F478318

General Info

Members Datasets Scaffolds Average Seq Length
737 314 728 358

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100112407|Ga0070665_1001124071
Length 411
Sequence LLGTKEPGTGRKQDQTKDSVPHIQPSSSSYNFFLTLPSQLVKWVVKALSLFLRNMKFRNFKMVGYVVYGRGSFNQLDEIIEPHRKADDPMIFLVDYFFEKKPLINRIPLRGHDKIVFADVTYEPKTTLVDKLAQQLKDEFGRVSGIIGIGGGSTMDLAKAVSLMMNNPGSSADYQGWDLVKFPGVYKVGIPTLSGTGAEVSRTCVLTGPTKKLGMNSDFTPFDQIVLDPELTTNAPVNQRFYTGMDCYIHCIESLNGTYLNEFSKSYGEKALQLCRKVFVEKKQWDDESDDQLMMASYAGGMSIAYSQVGVAHAVSYGLSYLLGTKHGIGNCIVFDKLEEYYPEGVREFKYMVEKNKIDIPQNITKGLSDEQFDTMINVSMGMKPLWENALGKDWEKVMTREKLRKLFNSL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
5 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
194 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
202 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
263 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
266 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
267 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
268 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
269 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
270 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
271 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
272 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
273 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
274 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
278 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
279 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
284 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
298 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
299 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
304 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
305 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
306 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
307 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0
Rhizoplane 0.81
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1886170 2162886007 Bacteria 206362
2 JGI24740J21852_10000359 3300001979 Bacteria 19514
3 JGI24740J21852_10004944 3300001979 Bacteria 5668
4 JGI24751J29686_10002525 3300002459 Bacteria 3685
5 JGI25154J39366_1000023 3300002738 Bacteria 219569
6 JGI25153J46596_10017854 3300003215 Bacteria 2777
7 JGI25153J46596_10023624 3300003215 Bacteria 2236
8 rootH1_10132364 3300003316 Bacteria 4196
9 rootH2_10003346 3300003320 Bacteria 29041
10 rootH2_10088824 3300003320 Bacteria 4549
11 rootH2_10128231 3300003320 Bacteria 7245
12 rootL2_10200643 3300003322 Bacteria 3184
13 rootH1_10042049 3300003323 Bacteria 15171
14 rootH1_10114166 3300003323 Bacteria 4087
15 JGI25160J50197_1000375 3300003354 Bacteria 29260
16 JGI25160J50197_1006556 3300003354 Bacteria 4693
17 Ga0055526_1019922 3300003771 Bacteria 2417
18 Ga0055528_1003039 3300003790 Bacteria 8643
19 Ga0055530_10000118 3300003791 Bacteria 68596
20 Ga0055531_10000054 3300003794 Bacteria 123684
21 Ga0055531_10031787 3300003794 Bacteria 1739
22 Ga0055543_1012077 3300004625 Bacteria 1748
23 Ga0065165_1000027 3300005262 Bacteria 228507
24 Ga0065714_10083974 3300005288 Bacteria 2222
25 Ga0065704_10070159 3300005289 Bacteria 207348
26 Ga0065704_10077260 3300005289 Bacteria 4798
27 Ga0070658_10032464 3300005327 Bacteria 4197
28 Ga0070676_10000167 3300005328 Bacteria 26643
29 Ga0070683_100018391 3300005329 Bacteria 6189
30 Ga0070683_100034680 3300005329 Bacteria 4611
31 Ga0070683_100054475 3300005329 Bacteria 3708
32 Ga0070690_100010364 3300005330 Bacteria 5423
33 Ga0070690_100041885 3300005330 Unclassified 2900
34 Ga0070670_100038146 3300005331 Bacteria 4131
35 Ga0070670_100038347 3300005331 Bacteria 4120
36 Ga0070670_100049111 3300005331 Bacteria 3629
37 Ga0070670_100123093 3300005331 Unclassified 2238
38 Ga0070670_100277949 3300005331 Bacteria 1462
39 Ga0068869_100036022 3300005334 Unclassified 3512
40 Ga0068869_100046132 3300005334 Unclassified 3141
41 Ga0068869_100095335 3300005334 Unclassified 2245
42 Ga0068869_100133282 3300005334 Unclassified 1912
43 Ga0068869_100236831 3300005334 Bacteria 1453
44 Ga0070666_10000030 3300005335 Bacteria 137543
45 Ga0070666_10000512 3300005335 Bacteria 23407
46 Ga0070666_10083175 3300005335 Bacteria 2189
47 Ga0070680_100023108 3300005336 Bacteria 4956
48 Ga0070682_100000012 3300005337 Bacteria 265658
49 Ga0070682_100004319 3300005337 Bacteria 7892
50 Ga0070682_100007939 3300005337 Bacteria 5971
51 Ga0070682_100295233 3300005337 Bacteria 1187
52 Ga0068868_100004051 3300005338 Bacteria 10214
53 Ga0068868_100005213 3300005338 Bacteria 9122
54 Ga0068868_100010790 3300005338 Bacteria 6626
55 Ga0068868_100142518 3300005338 Bacteria 1968
56 Ga0068868_100332150 3300005338 Bacteria 1298
57 Ga0070660_100063106 3300005339 Bacteria 2880
58 Ga0070660_100401809 3300005339 Unclassified 1133
59 Ga0070661_100015588 3300005344 Bacteria 5364
60 Ga0070661_100136899 3300005344 Bacteria 1843
61 Ga0070661_100216540 3300005344 Bacteria 1467
62 Ga0070668_100032723 3300005347 Bacteria 3956
63 Ga0070669_100096255 3300005353 Bacteria 2227
64 Ga0070675_100067860 3300005354 Bacteria 2952
65 Ga0070675_100102206 3300005354 Bacteria 2415
66 Ga0070671_100025809 3300005355 Bacteria 4824
67 Ga0070671_100032138 3300005355 Bacteria 4340
68 Ga0070671_100127806 3300005355 Unclassified 2140
69 Ga0070671_100262268 3300005355 Bacteria 1468
70 Ga0070674_100009484 3300005356 Bacteria 5827
71 Ga0070674_100136108 3300005356 Unclassified 1837
72 Ga0070674_100184860 3300005356 Unclassified 1599
73 Ga0070673_100003256 3300005364 Bacteria 10073
74 Ga0070673_100033458 3300005364 Unclassified 3882
75 Ga0070673_100116177 3300005364 Unclassified 2226
76 Ga0070673_100240982 3300005364 Bacteria 1572
77 Ga0070688_100006998 3300005365 Bacteria 6062
78 Ga0070688_100033042 3300005365 Bacteria 3125
79 Ga0070659_100012764 3300005366 Bacteria 6237
80 Ga0070659_100078396 3300005366 Bacteria 2635
81 Ga0070659_100086851 3300005366 Bacteria 2504
82 Ga0070667_100029965 3300005367 Bacteria 4538
83 Ga0070700_100070715 3300005441 Unclassified 2226
84 Ga0070663_100116211 3300005455 Bacteria 2016
85 Ga0070678_100021913 3300005456 Unclassified 4223
86 Ga0070662_100021196 3300005457 Bacteria 4435
87 Ga0070662_100022881 3300005457 Bacteria 4286
88 Ga0070662_100046357 3300005457 Bacteria 3123
89 Ga0070681_10013527 3300005458 Bacteria 8114
90 Ga0070681_10099291 3300005458 Bacteria 2857
91 Ga0068867_100021839 3300005459 Bacteria 4570
92 Ga0068867_100085236 3300005459 Bacteria 2388
93 Ga0068867_100156571 3300005459 Unclassified 1794
94 Ga0068867_100237520 3300005459 Bacteria 1476
95 Ga0070685_10014160 3300005466 Bacteria 4219
96 Ga0070685_10025057 3300005466 Bacteria 3283
97 Ga0070679_100028777 3300005530 Bacteria 5480
98 Ga0070679_100039559 3300005530 Bacteria 4686
99 Ga0070679_100099324 3300005530 Bacteria 2898
100 Ga0070684_100012657 3300005535 Bacteria 6767
101 Ga0070684_100013984 3300005535 Bacteria 6488
102 Ga0070684_100068101 3300005535 Bacteria 3128
103 Ga0068853_100000773 3300005539 Bacteria 22203
104 Ga0068853_100008684 3300005539 Bacteria 8172
105 Ga0068853_100010271 3300005539 Bacteria 7572
106 Ga0068853_100019862 3300005539 Bacteria 5581
107 Ga0068853_100040412 3300005539 Bacteria 3979
108 Ga0068853_100061769 3300005539 Bacteria 3241
109 Ga0068853_100069992 3300005539 Bacteria 3053
110 Ga0068853_100214130 3300005539 Bacteria 1757
111 Ga0070672_100000310 3300005543 Bacteria 27579
112 Ga0070672_100028044 3300005543 Unclassified 4207
113 Ga0070672_100028517 3300005543 Unclassified 4177
114 Ga0070672_100051522 3300005543 Unclassified 3211
115 Ga0070686_100189809 3300005544 Bacteria 1466
116 Ga0070693_100010763 3300005547 Bacteria 4589
117 Ga0070665_100000047 3300005548 Bacteria 269702
118 Ga0070665_100007830 3300005548 Bacteria 10838
119 Ga0070665_100112407 3300005548 Bacteria 2726
120 Ga0068855_100000081 3300005563 Bacteria 115707
121 Ga0068855_100004683 3300005563 Bacteria 16718
122 Ga0068855_100018949 3300005563 Bacteria 8273
123 Ga0068855_100030104 3300005563 Bacteria 6492
124 Ga0068855_100043093 3300005563 Bacteria 5347
125 Ga0068855_100385955 3300005563 Bacteria 1537
126 Ga0070664_100002738 3300005564 Bacteria 14221
127 Ga0070664_100008778 3300005564 Bacteria 8186
128 Ga0070664_100008826 3300005564 Bacteria 8168
129 Ga0070664_100129710 3300005564 Bacteria 2214
130 Ga0070664_100164639 3300005564 Unclassified 1964
131 Ga0068857_100003167 3300005577 Bacteria 13643
132 Ga0068857_100011324 3300005577 Bacteria 7759
133 Ga0068857_100026193 3300005577 Bacteria 5138
134 Ga0068857_100037069 3300005577 Bacteria 4318
135 Ga0068857_100155672 3300005577 Bacteria 2072
136 Ga0068854_100105255 3300005578 Unclassified 2121
137 Ga0068856_100007849 3300005614 Bacteria 10422
138 Ga0068856_100011188 3300005614 Bacteria 8709
139 Ga0068856_100050886 3300005614 Bacteria 4085
140 Ga0068856_100275438 3300005614 Bacteria 1699
141 Ga0068856_100329230 3300005614 Bacteria 1545
142 Ga0070702_100084942 3300005615 Unclassified 1905
