | Unclassified | 3758 |
| 253 | Ga0105239_10128347 | 3300010375 | Bacteria | 2819 |
| 254 | Ga0105239_10206355 | 3300010375 | Bacteria | 2202 |
| 255 | Ga0105239_10311144 | 3300010375 | Bacteria | 1775 |
| 256 | Ga0105239_10478215 | 3300010375 | Bacteria | 1415 |
| 257 | Ga0105246_10008264 | 3300011119 | Bacteria | 6392 |
| 258 | Ga0105246_10023545 | 3300011119 | Bacteria | 3986 |
| 259 | Ga0105246_10061609 | 3300011119 | Unclassified | 2611 |
| 260 | Ga0105246_10139180 | 3300011119 | Bacteria | 1823 |
| 261 | Ga0157373_10004289 | 3300013100 | Bacteria | 10733 |
| 262 | Ga0157371_10021112 | 3300013102 | Bacteria | 4786 |
| 263 | Ga0157370_10006558 | 3300013104 | Bacteria | 12819 |
| 264 | Ga0157370_10043563 | 3300013104 | Bacteria | 4317 |
| 265 | Ga0157370_10053535 | 3300013104 | Bacteria | 3848 |
| 266 | Ga0157369_10005892 | 3300013105 | Bacteria | 14242 |
| 267 | Ga0157369_10029853 | 3300013105 | Bacteria | 6021 |
| 268 | Ga0157369_10031421 | 3300013105 | Bacteria | 5847 |
| 269 | Ga0157374_10000027 | 3300013296 | Bacteria | 233444 |
| 270 | Ga0157374_10009273 | 3300013296 | Bacteria | 8438 |
| 271 | Ga0157374_10015811 | 3300013296 | Bacteria | 6629 |
| 272 | Ga0157374_10032340 | 3300013296 | Bacteria | 4762 |
| 273 | Ga0157374_10102497 | 3300013296 | Bacteria | 2745 |
| 274 | Ga0157374_10312682 | 3300013296 | Unclassified | 1556 |
| 275 | Ga0157378_10003338 | 3300013297 | Bacteria | 14277 |
| 276 | Ga0157378_10014172 | 3300013297 | Bacteria | 6976 |
| 277 | Ga0157378_10014613 | 3300013297 | Bacteria | 6872 |
| 278 | Ga0157378_10016465 | 3300013297 | Bacteria | 6476 |
| 279 | Ga0157378_10016865 | 3300013297 | Bacteria | 6403 |
| 280 | Ga0157378_10045180 | 3300013297 | Unclassified | 3913 |
| 281 | Ga0157378_10168388 | 3300013297 | Bacteria | 2053 |
| 282 | Ga0163162_10000237 | 3300013306 | Bacteria | 50279 |
| 283 | Ga0163162_10000725 | 3300013306 | Bacteria | 30582 |
| 284 | Ga0163162_10001535 | 3300013306 | Bacteria | 21544 |
| 285 | Ga0163162_10001913 | 3300013306 | Bacteria | 19626 |
| 286 | Ga0163162_10002195 | 3300013306 | Bacteria | 18320 |
| 287 | Ga0163162_10017145 | 3300013306 | Bacteria | 7086 |
| 288 | Ga0163162_10027786 | 3300013306 | Bacteria | 5596 |
| 289 | Ga0163162_10036142 | 3300013306 | Bacteria | 4922 |
| 290 | Ga0163162_10048111 | 3300013306 | Bacteria | 4272 |
| 291 | Ga0163162_10112259 | 3300013306 | Unclassified | 2824 |
| 292 | Ga0163162_10193704 | 3300013306 | Unclassified | 2161 |
| 293 | Ga0163162_10212763 | 3300013306 | Bacteria | 2063 |
| 294 | Ga0157372_10006497 | 3300013307 | Bacteria | 12443 |
| 295 | Ga0157372_10017166 | 3300013307 | Bacteria | 7770 |
| 296 | Ga0157372_10030119 | 3300013307 | Bacteria | 5933 |
| 297 | Ga0157372_10053396 | 3300013307 | Bacteria | 4504 |
| 298 | Ga0157372_10173331 | 3300013307 | Bacteria | 2496 |
| 299 | Ga0157372_10238904 | 3300013307 | Bacteria | 2108 |
| 300 | Ga0157372_10542483 | 3300013307 | Bacteria | 1356 |
| 301 | Ga0157375_10000599 | 3300013308 | Bacteria | 31988 |
| 302 | Ga0157375_10026885 | 3300013308 | Bacteria | 5370 |
| 303 | Ga0157375_10032650 | 3300013308 | Bacteria | 4938 |
| 304 | Ga0157375_10116670 | 3300013308 | Unclassified | 2774 |
| 305 | Ga0157375_10360166 | 3300013308 | Unclassified | 1620 |
| 306 | Ga0163163_10000703 | 3300014325 | Bacteria | 28430 |
| 307 | Ga0163163_10001644 | 3300014325 | Bacteria | 18813 |
| 308 | Ga0163163_10209635 | 3300014325 | Bacteria | 1997 |
| 309 | Ga0163163_10398443 | 3300014325 | Bacteria | 1434 |
| 310 | Ga0157380_10001186 | 3300014326 | Bacteria | 16856 |
| 311 | Ga0157380_10036672 | 3300014326 | Bacteria | 3795 |
| 312 | Ga0157380_10182822 | 3300014326 | Bacteria | 1843 |
| 313 | Ga0157377_10010551 | 3300014745 | Bacteria | 4573 |
| 314 | Ga0157377_10012029 | 3300014745 | Bacteria | 4340 |
| 315 | Ga0157377_10014014 | 3300014745 | Unclassified | 4072 |
| 316 | Ga0157379_10000810 | 3300014968 | Bacteria | 25369 |
| 317 | Ga0157379_10002064 | 3300014968 | Bacteria | 16687 |
| 318 | Ga0157379_10035463 | 3300014968 | Bacteria | 4447 |
| 319 | Ga0157379_10072029 | 3300014968 | Bacteria | 3091 |
| 320 | Ga0157376_10000971 | 3300014969 | Bacteria | 18693 |
| 321 | Ga0157376_10008235 | 3300014969 | Bacteria | 7508 |
| 322 | Ga0157376_10050156 | 3300014969 | Bacteria | 3461 |
| 323 | Ga0157376_10077233 | 3300014969 | Bacteria | 2848 |
| 324 | Ga0157376_10093591 | 3300014969 | Bacteria | 2609 |
| 325 | Ga0182005_1000043 | 3300015265 | Bacteria | 140285 |
| 326 | Ga0163161_10020322 | 3300017792 | Bacteria | 4659 |
| 327 | Ga0213876_10003420 | 3300021384 | Bacteria | 9081 |
| 328 | Ga0209436_101411 | 3300025208 | Bacteria | 8449 |
| 329 | Ga0209258_100302 | 3300025242 | Bacteria | 79794 |
| 330 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 331 | Ga0209026_1000095 | 3300025250 | Bacteria | 164309 |
| 332 | Ga0209148_1000131 | 3300025254 | Bacteria | 174079 |
| 333 | Ga0209673_1000078 | 3300025273 | Bacteria | 227727 |
| 334 | Ga0209564_1003616 | 3300025295 | Bacteria | 10288 |
| 335 | Ga0209758_1005348 | 3300025297 | Bacteria | 9961 |
| 336 | Ga0209758_1005622 | 3300025297 | Bacteria | 9519 |
| 337 | Ga0209758_1009342 | 3300025297 | Bacteria | 6116 |
| 338 | Ga0209050_1000097 | 3300025298 | Bacteria | 239919 |
| 339 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 340 | Ga0207426_1000313 | 3300025302 | Bacteria | 94934 |
| 341 | Ga0207426_1000541 | 3300025302 | Bacteria | 54110 |
| 342 | Ga0207426_1010348 | 3300025302 | Bacteria | 3624 |
| 343 | Ga0207426_1015383 | 3300025302 | Bacteria | 2775 |
| 344 | Ga0209257_1000070 | 3300025304 | Bacteria | 336454 |
| 345 | Ga0209257_1004414 | 3300025304 | Bacteria | 10921 |
| 346 | Ga0207656_10001907 | 3300025321 | Bacteria | 6939 |
| 347 | Ga0207656_10002373 | 3300025321 | Bacteria | 6324 |
| 348 | Ga0207656_10002476 | 3300025321 | Bacteria | 6233 |
| 349 | Ga0207656_10016219 | 3300025321 | Bacteria | 2898 |
| 350 | Ga0207682_10017202 | 3300025893 | Unclassified | 2823 |
| 351 | Ga0207710_10006407 | 3300025900 | Bacteria | 5027 |
| 352 | Ga0207710_10018603 | 3300025900 | Unclassified | 2956 |
| 353 | Ga0207688_10007222 | 3300025901 | Bacteria | 6043 |
| 354 | Ga0207680_10000014 | 3300025903 | Bacteria | 179035 |
| 355 | Ga0207680_10015219 | 3300025903 | Bacteria | 4010 |
| 356 | Ga0207680_10015294 | 3300025903 | Unclassified | 4002 |
| 357 | Ga0207647_10013211 | 3300025904 | Bacteria | 5732 |
| 358 | Ga0207647_10019688 | 3300025904 | Bacteria | 4536 |
| 359 | Ga0207647_10023965 | 3300025904 | Bacteria | 4030 |
| 360 | Ga0207647_10027412 | 3300025904 | Bacteria | 3713 |
| 361 | Ga0207647_10103079 | 3300025904 | Unclassified | 1692 |
| 362 | Ga0207647_10152421 | 3300025904 | Bacteria | 1350 |
| 363 | Ga0207685_10069962 | 3300025905 | Bacteria | 1419 |
| 364 | Ga0207645_10003328 | 3300025907 | Bacteria | 12257 |
| 365 | Ga0207645_10013811 | 3300025907 | Bacteria | 5421 |
| 366 | Ga0207645_10018115 | 3300025907 | Unclassified | 4642 |
| 367 | Ga0207645_10022808 | 3300025907 | Unclassified | 4069 |
| 368 | Ga0207645_10064304 | 3300025907 | Bacteria | 2344 |
| 369 | Ga0207645_10105238 | 3300025907 | Bacteria | 1823 |
| 370 | Ga0207654_10002114 | 3300025911 | Bacteria | 10173 |
| 371 | Ga0207654_10002774 | 3300025911 | Bacteria | 8895 |
| 372 | Ga0207654_10005683 | 3300025911 | Bacteria | 6306 |
| 373 | Ga0207654_10128839 | 3300025911 | Bacteria | 1599 |
| 374 | Ga0207707_10004563 | 3300025912 | Bacteria | 12175 |
| 375 | Ga0207707_10033910 | 3300025912 | Bacteria | 4467 |
| 376 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 377 | Ga0207695_10000299 | 3300025913 | Bacteria | 122118 |
| 378 | Ga0207695_10000676 | 3300025913 | Bacteria | 67018 |
| 379 | Ga0207695_10001116 | 3300025913 | Bacteria | 46659 |
| 380 | Ga0207695_10006435 | 3300025913 | Bacteria | 15251 |
| 381 | Ga0207695_10024733 | 3300025913 | Bacteria | 6744 |
| 382 | Ga0207695_10028549 | 3300025913 | Bacteria | 6184 |
| 383 | Ga0207695_10078511 | 3300025913 | Bacteria | 3349 |
| 384 | Ga0207695_10125083 | 3300025913 | Bacteria | 2535 |
| 385 | Ga0207671_10000102 | 3300025914 | Bacteria | 130461 |
| 386 | Ga0207671_10000533 | 3300025914 | Bacteria | 51330 |
| 387 | Ga0207671_10001227 | 3300025914 | Bacteria | 30346 |
| 388 | Ga0207671_10001705 | 3300025914 | Bacteria | 24839 |
| 389 | Ga0207671_10001854 | 3300025914 | Bacteria | 23604 |
| 390 | Ga0207671_10021513 | 3300025914 | Bacteria | 4890 |
| 391 | Ga0207660_10013410 | 3300025917 | Bacteria | 5371 |
| 392 | Ga0207657_10003151 | 3300025919 | Bacteria | 17638 |
| 393 | Ga0207657_10308641 | 3300025919 | Bacteria | 1252 |
| 394 | Ga0207649_10011087 | 3300025920 | Unclassified | 4961 |
| 395 | Ga0207652_10013744 | 3300025921 | Bacteria | 6547 |
| 396 | Ga0207652_10031060 | 3300025921 | Bacteria | 4482 |
| 397 | Ga0207681_10174981 | 3300025923 | Unclassified | 1630 |
| 398 | Ga0207694_10003724 | 3300025924 | Bacteria | 12077 |
| 399 | Ga0207694_10122734 | 3300025924 | Bacteria | 2075 |
| 400 | Ga0207650_10097012 | 3300025925 | Bacteria | 2262 |
| 401 | Ga0207650_10301644 | 3300025925 | Bacteria | 1308 |
| 402 | Ga0207659_10032289 | 3300025926 | Bacteria | 3592 |
| 403 | Ga0207644_10025539 | 3300025931 | Bacteria | 4062 |
| 404 | Ga0207644_10182360 | 3300025931 | Bacteria | 1646 |
| 405 | Ga0207644_10197128 | 3300025931 | Unclassified | 1586 |
| 406 | Ga0207690_10003794 | 3300025932 | Bacteria | 8945 |
| 407 | Ga0207706_10004657 | 3300025933 | Bacteria | 12852 |
| 408 | Ga0207706_10015622 | 3300025933 | Bacteria | 6861 |
| 409 | Ga0207706_10017842 | 3300025933 | Bacteria | 6391 |
| 410 | Ga0207706_10085409 | 3300025933 | Bacteria | 2775 |
| 411 | Ga0207686_10034702 | 3300025934 | Bacteria | 3021 |
| 412 | Ga0207686_10070230 | 3300025934 | Unclassified | 2249 |
| 413 | Ga0207670_10013966 | 3300025936 | Bacteria | 4754 |
| 414 | Ga0207670_10190783 | 3300025936 | Unclassified | 1551 |
| 415 | Ga0207669_10006970 | 3300025937 | Bacteria | 5198 |
| 416 | Ga0207669_10091876 | 3300025937 | Bacteria | 1978 |
| 417 | Ga0207691_10000234 | 3300025940 | Bacteria | 54055 |
| 418 | Ga0207691_10015317 | 3300025940 | Bacteria | 7293 |
| 419 | Ga0207691_10031372 | 3300025940 | Bacteria | 4960 |
| 420 | Ga0207691_10105683 | 3300025940 | Bacteria | 2508 |
| 421 | Ga0207689_10000664 | 3300025942 | Bacteria | 32785 |
| 422 | Ga0207689_10002814 | 3300025942 | Bacteria | 16076 |
| 423 | Ga0207689_10003172 | 3300025942 | Bacteria | 15082 |
| 424 | Ga0207689_10003467 | 3300025942 | Bacteria | 14413 |