143 Ga0068852_100001636 3300005616 Bacteria 15296
144 Ga0068852_100002835 3300005616 Bacteria 12020
145 Ga0068852_100012225 3300005616 Bacteria 6508
146 Ga0068852_100053908 3300005616 Bacteria 3464
147 Ga0068852_100071802 3300005616 Bacteria 3041
148 Ga0068852_100074402 3300005616 Bacteria 2992
149 Ga0068852_100079150 3300005616 Unclassified 2911
150 Ga0068852_100299596 3300005616 Bacteria 1556
151 Ga0068859_100000003 3300005617 Bacteria 479218
152 Ga0068859_100000461 3300005617 Bacteria 40272
153 Ga0068859_100034447 3300005617 Bacteria 5082
154 Ga0068859_100040903 3300005617 Bacteria 4656
155 Ga0068859_100119465 3300005617 Unclassified 2702
156 Ga0068864_100001741 3300005618 Bacteria 17886
157 Ga0068864_100005856 3300005618 Bacteria 10073
158 Ga0068864_100063881 3300005618 Bacteria 3191
159 Ga0068861_100003203 3300005719 Bacteria 10829
160 Ga0068861_100043733 3300005719 Bacteria 3364
161 Ga0068851_10002509 3300005834 Bacteria 8069
162 Ga0068851_10004484 3300005834 Bacteria 6300
163 Ga0068851_10010113 3300005834 Bacteria 4396
164 Ga0068870_10022268 3300005840 Unclassified 3112
165 Ga0068870_10101189 3300005840 Bacteria 1629
166 Ga0068863_100002398 3300005841 Bacteria 18634
167 Ga0068863_100119217 3300005841 Bacteria 2515
168 Ga0068863_100307456 3300005841 Bacteria 1538
169 Ga0068858_100007027 3300005842 Bacteria 10938
170 Ga0068858_100036435 3300005842 Bacteria 4561
171 Ga0068858_100041442 3300005842 Bacteria 4268
172 Ga0068860_100000024 3300005843 Bacteria 271902
173 Ga0068860_100002247 3300005843 Bacteria 20332
174 Ga0068860_100003895 3300005843 Bacteria 15334
175 Ga0068860_100010764 3300005843 Bacteria 9028
176 Ga0068860_100041220 3300005843 Bacteria 4410
177 Ga0081540_1017589 3300005983 Bacteria 4418
178 Ga0081539_10000604 3300005985 Bacteria 73040
179 Ga0081539_10013564 3300005985 Bacteria 6129
180 Ga0075366_10164700 3300006195 Bacteria 1344
181 Ga0097621_100000352 3300006237 Bacteria 31757
182 Ga0097621_100007236 3300006237 Bacteria 7923
183 Ga0097621_100018563 3300006237 Bacteria 5316
184 Ga0097621_100042232 3300006237 Bacteria 3672
185 Ga0097621_100149100 3300006237 Bacteria 2005
186 Ga0097621_100354913 3300006237 Bacteria 1305
187 Ga0068871_100001720 3300006358 Bacteria 14724
188 Ga0068871_100003843 3300006358 Bacteria 10352
189 Ga0068871_100011203 3300006358 Bacteria 6571
190 Ga0068871_100040832 3300006358 Bacteria 3717
191 Ga0068871_100043801 3300006358 Bacteria 3596
192 Ga0068871_100045786 3300006358 Bacteria 3522
193 Ga0068871_100118440 3300006358 Bacteria 2234
194 Ga0075431_100009229 3300006847 Bacteria 9899
195 Ga0075434_100205454 3300006871 Bacteria 1990
196 Ga0075429_100004600 3300006880 Bacteria 11863
197 Ga0068865_100104292 3300006881 Bacteria 2081
198 Ga0068865_100198911 3300006881 Bacteria 1555
199 Ga0097620_100000003 3300006931 Bacteria 479218
200 Ga0097620_100000461 3300006931 Bacteria 40272
201 Ga0097620_100034448 3300006931 Bacteria 5082
202 Ga0097620_100040903 3300006931 Bacteria 4656
203 Ga0097620_100119477 3300006931 Unclassified 2702
204 Ga0105240_10000445 3300009093 Bacteria 76036
205 Ga0105240_10000597 3300009093 Bacteria 67036
206 Ga0105240_10003084 3300009093 Bacteria 26189
207 Ga0105240_10003774 3300009093 Bacteria 23401
208 Ga0105240_10008651 3300009093 Bacteria 14544
209 Ga0105240_10064971 3300009093 Bacteria 4531
210 Ga0105240_10073572 3300009093 Bacteria 4219
211 Ga0105240_10214817 3300009093 Bacteria 2245
212 Ga0111539_10024898 3300009094 Bacteria 7337
213 Ga0111539_10132349 3300009094 Unclassified 2920
214 Ga0105247_10000331 3300009101 Bacteria 41671
215 Ga0105247_10027687 3300009101 Bacteria 3427
216 Ga0105247_10079899 3300009101 Bacteria 2059
217 Ga0114129_10021302 3300009147 Bacteria 9203
218 Ga0114129_10037600 3300009147 Bacteria 6834
219 Ga0105241_10000180 3300009174 Bacteria 47089
220 Ga0105241_10000564 3300009174 Bacteria 27971
221 Ga0105241_10004810 3300009174 Bacteria 9949
222 Ga0105241_10180324 3300009174 Bacteria 1751
223 Ga0105241_10190581 3300009174 Bacteria 1706
224 Ga0105241_10209427 3300009174 Bacteria 1633
225 Ga0105241_10354331 3300009174 Bacteria 1275
226 Ga0105242_10025384 3300009176 Bacteria 4690
227 Ga0105242_10146321 3300009176 Unclassified 2056
228 Ga0105242_10213857 3300009176 Bacteria 1719
229 Ga0105248_10053027 3300009177 Bacteria 4551
230 Ga0105237_10000294 3300009545 Bacteria 69126
231 Ga0105237_10000759 3300009545 Bacteria 44278
232 Ga0105237_10009804 3300009545 Bacteria 10240
233 Ga0105237_10010515 3300009545 Bacteria 9832
234 Ga0105237_10015867 3300009545 Bacteria 7832
235 Ga0105237_10057800 3300009545 Unclassified 3881
236 Ga0105238_10001087 3300009551 Bacteria 27427
237 Ga0105238_10075882 3300009551 Bacteria 3353
238 Ga0105238_10154523 3300009551 Unclassified 2269
239 Ga0105238_10320965 3300009551 Bacteria 1535
240 Ga0105249_10003321 3300009553 Bacteria 13936
241 Ga0105249_10016126 3300009553 Bacteria 6624
242 Ga0105249_10022846 3300009553 Bacteria 5606
243 Ga0105249_10031545 3300009553 Bacteria 4792
244 Ga0105249_10045937 3300009553 Bacteria 3974
245 Ga0105249_10177950 3300009553 Bacteria 2067
246 Ga0105249_10234009 3300009553 Unclassified 1813
247 Ga0105239_10000628 3300010375 Bacteria 50293
248 Ga0105239_10005401 3300010375 Bacteria 14995
249 Ga0105239_10011209 3300010375 Bacteria 10003
250 Ga0105239_10012135 3300010375 Bacteria 9608
251 Ga0105239_10035013 3300010375 Bacteria 5514
252 Ga0105239_10073535 3300010375 Unclassified 3758
253 Ga0105239_10128347 3300010375 Bacteria 2819
254 Ga0105239_10206355 3300010375 Bacteria 2202
255 Ga0105239_10311144 3300010375 Bacteria 1775
256 Ga0105239_10478215 3300010375 Bacteria 1415
257 Ga0105246_10008264 3300011119 Bacteria 6392
258 Ga0105246_10023545 3300011119 Bacteria 3986
259 Ga0105246_10061609 3300011119 Unclassified 2611
260 Ga0105246_10139180 3300011119 Bacteria 1823
261 Ga0157373_10004289 3300013100 Bacteria 10733
262 Ga0157371_10021112 3300013102 Bacteria 4786
263 Ga0157370_10006558 3300013104 Bacteria 12819
264 Ga0157370_10043563 3300013104 Bacteria 4317
265 Ga0157370_10053535 3300013104 Bacteria 3848
266 Ga0157369_10005892 3300013105 Bacteria 14242
267 Ga0157369_10029853 3300013105 Bacteria 6021
268 Ga0157369_10031421 3300013105 Bacteria 5847
269 Ga0157374_10000027 3300013296 Bacteria 233444
270 Ga0157374_10009273 3300013296 Bacteria 8438
271 Ga0157374_10015811 3300013296 Bacteria 6629
272 Ga0157374_10032340 3300013296 Bacteria 4762
273 Ga0157374_10102497 3300013296 Bacteria 2745
274 Ga0157374_10312682 3300013296 Unclassified 1556
275 Ga0157378_10003338 3300013297 Bacteria 14277
276 Ga0157378_10014172 3300013297 Bacteria 6976
277 Ga0157378_10014613 3300013297 Bacteria 6872
278 Ga0157378_10016465 3300013297 Bacteria 6476
279 Ga0157378_10016865 3300013297 Bacteria 6403
280 Ga0157378_10045180 3300013297 Unclassified 3913
281 Ga0157378_10168388 3300013297 Bacteria 2053
282 Ga0163162_10000237 3300013306 Bacteria 50279
283 Ga0163162_10000725 3300013306 Bacteria 30582
284 Ga0163162_10001535 3300013306 Bacteria 21544
285 Ga0163162_10001913 3300013306 Bacteria 19626
286 Ga0163162_10002195 3300013306 Bacteria 18320
287 Ga0163162_10017145 3300013306 Bacteria 7086
288 Ga0163162_10027786 3300013306 Bacteria 5596
289 Ga0163162_10036142 3300013306 Bacteria 4922
290 Ga0163162_10048111 3300013306 Bacteria 4272
291 Ga0163162_10112259 3300013306 Unclassified 2824
292 Ga0163162_10193704 3300013306 Unclassified 2161
293 Ga0163162_10212763 3300013306 Bacteria 2063
294 Ga0157372_10006497 3300013307 Bacteria 12443
295 Ga0157372_10017166 3300013307 Bacteria 7770
296 Ga0157372_10030119 3300013307 Bacteria 5933
297 Ga0157372_10053396 3300013307 Bacteria 4504
298 Ga0157372_10173331 3300013307 Bacteria 2496
299 Ga0157372_10238904 3300013307 Bacteria 2108
300 Ga0157372_10542483 3300013307 Bacteria 1356
301 Ga0157375_10000599 3300013308 Bacteria 31988
302 Ga0157375_10026885 3300013308 Bacteria 5370
303 Ga0157375_10032650 3300013308 Bacteria 4938
304 Ga0157375_10116670 3300013308 Unclassified 2774
305 Ga0157375_10360166 3300013308 Unclassified 1620
306 Ga0163163_10000703 3300014325 Bacteria 28430
307 Ga0163163_10001644 3300014325 Bacteria 18813
308 Ga0163163_10209635 3300014325 Bacteria 1997
309 Ga0163163_10398443 3300014325 Bacteria 1434
310 Ga0157380_10001186 3300014326 Bacteria 16856
311 Ga0157380_10036672 3300014326 Bacteria 3795
312 Ga0157380_10182822 3300014326 Bacteria 1843
313 Ga0157377_10010551 3300014745 Bacteria 4573
314 Ga0157377_10012029 3300014745 Bacteria 4340
315 Ga0157377_10014014 3300014745 Unclassified 4072
316 Ga0157379_10000810 3300014968 Bacteria 25369
317 Ga0157379_10002064 3300014968 Bacteria 16687
318 Ga0157379_10035463 3300014968 Bacteria 4447
319 Ga0157379_10072029 3300014968 Bacteria 3091
320 Ga0157376_10000971 3300014969 Bacteria 18693
321 Ga0157376_10008235 3300014969 Bacteria 7508
322 Ga0157376_10050156 3300014969 Bacteria 3461
323 Ga0157376_10077233 3300014969 Bacteria 2848
324 Ga0157376_10093591 3300014969 Bacteria 2609
325 Ga0182005_1000043 3300015265 Bacteria 140285
326 Ga0163161_10020322 3300017792 Bacteria 4659
327 Ga0213876_10003420 3300021384 Bacteria 9081
328 Ga0209436_101411 3300025208 Bacteria 8449
329 Ga0209258_100302 3300025242 Bacteria 79794
330 Ga0209646_1000004 3300025246 Bacteria 786587
331 Ga0209026_1000095 3300025250 Bacteria 164309
332 Ga0209148_1000131 3300025254 Bacteria 174079
333 Ga0209673_1000078 3300025273 Bacteria 227727
334 Ga0209564_1003616 3300025295 Bacteria 10288
335 Ga0209758_1005348 3300025297 Bacteria 9961
336 Ga0209758_1005622 3300025297 Bacteria 9519
337 Ga0209758_1009342 3300025297 Bacteria 6116
338 Ga0209050_1000097 3300025298 Bacteria 239919
339 Ga0207426_1000026 3300025302 Bacteria 515228
340 Ga0207426_1000313 3300025302 Bacteria 94934
341 Ga0207426_1000541 3300025302 Bacteria 54110
342 Ga0207426_1010348 3300025302 Bacteria 3624
343 Ga0207426_1015383 3300025302 Bacteria 2775
344 Ga0209257_1000070 3300025304 Bacteria 336454
345 Ga0209257_1004414 3300025304 Bacteria 10921
346 Ga0207656_10001907 3300025321 Bacteria 6939
347 Ga0207656_10002373 3300025321 Bacteria 6324
348 Ga0207656_10002476 3300025321 Bacteria 6233
349 Ga0207656_10016219 3300025321 Bacteria 2898
350 Ga0207682_10017202 3300025893 Unclassified 2823
351 Ga0207710_10006407 3300025900 Bacteria 5027
352 Ga0207710_10018603 3300025900 Unclassified 2956
353 Ga0207688_10007222 3300025901 Bacteria 6043
354 Ga0207680_10000014 3300025903 Bacteria 179035
355 Ga0207680_10015219 3300025903 Bacteria 4010
356 Ga0207680_10015294 3300025903 Unclassified 4002
357 Ga0207647_10013211 3300025904 Bacteria 5732
358 Ga0207647_10019688 3300025904 Bacteria 4536
359 Ga0207647_10023965 3300025904 Bacteria 4030
360 Ga0207647_10027412 3300025904 Bacteria 3713
361 Ga0207647_10103079 3300025904 Unclassified 1692
362 Ga0207647_10152421 3300025904 Bacteria 1350
363 Ga0207685_10069962 3300025905 Bacteria 1419
364 Ga0207645_10003328 3300025907 Bacteria 12257
365 Ga0207645_10013811 3300025907 Bacteria 5421
366 Ga0207645_10018115 3300025907 Unclassified 4642
367 Ga0207645_10022808 3300025907 Unclassified 4069
368 Ga0207645_10064304 3300025907 Bacteria 2344
369 Ga0207645_10105238 3300025907 Bacteria 1823
370 Ga0207654_10002114 3300025911 Bacteria 10173
371 Ga0207654_10002774 3300025911 Bacteria 8895
372 Ga0207654_10005683 3300025911 Bacteria 6306
373 Ga0207654_10128839 3300025911 Bacteria 1599
374 Ga0207707_10004563 3300025912 Bacteria 12175
375 Ga0207707_10033910 3300025912 Bacteria 4467
376 Ga0207695_10000087 3300025913 Bacteria 276412
377 Ga0207695_10000299 3300025913 Bacteria 122118
378 Ga0207695_10000676 3300025913 Bacteria 67018
379 Ga0207695_10001116 3300025913 Bacteria 46659
380 Ga0207695_10006435 3300025913 Bacteria 15251
381 Ga0207695_10024733 3300025913 Bacteria 6744
382 Ga0207695_10028549 3300025913 Bacteria 6184
383 Ga0207695_10078511 3300025913 Bacteria 3349
384 Ga0207695_10125083 3300025913 Bacteria 2535
385 Ga0207671_10000102 3300025914 Bacteria 130461
386 Ga0207671_10000533 3300025914 Bacteria 51330
387 Ga0207671_10001227 3300025914 Bacteria 30346
388 Ga0207671_10001705 3300025914 Bacteria 24839
389 Ga0207671_10001854 3300025914 Bacteria 23604
390 Ga0207671_10021513 3300025914 Bacteria 4890
391 Ga0207660_10013410 3300025917 Bacteria 5371
392 Ga0207657_10003151 3300025919 Bacteria 17638
393 Ga0207657_10308641 3300025919 Bacteria 1252
394 Ga0207649_10011087 3300025920 Unclassified 4961
395 Ga0207652_10013744 3300025921 Bacteria 6547
396 Ga0207652_10031060 3300025921 Bacteria 4482
397 Ga0207681_10174981 3300025923 Unclassified 1630
398 Ga0207694_10003724 3300025924 Bacteria 12077
399 Ga0207694_10122734 3300025924 Bacteria 2075
400 Ga0207650_10097012 3300025925 Bacteria 2262
401 Ga0207650_10301644 3300025925 Bacteria 1308
402 Ga0207659_10032289 3300025926 Bacteria 3592
403 Ga0207644_10025539 3300025931 Bacteria 4062
404 Ga0207644_10182360 3300025931 Bacteria 1646
405 Ga0207644_10197128 3300025931 Unclassified 1586
406 Ga0207690_10003794 3300025932 Bacteria 8945
407 Ga0207706_10004657 3300025933 Bacteria 12852
408 Ga0207706_10015622 3300025933 Bacteria 6861
409 Ga0207706_10017842 3300025933 Bacteria 6391
410 Ga0207706_10085409 3300025933 Bacteria 2775
411 Ga0207686_10034702 3300025934 Bacteria 3021
412 Ga0207686_10070230 3300025934 Unclassified 2249
413 Ga0207670_10013966 3300025936 Bacteria 4754
414 Ga0207670_10190783 3300025936 Unclassified 1551
415 Ga0207669_10006970 3300025937 Bacteria 5198
416 Ga0207669_10091876 3300025937 Bacteria 1978
417 Ga0207691_10000234 3300025940 Bacteria 54055
418 Ga0207691_10015317 3300025940 Bacteria 7293
419 Ga0207691_10031372 3300025940 Bacteria 4960
420 Ga0207691_10105683 3300025940 Bacteria 2508
421 Ga0207689_10000664 3300025942 Bacteria 32785
422 Ga0207689_10002814 3300025942 Bacteria 16076
423 Ga0207689_10003172 3300025942 Bacteria 15082
424 Ga0207689_10003467 3300025942 Bacteria 14413
425 Ga0207689_10012563 3300025942 Bacteria 7234
426 Ga0207689_10040117 3300025942 Unclassified 3876
427 Ga0207689_10103943 3300025942 Unclassified 2334
428 Ga0207661_10406879 3300025944 Bacteria 1234
429 Ga0207679_10002893 3300025945 Bacteria 10653
430 Ga0207679_10010064 3300025945 Bacteria 6077
431 Ga0207679_10011212 3300025945 Bacteria 5792
432 Ga0207679_10279252 3300025945 Bacteria 1432
433 Ga0207667_10000172 3300025949 Bacteria 95455
434 Ga0207667_10004715 3300025949 Bacteria 16690
435 Ga0207667_10005849 3300025949 Bacteria 14978
436 Ga0207667_10056467 3300025949 Bacteria 4125
437 Ga0207667_10074035 3300025949 Bacteria 3538
438 Ga0207667_10297949 3300025949 Bacteria 1647
439 Ga0207651_10180703 3300025960 Unclassified 1673
440 Ga0207712_10011258 3300025961 Bacteria 5695
441 Ga0207712_10019114 3300025961 Bacteria 4470
442 Ga0207712_10057965 3300025961 Bacteria 2735
443 Ga0207712_10058345 3300025961 Bacteria 2727
444 Ga0207712_10062019 3300025961 Unclassified 2656
445 Ga0207712_10151401 3300025961 Bacteria 1792
446 Ga0207668_10064997 3300025972 Bacteria 2580
447 Ga0207640_10164899 3300025981 Bacteria 1644
448 Ga0207658_10002543 3300025986 Bacteria 13258
449 Ga0207658_10024748 3300025986 Bacteria 4201
450 Ga0207658_10224509 3300025986 Bacteria 1582
451 Ga0207658_10226919 3300025986 Bacteria 1574
452 Ga0207677_10013733 3300026023 Bacteria 4702
453 Ga0207677_10026299 3300026023 Bacteria 3647
454 Ga0207677_10270022 3300026023 Bacteria 1391
455 Ga0207703_10002928 3300026035 Bacteria 14528
456 Ga0207703_10020985 3300026035 Bacteria 5111
457 Ga0207703_10110543 3300026035 Bacteria 2344
458 Ga0207703_10158464 3300026035 Unclassified 1980
459 Ga0207639_10005873 3300026041 Bacteria 8317
460 Ga0207639_10011289 3300026041 Bacteria 6199
461 Ga0207639_10021969 3300026041 Bacteria 4591
462 Ga0207639_10047548 3300026041 Bacteria 3243
463 Ga0207639_10077413 3300026041 Bacteria 2622
464 Ga0207639_10173339 3300026041 Unclassified 1829
465 Ga0207678_10059105 3300026067 Bacteria 3299
466 Ga0207708_10180341 3300026075 Unclassified 1676
467 Ga0207702_10047881 3300026078 Bacteria 3604
468 Ga0207702_10083640 3300026078 Bacteria 2777
469 Ga0207702_10111931 3300026078 Bacteria 2429
470 Ga0207702_10141443 3300026078 Bacteria 2178
471 Ga0207641_10000015 3300026088 Bacteria 321332
472 Ga0207641_10040030 3300026088 Bacteria 3921
473 Ga0207648_10005571 3300026089 Bacteria 12669
474 Ga0207648_10009688 3300026089 Bacteria 9214
475 Ga0207648_10047707 3300026089 Bacteria 3753
476 Ga0207648_10132232 3300026089 Bacteria 2196
477 Ga0207648_10152560 3300026089 Unclassified 2039
478 Ga0207648_10225971 3300026089 Bacteria 1664
479 Ga0207648_10297107 3300026089 Bacteria 1448
480 Ga0207676_10000899 3300026095 Bacteria 23060
481 Ga0207676_10018524 3300026095 Bacteria 5062
482 Ga0207676_10040588 3300026095 Bacteria 3567
483 Ga0207676_10147163 3300026095 Bacteria 2024
484 Ga0207676_10388988 3300026095 Bacteria 1300
485 Ga0207674_10002816 3300026116 Bacteria 21618
486 Ga0207674_10017794 3300026116 Bacteria 7747
487 Ga0207674_10018853 3300026116 Bacteria 7484
488 Ga0207674_10126239 3300026116 Bacteria 2524
489 Ga0207674_10139245 3300026116 Bacteria 2387
490 Ga0207675_100009868 3300026118 Bacteria 8931
491 Ga0207675_100021227 3300026118 Bacteria 6049
492 Ga0207675_100030787 3300026118 Bacteria 4997
493 Ga0207683_10018763 3300026121 Bacteria 5900
494 Ga0207683_10021082 3300026121 Bacteria 5577
495 Ga0207683_10025880 3300026121 Bacteria 5064
496 Ga0207698_10003403 3300026142 Bacteria 9577
497 Ga0207698_10007252 3300026142 Bacteria 6946
498 Ga0207698_10009707 3300026142 Bacteria 6146
499 Ga0207698_10042389 3300026142 Bacteria 3400
500 Ga0207698_10057416 3300026142 Bacteria 3011
501 Ga0207698_10096394 3300026142 Unclassified 2438
502 Ga0207698_10128166 3300026142 Unclassified 2163
503 Ga0268266_10000048 3300028379 Bacteria 310336
504 Ga0268266_10003786 3300028379 Bacteria 14810
505 Ga0268266_10094506 3300028379 Unclassified 2624
506 Ga0268266_10102477 3300028379 Bacteria 2525