| 425 | Ga0207689_10012563 | 3300025942 | Bacteria | 7234 |
| 426 | Ga0207689_10040117 | 3300025942 | Unclassified | 3876 |
| 427 | Ga0207689_10103943 | 3300025942 | Unclassified | 2334 |
| 428 | Ga0207661_10406879 | 3300025944 | Bacteria | 1234 |
| 429 | Ga0207679_10002893 | 3300025945 | Bacteria | 10653 |
| 430 | Ga0207679_10010064 | 3300025945 | Bacteria | 6077 |
| 431 | Ga0207679_10011212 | 3300025945 | Bacteria | 5792 |
| 432 | Ga0207679_10279252 | 3300025945 | Bacteria | 1432 |
| 433 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 434 | Ga0207667_10004715 | 3300025949 | Bacteria | 16690 |
| 435 | Ga0207667_10005849 | 3300025949 | Bacteria | 14978 |
| 436 | Ga0207667_10056467 | 3300025949 | Bacteria | 4125 |
| 437 | Ga0207667_10074035 | 3300025949 | Bacteria | 3538 |
| 438 | Ga0207667_10297949 | 3300025949 | Bacteria | 1647 |
| 439 | Ga0207651_10180703 | 3300025960 | Unclassified | 1673 |
| 440 | Ga0207712_10011258 | 3300025961 | Bacteria | 5695 |
| 441 | Ga0207712_10019114 | 3300025961 | Bacteria | 4470 |
| 442 | Ga0207712_10057965 | 3300025961 | Bacteria | 2735 |
| 443 | Ga0207712_10058345 | 3300025961 | Bacteria | 2727 |
| 444 | Ga0207712_10062019 | 3300025961 | Unclassified | 2656 |
| 445 | Ga0207712_10151401 | 3300025961 | Bacteria | 1792 |
| 446 | Ga0207668_10064997 | 3300025972 | Bacteria | 2580 |
| 447 | Ga0207640_10164899 | 3300025981 | Bacteria | 1644 |
| 448 | Ga0207658_10002543 | 3300025986 | Bacteria | 13258 |
| 449 | Ga0207658_10024748 | 3300025986 | Bacteria | 4201 |
| 450 | Ga0207658_10224509 | 3300025986 | Bacteria | 1582 |
| 451 | Ga0207658_10226919 | 3300025986 | Bacteria | 1574 |
| 452 | Ga0207677_10013733 | 3300026023 | Bacteria | 4702 |
| 453 | Ga0207677_10026299 | 3300026023 | Bacteria | 3647 |
| 454 | Ga0207677_10270022 | 3300026023 | Bacteria | 1391 |
| 455 | Ga0207703_10002928 | 3300026035 | Bacteria | 14528 |
| 456 | Ga0207703_10020985 | 3300026035 | Bacteria | 5111 |
| 457 | Ga0207703_10110543 | 3300026035 | Bacteria | 2344 |
| 458 | Ga0207703_10158464 | 3300026035 | Unclassified | 1980 |
| 459 | Ga0207639_10005873 | 3300026041 | Bacteria | 8317 |
| 460 | Ga0207639_10011289 | 3300026041 | Bacteria | 6199 |
| 461 | Ga0207639_10021969 | 3300026041 | Bacteria | 4591 |
| 462 | Ga0207639_10047548 | 3300026041 | Bacteria | 3243 |
| 463 | Ga0207639_10077413 | 3300026041 | Bacteria | 2622 |
| 464 | Ga0207639_10173339 | 3300026041 | Unclassified | 1829 |
| 465 | Ga0207678_10059105 | 3300026067 | Bacteria | 3299 |
| 466 | Ga0207708_10180341 | 3300026075 | Unclassified | 1676 |
| 467 | Ga0207702_10047881 | 3300026078 | Bacteria | 3604 |
| 468 | Ga0207702_10083640 | 3300026078 | Bacteria | 2777 |
| 469 | Ga0207702_10111931 | 3300026078 | Bacteria | 2429 |
| 470 | Ga0207702_10141443 | 3300026078 | Bacteria | 2178 |
| 471 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 472 | Ga0207641_10040030 | 3300026088 | Bacteria | 3921 |
| 473 | Ga0207648_10005571 | 3300026089 | Bacteria | 12669 |
| 474 | Ga0207648_10009688 | 3300026089 | Bacteria | 9214 |
| 475 | Ga0207648_10047707 | 3300026089 | Bacteria | 3753 |
| 476 | Ga0207648_10132232 | 3300026089 | Bacteria | 2196 |
| 477 | Ga0207648_10152560 | 3300026089 | Unclassified | 2039 |
| 478 | Ga0207648_10225971 | 3300026089 | Bacteria | 1664 |
| 479 | Ga0207648_10297107 | 3300026089 | Bacteria | 1448 |
| 480 | Ga0207676_10000899 | 3300026095 | Bacteria | 23060 |
| 481 | Ga0207676_10018524 | 3300026095 | Bacteria | 5062 |
| 482 | Ga0207676_10040588 | 3300026095 | Bacteria | 3567 |
| 483 | Ga0207676_10147163 | 3300026095 | Bacteria | 2024 |
| 484 | Ga0207676_10388988 | 3300026095 | Bacteria | 1300 |
| 485 | Ga0207674_10002816 | 3300026116 | Bacteria | 21618 |
| 486 | Ga0207674_10017794 | 3300026116 | Bacteria | 7747 |
| 487 | Ga0207674_10018853 | 3300026116 | Bacteria | 7484 |
| 488 | Ga0207674_10126239 | 3300026116 | Bacteria | 2524 |
| 489 | Ga0207674_10139245 | 3300026116 | Bacteria | 2387 |
| 490 | Ga0207675_100009868 | 3300026118 | Bacteria | 8931 |
| 491 | Ga0207675_100021227 | 3300026118 | Bacteria | 6049 |
| 492 | Ga0207675_100030787 | 3300026118 | Bacteria | 4997 |
| 493 | Ga0207683_10018763 | 3300026121 | Bacteria | 5900 |
| 494 | Ga0207683_10021082 | 3300026121 | Bacteria | 5577 |
| 495 | Ga0207683_10025880 | 3300026121 | Bacteria | 5064 |
| 496 | Ga0207698_10003403 | 3300026142 | Bacteria | 9577 |
| 497 | Ga0207698_10007252 | 3300026142 | Bacteria | 6946 |
| 498 | Ga0207698_10009707 | 3300026142 | Bacteria | 6146 |
| 499 | Ga0207698_10042389 | 3300026142 | Bacteria | 3400 |
| 500 | Ga0207698_10057416 | 3300026142 | Bacteria | 3011 |
| 501 | Ga0207698_10096394 | 3300026142 | Unclassified | 2438 |
| 502 | Ga0207698_10128166 | 3300026142 | Unclassified | 2163 |
| 503 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 504 | Ga0268266_10003786 | 3300028379 | Bacteria | 14810 |
| 505 | Ga0268266_10094506 | 3300028379 | Unclassified | 2624 |
| 506 | Ga0268266_10102477 | 3300028379 | Bacteria | 2525 |
| 507 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 508 | Ga0268264_10001687 | 3300028381 | Bacteria | 20359 |
| 509 | Ga0268264_10003414 | 3300028381 | Bacteria | 13700 |
| 510 | Ga0268264_10003823 | 3300028381 | Bacteria | 12909 |
| 511 | Ga0268264_10010251 | 3300028381 | Bacteria | 7758 |
| 512 | Ga0268264_10069758 | 3300028381 | Bacteria | 2973 |
| 513 | Ga0307517_10009783 | 3300028786 | Bacteria | 13534 |
| 514 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 515 | Ga0307515_10000118 | 3300028794 | Bacteria | 190444 |
| 516 | Ga0307511_10000002 | 3300030521 | Bacteria | 199923 |
| 517 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 518 | Ga0265327_10000031 | 3300031251 | Bacteria | 325718 |
| 519 | Ga0265327_10000272 | 3300031251 | Bacteria | 102100 |
| 520 | Ga0265327_10017785 | 3300031251 | Bacteria | 4438 |
| 521 | Ga0265327_10026902 | 3300031251 | Bacteria | 3323 |
| 522 | Ga0265327_10027581 | 3300031251 | Bacteria | 3265 |
| 523 | Ga0307513_10111970 | 3300031456 | Bacteria | 2721 |
| 524 | Ga0307509_10121615 | 3300031507 | Bacteria | 2587 |
| 525 | Ga0307508_10000694 | 3300031616 | Bacteria | 40289 |
| 526 | Ga0316575_10004858 | 3300031665 | Bacteria | 4746 |
| 527 | Ga0316579_10015435 | 3300031691 | Bacteria | 3318 |
| 528 | Ga0316579_10036188 | 3300031691 | Bacteria | 2277 |
| 529 | Ga0316576_10001884 | 3300031727 | Bacteria | 11659 |
| 530 | Ga0316576_10105541 | 3300031727 | Bacteria | 2109 |
| 531 | Ga0316576_10107685 | 3300031727 | Bacteria | 2088 |
| 532 | Ga0316576_10229364 | 3300031727 | Bacteria | 1396 |
| 533 | Ga0316578_10001089 | 3300031728 | Bacteria | 10543 |
| 534 | Ga0316578_10129453 | 3300031728 | Bacteria | 1518 |
| 535 | Ga0316578_10153889 | 3300031728 | Bacteria | 1386 |
| 536 | Ga0307516_10000486 | 3300031730 | Bacteria | 52749 |
| 537 | Ga0316577_10000132 | 3300031733 | Bacteria | 22009 |
| 538 | Ga0316577_10015293 | 3300031733 | Bacteria | 4220 |
| 539 | Ga0316577_10017183 | 3300031733 | Bacteria | 3992 |
| 540 | Ga0316577_10025732 | 3300031733 | Bacteria | 3273 |
| 541 | Ga0316583_10008571 | 3300032133 | Bacteria | 3687 |
| 542 | Ga0316583_10013737 | 3300032133 | Bacteria | 2922 |
| 543 | Ga0316585_10000701 | 3300032137 | Bacteria | 8358 |
| 544 | Ga0316580_10010569 | 3300032139 | Bacteria | 2793 |
| 545 | Ga0373956_0082131 | 3300035119 | Bacteria | 1480 |
| 546 | Ga0316574_0000550 | 3300035398 | Bacteria | 15524 |
| 547 | Ga0316574_0001012 | 3300035398 | Bacteria | 12681 |
| 548 | Ga0316574_0086988 | 3300035398 | Bacteria | 1989 |
| 549 | Ga0373937_0050758 | 3300036401 | Bacteria | 3800 |
| 550 | Ga0373937_0183189 | 3300036401 | Bacteria | 1967 |
| 551 | Ga0373937_0440396 | 3300036401 | Bacteria | 1237 |
| 552 | Ga0316582_0014378 | 3300036647 | Bacteria | 4490 |
| 553 | Ga0316584_0000219 | 3300036712 | Bacteria | 28153 |
| 554 | Ga0316584_0009283 | 3300036712 | Bacteria | 6820 |
| 555 | Ga0316584_0064689 | 3300036712 | Bacteria | 2739 |
| 556 | Ga0316584_0101403 | 3300036712 | Bacteria | 2155 |
| 557 | Ga0316584_0102333 | 3300036712 | Bacteria | 2145 |
| 558 | Ga0316584_0239239 | 3300036712 | Bacteria | 1329 |
| 559 | Ga0395905_0013872 | 3300037471 | Bacteria | 7710 |
| 560 | Ga0395905_0022101 | 3300037471 | Bacteria | 6017 |
| 561 | Ga0400490_06663 | 3300038726 | Bacteria | 42094 |
| 562 | Ga0400483_009020 | 3300039062 | Bacteria | 3599 |
| 563 | Ga0436365_0521562 | 3300039437 | Bacteria | 1744 |
| 564 | Ga0436365_1837098 | 3300039437 | Bacteria | 29699 |
| 565 | Ga0439436_0005908 | 3300041404 | Bacteria | 3752 |
| 566 | Ga0439449_0021694 | 3300042007 | Bacteria | 2404 |
| 567 | Ga0439457_001270 | 3300042014 | Bacteria | 7574 |
| 568 | Ga0439462_0003887 | 3300042015 | Bacteria | 3606 |
| 569 | Ga0451577_0011149 | 3300042876 | Bacteria | 8527 |
| 570 | Ga0451577_0014804 | 3300042876 | Bacteria | 7268 |
| 571 | Ga0466969_0002500 | 3300044656 | Bacteria | 9822 |
| 572 | Ga0466972_0000044 | 3300044658 | Bacteria | 131031 |
| 573 | Ga0466972_0006818 | 3300044658 | Bacteria | 5733 |
| 574 | Ga0466972_0100299 | 3300044658 | Bacteria | 1370 |
| 575 | Ga0466965_0206350 | 3300044683 | Bacteria | 1044 |
| 576 | Ga0466966_0002591 | 3300044684 | Bacteria | 11845 |
| 577 | Ga0466961_0032307 | 3300044693 | Bacteria | 3363 |
| 578 | Ga0453684_0018349 | 3300044712 | Bacteria | 10744 |
| 579 | Ga0453684_0026435 | 3300044712 | Bacteria | 8381 |
| 580 | Ga0453684_0039674 | 3300044712 | Bacteria | 6409 |
| 581 | Ga0453684_0102508 | 3300044712 | Bacteria | 3499 |
| 582 | Ga0453684_0168980 | 3300044712 | Bacteria | 2579 |
| 583 | Ga0453684_0328764 | 3300044712 | Bacteria | 1729 |
| 584 | Ga0466971_0003395 | 3300044719 | Bacteria | 6804 |
| 585 | Ga0466968_0006275 | 3300044735 | Bacteria | 4474 |
| 586 | Ga0466968_0008477 | 3300044735 | Bacteria | 3938 |
| 587 | Ga0466970_0004594 | 3300044765 | Bacteria | 6815 |
| 588 | Ga0466957_0005680 | 3300044842 | Bacteria | 7012 |
| 589 | Ga0466957_0014978 | 3300044842 | Bacteria | 4525 |
| 590 | Ga0466957_0054965 | 3300044842 | Bacteria | 2432 |
| 591 | Ga0466960_0022501 | 3300044901 | Bacteria | 2819 |
| 592 | Ga0466959_0000045 | 3300045049 | Bacteria | 89773 |
| 593 | Ga0466959_0000904 | 3300045049 | Bacteria | 17527 |
| 594 | Ga0451576_0267304 | 3300045051 | Bacteria | 1788 |
| 595 | Ga0495627_006679 | 3300046453 | Bacteria | 4493 |
| 596 | Ga0495638_0020775 | 3300046460 | Bacteria | 4336 |
| 597 | Ga0495638_0023374 | 3300046460 | Bacteria | 4043 |
| 598 | Ga0495638_0123599 | 3300046460 | Bacteria | 1527 |
| 599 | Ga0495650_0030464 | 3300046471 | Bacteria | 2444 |