507 Ga0268264_10000028 3300028381 Bacteria 426662
508 Ga0268264_10001687 3300028381 Bacteria 20359
509 Ga0268264_10003414 3300028381 Bacteria 13700
510 Ga0268264_10003823 3300028381 Bacteria 12909
511 Ga0268264_10010251 3300028381 Bacteria 7758
512 Ga0268264_10069758 3300028381 Bacteria 2973
513 Ga0307517_10009783 3300028786 Bacteria 13534
514 Ga0307515_10000001 3300028794 Bacteria 4259510
515 Ga0307515_10000118 3300028794 Bacteria 190444
516 Ga0307511_10000002 3300030521 Bacteria 199923
517 Ga0265327_10000024 3300031251 Bacteria 382499
518 Ga0265327_10000031 3300031251 Bacteria 325718
519 Ga0265327_10000272 3300031251 Bacteria 102100
520 Ga0265327_10017785 3300031251 Bacteria 4438
521 Ga0265327_10026902 3300031251 Bacteria 3323
522 Ga0265327_10027581 3300031251 Bacteria 3265
523 Ga0307513_10111970 3300031456 Bacteria 2721
524 Ga0307509_10121615 3300031507 Bacteria 2587
525 Ga0307508_10000694 3300031616 Bacteria 40289
526 Ga0316575_10004858 3300031665 Bacteria 4746
527 Ga0316579_10015435 3300031691 Bacteria 3318
528 Ga0316579_10036188 3300031691 Bacteria 2277
529 Ga0316576_10001884 3300031727 Bacteria 11659
530 Ga0316576_10105541 3300031727 Bacteria 2109
531 Ga0316576_10107685 3300031727 Bacteria 2088
532 Ga0316576_10229364 3300031727 Bacteria 1396
533 Ga0316578_10001089 3300031728 Bacteria 10543
534 Ga0316578_10129453 3300031728 Bacteria 1518
535 Ga0316578_10153889 3300031728 Bacteria 1386
536 Ga0307516_10000486 3300031730 Bacteria 52749
537 Ga0316577_10000132 3300031733 Bacteria 22009
538 Ga0316577_10015293 3300031733 Bacteria 4220
539 Ga0316577_10017183 3300031733 Bacteria 3992
540 Ga0316577_10025732 3300031733 Bacteria 3273
541 Ga0316583_10008571 3300032133 Bacteria 3687
542 Ga0316583_10013737 3300032133 Bacteria 2922
543 Ga0316585_10000701 3300032137 Bacteria 8358
544 Ga0316580_10010569 3300032139 Bacteria 2793
545 Ga0373956_0082131 3300035119 Bacteria 1480
546 Ga0316574_0000550 3300035398 Bacteria 15524
547 Ga0316574_0001012 3300035398 Bacteria 12681
548 Ga0316574_0086988 3300035398 Bacteria 1989
549 Ga0373937_0050758 3300036401 Bacteria 3800
550 Ga0373937_0183189 3300036401 Bacteria 1967
551 Ga0373937_0440396 3300036401 Bacteria 1237
552 Ga0316582_0014378 3300036647 Bacteria 4490
553 Ga0316584_0000219 3300036712 Bacteria 28153
554 Ga0316584_0009283 3300036712 Bacteria 6820
555 Ga0316584_0064689 3300036712 Bacteria 2739
556 Ga0316584_0101403 3300036712 Bacteria 2155
557 Ga0316584_0102333 3300036712 Bacteria 2145
558 Ga0316584_0239239 3300036712 Bacteria 1329
559 Ga0395905_0013872 3300037471 Bacteria 7710
560 Ga0395905_0022101 3300037471 Bacteria 6017
561 Ga0400490_06663 3300038726 Bacteria 42094
562 Ga0400483_009020 3300039062 Bacteria 3599
563 Ga0436365_0521562 3300039437 Bacteria 1744
564 Ga0436365_1837098 3300039437 Bacteria 29699
565 Ga0439436_0005908 3300041404 Bacteria 3752
566 Ga0439449_0021694 3300042007 Bacteria 2404
567 Ga0439457_001270 3300042014 Bacteria 7574
568 Ga0439462_0003887 3300042015 Bacteria 3606
569 Ga0451577_0011149 3300042876 Bacteria 8527
570 Ga0451577_0014804 3300042876 Bacteria 7268
571 Ga0466969_0002500 3300044656 Bacteria 9822
572 Ga0466972_0000044 3300044658 Bacteria 131031
573 Ga0466972_0006818 3300044658 Bacteria 5733
574 Ga0466972_0100299 3300044658 Bacteria 1370
575 Ga0466965_0206350 3300044683 Bacteria 1044
576 Ga0466966_0002591 3300044684 Bacteria 11845
577 Ga0466961_0032307 3300044693 Bacteria 3363
578 Ga0453684_0018349 3300044712 Bacteria 10744
579 Ga0453684_0026435 3300044712 Bacteria 8381
580 Ga0453684_0039674 3300044712 Bacteria 6409
581 Ga0453684_0102508 3300044712 Bacteria 3499
582 Ga0453684_0168980 3300044712 Bacteria 2579
583 Ga0453684_0328764 3300044712 Bacteria 1729
584 Ga0466971_0003395 3300044719 Bacteria 6804
585 Ga0466968_0006275 3300044735 Bacteria 4474
586 Ga0466968_0008477 3300044735 Bacteria 3938
587 Ga0466970_0004594 3300044765 Bacteria 6815
588 Ga0466957_0005680 3300044842 Bacteria 7012
589 Ga0466957_0014978 3300044842 Bacteria 4525
590 Ga0466957_0054965 3300044842 Bacteria 2432
591 Ga0466960_0022501 3300044901 Bacteria 2819
592 Ga0466959_0000045 3300045049 Bacteria 89773
593 Ga0466959_0000904 3300045049 Bacteria 17527
594 Ga0451576_0267304 3300045051 Bacteria 1788
595 Ga0495627_006679 3300046453 Bacteria 4493
596 Ga0495638_0020775 3300046460 Bacteria 4336
597 Ga0495638_0023374 3300046460 Bacteria 4043
598 Ga0495638_0123599 3300046460 Bacteria 1527
599 Ga0495650_0030464 3300046471 Bacteria 2444
600 Ga0495606_0004864 3300046507 Bacteria 13165
601 Ga0495618_0068606 3300046514 Bacteria 2255
602 Ga0495628_0212810 3300046516 Bacteria 1453
603 Ga0495652_0234535 3300046529 Bacteria 1370
604 Ga0495633_0000125 3300046558 Bacteria 104459
605 Ga0495668_0003508 3300046616 Bacteria 11693
606 Ga0495611_0000065 3300046648 Bacteria 74332
607 Ga0495657_0046927 3300046675 Bacteria 2923
608 Ga0495649_0025053 3300046694 Bacteria 3324
609 Ga0495636_0000026 3300047318 Bacteria 63897
610 Ga0495672_0002281 3300047320 Bacteria 17812
611 Ga0495672_0013217 3300047320 Bacteria 5705
612 Ga0495672_0036643 3300047320 Unclassified 3010
613 Ga0495687_000129 3300047443 Bacteria 116030
614 Ga0495684_0229279 3300047471 Bacteria 1359
615 Ga0495686_0000005 3300047472 Bacteria 827143
616 Ga0495686_0014570 3300047472 Bacteria 5408
617 Ga0496100_0038502 3300048903 Bacteria 3031
618 Ga0496101_0070296 3300048904 Bacteria 2563
619 Ga0496104_0306086 3300048907 Bacteria 1502
620 Ga0496114_0104859 3300048917 Bacteria 2418
621 Ga0496114_0245923 3300048917 Unclassified 1574
622 Ga0496115_0220891 3300048918 Bacteria 1563
623 Ga0496121_0000081 3300048924 Bacteria 229506
624 Ga0496126_0012204 3300048929 Bacteria 8815
625 Ga0496126_0310742 3300048929 Bacteria 1298
626 Ga0501300_007311 3300049523 Unclassified 1619
627 Ga0501032_0009405 3300049569 Bacteria 7080
628 Ga0501032_0028589 3300049569 Bacteria 3830
629 Ga0501032_0115842 3300049569 Unclassified 1772
630 Ga0501033_0031424 3300049570 Bacteria 3990
631 Ga0501034_0003157 3300049571 Bacteria 18950
632 Ga0501034_0009179 3300049571 Bacteria 10374
633 Ga0501034_0042674 3300049571 Bacteria 4591
634 Ga0501034_0153559 3300049571 Bacteria 2277
635 Ga0501034_0221715 3300049571 Bacteria 1843
636 Ga0501036_0006617 3300049572 Bacteria 9418
637 Ga0501036_0007556 3300049572 Bacteria 8868
638 Ga0501038_0011371 3300049574 Bacteria 8123
639 Ga0501038_0025837 3300049574 Bacteria 5232
640 Ga0501039_0011919 3300049575 Bacteria 6625
641 Ga0501043_0021243 3300049579 Bacteria 5089
642 Ga0501043_0095054 3300049579 Bacteria 2342
643 Ga0501043_0359411 3300049579 Bacteria 1105
644 Ga0501046_0090632 3300049580 Bacteria 2352
645 Ga0501047_0006237 3300049581 Bacteria 11210
646 Ga0501047_0078887 3300049581 Bacteria 3166
647 Ga0501047_0111573 3300049581 Bacteria 2617
648 Ga0501070_0082151 3300049586 Bacteria 2666
649 Ga0501070_0092405 3300049586 Bacteria 2504
650 Ga0501073_0045119 3300049589 Bacteria 3105
651 Ga0501073_0052595 3300049589 Bacteria 2851
652 Ga0501198_000167 3300049649 Bacteria 8710
653 Ga0501202_001568 3300049652 Bacteria 3688
654 Ga0501207_001417 3300049654 Bacteria 2993
655 Ga0501217_003020 3300049661 Bacteria 3372
656 Ga0501217_003022 3300049661 Bacteria 3372
657 Ga0501222_000629 3300049662 Bacteria 5168
658 Ga0501223_000426 3300049663 Bacteria 10221
659 Ga0501233_009818 3300049668 Bacteria 1874
660 Ga0501235_000033 3300049669 Bacteria 22695
661 Ga0501243_000152 3300049675 Bacteria 7985
662 Ga0501257_004677 3300049686 Bacteria 2992
663 Ga0501259_000375 3300049688 Bacteria 7028
664 Ga0501259_001723 3300049688 Bacteria 3627
665 Ga0501260_001544 3300049689 Bacteria 1911
666 Ga0501219_000019 3300049703 Bacteria 25267
667 Ga0501221_000120 3300049704 Bacteria 9800
668 Ga0501225_0003232 3300049705 Bacteria 4976
669 Ga0501225_0003564 3300049705 Bacteria 4697
670 Ga0501234_000621 3300049707 Bacteria 5456
671 Ga0501245_000053 3300049708 Bacteria 10632
672 Ga0501080_0049017 3300049742 Bacteria 3931
673 Ga0501080_0093829 3300049742 Bacteria 2787
674 Ga0501080_0174212 3300049742 Bacteria 1983
675 Ga0501083_0059245 3300049744 Bacteria 2561
676 Ga0501241_002043 3300049758 Bacteria 3953
677 Ga0501241_012824 3300049758 Bacteria 1524
678 Ga0501264_002416 3300049761 Unclassified 1746
679 Ga0501268_001584 3300049765 Bacteria 2861
680 Ga0501268_022938 3300049765 Bacteria 1081
681 Ga0501035_0082060 3300049822 Bacteria 2845
682 Ga0501035_0215079 3300049822 Unclassified 1643
683 Ga0501035_0219186 3300049822 Unclassified 1625
684 Ga0501044_0004638 3300049823 Bacteria 15377
685 Ga0501044_0009473 3300049823 Bacteria 10604
686 Ga0501044_0043392 3300049823 Bacteria 4671
687 Ga0501044_0063526 3300049823 Bacteria 3771
688 Ga0501044_0092825 3300049823 Bacteria 3044
689 Ga0501044_0097102 3300049823 Bacteria 2968
690 Ga0501045_0078786 3300049824 Bacteria 2429
691 Ga0501212_002902 3300049851 Bacteria 2104
692 Ga0501284_00007 3300050005 Bacteria 147956
693 nmdc:mga0k408_148245_c1 3300050493 Bacteria 1397
694 nmdc:mga0k408_24705_c1 3300050493 Bacteria 3398
695 nmdc:mga05p37_24567_c2 3300050507 Bacteria 2908
696 nmdc:mga05p37_58974_c1 3300050507 Bacteria 4727
697 nmdc:mga09592_13139_c1 3300050508 Bacteria 6757
698 nmdc:mga06r32_9580_c1 3300050510 Bacteria 8749
699 nmdc:mga08y16_76772_c1 3300050511 Bacteria 3482
700 nmdc:mga0n895_308217_c1 3300050512 Bacteria 1605
701 Ga0500578_0000026 3300053086 Bacteria 145328
702 Ga0500644_0000026 3300053088 Bacteria 93328
703 Ga0500583_0000001 3300053092 Bacteria 241642
704 Ga0500583_0004221 3300053092 Bacteria 4649
705 Ga0500583_0017888 3300053092 Bacteria 2868
706 Ga0500651_0001573 3300053093 Bacteria 11590
707 Ga0500555_013807 3300053103 Bacteria 2329
708 Ga0500562_000070 3300053108 Bacteria 49835
709 Ga0500569_000432 3300053109 Bacteria 6852
710 Ga0500594_0007656 3300053118 Bacteria 2449
711 Ga0500652_005247 3300053131 Bacteria 4064
712 Ga0500658_0002669 3300053134 Bacteria 6853
713 Ga0500559_0010116 3300053136 Bacteria 4060
714 Ga0500568_0003989 3300053139 Bacteria 8014
715 Ga0500577_0002713 3300053142 Bacteria 4545
716 Ga0500588_0004746 3300053146 Bacteria 2965
717 Ga0500589_018253 3300053147 Bacteria 3174
718 Ga0500590_089851 3300053148 Bacteria 1493
719 Ga0500604_0001556 3300053151 Bacteria 6423
720 Ga0500616_0047309 3300053153 Bacteria 2284
721 Ga0500622_0001947 3300053156 Bacteria 15544
722 Ga0500622_0014304 3300053156 Bacteria 4264
723 Ga0500633_0000253 3300053160 Bacteria 7733
724 Ga0500636_0012621 3300053177 Bacteria 4953
725 Ga0500611_000003 3300053727 Bacteria 333431
726 Ga0500611_009641 3300053727 Bacteria 1538
727 Ga0501082_0059741 3300060353 Unclassified 3285
728 Ga0466962_0003789 3300061719 Bacteria 7222

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031733 Ga0316577_10015293 Ga0316577_100152933 310
2 3300036712 Ga0316584_0064689 Ga0316584_0064689_29_1012 316
3 3300044683 Ga0466965_0206350 Ga0466965_0206350_22_1011 323
4 3300039062 Ga0400483_009020 Ga0400483_009020_51_1061 329
5 3300036712 Ga0316584_0102333 Ga0316584_0102333_83_1087 332
6 3300005337 Ga0070682_100000012 Ga0070682_100000012115 338
7 3300044712 Ga0453684_0328764 Ga0453684_0328764_517_1551 339
8 3300014326 Ga0157380_10036672 Ga0157380_100366724 340
9 3300035398 Ga0316574_0000550 Ga0316574_0000550_982_2031 344
10 3300035398 Ga0316574_0001012 Ga0316574_0001012_11432_12481 344
11 3300036712 Ga0316584_0000219 Ga0316584_0000219_24513_25562 344
12 3300005329 Ga0070683_100034680 Ga0070683_1000346802 346
13 3300005331 Ga0070670_100038347 Ga0070670_1000383472 346
14 3300005338 Ga0068868_100010790 Ga0068868_1000107904 346
15 3300005354 Ga0070675_100067860 Ga0070675_1000678602 346
16 3300005366 Ga0070659_100078396 Ga0070659_1000783962 346
17 3300005466 Ga0070685_10025057 Ga0070685_100250572 346
18 3300005535 Ga0070684_100068101 Ga0070684_1000681013 346
19 3300005544 Ga0070686_100189809 Ga0070686_1001898091 346
20 3300005577 Ga0068857_100037069 Ga0068857_1000370695 346
21 3300006358 Ga0068871_100043801 Ga0068871_1000438012 346
22 3300017792 Ga0163161_10020322 Ga0163161_100203222 346
23 3300025905 Ga0207685_10069962 Ga0207685_100699621 346
24 3300025931 Ga0207644_10197128 Ga0207644_101971281 346
25 3300025933 Ga0207706_10017842 Ga0207706_100178421 346
26 3300025933 Ga0207706_10085409 Ga0207706_100854092 346
27 3300025936 Ga0207670_10190783 Ga0207670_101907831 346
28 3300025942 Ga0207689_10040117 Ga0207689_100401172 346
29 3300026035 Ga0207703_10158464 Ga0207703_101584642 346
30 3300026089 Ga0207648_10297107 Ga0207648_102971071 346
31 3300026121 Ga0207683_10025880 Ga0207683_100258801 346
32 3300028381 Ga0268264_10069758 Ga0268264_100697582 346
33 3300031727 Ga0316576_10105541 Ga0316576_101055411 349
34 3300035398 Ga0316574_0086988 Ga0316574_0086988_586_1650 349
35 3300005329 Ga0070683_100054475 Ga0070683_1000544752 350
36 3300005330 Ga0070690_100041885 Ga0070690_1000418853 350
37 3300005334 Ga0068869_100046132 Ga0068869_1000461324 350
38 3300005338 Ga0068868_100332150 Ga0068868_1003321501 350
39 3300005339 Ga0070660_100401809 Ga0070660_1004018091 350
40 3300005344 Ga0070661_100136899 Ga0070661_1001368992 350
41 3300005353 Ga0070669_100096255 Ga0070669_1000962552 350
42 3300005355 Ga0070671_100032138 Ga0070671_1000321384 350
43 3300005355 Ga0070671_100127806 Ga0070671_1001278062 350
44 3300005364 Ga0070673_100033458 Ga0070673_1000334584 350
45 3300005364 Ga0070673_100116177 Ga0070673_1001161772 350
46 3300005365 Ga0070688_100033042 Ga0070688_1000330422 350
47 3300005366 Ga0070659_100086851 Ga0070659_1000868512 350
48 3300005441 Ga0070700_100070715 Ga0070700_1000707152 350
49 3300005459 Ga0068867_100156571 Ga0068867_1001565712 350
50 3300005466 Ga0070685_10014160 Ga0070685_100141602 350
51 3300005535 Ga0070684_100013984 Ga0070684_1000139847 350
52 3300005539 Ga0068853_100069992 Ga0068853_1000699922 350
53 3300005539 Ga0068853_100214130 Ga0068853_1002141301 350
54 3300005543 Ga0070672_100028044 Ga0070672_1000280442 350
55 3300005548 Ga0070665_100000047 Ga0070665_10000004754 350
56 3300005564 Ga0070664_100008826 Ga0070664_1000088266 350
57 3300005564 Ga0070664_100164639 Ga0070664_1001646392 350
58 3300005577 Ga0068857_100011324 Ga0068857_1000113242 350
59 3300005614 Ga0068856_100050886 Ga0068856_1000508862 350
60 3300005615 Ga0070702_100084942 Ga0070702_1000849422 350
61 3300005616 Ga0068852_100074402 Ga0068852_1000744023 350
62 3300005616 Ga0068852_100079150 Ga0068852_1000791503 350
63 3300005840 Ga0068870_10101189 Ga0068870_101011892 350
64 3300005842 Ga0068858_100041442 Ga0068858_1000414422 350
65 3300005843 Ga0068860_100000024 Ga0068860_10000002420 350
66 3300006237 Ga0097621_100149100 Ga0097621_1001491002 350
67 3300006358 Ga0068871_100011203 Ga0068871_1000112034 350
68 3300006358 Ga0068871_100040832 Ga0068871_1000408323 350
69 3300006871 Ga0075434_100205454 Ga0075434_1002054542 350
70 3300009093 Ga0105240_10000445 Ga0105240_1000044538 350
71 3300009093 Ga0105240_10064971 Ga0105240_100649712 350
72 3300009094 Ga0111539_10024898 Ga0111539_100248984 350
73 3300009101 Ga0105247_10000331 Ga0105247_1000033133 350
74 3300009174 Ga0105241_10000180 Ga0105241_1000018017 350
75 3300009174 Ga0105241_10180324 Ga0105241_101803242 350
76 3300009174 Ga0105241_10354331 Ga0105241_103543312 350
77 3300009176 Ga0105242_10146321 Ga0105242_101463211 350
78 3300009176 Ga0105242_10213857 Ga0105242_102138572 350
79 3300009545 Ga0105237_10010515 Ga0105237_100105152 350
80 3300009551 Ga0105238_10001087 Ga0105238_1000108722 350
81 3300009553 Ga0105249_10031545 Ga0105249_100315452 350
82 3300009553 Ga0105249_10045937 Ga0105249_100459372 350
83 3300010375 Ga0105239_10011209 Ga0105239_100112097 350
84 3300013105 Ga0157369_10029853 Ga0157369_100298535 350
85 3300013297 Ga0157378_10014613 Ga0157378_100146136 350
86 3300013306 Ga0163162_10000237 Ga0163162_1000023731 350
87 3300013307 Ga0157372_10006497 Ga0157372_100064977 350
88 3300013307 Ga0157372_10053396 Ga0157372_100533963 350
89 3300013308 Ga0157375_10000599 Ga0157375_1000059929 350
90 3300014325 Ga0163163_10000703 Ga0163163_1000070331 350
91 3300014325 Ga0163163_10209635 Ga0163163_102096351 350
92 3300014326 Ga0157380_10001186 Ga0157380_100011862 350
93 3300014326 Ga0157380_10182822 Ga0157380_101828222 350
94 3300014968 Ga0157379_10002064 Ga0157379_1000206413 350
95 3300014969 Ga0157376_10000971 Ga0157376_1000097113 350
96 3300025900 Ga0207710_10006407 Ga0207710_100064072 350
97 3300025907 Ga0207645_10013811 Ga0207645_100138113 350
98 3300025907 Ga0207645_10022808 Ga0207645_100228082 350
99 3300025911 Ga0207654_10002114 Ga0207654_100021143 350
100 3300025911 Ga0207654_10128839 Ga0207654_101288391 350
101 3300025912 Ga0207707_10033910 Ga0207707_100339103 350
102 3300025913 Ga0207695_10001116 Ga0207695_1000111633 350
103 3300025913 Ga0207695_10078511 Ga0207695_100785113 350
104 3300025914 Ga0207671_10001227 Ga0207671_100012278 350
105 3300025914 Ga0207671_10001705 Ga0207671_1000170515 350
106 3300025923 Ga0207681_10174981 Ga0207681_101749812 350
107 3300025924 Ga0207694_10003724 Ga0207694_100037247 350
108 3300025936 Ga0207670_10013966 Ga0207670_100139663 350
109 3300025940 Ga0207691_10031372 Ga0207691_100313723 350
110 3300025942 Ga0207689_10003172 Ga0207689_1000317212 350
111 3300025945 Ga0207679_10011212 Ga0207679_100112125 350
112 3300025960 Ga0207651_10180703 Ga0207651_101807031 350
113 3300026075 Ga0207708_10180341 Ga0207708_101803412 350
114 3300026078 Ga0207702_10083640 Ga0207702_100836402 350
115 3300026078 Ga0207702_10141443 Ga0207702_101414432 350
116 3300026089 Ga0207648_10047707 Ga0207648_100477073 350
117 3300026089 Ga0207648_10152560 Ga0207648_101525602 350
118 3300026095 Ga0207676_10388988 Ga0207676_103889881 350
119 3300026116 Ga0207674_10002816 Ga0207674_100028169 350
120 3300026116 Ga0207674_10017794 Ga0207674_100177942 350
121 3300026142 Ga0207698_10042389 Ga0207698_100423893 350
122 3300026142 Ga0207698_10096394 Ga0207698_100963943 350
123 3300028381 Ga0268264_10000028 Ga0268264_10000028200 350