| 600 | Ga0495606_0004864 | 3300046507 | Bacteria | 13165 |
| 601 | Ga0495618_0068606 | 3300046514 | Bacteria | 2255 |
| 602 | Ga0495628_0212810 | 3300046516 | Bacteria | 1453 |
| 603 | Ga0495652_0234535 | 3300046529 | Bacteria | 1370 |
| 604 | Ga0495633_0000125 | 3300046558 | Bacteria | 104459 |
| 605 | Ga0495668_0003508 | 3300046616 | Bacteria | 11693 |
| 606 | Ga0495611_0000065 | 3300046648 | Bacteria | 74332 |
| 607 | Ga0495657_0046927 | 3300046675 | Bacteria | 2923 |
| 608 | Ga0495649_0025053 | 3300046694 | Bacteria | 3324 |
| 609 | Ga0495636_0000026 | 3300047318 | Bacteria | 63897 |
| 610 | Ga0495672_0002281 | 3300047320 | Bacteria | 17812 |
| 611 | Ga0495672_0013217 | 3300047320 | Bacteria | 5705 |
| 612 | Ga0495672_0036643 | 3300047320 | Unclassified | 3010 |
| 613 | Ga0495687_000129 | 3300047443 | Bacteria | 116030 |
| 614 | Ga0495684_0229279 | 3300047471 | Bacteria | 1359 |
| 615 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 616 | Ga0495686_0014570 | 3300047472 | Bacteria | 5408 |
| 617 | Ga0496100_0038502 | 3300048903 | Bacteria | 3031 |
| 618 | Ga0496101_0070296 | 3300048904 | Bacteria | 2563 |
| 619 | Ga0496104_0306086 | 3300048907 | Bacteria | 1502 |
| 620 | Ga0496114_0104859 | 3300048917 | Bacteria | 2418 |
| 621 | Ga0496114_0245923 | 3300048917 | Unclassified | 1574 |
| 622 | Ga0496115_0220891 | 3300048918 | Bacteria | 1563 |
| 623 | Ga0496121_0000081 | 3300048924 | Bacteria | 229506 |
| 624 | Ga0496126_0012204 | 3300048929 | Bacteria | 8815 |
| 625 | Ga0496126_0310742 | 3300048929 | Bacteria | 1298 |
| 626 | Ga0501300_007311 | 3300049523 | Unclassified | 1619 |
| 627 | Ga0501032_0009405 | 3300049569 | Bacteria | 7080 |
| 628 | Ga0501032_0028589 | 3300049569 | Bacteria | 3830 |
| 629 | Ga0501032_0115842 | 3300049569 | Unclassified | 1772 |
| 630 | Ga0501033_0031424 | 3300049570 | Bacteria | 3990 |
| 631 | Ga0501034_0003157 | 3300049571 | Bacteria | 18950 |
| 632 | Ga0501034_0009179 | 3300049571 | Bacteria | 10374 |
| 633 | Ga0501034_0042674 | 3300049571 | Bacteria | 4591 |
| 634 | Ga0501034_0153559 | 3300049571 | Bacteria | 2277 |
| 635 | Ga0501034_0221715 | 3300049571 | Bacteria | 1843 |
| 636 | Ga0501036_0006617 | 3300049572 | Bacteria | 9418 |
| 637 | Ga0501036_0007556 | 3300049572 | Bacteria | 8868 |
| 638 | Ga0501038_0011371 | 3300049574 | Bacteria | 8123 |
| 639 | Ga0501038_0025837 | 3300049574 | Bacteria | 5232 |
| 640 | Ga0501039_0011919 | 3300049575 | Bacteria | 6625 |
| 641 | Ga0501043_0021243 | 3300049579 | Bacteria | 5089 |
| 642 | Ga0501043_0095054 | 3300049579 | Bacteria | 2342 |
| 643 | Ga0501043_0359411 | 3300049579 | Bacteria | 1105 |
| 644 | Ga0501046_0090632 | 3300049580 | Bacteria | 2352 |
| 645 | Ga0501047_0006237 | 3300049581 | Bacteria | 11210 |
| 646 | Ga0501047_0078887 | 3300049581 | Bacteria | 3166 |
| 647 | Ga0501047_0111573 | 3300049581 | Bacteria | 2617 |
| 648 | Ga0501070_0082151 | 3300049586 | Bacteria | 2666 |
| 649 | Ga0501070_0092405 | 3300049586 | Bacteria | 2504 |
| 650 | Ga0501073_0045119 | 3300049589 | Bacteria | 3105 |
| 651 | Ga0501073_0052595 | 3300049589 | Bacteria | 2851 |
| 652 | Ga0501198_000167 | 3300049649 | Bacteria | 8710 |
| 653 | Ga0501202_001568 | 3300049652 | Bacteria | 3688 |
| 654 | Ga0501207_001417 | 3300049654 | Bacteria | 2993 |
| 655 | Ga0501217_003020 | 3300049661 | Bacteria | 3372 |
| 656 | Ga0501217_003022 | 3300049661 | Bacteria | 3372 |
| 657 | Ga0501222_000629 | 3300049662 | Bacteria | 5168 |
| 658 | Ga0501223_000426 | 3300049663 | Bacteria | 10221 |
| 659 | Ga0501233_009818 | 3300049668 | Bacteria | 1874 |
| 660 | Ga0501235_000033 | 3300049669 | Bacteria | 22695 |
| 661 | Ga0501243_000152 | 3300049675 | Bacteria | 7985 |
| 662 | Ga0501257_004677 | 3300049686 | Bacteria | 2992 |
| 663 | Ga0501259_000375 | 3300049688 | Bacteria | 7028 |
| 664 | Ga0501259_001723 | 3300049688 | Bacteria | 3627 |
| 665 | Ga0501260_001544 | 3300049689 | Bacteria | 1911 |
| 666 | Ga0501219_000019 | 3300049703 | Bacteria | 25267 |
| 667 | Ga0501221_000120 | 3300049704 | Bacteria | 9800 |
| 668 | Ga0501225_0003232 | 3300049705 | Bacteria | 4976 |
| 669 | Ga0501225_0003564 | 3300049705 | Bacteria | 4697 |
| 670 | Ga0501234_000621 | 3300049707 | Bacteria | 5456 |
| 671 | Ga0501245_000053 | 3300049708 | Bacteria | 10632 |
| 672 | Ga0501080_0049017 | 3300049742 | Bacteria | 3931 |
| 673 | Ga0501080_0093829 | 3300049742 | Bacteria | 2787 |
| 674 | Ga0501080_0174212 | 3300049742 | Bacteria | 1983 |
| 675 | Ga0501083_0059245 | 3300049744 | Bacteria | 2561 |
| 676 | Ga0501241_002043 | 3300049758 | Bacteria | 3953 |
| 677 | Ga0501241_012824 | 3300049758 | Bacteria | 1524 |
| 678 | Ga0501264_002416 | 3300049761 | Unclassified | 1746 |
| 679 | Ga0501268_001584 | 3300049765 | Bacteria | 2861 |
| 680 | Ga0501268_022938 | 3300049765 | Bacteria | 1081 |
| 681 | Ga0501035_0082060 | 3300049822 | Bacteria | 2845 |
| 682 | Ga0501035_0215079 | 3300049822 | Unclassified | 1643 |
| 683 | Ga0501035_0219186 | 3300049822 | Unclassified | 1625 |
| 684 | Ga0501044_0004638 | 3300049823 | Bacteria | 15377 |
| 685 | Ga0501044_0009473 | 3300049823 | Bacteria | 10604 |
| 686 | Ga0501044_0043392 | 3300049823 | Bacteria | 4671 |
| 687 | Ga0501044_0063526 | 3300049823 | Bacteria | 3771 |
| 688 | Ga0501044_0092825 | 3300049823 | Bacteria | 3044 |
| 689 | Ga0501044_0097102 | 3300049823 | Bacteria | 2968 |
| 690 | Ga0501045_0078786 | 3300049824 | Bacteria | 2429 |
| 691 | Ga0501212_002902 | 3300049851 | Bacteria | 2104 |
| 692 | Ga0501284_00007 | 3300050005 | Bacteria | 147956 |
| 693 | nmdc:mga0k408_148245_c1 | 3300050493 | Bacteria | 1397 |
| 694 | nmdc:mga0k408_24705_c1 | 3300050493 | Bacteria | 3398 |
| 695 | nmdc:mga05p37_24567_c2 | 3300050507 | Bacteria | 2908 |
| 696 | nmdc:mga05p37_58974_c1 | 3300050507 | Bacteria | 4727 |
| 697 | nmdc:mga09592_13139_c1 | 3300050508 | Bacteria | 6757 |
| 698 | nmdc:mga06r32_9580_c1 | 3300050510 | Bacteria | 8749 |
| 699 | nmdc:mga08y16_76772_c1 | 3300050511 | Bacteria | 3482 |
| 700 | nmdc:mga0n895_308217_c1 | 3300050512 | Bacteria | 1605 |
| 701 | Ga0500578_0000026 | 3300053086 | Bacteria | 145328 |
| 702 | Ga0500644_0000026 | 3300053088 | Bacteria | 93328 |
| 703 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 704 | Ga0500583_0004221 | 3300053092 | Bacteria | 4649 |
| 705 | Ga0500583_0017888 | 3300053092 | Bacteria | 2868 |
| 706 | Ga0500651_0001573 | 3300053093 | Bacteria | 11590 |
| 707 | Ga0500555_013807 | 3300053103 | Bacteria | 2329 |
| 708 | Ga0500562_000070 | 3300053108 | Bacteria | 49835 |
| 709 | Ga0500569_000432 | 3300053109 | Bacteria | 6852 |
| 710 | Ga0500594_0007656 | 3300053118 | Bacteria | 2449 |
| 711 | Ga0500652_005247 | 3300053131 | Bacteria | 4064 |
| 712 | Ga0500658_0002669 | 3300053134 | Bacteria | 6853 |
| 713 | Ga0500559_0010116 | 3300053136 | Bacteria | 4060 |
| 714 | Ga0500568_0003989 | 3300053139 | Bacteria | 8014 |
| 715 | Ga0500577_0002713 | 3300053142 | Bacteria | 4545 |
| 716 | Ga0500588_0004746 | 3300053146 | Bacteria | 2965 |
| 717 | Ga0500589_018253 | 3300053147 | Bacteria | 3174 |
| 718 | Ga0500590_089851 | 3300053148 | Bacteria | 1493 |
| 719 | Ga0500604_0001556 | 3300053151 | Bacteria | 6423 |
| 720 | Ga0500616_0047309 | 3300053153 | Bacteria | 2284 |
| 721 | Ga0500622_0001947 | 3300053156 | Bacteria | 15544 |
| 722 | Ga0500622_0014304 | 3300053156 | Bacteria | 4264 |
| 723 | Ga0500633_0000253 | 3300053160 | Bacteria | 7733 |
| 724 | Ga0500636_0012621 | 3300053177 | Bacteria | 4953 |
| 725 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 726 | Ga0500611_009641 | 3300053727 | Bacteria | 1538 |
| 727 | Ga0501082_0059741 | 3300060353 | Unclassified | 3285 |
| 728 | Ga0466962_0003789 | 3300061719 | Bacteria | 7222 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031733 | Ga0316577_10015293 | Ga0316577_100152933 | 310 |
| 2 | 3300036712 | Ga0316584_0064689 | Ga0316584_0064689_29_1012 | 316 |
| 3 | 3300044683 | Ga0466965_0206350 | Ga0466965_0206350_22_1011 | 323 |
| 4 | 3300039062 | Ga0400483_009020 | Ga0400483_009020_51_1061 | 329 |
| 5 | 3300036712 | Ga0316584_0102333 | Ga0316584_0102333_83_1087 | 332 |
| 6 | 3300005337 | Ga0070682_100000012 | Ga0070682_100000012115 | 338 |
| 7 | 3300044712 | Ga0453684_0328764 | Ga0453684_0328764_517_1551 | 339 |
| 8 | 3300014326 | Ga0157380_10036672 | Ga0157380_100366724 | 340 |
| 9 | 3300035398 | Ga0316574_0000550 | Ga0316574_0000550_982_2031 | 344 |
| 10 | 3300035398 | Ga0316574_0001012 | Ga0316574_0001012_11432_12481 | 344 |
| 11 | 3300036712 | Ga0316584_0000219 | Ga0316584_0000219_24513_25562 | 344 |
| 12 | 3300005329 | Ga0070683_100034680 | Ga0070683_1000346802 | 346 |
| 13 | 3300005331 | Ga0070670_100038347 | Ga0070670_1000383472 | 346 |
| 14 | 3300005338 | Ga0068868_100010790 | Ga0068868_1000107904 | 346 |
| 15 | 3300005354 | Ga0070675_100067860 | Ga0070675_1000678602 | 346 |
| 16 | 3300005366 | Ga0070659_100078396 | Ga0070659_1000783962 | 346 |
| 17 | 3300005466 | Ga0070685_10025057 | Ga0070685_100250572 | 346 |
| 18 | 3300005535 | Ga0070684_100068101 | Ga0070684_1000681013 | 346 |
| 19 | 3300005544 | Ga0070686_100189809 | Ga0070686_1001898091 | 346 |
| 20 | 3300005577 | Ga0068857_100037069 | Ga0068857_1000370695 | 346 |
| 21 | 3300006358 | Ga0068871_100043801 | Ga0068871_1000438012 | 346 |
| 22 | 3300017792 | Ga0163161_10020322 | Ga0163161_100203222 | 346 |
| 23 | 3300025905 | Ga0207685_10069962 | Ga0207685_100699621 | 346 |
| 24 | 3300025931 | Ga0207644_10197128 | Ga0207644_101971281 | 346 |
| 25 | 3300025933 | Ga0207706_10017842 | Ga0207706_100178421 | 346 |
| 26 | 3300025933 | Ga0207706_10085409 | Ga0207706_100854092 | 346 |
| 27 | 3300025936 | Ga0207670_10190783 | Ga0207670_101907831 | 346 |
| 28 | 3300025942 | Ga0207689_10040117 | Ga0207689_100401172 | 346 |
| 29 | 3300026035 | Ga0207703_10158464 | Ga0207703_101584642 | 346 |
| 30 | 3300026089 | Ga0207648_10297107 | Ga0207648_102971071 | 346 |
| 31 | 3300026121 | Ga0207683_10025880 | Ga0207683_100258801 | 346 |
| 32 | 3300028381 | Ga0268264_10069758 | Ga0268264_100697582 | 346 |
| 33 | 3300031727 | Ga0316576_10105541 | Ga0316576_101055411 | 349 |
| 34 | 3300035398 | Ga0316574_0086988 | Ga0316574_0086988_586_1650 | 349 |
| 35 | 3300005329 | Ga0070683_100054475 | Ga0070683_1000544752 | 350 |
| 36 | 3300005330 | Ga0070690_100041885 | Ga0070690_1000418853 | 350 |
| 37 | 3300005334 | Ga0068869_100046132 | Ga0068869_1000461324 | 350 |
| 38 | 3300005338 | Ga0068868_100332150 | Ga0068868_1003321501 | 350 |
| 39 | 3300005339 | Ga0070660_100401809 | Ga0070660_1004018091 | 350 |