124 3300030521 Ga0307511_10000002 Ga0307511_1000000253 350
125 3300031251 Ga0265327_10017785 Ga0265327_100177852 350
126 3300031665 Ga0316575_10004858 Ga0316575_100048583 350
127 3300031691 Ga0316579_10036188 Ga0316579_100361881 350
128 3300031727 Ga0316576_10001884 Ga0316576_100018849 350
129 3300031727 Ga0316576_10229364 Ga0316576_102293641 350
130 3300031728 Ga0316578_10001089 Ga0316578_100010895 350
131 3300031728 Ga0316578_10129453 Ga0316578_101294531 350
132 3300031728 Ga0316578_10153889 Ga0316578_101538892 350
133 3300031730 Ga0307516_10000486 Ga0307516_100004867 350
134 3300031733 Ga0316577_10000132 Ga0316577_100001328 350
135 3300032133 Ga0316583_10008571 Ga0316583_100085712 350
136 3300032133 Ga0316583_10013737 Ga0316583_100137373 350
137 3300032137 Ga0316585_10000701 Ga0316585_100007014 350
138 3300032139 Ga0316580_10010569 Ga0316580_100105692 350
139 3300036647 Ga0316582_0014378 Ga0316582_0014378_1185_2252 350
140 3300036712 Ga0316584_0009283 Ga0316584_0009283_450_1517 350
141 3300037471 Ga0395905_0013872 Ga0395905_0013872_1100_2152 350
142 3300039437 Ga0436365_0521562 Ga0436365_0521562_48_1100 350
143 3300042876 Ga0451577_0011149 Ga0451577_0011149_392_1459 350
144 3300044658 Ga0466972_0006818 Ga0466972_0006818_1153_2205 350
145 3300044712 Ga0453684_0018349 Ga0453684_0018349_4685_5752 350
146 3300044712 Ga0453684_0026435 Ga0453684_0026435_4303_5370 350
147 3300044712 Ga0453684_0102508 Ga0453684_0102508_226_1293 350
148 3300044735 Ga0466968_0006275 Ga0466968_0006275_2466_3518 350
149 3300046675 Ga0495657_0046927 Ga0495657_0046927_1857_2909 350
150 3300047320 Ga0495672_0013217 Ga0495672_0013217_469_1521 350
151 3300047472 Ga0495686_0014570 Ga0495686_0014570_2093_3145 350
152 3300048903 Ga0496100_0038502 Ga0496100_0038502_67_1119 350
153 3300048904 Ga0496101_0070296 Ga0496101_0070296_349_1401 350
154 3300048907 Ga0496104_0306086 Ga0496104_0306086_384_1436 350
155 3300048917 Ga0496114_0104859 Ga0496114_0104859_1183_2235 350
156 3300049569 Ga0501032_0115842 Ga0501032_0115842_298_1350 350
157 3300049572 Ga0501036_0006617 Ga0501036_0006617_1046_2098 350
158 3300049574 Ga0501038_0025837 Ga0501038_0025837_3331_4383 350
159 3300049765 Ga0501268_022938 Ga0501268_022938_11_1063 350
160 3300050512 nmdc:mga0n895_308217_c1 nmdc:mga0n895_308217_c1_455_1546 350
161 3300015265 Ga0182005_1000043 Ga0182005_1000043127 351
162 3300031251 Ga0265327_10000272 Ga0265327_1000027214 351
163 3300044842 Ga0466957_0005680 Ga0466957_0005680_2263_3336 351
164 3300049579 Ga0501043_0359411 Ga0501043_0359411_21_1094 351
165 3300049703 Ga0501219_000019 Ga0501219_000019_272_1333 351
166 3300050005 Ga0501284_00007 Ga0501284_00007_54027_55088 351
167 3300050493 nmdc:mga0k408_148245_c1 nmdc:mga0k408_148245_c1_283_1356 351
168 3300031691 Ga0316579_10015435 Ga0316579_100154352 352
169 3300031727 Ga0316576_10107685 Ga0316576_101076852 352
170 3300031733 Ga0316577_10017183 Ga0316577_100171831 352
171 3300031733 Ga0316577_10025732 Ga0316577_100257323 352
172 3300036712 Ga0316584_0101403 Ga0316584_0101403_207_1286 352
173 3300036712 Ga0316584_0239239 Ga0316584_0239239_22_1101 352
174 3300038726 Ga0400490_06663 Ga0400490_06663_11410_12489 352
175 iso_pu_bacteria 2818991442 2819574895 354
176 iso_pu_bacteria 2821136567 2821140995 354
177 iso_pu_bacteria 2840677318 2840678766 354
178 iso_pu_bacteria 2883068021 2883069578 354
179 iso_pu_bacteria 2896085136 2896086584 354
180 iso_pu_bacteria 2896109856 2896113116 354
181 iso_pu_bacteria 2904467357 2904471495 354
182 iso_pu_bacteria 2929239360 2929240152 354
183 iso_pu_bacteria 2929921140 2929921847 354
184 3300025921 Ga0207652_10031060 Ga0207652_100310605 355
185 3300003354 JGI25160J50197_1000375 JGI25160J50197_10003753 356
186 3300025302 Ga0207426_1000026 Ga0207426_1000026281 356
187 3300036401 Ga0373937_0440396 Ga0373937_0440396_98_1168 356
188 3300001979 JGI24740J21852_10004944 JGI24740J21852_100049444 357
189 3300002459 JGI24751J29686_10002525 JGI24751J29686_100025252 357
190 3300003316 rootH1_10132364 rootH1_101323644 357
191 3300003320 rootH2_10003346 rootH2_1000334620 357
192 3300003320 rootH2_10088824 rootH2_100888243 357
193 3300003320 rootH2_10128231 rootH2_101282317 357
194 3300003322 rootL2_10200643 rootL2_102006431 357
195 3300003323 rootH1_10114166 rootH1_101141664 357
196 3300005288 Ga0065714_10083974 Ga0065714_100839741 357
197 3300005327 Ga0070658_10032464 Ga0070658_100324642 357
198 3300005328 Ga0070676_10000167 Ga0070676_1000016710 357
199 3300005329 Ga0070683_100018391 Ga0070683_1000183916 357
200 3300005330 Ga0070690_100010364 Ga0070690_1000103646 357
201 3300005331 Ga0070670_100038146 Ga0070670_1000381462 357
202 3300005331 Ga0070670_100049111 Ga0070670_1000491112 357
203 3300005331 Ga0070670_100123093 Ga0070670_1001230932 357
204 3300005331 Ga0070670_100277949 Ga0070670_1002779491 357
205 3300005334 Ga0068869_100036022 Ga0068869_1000360223 357
206 3300005334 Ga0068869_100095335 Ga0068869_1000953352 357
207 3300005334 Ga0068869_100133282 Ga0068869_1001332822 357
208 3300005334 Ga0068869_100236831 Ga0068869_1002368311 357
209 3300005335 Ga0070666_10000030 Ga0070666_1000003092 357
210 3300005335 Ga0070666_10000512 Ga0070666_1000051223 357
211 3300005335 Ga0070666_10083175 Ga0070666_100831751 357
212 3300005336 Ga0070680_100023108 Ga0070680_1000231084 357
213 3300005337 Ga0070682_100004319 Ga0070682_1000043194 357
214 3300005337 Ga0070682_100007939 Ga0070682_1000079392 357
215 3300005337 Ga0070682_100295233 Ga0070682_1002952331 357
216 3300005338 Ga0068868_100004051 Ga0068868_1000040518 357
217 3300005338 Ga0068868_100005213 Ga0068868_1000052134 357
218 3300005338 Ga0068868_100142518 Ga0068868_1001425181 357
219 3300005339 Ga0070660_100063106 Ga0070660_1000631063 357
220 3300005344 Ga0070661_100015588 Ga0070661_1000155885 357
221 3300005344 Ga0070661_100216540 Ga0070661_1002165401 357
222 3300005347 Ga0070668_100032723 Ga0070668_1000327232 357
223 3300005354 Ga0070675_100102206 Ga0070675_1001022064 357
224 3300005355 Ga0070671_100025809 Ga0070671_1000258095 357
225 3300005355 Ga0070671_100262268 Ga0070671_1002622682 357
226 3300005356 Ga0070674_100009484 Ga0070674_1000094844 357
227 3300005356 Ga0070674_100136108 Ga0070674_1001361082 357
228 3300005356 Ga0070674_100184860 Ga0070674_1001848602 357
229 3300005364 Ga0070673_100003256 Ga0070673_1000032568 357
230 3300005364 Ga0070673_100240982 Ga0070673_1002409822 357
231 3300005365 Ga0070688_100006998 Ga0070688_1000069983 357
232 3300005366 Ga0070659_100012764 Ga0070659_1000127643 357
233 3300005367 Ga0070667_100029965 Ga0070667_1000299652 357
234 3300005455 Ga0070663_100116211 Ga0070663_1001162112 357
235 3300005456 Ga0070678_100021913 Ga0070678_1000219133 357
236 3300005457 Ga0070662_100021196 Ga0070662_1000211964 357
237 3300005457 Ga0070662_100022881 Ga0070662_1000228814 357
238 3300005457 Ga0070662_100046357 Ga0070662_1000463572 357
239 3300005458 Ga0070681_10013527 Ga0070681_100135277 357
240 3300005458 Ga0070681_10099291 Ga0070681_100992913 357
241 3300005459 Ga0068867_100021839 Ga0068867_1000218392 357
242 3300005459 Ga0068867_100085236 Ga0068867_1000852363 357
243 3300005459 Ga0068867_100237520 Ga0068867_1002375202 357
244 3300005530 Ga0070679_100028777 Ga0070679_1000287776 357
245 3300005530 Ga0070679_100039559 Ga0070679_1000395594 357
246 3300005530 Ga0070679_100099324 Ga0070679_1000993242 357
247 3300005535 Ga0070684_100012657 Ga0070684_1000126572 357
248 3300005539 Ga0068853_100000773 Ga0068853_1000007739 357
249 3300005539 Ga0068853_100008684 Ga0068853_1000086846 357
250 3300005539 Ga0068853_100010271 Ga0068853_1000102713 357
251 3300005539 Ga0068853_100019862 Ga0068853_1000198624 357
252 3300005539 Ga0068853_100040412 Ga0068853_1000404122 357
253 3300005539 Ga0068853_100061769 Ga0068853_1000617693 357
254 3300005543 Ga0070672_100000310 Ga0070672_10000031021 357
255 3300005543 Ga0070672_100028517 Ga0070672_1000285173 357
256 3300005543 Ga0070672_100051522 Ga0070672_1000515224 357
257 3300005547 Ga0070693_100010763 Ga0070693_1000107634 357
258 3300005548 Ga0070665_100007830 Ga0070665_1000078304 357
259 3300005548 Ga0070665_100112407 Ga0070665_1001124071 357
260 3300005563 Ga0068855_100000081 Ga0068855_10000008122 357
261 3300005563 Ga0068855_100018949 Ga0068855_1000189495 357
262 3300005563 Ga0068855_100030104 Ga0068855_1000301043 357
263 3300005563 Ga0068855_100043093 Ga0068855_1000430933 357
264 3300005563 Ga0068855_100385955 Ga0068855_1003859551 357
265 3300005564 Ga0070664_100002738 Ga0070664_10000273817 357
266 3300005564 Ga0070664_100008778 Ga0070664_1000087785 357
267 3300005564 Ga0070664_100129710 Ga0070664_1001297102 357
268 3300005577 Ga0068857_100003167 Ga0068857_1000031673 357
269 3300005577 Ga0068857_100026193 Ga0068857_1000261933 357
270 3300005577 Ga0068857_100155672 Ga0068857_1001556722 357
271 3300005578 Ga0068854_100105255 Ga0068854_1001052552 357
272 3300005614 Ga0068856_100007849 Ga0068856_1000078498 357
273 3300005614 Ga0068856_100011188 Ga0068856_1000111887 357
274 3300005614 Ga0068856_100275438 Ga0068856_1002754382 357
275 3300005614 Ga0068856_100329230 Ga0068856_1003292302 357
276 3300005616 Ga0068852_100001636 Ga0068852_1000016365 357
277 3300005616 Ga0068852_100002835 Ga0068852_1000028359 357
278 3300005616 Ga0068852_100012225 Ga0068852_1000122253 357
279 3300005616 Ga0068852_100053908 Ga0068852_1000539083 357
280 3300005616 Ga0068852_100071802 Ga0068852_1000718023 357
281 3300005616 Ga0068852_100299596 Ga0068852_1002995962 357
282 3300005617 Ga0068859_100000003 Ga0068859_100000003432 357
283 3300005617 Ga0068859_100000461 Ga0068859_10000046126 357
284 3300005617 Ga0068859_100034447 Ga0068859_1000344474 357
285 3300005617 Ga0068859_100040903 Ga0068859_1000409035 357
286 3300005617 Ga0068859_100119465 Ga0068859_1001194653 357
287 3300005618 Ga0068864_100001741 Ga0068864_1000017415 357
288 3300005618 Ga0068864_100005856 Ga0068864_1000058564 357
289 3300005618 Ga0068864_100063881 Ga0068864_1000638813 357
290 3300005719 Ga0068861_100003203 Ga0068861_1000032036 357
291 3300005719 Ga0068861_100043733 Ga0068861_1000437333 357
292 3300005834 Ga0068851_10002509 Ga0068851_100025097 357
293 3300005834 Ga0068851_10004484 Ga0068851_100044845 357
294 3300005834 Ga0068851_10010113 Ga0068851_100101132 357
295 3300005840 Ga0068870_10022268 Ga0068870_100222682 357
296 3300005841 Ga0068863_100002398 Ga0068863_10000239811 357
297 3300005841 Ga0068863_100119217 Ga0068863_1001192172 357
298 3300005841 Ga0068863_100307456 Ga0068863_1003074561 357
299 3300005842 Ga0068858_100007027 Ga0068858_1000070278 357
300 3300005842 Ga0068858_100036435 Ga0068858_1000364352 357
301 3300005843 Ga0068860_100002247 Ga0068860_10000224714 357
302 3300005843 Ga0068860_100003895 Ga0068860_10000389512 357
303 3300005843 Ga0068860_100010764 Ga0068860_1000107646 357
304 3300005843 Ga0068860_100041220 Ga0068860_1000412203 357
305 3300005983 Ga0081540_1017589 Ga0081540_10175892 357
306 3300005985 Ga0081539_10000604 Ga0081539_1000060422 357
307 3300005985 Ga0081539_10013564 Ga0081539_100135647 357
308 3300006195 Ga0075366_10164700 Ga0075366_101647001 357
309 3300006237 Ga0097621_100000352 Ga0097621_10000035228 357
310 3300006237 Ga0097621_100007236 Ga0097621_1000072364 357
311 3300006237 Ga0097621_100018563 Ga0097621_1000185634 357
312 3300006237 Ga0097621_100042232 Ga0097621_1000422324 357
313 3300006237 Ga0097621_100354913 Ga0097621_1003549132 357
314 3300006358 Ga0068871_100001720 Ga0068871_1000017204 357
315 3300006358 Ga0068871_100003843 Ga0068871_1000038438 357
316 3300006358 Ga0068871_100045786 Ga0068871_1000457862 357
317 3300006358 Ga0068871_100118440 Ga0068871_1001184402 357
318 3300006847 Ga0075431_100009229 Ga0075431_1000092298 357
319 3300006880 Ga0075429_100004600 Ga0075429_10000460011 357
320 3300006881 Ga0068865_100104292 Ga0068865_1001042922 357
321 3300006881 Ga0068865_100198911 Ga0068865_1001989112 357
322 3300006931 Ga0097620_100000003 Ga0097620_100000003432 357
323 3300006931 Ga0097620_100000461 Ga0097620_10000046126 357
324 3300006931 Ga0097620_100034448 Ga0097620_1000344484 357
325 3300006931 Ga0097620_100040903 Ga0097620_1000409035 357
326 3300006931 Ga0097620_100119477 Ga0097620_1001194773 357
327 3300009093 Ga0105240_10000597 Ga0105240_1000059745 357
328 3300009093 Ga0105240_10003084 Ga0105240_1000308418 357
329 3300009093 Ga0105240_10003774 Ga0105240_1000377416 357
330 3300009093 Ga0105240_10008651 Ga0105240_100086515 357
331 3300009093 Ga0105240_10073572 Ga0105240_100735724 357
332 3300009093 Ga0105240_10214817 Ga0105240_102148171 357
333 3300009094 Ga0111539_10132349 Ga0111539_101323492 357
334 3300009101 Ga0105247_10027687 Ga0105247_100276873 357
335 3300009101 Ga0105247_10079899 Ga0105247_100798991 357
336 3300009147 Ga0114129_10021302 Ga0114129_100213026 357
337 3300009174 Ga0105241_10000564 Ga0105241_1000056417 357
338 3300009174 Ga0105241_10004810 Ga0105241_100048105 357
339 3300009174 Ga0105241_10190581 Ga0105241_101905811 357
340 3300009174 Ga0105241_10209427 Ga0105241_102094272 357
341 3300009176 Ga0105242_10025384 Ga0105242_100253843 357
342 3300009177 Ga0105248_10053027 Ga0105248_100530275 357
343 3300009545 Ga0105237_10000294 Ga0105237_1000029429 357
344 3300009545 Ga0105237_10000759 Ga0105237_1000075923 357
345 3300009545 Ga0105237_10009804 Ga0105237_100098047 357
346 3300009545 Ga0105237_10015867 Ga0105237_100158675 357
347 3300009551 Ga0105238_10075882 Ga0105238_100758823 357
348 3300009551 Ga0105238_10154523 Ga0105238_101545231 357
349 3300009551 Ga0105238_10320965 Ga0105238_103209652 357
350 3300009553 Ga0105249_10003321 Ga0105249_100033215 357
351 3300009553 Ga0105249_10016126 Ga0105249_100161264 357
352 3300009553 Ga0105249_10022846 Ga0105249_100228462 357
353 3300009553 Ga0105249_10177950 Ga0105249_101779501 357
354 3300009553 Ga0105249_10234009 Ga0105249_102340092 357
355 3300010375 Ga0105239_10000628 Ga0105239_1000062837 357
356 3300010375 Ga0105239_10005401 Ga0105239_100054017 357
357 3300010375 Ga0105239_10012135 Ga0105239_100121353 357
358 3300010375 Ga0105239_10035013 Ga0105239_100350132 357
359 3300010375 Ga0105239_10073535 Ga0105239_100735353 357
360 3300010375 Ga0105239_10128347 Ga0105239_101283472 357
361 3300010375 Ga0105239_10206355 Ga0105239_102063552 357
362 3300010375 Ga0105239_10311144 Ga0105239_103111442 357
363 3300010375 Ga0105239_10478215 Ga0105239_104782151 357
364 3300011119 Ga0105246_10008264 Ga0105246_100082646 357
365 3300011119 Ga0105246_10023545 Ga0105246_100235452 357
366 3300011119 Ga0105246_10061609 Ga0105246_100616092 357
367 3300011119 Ga0105246_10139180 Ga0105246_101391802 357
368 3300013100 Ga0157373_10004289 Ga0157373_100042896 357
369 3300013102 Ga0157371_10021112 Ga0157371_100211123 357
370 3300013104 Ga0157370_10006558 Ga0157370_100065587 357
371 3300013104 Ga0157370_10043563 Ga0157370_100435634 357
372 3300013104 Ga0157370_10053535 Ga0157370_100535353 357
373 3300013105 Ga0157369_10005892 Ga0157369_100058927 357
374 3300013105 Ga0157369_10031421 Ga0157369_100314211 357
375 3300013296 Ga0157374_10000027 Ga0157374_1000002776 357
376 3300013296 Ga0157374_10009273 Ga0157374_100092735 357
377 3300013296 Ga0157374_10015811 Ga0157374_100158112 357
378 3300013296 Ga0157374_10032340 Ga0157374_100323403 357
379 3300013296 Ga0157374_10102497 Ga0157374_101024971 357
380 3300013296 Ga0157374_10312682 Ga0157374_103126821 357
381 3300013297 Ga0157378_10003338 Ga0157378_100033386 357
382 3300013297 Ga0157378_10014172 Ga0157378_100141723 357
383 3300013297 Ga0157378_10016465 Ga0157378_100164656 357
384 3300013297 Ga0157378_10016865 Ga0157378_100168655 357
385 3300013297 Ga0157378_10045180 Ga0157378_100451802 357
386 3300013297 Ga0157378_10168388 Ga0157378_101683883 357
387 3300013306 Ga0163162_10000725 Ga0163162_1000072515 357
388 3300013306 Ga0163162_10001535 Ga0163162_100015354 357
389 3300013306 Ga0163162_10001913 Ga0163162_100019139 357
390 3300013306 Ga0163162_10002195 Ga0163162_100021957 357
391 3300013306 Ga0163162_10017145 Ga0163162_100171456 357
392 3300013306 Ga0163162_10027786 Ga0163162_100277865 357
393 3300013306 Ga0163162_10036142 Ga0163162_100361423 357
394 3300013306 Ga0163162_10048111 Ga0163162_100481113 357
395 3300013306 Ga0163162_10112259 Ga0163162_101122592 357
396 3300013306 Ga0163162_10193704 Ga0163162_101937042 357
397 3300013306 Ga0163162_10212763 Ga0163162_102127631 357
398 3300013307 Ga0157372_10017166 Ga0157372_100171663 357
399 3300013307 Ga0157372_10030119 Ga0157372_100301194 357
400 3300013307 Ga0157372_10173331 Ga0157372_101733313 357
401 3300013307 Ga0157372_10238904 Ga0157372_102389043 357
402 3300013307 Ga0157372_10542483 Ga0157372_105424831 357
403 3300013308 Ga0157375_10026885 Ga0157375_100268853 357
404 3300013308 Ga0157375_10032650 Ga0157375_100326502 357
405 3300013308 Ga0157375_10116670 Ga0157375_101166703 357
406 3300013308 Ga0157375_10360166 Ga0157375_103601662 357
407 3300014325 Ga0163163_10001644 Ga0163163_1000164420 357
408 3300014325 Ga0163163_10398443 Ga0163163_103984432 357
409 3300014745 Ga0157377_10010551 Ga0157377_100105512 357
410 3300014745 Ga0157377_10012029 Ga0157377_100120293 357
411 3300014745 Ga0157377_10014014 Ga0157377_100140142 357
412 3300014968 Ga0157379_10000810 Ga0157379_100008103 357
413 3300014968 Ga0157379_10035463 Ga0157379_100354633 357
414 3300014968 Ga0157379_10072029 Ga0157379_100720293 357
415 3300014969 Ga0157376_10008235 Ga0157376_100082353 357
416 3300014969 Ga0157376_10050156 Ga0157376_100501563 357
417 3300014969 Ga0157376_10077233 Ga0157376_100772331 357
418 3300014969 Ga0157376_10093591 Ga0157376_100935912 357
419 3300021384 Ga0213876_10003420 Ga0213876_100034207 357
420 3300025321 Ga0207656_10001907 Ga0207656_100019074 357
421 3300025321 Ga0207656_10002373 Ga0207656_100023735 357
422 3300025321 Ga0207656_10002476 Ga0207656_100024764 357
423 3300025321 Ga0207656_10016219 Ga0207656_100162192 357
424 3300025893 Ga0207682_10017202 Ga0207682_100172023 357