| 40 | 3300005344 | Ga0070661_100136899 | Ga0070661_1001368992 | 350 |
| 41 | 3300005353 | Ga0070669_100096255 | Ga0070669_1000962552 | 350 |
| 42 | 3300005355 | Ga0070671_100032138 | Ga0070671_1000321384 | 350 |
| 43 | 3300005355 | Ga0070671_100127806 | Ga0070671_1001278062 | 350 |
| 44 | 3300005364 | Ga0070673_100033458 | Ga0070673_1000334584 | 350 |
| 45 | 3300005364 | Ga0070673_100116177 | Ga0070673_1001161772 | 350 |
| 46 | 3300005365 | Ga0070688_100033042 | Ga0070688_1000330422 | 350 |
| 47 | 3300005366 | Ga0070659_100086851 | Ga0070659_1000868512 | 350 |
| 48 | 3300005441 | Ga0070700_100070715 | Ga0070700_1000707152 | 350 |
| 49 | 3300005459 | Ga0068867_100156571 | Ga0068867_1001565712 | 350 |
| 50 | 3300005466 | Ga0070685_10014160 | Ga0070685_100141602 | 350 |
| 51 | 3300005535 | Ga0070684_100013984 | Ga0070684_1000139847 | 350 |
| 52 | 3300005539 | Ga0068853_100069992 | Ga0068853_1000699922 | 350 |
| 53 | 3300005539 | Ga0068853_100214130 | Ga0068853_1002141301 | 350 |
| 54 | 3300005543 | Ga0070672_100028044 | Ga0070672_1000280442 | 350 |
| 55 | 3300005548 | Ga0070665_100000047 | Ga0070665_10000004754 | 350 |
| 56 | 3300005564 | Ga0070664_100008826 | Ga0070664_1000088266 | 350 |
| 57 | 3300005564 | Ga0070664_100164639 | Ga0070664_1001646392 | 350 |
| 58 | 3300005577 | Ga0068857_100011324 | Ga0068857_1000113242 | 350 |
| 59 | 3300005614 | Ga0068856_100050886 | Ga0068856_1000508862 | 350 |
| 60 | 3300005615 | Ga0070702_100084942 | Ga0070702_1000849422 | 350 |
| 61 | 3300005616 | Ga0068852_100074402 | Ga0068852_1000744023 | 350 |
| 62 | 3300005616 | Ga0068852_100079150 | Ga0068852_1000791503 | 350 |
| 63 | 3300005840 | Ga0068870_10101189 | Ga0068870_101011892 | 350 |
| 64 | 3300005842 | Ga0068858_100041442 | Ga0068858_1000414422 | 350 |
| 65 | 3300005843 | Ga0068860_100000024 | Ga0068860_10000002420 | 350 |
| 66 | 3300006237 | Ga0097621_100149100 | Ga0097621_1001491002 | 350 |
| 67 | 3300006358 | Ga0068871_100011203 | Ga0068871_1000112034 | 350 |
| 68 | 3300006358 | Ga0068871_100040832 | Ga0068871_1000408323 | 350 |
| 69 | 3300006871 | Ga0075434_100205454 | Ga0075434_1002054542 | 350 |
| 70 | 3300009093 | Ga0105240_10000445 | Ga0105240_1000044538 | 350 |
| 71 | 3300009093 | Ga0105240_10064971 | Ga0105240_100649712 | 350 |
| 72 | 3300009094 | Ga0111539_10024898 | Ga0111539_100248984 | 350 |
| 73 | 3300009101 | Ga0105247_10000331 | Ga0105247_1000033133 | 350 |
| 74 | 3300009174 | Ga0105241_10000180 | Ga0105241_1000018017 | 350 |
| 75 | 3300009174 | Ga0105241_10180324 | Ga0105241_101803242 | 350 |
| 76 | 3300009174 | Ga0105241_10354331 | Ga0105241_103543312 | 350 |
| 77 | 3300009176 | Ga0105242_10146321 | Ga0105242_101463211 | 350 |
| 78 | 3300009176 | Ga0105242_10213857 | Ga0105242_102138572 | 350 |
| 79 | 3300009545 | Ga0105237_10010515 | Ga0105237_100105152 | 350 |
| 80 | 3300009551 | Ga0105238_10001087 | Ga0105238_1000108722 | 350 |
| 81 | 3300009553 | Ga0105249_10031545 | Ga0105249_100315452 | 350 |
| 82 | 3300009553 | Ga0105249_10045937 | Ga0105249_100459372 | 350 |
| 83 | 3300010375 | Ga0105239_10011209 | Ga0105239_100112097 | 350 |
| 84 | 3300013105 | Ga0157369_10029853 | Ga0157369_100298535 | 350 |
| 85 | 3300013297 | Ga0157378_10014613 | Ga0157378_100146136 | 350 |
| 86 | 3300013306 | Ga0163162_10000237 | Ga0163162_1000023731 | 350 |
| 87 | 3300013307 | Ga0157372_10006497 | Ga0157372_100064977 | 350 |
| 88 | 3300013307 | Ga0157372_10053396 | Ga0157372_100533963 | 350 |
| 89 | 3300013308 | Ga0157375_10000599 | Ga0157375_1000059929 | 350 |
| 90 | 3300014325 | Ga0163163_10000703 | Ga0163163_1000070331 | 350 |
| 91 | 3300014325 | Ga0163163_10209635 | Ga0163163_102096351 | 350 |
| 92 | 3300014326 | Ga0157380_10001186 | Ga0157380_100011862 | 350 |
| 93 | 3300014326 | Ga0157380_10182822 | Ga0157380_101828222 | 350 |
| 94 | 3300014968 | Ga0157379_10002064 | Ga0157379_1000206413 | 350 |
| 95 | 3300014969 | Ga0157376_10000971 | Ga0157376_1000097113 | 350 |
| 96 | 3300025900 | Ga0207710_10006407 | Ga0207710_100064072 | 350 |
| 97 | 3300025907 | Ga0207645_10013811 | Ga0207645_100138113 | 350 |
| 98 | 3300025907 | Ga0207645_10022808 | Ga0207645_100228082 | 350 |
| 99 | 3300025911 | Ga0207654_10002114 | Ga0207654_100021143 | 350 |
| 100 | 3300025911 | Ga0207654_10128839 | Ga0207654_101288391 | 350 |
| 101 | 3300025912 | Ga0207707_10033910 | Ga0207707_100339103 | 350 |
| 102 | 3300025913 | Ga0207695_10001116 | Ga0207695_1000111633 | 350 |
| 103 | 3300025913 | Ga0207695_10078511 | Ga0207695_100785113 | 350 |
| 104 | 3300025914 | Ga0207671_10001227 | Ga0207671_100012278 | 350 |
| 105 | 3300025914 | Ga0207671_10001705 | Ga0207671_1000170515 | 350 |
| 106 | 3300025923 | Ga0207681_10174981 | Ga0207681_101749812 | 350 |
| 107 | 3300025924 | Ga0207694_10003724 | Ga0207694_100037247 | 350 |
| 108 | 3300025936 | Ga0207670_10013966 | Ga0207670_100139663 | 350 |
| 109 | 3300025940 | Ga0207691_10031372 | Ga0207691_100313723 | 350 |
| 110 | 3300025942 | Ga0207689_10003172 | Ga0207689_1000317212 | 350 |
| 111 | 3300025945 | Ga0207679_10011212 | Ga0207679_100112125 | 350 |
| 112 | 3300025960 | Ga0207651_10180703 | Ga0207651_101807031 | 350 |
| 113 | 3300026075 | Ga0207708_10180341 | Ga0207708_101803412 | 350 |
| 114 | 3300026078 | Ga0207702_10083640 | Ga0207702_100836402 | 350 |
| 115 | 3300026078 | Ga0207702_10141443 | Ga0207702_101414432 | 350 |
| 116 | 3300026089 | Ga0207648_10047707 | Ga0207648_100477073 | 350 |
| 117 | 3300026089 | Ga0207648_10152560 | Ga0207648_101525602 | 350 |
| 118 | 3300026095 | Ga0207676_10388988 | Ga0207676_103889881 | 350 |
| 119 | 3300026116 | Ga0207674_10002816 | Ga0207674_100028169 | 350 |
| 120 | 3300026116 | Ga0207674_10017794 | Ga0207674_100177942 | 350 |
| 121 | 3300026142 | Ga0207698_10042389 | Ga0207698_100423893 | 350 |
| 122 | 3300026142 | Ga0207698_10096394 | Ga0207698_100963943 | 350 |
| 123 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028200 | 350 |
| 124 | 3300030521 | Ga0307511_10000002 | Ga0307511_1000000253 | 350 |
| 125 | 3300031251 | Ga0265327_10017785 | Ga0265327_100177852 | 350 |
| 126 | 3300031665 | Ga0316575_10004858 | Ga0316575_100048583 | 350 |
| 127 | 3300031691 | Ga0316579_10036188 | Ga0316579_100361881 | 350 |
| 128 | 3300031727 | Ga0316576_10001884 | Ga0316576_100018849 | 350 |
| 129 | 3300031727 | Ga0316576_10229364 | Ga0316576_102293641 | 350 |
| 130 | 3300031728 | Ga0316578_10001089 | Ga0316578_100010895 | 350 |
| 131 | 3300031728 | Ga0316578_10129453 | Ga0316578_101294531 | 350 |
| 132 | 3300031728 | Ga0316578_10153889 | Ga0316578_101538892 | 350 |
| 133 | 3300031730 | Ga0307516_10000486 | Ga0307516_100004867 | 350 |
| 134 | 3300031733 | Ga0316577_10000132 | Ga0316577_100001328 | 350 |
| 135 | 3300032133 | Ga0316583_10008571 | Ga0316583_100085712 | 350 |
| 136 | 3300032133 | Ga0316583_10013737 | Ga0316583_100137373 | 350 |
| 137 | 3300032137 | Ga0316585_10000701 | Ga0316585_100007014 | 350 |
| 138 | 3300032139 | Ga0316580_10010569 | Ga0316580_100105692 | 350 |
| 139 | 3300036647 | Ga0316582_0014378 | Ga0316582_0014378_1185_2252 | 350 |
| 140 | 3300036712 | Ga0316584_0009283 | Ga0316584_0009283_450_1517 | 350 |
| 141 | 3300037471 | Ga0395905_0013872 | Ga0395905_0013872_1100_2152 | 350 |
| 142 | 3300039437 | Ga0436365_0521562 | Ga0436365_0521562_48_1100 | 350 |
| 143 | 3300042876 | Ga0451577_0011149 | Ga0451577_0011149_392_1459 | 350 |
| 144 | 3300044658 | Ga0466972_0006818 | Ga0466972_0006818_1153_2205 | 350 |
| 145 | 3300044712 | Ga0453684_0018349 | Ga0453684_0018349_4685_5752 | 350 |
| 146 | 3300044712 | Ga0453684_0026435 | Ga0453684_0026435_4303_5370 | 350 |
| 147 | 3300044712 | Ga0453684_0102508 | Ga0453684_0102508_226_1293 | 350 |
| 148 | 3300044735 | Ga0466968_0006275 | Ga0466968_0006275_2466_3518 | 350 |
| 149 | 3300046675 | Ga0495657_0046927 | Ga0495657_0046927_1857_2909 | 350 |
| 150 | 3300047320 | Ga0495672_0013217 | Ga0495672_0013217_469_1521 | 350 |
| 151 | 3300047472 | Ga0495686_0014570 | Ga0495686_0014570_2093_3145 | 350 |
| 152 | 3300048903 | Ga0496100_0038502 | Ga0496100_0038502_67_1119 | 350 |
| 153 | 3300048904 | Ga0496101_0070296 | Ga0496101_0070296_349_1401 | 350 |
| 154 | 3300048907 | Ga0496104_0306086 | Ga0496104_0306086_384_1436 | 350 |
| 155 | 3300048917 | Ga0496114_0104859 | Ga0496114_0104859_1183_2235 | 350 |
| 156 | 3300049569 | Ga0501032_0115842 | Ga0501032_0115842_298_1350 | 350 |
| 157 | 3300049572 | Ga0501036_0006617 | Ga0501036_0006617_1046_2098 | 350 |
| 158 | 3300049574 | Ga0501038_0025837 | Ga0501038_0025837_3331_4383 | 350 |
| 159 | 3300049765 | Ga0501268_022938 | Ga0501268_022938_11_1063 | 350 |
| 160 | 3300050512 | nmdc:mga0n895_308217_c1 | nmdc:mga0n895_308217_c1_455_1546 | 350 |
| 161 | 3300015265 | Ga0182005_1000043 | Ga0182005_1000043127 | 351 |
| 162 | 3300031251 | Ga0265327_10000272 | Ga0265327_1000027214 | 351 |
| 163 | 3300044842 | Ga0466957_0005680 | Ga0466957_0005680_2263_3336 | 351 |
| 164 | 3300049579 | Ga0501043_0359411 | Ga0501043_0359411_21_1094 | 351 |
| 165 | 3300049703 | Ga0501219_000019 | Ga0501219_000019_272_1333 | 351 |
| 166 | 3300050005 | Ga0501284_00007 | Ga0501284_00007_54027_55088 | 351 |
| 167 | 3300050493 | nmdc:mga0k408_148245_c1 | nmdc:mga0k408_148245_c1_283_1356 | 351 |
| 168 | 3300031691 | Ga0316579_10015435 | Ga0316579_100154352 | 352 |
| 169 | 3300031727 | Ga0316576_10107685 | Ga0316576_101076852 | 352 |
| 170 | 3300031733 | Ga0316577_10017183 | Ga0316577_100171831 | 352 |
| 171 | 3300031733 | Ga0316577_10025732 | Ga0316577_100257323 | 352 |
| 172 | 3300036712 | Ga0316584_0101403 | Ga0316584_0101403_207_1286 | 352 |
| 173 | 3300036712 | Ga0316584_0239239 | Ga0316584_0239239_22_1101 | 352 |
| 174 | 3300038726 | Ga0400490_06663 | Ga0400490_06663_11410_12489 | 352 |
| 175 | iso_pu_bacteria | 2818991442 | 2819574895 | 354 |
| 176 | iso_pu_bacteria | 2821136567 | 2821140995 | 354 |
| 177 | iso_pu_bacteria | 2840677318 | 2840678766 | 354 |
| 178 | iso_pu_bacteria | 2883068021 | 2883069578 | 354 |
| 179 | iso_pu_bacteria | 2896085136 | 2896086584 | 354 |
| 180 | iso_pu_bacteria | 2896109856 | 2896113116 | 354 |
| 181 | iso_pu_bacteria | 2904467357 | 2904471495 | 354 |
| 182 | iso_pu_bacteria | 2929239360 | 2929240152 | 354 |
| 183 | iso_pu_bacteria | 2929921140 | 2929921847 | 354 |
| 184 | 3300025921 | Ga0207652_10031060 | Ga0207652_100310605 | 355 |
| 185 | 3300003354 | JGI25160J50197_1000375 | JGI25160J50197_10003753 | 356 |
| 186 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026281 | 356 |
| 187 | 3300036401 | Ga0373937_0440396 | Ga0373937_0440396_98_1168 | 356 |
| 188 | 3300001979 | JGI24740J21852_10004944 | JGI24740J21852_100049444 | 357 |
| 189 | 3300002459 | JGI24751J29686_10002525 | JGI24751J29686_100025252 | 357 |
| 190 | 3300003316 | rootH1_10132364 | rootH1_101323644 | 357 |
| 191 | 3300003320 | rootH2_10003346 | rootH2_1000334620 | 357 |
| 192 | 3300003320 | rootH2_10088824 | rootH2_100888243 | 357 |
| 193 | 3300003320 | rootH2_10128231 | rootH2_101282317 | 357 |
| 194 | 3300003322 | rootL2_10200643 | rootL2_102006431 | 357 |
| 195 | 3300003323 | rootH1_10114166 | rootH1_101141664 | 357 |
| 196 | 3300005288 | Ga0065714_10083974 | Ga0065714_100839741 | 357 |
| 197 | 3300005327 | Ga0070658_10032464 | Ga0070658_100324642 | 357 |
| 198 | 3300005328 | Ga0070676_10000167 | Ga0070676_1000016710 | 357 |
| 199 | 3300005329 | Ga0070683_100018391 | Ga0070683_1000183916 | 357 |
| 200 | 3300005330 | Ga0070690_100010364 | Ga0070690_1000103646 | 357 |
| 201 | 3300005331 | Ga0070670_100038146 | Ga0070670_1000381462 | 357 |
| 202 | 3300005331 | Ga0070670_100049111 | Ga0070670_1000491112 | 357 |
| 203 | 3300005331 | Ga0070670_100123093 | Ga0070670_1001230932 | 357 |
| 204 | 3300005331 | Ga0070670_100277949 | Ga0070670_1002779491 | 357 |
| 205 | 3300005334 | Ga0068869_100036022 | Ga0068869_1000360223 | 357 |
| 206 | 3300005334 | Ga0068869_100095335 | Ga0068869_1000953352 | 357 |
| 207 | 3300005334 | Ga0068869_100133282 | Ga0068869_1001332822 | 357 |
| 208 | 3300005334 | Ga0068869_100236831 | Ga0068869_1002368311 | 357 |
| 209 | 3300005335 | Ga0070666_10000030 | Ga0070666_1000003092 | 357 |
| 210 | 3300005335 | Ga0070666_10000512 | Ga0070666_1000051223 | 357 |
| 211 | 3300005335 | Ga0070666_10083175 | Ga0070666_100831751 | 357 |
| 212 | 3300005336 | Ga0070680_100023108 | Ga0070680_1000231084 | 357 |
| 213 | 3300005337 | Ga0070682_100004319 | Ga0070682_1000043194 | 357 |
| 214 | 3300005337 | Ga0070682_100007939 | Ga0070682_1000079392 | 357 |
| 215 | 3300005337 | Ga0070682_100295233 | Ga0070682_1002952331 | 357 |
| 216 | 3300005338 | Ga0068868_100004051 | Ga0068868_1000040518 | 357 |
| 217 | 3300005338 | Ga0068868_100005213 | Ga0068868_1000052134 | 357 |
| 218 | 3300005338 | Ga0068868_100142518 | Ga0068868_1001425181 | 357 |
| 219 | 3300005339 | Ga0070660_100063106 | Ga0070660_1000631063 | 357 |
| 220 | 3300005344 | Ga0070661_100015588 | Ga0070661_1000155885 | 357 |
| 221 | 3300005344 | Ga0070661_100216540 | Ga0070661_1002165401 | 357 |
| 222 | 3300005347 | Ga0070668_100032723 | Ga0070668_1000327232 | 357 |
| 223 | 3300005354 | Ga0070675_100102206 | Ga0070675_1001022064 | 357 |
| 224 | 3300005355 | Ga0070671_100025809 | Ga0070671_1000258095 | 357 |
| 225 | 3300005355 | Ga0070671_100262268 | Ga0070671_1002622682 | 357 |
| 226 | 3300005356 | Ga0070674_100009484 | Ga0070674_1000094844 | 357 |
| 227 | 3300005356 | Ga0070674_100136108 | Ga0070674_1001361082 | 357 |
| 228 | 3300005356 | Ga0070674_100184860 | Ga0070674_1001848602 | 357 |
| 229 | 3300005364 | Ga0070673_100003256 | Ga0070673_1000032568 | 357 |
| 230 | 3300005364 | Ga0070673_100240982 | Ga0070673_1002409822 | 357 |
| 231 | 3300005365 | Ga0070688_100006998 | Ga0070688_1000069983 | 357 |
| 232 | 3300005366 | Ga0070659_100012764 | Ga0070659_1000127643 | 357 |
| 233 | 3300005367 | Ga0070667_100029965 | Ga0070667_1000299652 | 357 |
| 234 | 3300005455 | Ga0070663_100116211 | Ga0070663_1001162112 | 357 |
| 235 | 3300005456 | Ga0070678_100021913 | Ga0070678_1000219133 | 357 |
| 236 | 3300005457 | Ga0070662_100021196 | Ga0070662_1000211964 | 357 |
| 237 | 3300005457 | Ga0070662_100022881 | Ga0070662_1000228814 | 357 |
| 238 | 3300005457 | Ga0070662_100046357 | Ga0070662_1000463572 | 357 |
| 239 | 3300005458 | Ga0070681_10013527 | Ga0070681_100135277 | 357 |
| 240 | 3300005458 | Ga0070681_10099291 | Ga0070681_100992913 | 357 |
| 241 | 3300005459 | Ga0068867_100021839 | Ga0068867_1000218392 | 357 |
| 242 | 3300005459 | Ga0068867_100085236 | Ga0068867_1000852363 | 357 |
| 243 | 3300005459 | Ga0068867_100237520 | Ga0068867_1002375202 | 357 |
| 244 | 3300005530 | Ga0070679_100028777 | Ga0070679_1000287776 | 357 |
| 245 | 3300005530 | Ga0070679_100039559 | Ga0070679_1000395594 | 357 |
| 246 | 3300005530 | Ga0070679_100099324 | Ga0070679_1000993242 | 357 |
| 247 | 3300005535 | Ga0070684_100012657 | Ga0070684_1000126572 | 357 |
| 248 | 3300005539 | Ga0068853_100000773 | Ga0068853_1000007739 | 357 |
| 249 | 3300005539 | Ga0068853_100008684 | Ga0068853_1000086846 | 357 |
| 250 | 3300005539 | Ga0068853_100010271 | Ga0068853_1000102713 | 357 |
| 251 | 3300005539 | Ga0068853_100019862 | Ga0068853_1000198624 | 357 |
| 252 | 3300005539 | Ga0068853_100040412 | Ga0068853_1000404122 | 357 |
| 253 | 3300005539 | Ga0068853_100061769 | Ga0068853_1000617693 | 357 |
| 254 | 3300005543 | Ga0070672_100000310 | Ga0070672_10000031021 | 357 |
| 255 | 3300005543 | Ga0070672_100028517 | Ga0070672_1000285173 | 357 |
| 256 | 3300005543 | Ga0070672_100051522 | Ga0070672_1000515224 | 357 |
| 257 | 3300005547 | Ga0070693_100010763 | Ga0070693_1000107634 | 357 |
| 258 | 3300005548 | Ga0070665_100007830 | Ga0070665_1000078304 | 357 |
| 259 | 3300005548 | Ga0070665_100112407 | Ga0070665_1001124071 | 357 |
| 260 | 3300005563 | Ga0068855_100000081 | Ga0068855_10000008122 | 357 |
| 261 | 3300005563 | Ga0068855_100018949 | Ga0068855_1000189495 | 357 |
| 262 | 3300005563 | Ga0068855_100030104 | Ga0068855_1000301043 | 357 |
| 263 | 3300005563 | Ga0068855_100043093 | Ga0068855_1000430933 | 357 |
| 264 | 3300005563 | Ga0068855_100385955 | Ga0068855_1003859551 | 357 |
| 265 | 3300005564 | Ga0070664_100002738 | Ga0070664_10000273817 | 357 |
| 266 | 3300005564 | Ga0070664_100008778 | Ga0070664_1000087785 | 357 |
| 267 | 3300005564 | Ga0070664_100129710 | Ga0070664_1001297102 | 357 |
| 268 | 3300005577 | Ga0068857_100003167 | Ga0068857_1000031673 | 357 |
| 269 | 3300005577 | Ga0068857_100026193 | Ga0068857_1000261933 | 357 |
| 270 | 3300005577 | Ga0068857_100155672 | Ga0068857_1001556722 | 357 |
| 271 | 3300005578 | Ga0068854_100105255 | Ga0068854_1001052552 | 357 |
| 272 | 3300005614 | Ga0068856_100007849 | Ga0068856_1000078498 | 357 |
| 273 | 3300005614 | Ga0068856_100011188 | Ga0068856_1000111887 | 357 |
| 274 | 3300005614 | Ga0068856_100275438 | Ga0068856_1002754382 | 357 |
| 275 | 3300005614 | Ga0068856_100329230 | Ga0068856_1003292302 | 357 |
| 276 | 3300005616 | Ga0068852_100001636 | Ga0068852_1000016365 | 357 |
| 277 | 3300005616 | Ga0068852_100002835 | Ga0068852_1000028359 | 357 |
| 278 | 3300005616 | Ga0068852_100012225 | Ga0068852_1000122253 | 357 |
| 279 | 3300005616 | Ga0068852_100053908 | Ga0068852_1000539083 | 357 |
| 280 | 3300005616 | Ga0068852_100071802 | Ga0068852_1000718023 | 357 |
| 281 | 3300005616 | Ga0068852_100299596 | Ga0068852_1002995962 | 357 |
| 282 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003432 | 357 |
| 283 | 3300005617 | Ga0068859_100000461 | Ga0068859_10000046126 | 357 |
| 284 | 3300005617 | Ga0068859_100034447 | Ga0068859_1000344474 | 357 |
| 285 | 3300005617 | Ga0068859_100040903 | Ga0068859_1000409035 | 357 |
| 286 | 3300005617 | Ga0068859_100119465 | Ga0068859_1001194653 | 357 |
| 287 | 3300005618 | Ga0068864_100001741 | Ga0068864_1000017415 | 357 |
| 288 | 3300005618 | Ga0068864_100005856 | Ga0068864_1000058564 | 357 |
| 289 | 3300005618 | Ga0068864_100063881 | Ga0068864_1000638813 | 357 |
| 290 | 3300005719 | Ga0068861_100003203 | Ga0068861_1000032036 | 357 |
| 291 | 3300005719 | Ga0068861_100043733 | Ga0068861_1000437333 | 357 |
| 292 | 3300005834 | Ga0068851_10002509 | Ga0068851_100025097 | 357 |
| 293 | 3300005834 | Ga0068851_10004484 | Ga0068851_100044845 | 357 |
| 294 | 3300005834 | Ga0068851_10010113 | Ga0068851_100101132 | 357 |
| 295 | 3300005840 | Ga0068870_10022268 | Ga0068870_100222682 | 357 |
| 296 | 3300005841 | Ga0068863_100002398 | Ga0068863_10000239811 | 357 |
| 297 | 3300005841 | Ga0068863_100119217 | Ga0068863_1001192172 | 357 |
| 298 | 3300005841 | Ga0068863_100307456 | Ga0068863_1003074561 | 357 |
| 299 | 3300005842 | Ga0068858_100007027 | Ga0068858_1000070278 | 357 |
| 300 | 3300005842 | Ga0068858_100036435 | Ga0068858_1000364352 | 357 |
| 301 | 3300005843 | Ga0068860_100002247 | Ga0068860_10000224714 | 357 |
| 302 | 3300005843 | Ga0068860_100003895 | Ga0068860_10000389512 | 357 |
| 303 | 3300005843 | Ga0068860_100010764 | Ga0068860_1000107646 | 357 |
| 304 | 3300005843 | Ga0068860_100041220 | Ga0068860_1000412203 | 357 |
| 305 | 3300005983 | Ga0081540_1017589 | Ga0081540_10175892 | 357 |
| 306 | 3300005985 | Ga0081539_10000604 | Ga0081539_1000060422 | 357 |
| 307 | 3300005985 | Ga0081539_10013564 | Ga0081539_100135647 | 357 |
| 308 | 3300006195 | Ga0075366_10164700 | Ga0075366_101647001 | 357 |
| 309 | 3300006237 | Ga0097621_100000352 | Ga0097621_10000035228 | 357 |
| 310 | 3300006237 | Ga0097621_100007236 | Ga0097621_1000072364 | 357 |
| 311 | 3300006237 | Ga0097621_100018563 | Ga0097621_1000185634 | 357 |
| 312 | 3300006237 | Ga0097621_100042232 | Ga0097621_1000422324 | 357 |
| 313 | 3300006237 | Ga0097621_100354913 | Ga0097621_1003549132 | 357 |
| 314 | 3300006358 | Ga0068871_100001720 | Ga0068871_1000017204 | 357 |
| 315 | 3300006358 | Ga0068871_100003843 | Ga0068871_1000038438 | 357 |
| 316 | 3300006358 | Ga0068871_100045786 | Ga0068871_1000457862 | 357 |
| 317 | 3300006358 | Ga0068871_100118440 | Ga0068871_1001184402 | 357 |
| 318 | 3300006847 | Ga0075431_100009229 | Ga0075431_1000092298 | 357 |
| 319 | 3300006880 | Ga0075429_100004600 | Ga0075429_10000460011 | 357 |
| 320 | 3300006881 | Ga0068865_100104292 | Ga0068865_1001042922 | 357 |
| 321 | 3300006881 | Ga0068865_100198911 | Ga0068865_1001989112 | 357 |
| 322 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003432 | 357 |
| 323 | 3300006931 | Ga0097620_100000461 | Ga0097620_10000046126 | 357 |
| 324 | 3300006931 | Ga0097620_100034448 | Ga0097620_1000344484 | 357 |
| 325 | 3300006931 | Ga0097620_100040903 | Ga0097620_1000409035 | 357 |
| 326 | 3300006931 | Ga0097620_100119477 | Ga0097620_1001194773 | 357 |
| 327 | 3300009093 | Ga0105240_10000597 | Ga0105240_1000059745 | 357 |
| 328 | 3300009093 | Ga0105240_10003084 | Ga0105240_1000308418 | 357 |
| 329 | 3300009093 | Ga0105240_10003774 | Ga0105240_1000377416 | 357 |
| 330 | 3300009093 | Ga0105240_10008651 | Ga0105240_100086515 | 357 |
| 331 | 3300009093 | Ga0105240_10073572 | Ga0105240_100735724 | 357 |
| 332 | 3300009093 | Ga0105240_10214817 | Ga0105240_102148171 | 357 |
| 333 | 3300009094 | Ga0111539_10132349 | Ga0111539_101323492 | 357 |