425 3300025900 Ga0207710_10018603 Ga0207710_100186031 357
426 3300025901 Ga0207688_10007222 Ga0207688_100072221 357
427 3300025903 Ga0207680_10000014 Ga0207680_1000001415 357
428 3300025903 Ga0207680_10015219 Ga0207680_100152193 357
429 3300025903 Ga0207680_10015294 Ga0207680_100152943 357
430 3300025904 Ga0207647_10019688 Ga0207647_100196883 357
431 3300025904 Ga0207647_10023965 Ga0207647_100239653 357
432 3300025904 Ga0207647_10027412 Ga0207647_100274123 357
433 3300025904 Ga0207647_10103079 Ga0207647_101030791 357
434 3300025904 Ga0207647_10152421 Ga0207647_101524211 357
435 3300025907 Ga0207645_10003328 Ga0207645_100033284 357
436 3300025907 Ga0207645_10018115 Ga0207645_100181154 357
437 3300025907 Ga0207645_10064304 Ga0207645_100643041 357
438 3300025907 Ga0207645_10105238 Ga0207645_101052382 357
439 3300025911 Ga0207654_10002774 Ga0207654_100027745 357
440 3300025911 Ga0207654_10005683 Ga0207654_100056834 357
441 3300025912 Ga0207707_10004563 Ga0207707_100045635 357
442 3300025913 Ga0207695_10000087 Ga0207695_10000087230 357
443 3300025913 Ga0207695_10000299 Ga0207695_1000029957 357
444 3300025913 Ga0207695_10000676 Ga0207695_1000067615 357
445 3300025913 Ga0207695_10024733 Ga0207695_100247335 357
446 3300025913 Ga0207695_10028549 Ga0207695_100285493 357
447 3300025913 Ga0207695_10125083 Ga0207695_101250832 357
448 3300025914 Ga0207671_10000533 Ga0207671_1000053340 357
449 3300025914 Ga0207671_10001854 Ga0207671_100018547 357
450 3300025914 Ga0207671_10021513 Ga0207671_100215135 357
451 3300025917 Ga0207660_10013410 Ga0207660_100134103 357
452 3300025919 Ga0207657_10003151 Ga0207657_100031517 357
453 3300025919 Ga0207657_10308641 Ga0207657_103086411 357
454 3300025920 Ga0207649_10011087 Ga0207649_100110872 357
455 3300025921 Ga0207652_10013744 Ga0207652_100137443 357
456 3300025924 Ga0207694_10122734 Ga0207694_101227342 357
457 3300025925 Ga0207650_10097012 Ga0207650_100970123 357
458 3300025925 Ga0207650_10301644 Ga0207650_103016442 357
459 3300025926 Ga0207659_10032289 Ga0207659_100322893 357
460 3300025931 Ga0207644_10025539 Ga0207644_100255394 357
461 3300025931 Ga0207644_10182360 Ga0207644_101823602 357
462 3300025932 Ga0207690_10003794 Ga0207690_100037944 357
463 3300025933 Ga0207706_10004657 Ga0207706_100046577 357
464 3300025933 Ga0207706_10015622 Ga0207706_100156224 357
465 3300025934 Ga0207686_10034702 Ga0207686_100347023 357
466 3300025934 Ga0207686_10070230 Ga0207686_100702302 357
467 3300025937 Ga0207669_10006970 Ga0207669_100069704 357
468 3300025937 Ga0207669_10091876 Ga0207669_100918763 357
469 3300025940 Ga0207691_10000234 Ga0207691_1000023435 357
470 3300025940 Ga0207691_10015317 Ga0207691_100153174 357
471 3300025940 Ga0207691_10105683 Ga0207691_101056831 357
472 3300025942 Ga0207689_10000664 Ga0207689_100006649 357
473 3300025942 Ga0207689_10002814 Ga0207689_1000281414 357
474 3300025942 Ga0207689_10003467 Ga0207689_100034677 357
475 3300025942 Ga0207689_10012563 Ga0207689_100125633 357
476 3300025942 Ga0207689_10103943 Ga0207689_101039432 357
477 3300025944 Ga0207661_10406879 Ga0207661_104068791 357
478 3300025945 Ga0207679_10002893 Ga0207679_100028932 357
479 3300025945 Ga0207679_10010064 Ga0207679_100100643 357
480 3300025945 Ga0207679_10279252 Ga0207679_102792522 357
481 3300025949 Ga0207667_10000172 Ga0207667_1000017258 357
482 3300025949 Ga0207667_10005849 Ga0207667_100058495 357
483 3300025949 Ga0207667_10056467 Ga0207667_100564672 357
484 3300025949 Ga0207667_10074035 Ga0207667_100740352 357
485 3300025949 Ga0207667_10297949 Ga0207667_102979492 357
486 3300025961 Ga0207712_10011258 Ga0207712_100112583 357
487 3300025961 Ga0207712_10019114 Ga0207712_100191142 357
488 3300025961 Ga0207712_10057965 Ga0207712_100579652 357
489 3300025961 Ga0207712_10058345 Ga0207712_100583453 357
490 3300025961 Ga0207712_10062019 Ga0207712_100620193 357
491 3300025961 Ga0207712_10151401 Ga0207712_101514012 357
492 3300025972 Ga0207668_10064997 Ga0207668_100649973 357
493 3300025981 Ga0207640_10164899 Ga0207640_101648991 357
494 3300025986 Ga0207658_10002543 Ga0207658_100025434 357
495 3300025986 Ga0207658_10024748 Ga0207658_100247482 357
496 3300025986 Ga0207658_10224509 Ga0207658_102245092 357
497 3300025986 Ga0207658_10226919 Ga0207658_102269191 357
498 3300026023 Ga0207677_10013733 Ga0207677_100137336 357
499 3300026023 Ga0207677_10026299 Ga0207677_100262992 357
500 3300026023 Ga0207677_10270022 Ga0207677_102700222 357
501 3300026035 Ga0207703_10002928 Ga0207703_100029288 357
502 3300026035 Ga0207703_10020985 Ga0207703_100209854 357
503 3300026035 Ga0207703_10110543 Ga0207703_101105431 357
504 3300026041 Ga0207639_10005873 Ga0207639_100058736 357
505 3300026041 Ga0207639_10011289 Ga0207639_100112892 357
506 3300026041 Ga0207639_10021969 Ga0207639_100219697 357
507 3300026041 Ga0207639_10047548 Ga0207639_100475482 357
508 3300026041 Ga0207639_10077413 Ga0207639_100774132 357
509 3300026041 Ga0207639_10173339 Ga0207639_101733392 357
510 3300026067 Ga0207678_10059105 Ga0207678_100591052 357
511 3300026078 Ga0207702_10047881 Ga0207702_100478812 357
512 3300026078 Ga0207702_10111931 Ga0207702_101119312 357
513 3300026088 Ga0207641_10000015 Ga0207641_10000015108 357
514 3300026088 Ga0207641_10040030 Ga0207641_100400303 357
515 3300026089 Ga0207648_10005571 Ga0207648_100055718 357
516 3300026089 Ga0207648_10009688 Ga0207648_100096885 357
517 3300026089 Ga0207648_10132232 Ga0207648_101322321 357
518 3300026089 Ga0207648_10225971 Ga0207648_102259712 357
519 3300026095 Ga0207676_10000899 Ga0207676_1000089913 357
520 3300026095 Ga0207676_10018524 Ga0207676_100185242 357
521 3300026095 Ga0207676_10040588 Ga0207676_100405883 357
522 3300026095 Ga0207676_10147163 Ga0207676_101471632 357
523 3300026116 Ga0207674_10018853 Ga0207674_100188536 357
524 3300026116 Ga0207674_10126239 Ga0207674_101262392 357
525 3300026118 Ga0207675_100009868 Ga0207675_1000098682 357
526 3300026118 Ga0207675_100021227 Ga0207675_1000212276 357
527 3300026118 Ga0207675_100030787 Ga0207675_1000307873 357
528 3300026121 Ga0207683_10018763 Ga0207683_100187632 357
529 3300026121 Ga0207683_10021082 Ga0207683_100210822 357
530 3300026142 Ga0207698_10003403 Ga0207698_100034035 357
531 3300026142 Ga0207698_10007252 Ga0207698_100072523 357
532 3300026142 Ga0207698_10009707 Ga0207698_100097074 357
533 3300026142 Ga0207698_10057416 Ga0207698_100574163 357
534 3300026142 Ga0207698_10128166 Ga0207698_101281662 357
535 3300028379 Ga0268266_10000048 Ga0268266_1000004833 357
536 3300028379 Ga0268266_10094506 Ga0268266_100945062 357
537 3300028379 Ga0268266_10102477 Ga0268266_101024771 357
538 3300028381 Ga0268264_10001687 Ga0268264_100016877 357
539 3300028381 Ga0268264_10003414 Ga0268264_100034142 357
540 3300028381 Ga0268264_10003823 Ga0268264_100038238 357
541 3300028381 Ga0268264_10010251 Ga0268264_100102515 357
542 3300028786 Ga0307517_10009783 Ga0307517_100097837 357
543 3300028794 Ga0307515_10000001 Ga0307515_100000012762 357
544 3300028794 Ga0307515_10000118 Ga0307515_100001184 357
545 3300031251 Ga0265327_10000024 Ga0265327_10000024123 357
546 3300031251 Ga0265327_10000031 Ga0265327_10000031102 357
547 3300031251 Ga0265327_10026902 Ga0265327_100269022 357
548 3300031251 Ga0265327_10027581 Ga0265327_100275812 357
549 3300031456 Ga0307513_10111970 Ga0307513_101119702 357
550 3300031616 Ga0307508_10000694 Ga0307508_100006949 357
551 3300035119 Ga0373956_0082131 Ga0373956_0082131_211_1284 357
552 3300036401 Ga0373937_0050758 Ga0373937_0050758_2539_3612 357
553 3300036401 Ga0373937_0183189 Ga0373937_0183189_466_1539 357
554 3300037471 Ga0395905_0022101 Ga0395905_0022101_2388_3461 357
555 3300039437 Ga0436365_1837098 Ga0436365_1837098_6461_7534 357
556 3300042876 Ga0451577_0014804 Ga0451577_0014804_5206_6279 357
557 3300044712 Ga0453684_0039674 Ga0453684_0039674_4181_5254 357
558 3300044712 Ga0453684_0168980 Ga0453684_0168980_1144_2217 357
559 3300044719 Ga0466971_0003395 Ga0466971_0003395_1889_2962 357
560 3300044842 Ga0466957_0054965 Ga0466957_0054965_1287_2360 357
561 3300045049 Ga0466959_0000904 Ga0466959_0000904_8494_9567 357
562 3300045051 Ga0451576_0267304 Ga0451576_0267304_368_1441 357
563 3300046460 Ga0495638_0020775 Ga0495638_0020775_193_1266 357
564 3300046460 Ga0495638_0023374 Ga0495638_0023374_2388_3470 357
565 3300046460 Ga0495638_0123599 Ga0495638_0123599_111_1184 357
566 3300046471 Ga0495650_0030464 Ga0495650_0030464_575_1648 357
567 3300046507 Ga0495606_0004864 Ga0495606_0004864_67_1140 357
568 3300046514 Ga0495618_0068606 Ga0495618_0068606_1166_2239 357
569 3300046516 Ga0495628_0212810 Ga0495628_0212810_188_1261 357
570 3300046529 Ga0495652_0234535 Ga0495652_0234535_168_1241 357
571 3300046616 Ga0495668_0003508 Ga0495668_0003508_6428_7501 357
572 3300046648 Ga0495611_0000065 Ga0495611_0000065_39793_40866 357
573 3300046694 Ga0495649_0025053 Ga0495649_0025053_2025_3098 357
574 3300047320 Ga0495672_0002281 Ga0495672_0002281_9462_10535 357
575 3300047443 Ga0495