| 334 | 3300009101 | Ga0105247_10027687 | Ga0105247_100276873 | 357 |
| 335 | 3300009101 | Ga0105247_10079899 | Ga0105247_100798991 | 357 |
| 336 | 3300009147 | Ga0114129_10021302 | Ga0114129_100213026 | 357 |
| 337 | 3300009174 | Ga0105241_10000564 | Ga0105241_1000056417 | 357 |
| 338 | 3300009174 | Ga0105241_10004810 | Ga0105241_100048105 | 357 |
| 339 | 3300009174 | Ga0105241_10190581 | Ga0105241_101905811 | 357 |
| 340 | 3300009174 | Ga0105241_10209427 | Ga0105241_102094272 | 357 |
| 341 | 3300009176 | Ga0105242_10025384 | Ga0105242_100253843 | 357 |
| 342 | 3300009177 | Ga0105248_10053027 | Ga0105248_100530275 | 357 |
| 343 | 3300009545 | Ga0105237_10000294 | Ga0105237_1000029429 | 357 |
| 344 | 3300009545 | Ga0105237_10000759 | Ga0105237_1000075923 | 357 |
| 345 | 3300009545 | Ga0105237_10009804 | Ga0105237_100098047 | 357 |
| 346 | 3300009545 | Ga0105237_10015867 | Ga0105237_100158675 | 357 |
| 347 | 3300009551 | Ga0105238_10075882 | Ga0105238_100758823 | 357 |
| 348 | 3300009551 | Ga0105238_10154523 | Ga0105238_101545231 | 357 |
| 349 | 3300009551 | Ga0105238_10320965 | Ga0105238_103209652 | 357 |
| 350 | 3300009553 | Ga0105249_10003321 | Ga0105249_100033215 | 357 |
| 351 | 3300009553 | Ga0105249_10016126 | Ga0105249_100161264 | 357 |
| 352 | 3300009553 | Ga0105249_10022846 | Ga0105249_100228462 | 357 |
| 353 | 3300009553 | Ga0105249_10177950 | Ga0105249_101779501 | 357 |
| 354 | 3300009553 | Ga0105249_10234009 | Ga0105249_102340092 | 357 |
| 355 | 3300010375 | Ga0105239_10000628 | Ga0105239_1000062837 | 357 |
| 356 | 3300010375 | Ga0105239_10005401 | Ga0105239_100054017 | 357 |
| 357 | 3300010375 | Ga0105239_10012135 | Ga0105239_100121353 | 357 |
| 358 | 3300010375 | Ga0105239_10035013 | Ga0105239_100350132 | 357 |
| 359 | 3300010375 | Ga0105239_10073535 | Ga0105239_100735353 | 357 |
| 360 | 3300010375 | Ga0105239_10128347 | Ga0105239_101283472 | 357 |
| 361 | 3300010375 | Ga0105239_10206355 | Ga0105239_102063552 | 357 |
| 362 | 3300010375 | Ga0105239_10311144 | Ga0105239_103111442 | 357 |
| 363 | 3300010375 | Ga0105239_10478215 | Ga0105239_104782151 | 357 |
| 364 | 3300011119 | Ga0105246_10008264 | Ga0105246_100082646 | 357 |
| 365 | 3300011119 | Ga0105246_10023545 | Ga0105246_100235452 | 357 |
| 366 | 3300011119 | Ga0105246_10061609 | Ga0105246_100616092 | 357 |
| 367 | 3300011119 | Ga0105246_10139180 | Ga0105246_101391802 | 357 |
| 368 | 3300013100 | Ga0157373_10004289 | Ga0157373_100042896 | 357 |
| 369 | 3300013102 | Ga0157371_10021112 | Ga0157371_100211123 | 357 |
| 370 | 3300013104 | Ga0157370_10006558 | Ga0157370_100065587 | 357 |
| 371 | 3300013104 | Ga0157370_10043563 | Ga0157370_100435634 | 357 |
| 372 | 3300013104 | Ga0157370_10053535 | Ga0157370_100535353 | 357 |
| 373 | 3300013105 | Ga0157369_10005892 | Ga0157369_100058927 | 357 |
| 374 | 3300013105 | Ga0157369_10031421 | Ga0157369_100314211 | 357 |
| 375 | 3300013296 | Ga0157374_10000027 | Ga0157374_1000002776 | 357 |
| 376 | 3300013296 | Ga0157374_10009273 | Ga0157374_100092735 | 357 |
| 377 | 3300013296 | Ga0157374_10015811 | Ga0157374_100158112 | 357 |
| 378 | 3300013296 | Ga0157374_10032340 | Ga0157374_100323403 | 357 |
| 379 | 3300013296 | Ga0157374_10102497 | Ga0157374_101024971 | 357 |
| 380 | 3300013296 | Ga0157374_10312682 | Ga0157374_103126821 | 357 |
| 381 | 3300013297 | Ga0157378_10003338 | Ga0157378_100033386 | 357 |
| 382 | 3300013297 | Ga0157378_10014172 | Ga0157378_100141723 | 357 |
| 383 | 3300013297 | Ga0157378_10016465 | Ga0157378_100164656 | 357 |
| 384 | 3300013297 | Ga0157378_10016865 | Ga0157378_100168655 | 357 |
| 385 | 3300013297 | Ga0157378_10045180 | Ga0157378_100451802 | 357 |
| 386 | 3300013297 | Ga0157378_10168388 | Ga0157378_101683883 | 357 |
| 387 | 3300013306 | Ga0163162_10000725 | Ga0163162_1000072515 | 357 |
| 388 | 3300013306 | Ga0163162_10001535 | Ga0163162_100015354 | 357 |
| 389 | 3300013306 | Ga0163162_10001913 | Ga0163162_100019139 | 357 |
| 390 | 3300013306 | Ga0163162_10002195 | Ga0163162_100021957 | 357 |
| 391 | 3300013306 | Ga0163162_10017145 | Ga0163162_100171456 | 357 |
| 392 | 3300013306 | Ga0163162_10027786 | Ga0163162_100277865 | 357 |
| 393 | 3300013306 | Ga0163162_10036142 | Ga0163162_100361423 | 357 |
| 394 | 3300013306 | Ga0163162_10048111 | Ga0163162_100481113 | 357 |
| 395 | 3300013306 | Ga0163162_10112259 | Ga0163162_101122592 | 357 |
| 396 | 3300013306 | Ga0163162_10193704 | Ga0163162_101937042 | 357 |
| 397 | 3300013306 | Ga0163162_10212763 | Ga0163162_102127631 | 357 |
| 398 | 3300013307 | Ga0157372_10017166 | Ga0157372_100171663 | 357 |
| 399 | 3300013307 | Ga0157372_10030119 | Ga0157372_100301194 | 357 |
| 400 | 3300013307 | Ga0157372_10173331 | Ga0157372_101733313 | 357 |
| 401 | 3300013307 | Ga0157372_10238904 | Ga0157372_102389043 | 357 |
| 402 | 3300013307 | Ga0157372_10542483 | Ga0157372_105424831 | 357 |
| 403 | 3300013308 | Ga0157375_10026885 | Ga0157375_100268853 | 357 |
| 404 | 3300013308 | Ga0157375_10032650 | Ga0157375_100326502 | 357 |
| 405 | 3300013308 | Ga0157375_10116670 | Ga0157375_101166703 | 357 |
| 406 | 3300013308 | Ga0157375_10360166 | Ga0157375_103601662 | 357 |
| 407 | 3300014325 | Ga0163163_10001644 | Ga0163163_1000164420 | 357 |
| 408 | 3300014325 | Ga0163163_10398443 | Ga0163163_103984432 | 357 |
| 409 | 3300014745 | Ga0157377_10010551 | Ga0157377_100105512 | 357 |
| 410 | 3300014745 | Ga0157377_10012029 | Ga0157377_100120293 | 357 |
| 411 | 3300014745 | Ga0157377_10014014 | Ga0157377_100140142 | 357 |
| 412 | 3300014968 | Ga0157379_10000810 | Ga0157379_100008103 | 357 |
| 413 | 3300014968 | Ga0157379_10035463 | Ga0157379_100354633 | 357 |
| 414 | 3300014968 | Ga0157379_10072029 | Ga0157379_100720293 | 357 |
| 415 | 3300014969 | Ga0157376_10008235 | Ga0157376_100082353 | 357 |
| 416 | 3300014969 | Ga0157376_10050156 | Ga0157376_100501563 | 357 |
| 417 | 3300014969 | Ga0157376_10077233 | Ga0157376_100772331 | 357 |
| 418 | 3300014969 | Ga0157376_10093591 | Ga0157376_100935912 | 357 |
| 419 | 3300021384 | Ga0213876_10003420 | Ga0213876_100034207 | 357 |
| 420 | 3300025321 | Ga0207656_10001907 | Ga0207656_100019074 | 357 |
| 421 | 3300025321 | Ga0207656_10002373 | Ga0207656_100023735 | 357 |
| 422 | 3300025321 | Ga0207656_10002476 | Ga0207656_100024764 | 357 |
| 423 | 3300025321 | Ga0207656_10016219 | Ga0207656_100162192 | 357 |
| 424 | 3300025893 | Ga0207682_10017202 | Ga0207682_100172023 | 357 |
| 425 | 3300025900 | Ga0207710_10018603 | Ga0207710_100186031 | 357 |
| 426 | 3300025901 | Ga0207688_10007222 | Ga0207688_100072221 | 357 |
| 427 | 3300025903 | Ga0207680_10000014 | Ga0207680_1000001415 | 357 |
| 428 | 3300025903 | Ga0207680_10015219 | Ga0207680_100152193 | 357 |
| 429 | 3300025903 | Ga0207680_10015294 | Ga0207680_100152943 | 357 |
| 430 | 3300025904 | Ga0207647_10019688 | Ga0207647_100196883 | 357 |
| 431 | 3300025904 | Ga0207647_10023965 | Ga0207647_100239653 | 357 |
| 432 | 3300025904 | Ga0207647_10027412 | Ga0207647_100274123 | 357 |
| 433 | 3300025904 | Ga0207647_10103079 | Ga0207647_101030791 | 357 |
| 434 | 3300025904 | Ga0207647_10152421 | Ga0207647_101524211 | 357 |
| 435 | 3300025907 | Ga0207645_10003328 | Ga0207645_100033284 | 357 |
| 436 | 3300025907 | Ga0207645_10018115 | Ga0207645_100181154 | 357 |
| 437 | 3300025907 | Ga0207645_10064304 | Ga0207645_100643041 | 357 |
| 438 | 3300025907 | Ga0207645_10105238 | Ga0207645_101052382 | 357 |
| 439 | 3300025911 | Ga0207654_10002774 | Ga0207654_100027745 | 357 |
| 440 | 3300025911 | Ga0207654_10005683 | Ga0207654_100056834 | 357 |
| 441 | 3300025912 | Ga0207707_10004563 | Ga0207707_100045635 | 357 |
| 442 | 3300025913 | Ga0207695_10000087 | Ga0207695_10000087230 | 357 |
| 443 | 3300025913 | Ga0207695_10000299 | Ga0207695_1000029957 | 357 |
| 444 | 3300025913 | Ga0207695_10000676 | Ga0207695_1000067615 | 357 |
| 445 | 3300025913 | Ga0207695_10024733 | Ga0207695_100247335 | 357 |
| 446 | 3300025913 | Ga0207695_10028549 | Ga0207695_100285493 | 357 |
| 447 | 3300025913 | Ga0207695_10125083 | Ga0207695_101250832 | 357 |
| 448 | 3300025914 | Ga0207671_10000533 | Ga0207671_1000053340 | 357 |
| 449 | 3300025914 | Ga0207671_10001854 | Ga0207671_100018547 | 357 |
| 450 | 3300025914 | Ga0207671_10021513 | Ga0207671_100215135 | 357 |
| 451 | 3300025917 | Ga0207660_10013410 | Ga0207660_100134103 | 357 |
| 452 | 3300025919 | Ga0207657_10003151 | Ga0207657_100031517 | 357 |
| 453 | 3300025919 | Ga0207657_10308641 | Ga0207657_103086411 | 357 |
| 454 | 3300025920 | Ga0207649_10011087 | Ga0207649_100110872 | 357 |
| 455 | 3300025921 | Ga0207652_10013744 | Ga0207652_100137443 | 357 |
| 456 | 3300025924 | Ga0207694_10122734 | Ga0207694_101227342 | 357 |
| 457 | 3300025925 | Ga0207650_10097012 | Ga0207650_100970123 | 357 |
| 458 | 3300025925 | Ga0207650_10301644 | Ga0207650_103016442 | 357 |
| 459 | 3300025926 | Ga0207659_10032289 | Ga0207659_100322893 | 357 |
| 460 | 3300025931 | Ga0207644_10025539 | Ga0207644_100255394 | 357 |
| 461 | 3300025931 | Ga0207644_10182360 | Ga0207644_101823602 | 357 |
| 462 | 3300025932 | Ga0207690_10003794 | Ga0207690_100037944 | 357 |
| 463 | 3300025933 | Ga0207706_10004657 | Ga0207706_100046577 | 357 |
| 464 | 3300025933 | Ga0207706_10015622 | Ga0207706_100156224 | 357 |
| 465 | 3300025934 | Ga0207686_10034702 | Ga0207686_100347023 | 357 |
| 466 | 3300025934 | Ga0207686_10070230 | Ga0207686_100702302 | 357 |
| 467 | 3300025937 | Ga0207669_10006970 | Ga0207669_100069704 | 357 |
| 468 | 3300025937 | Ga0207669_10091876 | Ga0207669_100918763 | 357 |
| 469 | 3300025940 | Ga0207691_10000234 | Ga0207691_1000023435 | 357 |
| 470 | 3300025940 | Ga0207691_10015317 | Ga0207691_100153174 | 357 |
| 471 | 3300025940 | Ga0207691_10105683 | Ga0207691_101056831 | 357 |
| 472 | 3300025942 | Ga0207689_10000664 | Ga0207689_100006649 | 357 |
| 473 | 3300025942 | Ga0207689_10002814 | Ga0207689_1000281414 | 357 |
| 474 | 3300025942 | Ga0207689_10003467 | Ga0207689_100034677 | 357 |
| 475 | 3300025942 | Ga0207689_10012563 | Ga0207689_100125633 | 357 |
| 476 | 3300025942 | Ga0207689_10103943 | Ga0207689_101039432 | 357 |
| 477 | 3300025944 | Ga0207661_10406879 | Ga0207661_104068791 | 357 |
| 478 | 3300025945 | Ga0207679_10002893 | Ga0207679_100028932 | 357 |
| 479 | 3300025945 | Ga0207679_10010064 | Ga0207679_100100643 | 357 |
| 480 | 3300025945 | Ga0207679_10279252 | Ga0207679_102792522 | 357 |
| 481 | 3300025949 | Ga0207667_10000172 | Ga0207667_1000017258 | 357 |
| 482 | 3300025949 | Ga0207667_10005849 | Ga0207667_100058495 | 357 |
| 483 | 3300025949 | Ga0207667_10056467 | Ga0207667_100564672 | 357 |
| 484 | 3300025949 | Ga0207667_10074035 | Ga0207667_100740352 | 357 |
| 485 | 3300025949 | Ga0207667_10297949 | Ga0207667_102979492 | 357 |
| 486 | 3300025961 | Ga0207712_10011258 | Ga0207712_100112583 | 357 |
| 487 | 3300025961 | Ga0207712_10019114 | Ga0207712_100191142 | 357 |
| 488 | 3300025961 | Ga0207712_10057965 | Ga0207712_100579652 | 357 |
| 489 | 3300025961 | Ga0207712_10058345 | Ga0207712_100583453 | 357 |
| 490 | 3300025961 | Ga0207712_10062019 | Ga0207712_100620193 | 357 |
| 491 | 3300025961 | Ga0207712_10151401 | Ga0207712_101514012 | 357 |
| 492 | 3300025972 | Ga0207668_10064997 | Ga0207668_100649973 | 357 |
| 493 | 3300025981 | Ga0207640_10164899 | Ga0207640_101648991 | 357 |
| 494 | 3300025986 | Ga0207658_10002543 | Ga0207658_100025434 | 357 |
| 495 | 3300025986 | Ga0207658_10024748 | Ga0207658_100247482 | 357 |
| 496 | 3300025986 | Ga0207658_10224509 | Ga0207658_102245092 | 357 |
| 497 | 3300025986 | Ga0207658_10226919 | Ga0207658_102269191 | 357 |
| 498 | 3300026023 | Ga0207677_10013733 | Ga0207677_100137336 | 357 |
| 499 | 3300026023 | Ga0207677_10026299 | Ga0207677_100262992 | 357 |
| 500 | 3300026023 | Ga0207677_10270022 | Ga0207677_102700222 | 357 |
| 501 | 3300026035 | Ga0207703_10002928 | Ga0207703_100029288 | 357 |
| 502 | 3300026035 | Ga0207703_10020985 | Ga0207703_100209854 | 357 |
| 503 | 3300026035 | Ga0207703_10110543 | Ga0207703_101105431 | 357 |
| 504 | 3300026041 | Ga0207639_10005873 | Ga0207639_100058736 | 357 |
| 505 | 3300026041 | Ga0207639_10011289 | Ga0207639_100112892 | 357 |
| 506 | 3300026041 | Ga0207639_10021969 | Ga0207639_100219697 | 357 |
| 507 | 3300026041 | Ga0207639_10047548 | Ga0207639_100475482 | 357 |
| 508 | 3300026041 | Ga0207639_10077413 | Ga0207639_100774132 | 357 |
| 509 | 3300026041 | Ga0207639_10173339 | Ga0207639_101733392 | 357 |
| 510 | 3300026067 | Ga0207678_10059105 | Ga0207678_100591052 | 357 |
| 511 | 3300026078 | Ga0207702_10047881 | Ga0207702_100478812 | 357 |
| 512 | 3300026078 | Ga0207702_10111931 | Ga0207702_101119312 | 357 |
| 513 | 3300026088 | Ga0207641_10000015 | Ga0207641_10000015108 | 357 |
| 514 | 3300026088 | Ga0207641_10040030 | Ga0207641_100400303 | 357 |
| 515 | 3300026089 | Ga0207648_10005571 | Ga0207648_100055718 | 357 |
| 516 | 3300026089 | Ga0207648_10009688 | Ga0207648_100096885 | 357 |
| 517 | 3300026089 | Ga0207648_10132232 | Ga0207648_101322321 | 357 |
| 518 | 3300026089 | Ga0207648_10225971 | Ga0207648_102259712 | 357 |
| 519 | 3300026095 | Ga0207676_10000899 | Ga0207676_1000089913 | 357 |
| 520 | 3300026095 | Ga0207676_10018524 | Ga0207676_100185242 | 357 |
| 521 | 3300026095 | Ga0207676_10040588 | Ga0207676_100405883 | 357 |
| 522 | 3300026095 | Ga0207676_10147163 | Ga0207676_101471632 | 357 |
| 523 | 3300026116 | Ga0207674_10018853 | Ga0207674_100188536 | 357 |
| 524 | 3300026116 | Ga0207674_10126239 | Ga0207674_101262392 | 357 |
| 525 | 3300026118 | Ga0207675_100009868 | Ga0207675_1000098682 | 357 |
| 526 | 3300026118 | Ga0207675_100021227 | Ga0207675_1000212276 | 357 |
| 527 | 3300026118 | Ga0207675_100030787 | Ga0207675_1000307873 | 357 |
| 528 | 3300026121 | Ga0207683_10018763 | Ga0207683_100187632 | 357 |
| 529 | 3300026121 | Ga0207683_10021082 | Ga0207683_100210822 | 357 |
| 530 | 3300026142 | Ga0207698_10003403 | Ga0207698_100034035 | 357 |
| 531 | 3300026142 | Ga0207698_10007252 | Ga0207698_100072523 | 357 |
| 532 | 3300026142 | Ga0207698_10009707 | Ga0207698_100097074 | 357 |
| 533 | 3300026142 | Ga0207698_10057416 | Ga0207698_100574163 | 357 |
| 534 | 3300026142 | Ga0207698_10128166 | Ga0207698_101281662 | 357 |
| 535 | 3300028379 | Ga0268266_10000048 | Ga0268266_1000004833 | 357 |
| 536 | 3300028379 | Ga0268266_10094506 | Ga0268266_100945062 | 357 |
| 537 | 3300028379 | Ga0268266_10102477 | Ga0268266_101024771 | 357 |
| 538 | 3300028381 | Ga0268264_10001687 | Ga0268264_100016877 | 357 |
| 539 | 3300028381 | Ga0268264_10003414 | Ga0268264_100034142 | 357 |
| 540 | 3300028381 | Ga0268264_10003823 | Ga0268264_100038238 | 357 |
| 541 | 3300028381 | Ga0268264_10010251 | Ga0268264_100102515 | 357 |
| 542 | 3300028786 | Ga0307517_10009783 | Ga0307517_100097837 | 357 |
| 543 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012762 | 357 |
| 544 | 3300028794 | Ga0307515_10000118 | Ga0307515_100001184 | 357 |
| 545 | 3300031251 | Ga0265327_10000024 | Ga0265327_10000024123 | 357 |
| 546 | 3300031251 | Ga0265327_10000031 | Ga0265327_10000031102 | 357 |
| 547 | 3300031251 | Ga0265327_10026902 | Ga0265327_100269022 | 357 |
| 548 | 3300031251 | Ga0265327_10027581 | Ga0265327_100275812 | 357 |
| 549 | 3300031456 | Ga0307513_10111970 | Ga0307513_101119702 | 357 |
| 550 | 3300031616 | Ga0307508_10000694 | Ga0307508_100006949 | 357 |
| 551 | 3300035119 | Ga0373956_0082131 | Ga0373956_0082131_211_1284 | 357 |
| 552 | 3300036401 | Ga0373937_0050758 | Ga0373937_0050758_2539_3612 | 357 |
| 553 | 3300036401 | Ga0373937_0183189 | Ga0373937_0183189_466_1539 | 357 |
| 554 | 3300037471 | Ga0395905_0022101 | Ga0395905_0022101_2388_3461 | 357 |
| 555 | 3300039437 | Ga0436365_1837098 | Ga0436365_1837098_6461_7534 | 357 |
| 556 | 3300042876 | Ga0451577_0014804 | Ga0451577_0014804_5206_6279 | 357 |
| 557 | 3300044712 | Ga0453684_0039674 | Ga0453684_0039674_4181_5254 | 357 |
| 558 | 3300044712 | Ga0453684_0168980 | Ga0453684_0168980_1144_2217 | 357 |
| 559 | 3300044719 | Ga0466971_0003395 | Ga0466971_0003395_1889_2962 | 357 |
| 560 | 3300044842 | Ga0466957_0054965 | Ga0466957_0054965_1287_2360 | 357 |
| 561 | 3300045049 | Ga0466959_0000904 | Ga0466959_0000904_8494_9567 | 357 |
| 562 | 3300045051 | Ga0451576_0267304 | Ga0451576_0267304_368_1441 | 357 |
| 563 | 3300046460 | Ga0495638_0020775 | Ga0495638_0020775_193_1266 | 357 |
| 564 | 3300046460 | Ga0495638_0023374 | Ga0495638_0023374_2388_3470 | 357 |
| 565 | 3300046460 | Ga0495638_0123599 | Ga0495638_0123599_111_1184 | 357 |
| 566 | 3300046471 | Ga0495650_0030464 | Ga0495650_0030464_575_1648 | 357 |
| 567 | 3300046507 | Ga0495606_0004864 | Ga0495606_0004864_67_1140 | 357 |
| 568 | 3300046514 | Ga0495618_0068606 | Ga0495618_0068606_1166_2239 | 357 |
| 569 | 3300046516 | Ga0495628_0212810 | Ga0495628_0212810_188_1261 | 357 |
| 570 | 3300046529 | Ga0495652_0234535 | Ga0495652_0234535_168_1241 | 357 |
| 571 | 3300046616 | Ga0495668_0003508 | Ga0495668_0003508_6428_7501 | 357 |
| 572 | 3300046648 | Ga0495611_0000065 | Ga0495611_0000065_39793_40866 | 357 |
| 573 | 3300046694 | Ga0495649_0025053 | Ga0495649_0025053_2025_3098 | 357 |
| 574 | 3300047320 | Ga0495672_0002281 | Ga0495672_0002281_9462_10535 | 357 |
| 575 | 3300047443 | Ga0495687_000129 | Ga0495687_000129_69482_70564 | 357 |
| 576 | 3300047471 | Ga0495684_0229279 | Ga0495684_0229279_135_1208 | 357 |
| 577 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_720694_721767 | 357 |
| 578 | 3300048917 | Ga0496114_0245923 | Ga0496114_0245923_472_1545 | 357 |
| 579 | 3300048918 | Ga0496115_0220891 | Ga0496115_0220891_128_1201 | 357 |
| 580 | 3300048929 | Ga0496126_0310742 | Ga0496126_0310742_195_1277 | 357 |
| 581 | 3300049523 | Ga0501300_007311 | Ga0501300_007311_16_1089 | 357 |
| 582 | 3300049569 | Ga0501032_0009405 | Ga0501032_0009405_5414_6487 | 357 |
| 583 | 3300049569 | Ga0501032_0028589 | Ga0501032_0028589_1374_2447 | 357 |
| 584 | 3300049570 | Ga0501033_0031424 | Ga0501033_0031424_2078_3151 | 357 |
| 585 | 3300049571 | Ga0501034_0003157 | Ga0501034_0003157_2544_3617 | 357 |
| 586 | 3300049571 | Ga0501034_0009179 | Ga0501034_0009179_4939_6012 | 357 |
| 587 | 3300049571 | Ga0501034_0042674 | Ga0501034_0042674_1956_3029 | 357 |
| 588 | 3300049571 | Ga0501034_0221715 | Ga0501034_0221715_588_1661 | 357 |
| 589 | 3300049572 | Ga0501036_0007556 | Ga0501036_0007556_6323_7396 | 357 |
| 590 | 3300049574 | Ga0501038_0011371 | Ga0501038_0011371_852_1925 | 357 |
| 591 | 3300049575 | Ga0501039_0011919 | Ga0501039_0011919_3437_4510 | 357 |
| 592 | 3300049579 | Ga0501043_0021243 | Ga0501043_0021243_1930_3003 | 357 |
| 593 | 3300049579 | Ga0501043_0095054 | Ga0501043_0095054_34_1107 | 357 |
| 594 | 3300049580 | Ga0501046_0090632 | Ga0501046_0090632_1167_2240 | 357 |
| 595 | 3300049581 | Ga0501047_0006237 | Ga0501047_0006237_9372_10445 | 357 |
| 596 | 3300049581 | Ga0501047_0111573 | Ga0501047_0111573_1007_2080 | 357 |
| 597 | 3300049586 | Ga0501070_0082151 | Ga0501070_0082151_449_1522 | 357 |
| 598 | 3300049586 | Ga0501070_0092405 | Ga0501070_0092405_995_2068 | 357 |
| 599 | 3300049589 | Ga0501073_0045119 | Ga0501073_0045119_503_1576 | 357 |
| 600 | 3300049589 | Ga0501073_0052595 | Ga0501073_0052595_1759_2832 | 357 |
| 601 | 3300049649 | Ga0501198_000167 | Ga0501198_000167_5188_6261 | 357 |
| 602 | 3300049652 | Ga0501202_001568 | Ga0501202_001568_2388_3461 | 357 |
| 603 | 3300049654 | Ga0501207_001417 | Ga0501207_001417_541_1614 | 357 |
| 604 | 3300049661 | Ga0501217_003020 | Ga0501217_003020_1749_2822 | 357 |
| 605 | 3300049661 | Ga0501217_003022 | Ga0501217_003022_634_1707 | 357 |
| 606 | 3300049662 | Ga0501222_000629 | Ga0501222_000629_3829_4902 | 357 |
| 607 | 3300049663 | Ga0501223_000426 | Ga0501223_000426_5820_6893 | 357 |
| 608 | 3300049668 | Ga0501233_009818 | Ga0501233_009818_772_1845 | 357 |
| 609 | 3300049669 | Ga0501235_000033 | Ga0501235_000033_20244_21317 | 357 |
| 610 | 3300049675 | Ga0501243_000152 | Ga0501243_000152_5404_6477 | 357 |
| 611 | 3300049686 | Ga0501257_004677 | Ga0501257_004677_245_1318 | 357 |
| 612 | 3300049688 | Ga0501259_000375 | Ga0501259_000375_2500_3573 | 357 |
| 613 | 3300049688 | Ga0501259_001723 | Ga0501259_001723_1165_2238 | 357 |
| 614 | 3300049689 | Ga0501260_001544 | Ga0501260_001544_398_1471 | 357 |
| 615 | 3300049704 | Ga0501221_000120 | Ga0501221_000120_139_1212 | 357 |
| 616 | 3300049705 | Ga0501225_0003232 | Ga0501225_0003232_3509_4582 | 357 |
| 617 | 3300049707 | Ga0501234_000621 | Ga0501234_000621_1557_2630 | 357 |
| 618 | 3300049708 | Ga0501245_000053 | Ga0501245_000053_6289_7362 | 357 |
| 619 | 3300049742 | Ga0501080_0049017 | Ga0501080_0049017_210_1283 | 357 |
| 620 | 3300049742 | Ga0501080_0093829 | Ga0501080_0093829_1641_2714 | 357 |
| 621 | 3300049742 | Ga0501080_0174212 | Ga0501080_0174212_815_1888 | 357 |
| 622 | 3300049744 | Ga0501083_0059245 | Ga0501083_0059245_985_2058 | 357 |
| 623 | 3300049761 | Ga0501264_002416 | Ga0501264_002416_430_1503 | 357 |
| 624 | 3300049765 | Ga0501268_001584 | Ga0501268_001584_1055_2128 | 357 |
| 625 | 3300049822 | Ga0501035_0082060 | Ga0501035_0082060_539_1612 | 357 |
| 626 | 3300049822 | Ga0501035_0215079 | Ga0501035_0215079_171_1244 | 357 |
| 627 | 3300049822 | Ga0501035_0219186 | Ga0501035_0219186_402_1475 | 357 |
| 628 | 3300049823 | Ga0501044_0009473 | Ga0501044_0009473_8848_9921 | 357 |
| 629 | 3300049823 | Ga0501044_0043392 | Ga0501044_0043392_469_1542 | 357 |
| 630 | 3300049823 | Ga0501044_0063526 | Ga0501044_0063526_2679_3752 | 357 |
| 631 | 3300049823 | Ga0501044_0092825 | Ga0501044_0092825_906_1979 | 357 |
| 632 | 3300049823 | Ga0501044_0097102 | Ga0501044_0097102_1452_2525 | 357 |
| 633 | 3300049824 | Ga0501045_0078786 | Ga0501045_0078786_935_2008 | 357 |
| 634 | 3300049851 | Ga0501212_002902 | Ga0501212_002902_429_1502 | 357 |
| 635 | 3300050493 | nmdc:mga0k408_24705_c1 | nmdc:mga0k408_24705_c1_493_1566 | 357 |
| 636 | 3300050507 | nmdc:mga05p37_24567_c2 | nmdc:mga05p37_24567_c2_613_1686 | 357 |
| 637 | 3300050508 | nmdc:mga09592_13139_c1 | nmdc:mga09592_13139_c1_1240_2313 | 357 |
| 638 | 3300050510 | nmdc:mga06r32_9580_c1 | nmdc:mga06r32_9580_c1_5531_6604 | 357 |
| 639 | 3300050511 | nmdc:mga08y16_76772_c1 | nmdc:mga08y16_76772_c1_578_1651 | 357 |
| 640 | 3300053108 | Ga0500562_000070 | Ga0500562_000070_42774_43850 | 357 |
| 641 | 3300053118 | Ga0500594_0007656 | Ga0500594_0007656_1233_2309 | 357 |
| 642 | 3300053139 | Ga0500568_0003989 | Ga0500568_0003989_2047_3129 | 357 |
| 643 | 3300053146 | Ga0500588_0004746 | Ga0500588_0004746_1441_2514 | 357 |
| 644 | 3300053151 | Ga0500604_0001556 | Ga0500604_0001556_868_1941 | 357 |
| 645 | 3300053156 | Ga0500622_0001947 | Ga0500622_0001947_13763_14845 | 357 |
| 646 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_87770_88852 | 357 |
| 647 | 3300060353 | Ga0501082_0059741 | Ga0501082_0059741_840_1913 | 357 |
| 648 | 3300061719 | Ga0466962_0003789 | Ga0466962_0003789_5884_6957 | 357 |
| 649 | 2162886007 | SwRhRL2b_contig_1886170 | SwRhRL2b_0728.00009280 | 358 |
| 650 | 3300001979 | JGI24740J21852_10000359 | JGI24740J21852_1000035912 | 358 |
| 651 | 3300002738 | JGI25154J39366_1000023 | JGI25154J39366_1000023122 | 358 |
| 652 | 3300003215 | JGI25153J46596_10017854 | JGI25153J46596_100178542 | 358 |
| 653 | 3300003215 | JGI25153J46596_10023624 | JGI25153J46596_100236241 | 358 |
| 654 | 3300003323 | rootH1_10042049 | rootH1_100420497 | 358 |
| 655 | 3300003354 | JGI25160J50197_1006556 | JGI25160J50197_10065565 | 358 |
| 656 | 3300003771 | Ga0055526_1019922 | Ga0055526_10199221 | 358 |
| 657 | 3300003790 | Ga0055528_1003039 | Ga0055528_10030397 | 358 |
| 658 | 3300003791 | Ga0055530_10000118 | Ga0055530_1000011852 | 358 |
| 659 | 3300003794 | Ga0055531_10000054 | Ga0055531_1000005451 | 358 |
| 660 | 3300003794 | Ga0055531_10031787 | Ga0055531_100317872 | 358 |
| 661 | 3300004625 | Ga0055543_1012077 | Ga0055543_10120772 | 358 |
| 662 | 3300005262 | Ga0065165_1000027 | Ga0065165_100002794 | 358 |
| 663 | 3300005289 | Ga0065704_10070159 | Ga0065704_10070159159 | 358 |
| 664 | 3300005289 | Ga0065704_10077260 | Ga0065704_100772603 | 358 |
| 665 | 3300005563 | Ga0068855_100004683 | Ga0068855_10000468314 | 358 |
| 666 | 3300009147 | Ga0114129_10037600 | Ga0114129_100376004 | 358 |
| 667 | 3300009545 | Ga0105237_10057800 | Ga0105237_100578005 | 358 |
| 668 | 3300025208 | Ga0209436_101411 | Ga0209436_1014112 | 358 |
| 669 | 3300025242 | Ga0209258_100302 | Ga0209258_10030232 | 358 |
| 670 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004476 | 358 |
| 671 | 3300025250 | Ga0209026_1000095 | Ga0209026_100009584 | 358 |
| 672 | 3300025254 | Ga0209148_1000131 | Ga0209148_100013149 | 358 |
| 673 | 3300025273 | Ga0209673_1000078 | Ga0209673_1000078194 | 358 |
| 674 | 3300025295 | Ga0209564_1003616 | Ga0209564_10036162 | 358 |
| 675 | 3300025297 | Ga0209758_1005348 | Ga0209758_100534813 | 358 |
| 676 | 3300025297 | Ga0209758_1005622 | Ga0209758_10056229 | 358 |
| 677 | 3300025297 | Ga0209758_1009342 | Ga0209758_10093424 | 358 |
| 678 | 3300025298 | Ga0209050_1000097 | Ga0209050_1000097208 | 358 |
| 679 | 3300025302 | Ga0207426_1000313 | Ga0207426_10003137 | 358 |
| 680 | 3300025302 | Ga0207426_1000541 | Ga0207426_100054114 | 358 |
| 681 | 3300025302 | Ga0207426_1010348 | Ga0207426_10103482 | 358 |
| 682 | 3300025302 | Ga0207426_1015383 | Ga0207426_10153832 | 358 |
| 683 | 3300025304 | Ga0209257_1000070 | Ga0209257_100007057 | 358 |
| 684 | 3300025304 | Ga0209257_1004414 | Ga0209257_100441416 | 358 |
| 685 | 3300025904 | Ga0207647_10013211 | Ga0207647_100132115 | 358 |
| 686 | 3300025913 | Ga0207695_10006435 | Ga0207695_100064353 | 358 |
| 687 | 3300025914 | Ga0207671_10000102 | Ga0207671_1000010220 | 358 |
| 688 | 3300025949 | Ga0207667_10004715 | Ga0207667_100047155 | 358 |
| 689 | 3300026116 | Ga0207674_10139245 | Ga0207674_101392452 | 358 |
| 690 | 3300028379 | Ga0268266_10003786 | Ga0268266_1000378615 | 358 |
| 691 | 3300031507 | Ga0307509_10121615 | Ga0307509_101216152 | 358 |
| 692 | 3300041404 | Ga0439436_0005908 | Ga0439436_0005908_2305_3399 | 358 |
| 693 | 3300042007 | Ga0439449_0021694 | Ga0439449_0021694_723_1817 | 358 |
| 694 | 3300042014 | Ga0439457_001270 | Ga0439457_001270_127_1221 | 358 |
| 695 | 3300042015 | Ga0439462_0003887 | Ga0439462_0003887_60_1154 | 358 |
| 696 | 3300044656 | Ga0466969_0002500 | Ga0466969_0002500_3688_4782 | 358 |
| 697 | 3300044658 | Ga0466972_0000044 | Ga0466972_0000044_66607_67701 | 358 |
| 698 | 3300044658 | Ga0466972_0100299 | Ga0466972_0100299_164_1258 | 358 |
| 699 | 3300044684 | Ga0466966_0002591 | Ga0466966_0002591_3110_4204 | 358 |
| 700 | 3300044693 | Ga0466961_0032307 | Ga0466961_0032307_2014_3108 | 358 |
| 701 | 3300044735 | Ga0466968_0008477 | Ga0466968_0008477_700_1791 | 358 |
| 702 | 3300044765 | Ga0466970_0004594 | Ga0466970_0004594_700_1791 | 358 |
| 703 | 3300044842 | Ga0466957_0014978 | Ga0466957_0014978_1121_2215 | 358 |
| 704 | 3300044901 | Ga0466960_0022501 | Ga0466960_0022501_390_1484 | 358 |
| 705 | 3300045049 | Ga0466959_0000045 | Ga0466959_0000045_5317_6411 | 358 |
| 706 | 3300046453 | Ga0495627_006679 | Ga0495627_006679_3018_4094 | 358 |
| 707 | 3300046558 | Ga0495633_0000125 | Ga0495633_0000125_88253_89329 | 358 |
| 708 | 3300047318 | Ga0495636_0000026 | Ga0495636_0000026_6674_7786 | 358 |
| 709 | 3300047320 | Ga0495672_0036643 | Ga0495672_0036643_403_1494 | 358 |
| 710 | 3300048924 | Ga0496121_0000081 | Ga0496121_0000081_42165_43241 | 358 |
| 711 | 3300048929 | Ga0496126_0012204 | Ga0496126_0012204_2798_3874 | 358 |
| 712 | 3300049571 | Ga0501034_0153559 | Ga0501034_0153559_332_1408 | 358 |
| 713 | 3300049581 | Ga0501047_0078887 | Ga0501047_0078887_2022_3116 | 358 |
| 714 | 3300049705 | Ga0501225_0003564 | Ga0501225_0003564_1997_3091 | 358 |
| 715 | 3300049758 | Ga0501241_002043 | Ga0501241_002043_1902_2978 | 358 |
| 716 | 3300049758 | Ga0501241_012824 | Ga0501241_012824_227_1303 | 358 |
| 717 | 3300049823 | Ga0501044_0004638 | Ga0501044_0004638_120_1214 | 358 |
| 718 | 3300050507 | nmdc:mga05p37_58974_c1 | nmdc:mga05p37_58974_c1_759_1853 | 358 |
| 719 | 3300053086 | Ga0500578_0000026 | Ga0500578_0000026_108085_109179 | 358 |
| 720 | 3300053088 | Ga0500644_0000026 | Ga0500644_0000026_36697_37773 | 358 |
| 721 | 3300053092 | Ga0500583_0000001 | Ga0500583_0000001_143866_144960 | 358 |
| 722 | 3300053092 | Ga0500583_0004221 | Ga0500583_0004221_3479_4555 | 358 |
| 723 | 3300053092 | Ga0500583_0017888 | Ga0500583_0017888_131_1225 | 358 |
| 724 | 3300053093 | Ga0500651_0001573 | Ga0500651_0001573_505_1581 | 358 |
| 725 | 3300053103 | Ga0500555_013807 | Ga0500555_013807_953_2047 | 358 |
| 726 | 3300053109 | Ga0500569_000432 | Ga0500569_000432_4692_5768 | 358 |
| 727 | 3300053131 | Ga0500652_005247 | Ga0500652_005247_2764_3840 | 358 |
| 728 | 3300053134 | Ga0500658_0002669 | Ga0500658_0002669_362_1438 | 358 |
| 729 | 3300053136 | Ga0500559_0010116 | Ga0500559_0010116_2255_3331 | 358 |
| 730 | 3300053142 | Ga0500577_0002713 | Ga0500577_0002713_719_1795 | 358 |
| 731 | 3300053147 | Ga0500589_018253 | Ga0500589_018253_612_1706 | 358 |
| 732 | 3300053148 | Ga0500590_089851 | Ga0500590_089851_320_1396 | 358 |
| 733 | 3300053153 | Ga0500616_0047309 | Ga0500616_0047309_874_1950 | 358 |
| 734 | 3300053156 | Ga0500622_0014304 | Ga0500622_0014304_312_1406 | 358 |
| 735 | 3300053160 | Ga0500633_0000253 | Ga0500633_0000253_846_1922 | 358 |
| 736 | 3300053177 | Ga0500636_0012621 | Ga0500636_0012621_2896_3972 | 358 |
| 737 | 3300053727 | Ga0500611_009641 | Ga0500611_009641_399_1493 | 358 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k8c-assembly1.cif.gz_A-2 | x-ray structure of kdnb, 3-deoxy-alpha-d-manno-octulosonate 8-oxidase, from shewanella oneidensis | 0.9563 | 1 | 358 |
| 3rf7-assembly1.cif.gz_A-2 | crystal structure of an iron-containing alcohol dehydrogenase (sden_2133) from shewanella denitrificans os-217 at 2.12 a resolution | 0.9449 | 1 | 358 |
| 3rf7-assembly1.cif.gz_A-2 | crystal structure of an iron-containing alcohol dehydrogenase (sden_2133) from shewanella denitrificans os-217 at 2.12 a resolution | 0.9373 | 1 | 358 |
| 3owo-assembly2.cif.gz_D | structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor | 0.8571 | 5 | 355 |
| 3owo-assembly2.cif.gz_D | structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor | 0.8393 | 5 | 355 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5k8cA02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9759 | 184 | 358 | 1.20.1090.10 |
| 5k8cA02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9703 | 184 | 358 | 1.20.1090.10 |
| 3rf7A02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9501 | 184 | 358 | 1.20.1090.10 |
| 3rf7A02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.9445 | 184 | 358 | 1.20.1090.10 |
| 3rf7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9232 | 2 | 183 | 3.40.50.1970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M3GDM2-F1-model_v4 | Alcohol dehydrogenase iron-type/glycerol dehydrogenase GldA domain-containing protein | 0.9763 | 243 | 358 |
GO:0016491
GO:0046872 |
| AF-A0A4Q6BAJ9-F1-model_v4 | Iron-containing alcohol dehydrogenase | 0.9665 | 8 | 315 |
GO:0004022
GO:0046872 |
| AF-A0A4Q6BAJ9-F1-model_v4 | Iron-containing alcohol dehydrogenase | 0.9634 | 8 | 315 |
GO:0004022
GO:0046872 |
| AF-A0A7W6ERF9-F1-model_v4 | 3-deoxy-alpha-D-manno-octulosonate 8-oxidase (EC 1.1.3.48) | 0.9548 | 4 | 358 |
GO:0004022
GO:0046872 |
| AF-M3GDM2-F1-model_v4 | Alcohol dehydrogenase iron-type/glycerol dehydrogenase GldA domain-containing protein | 0.9521 | 243 | 358 |
GO:0016491
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar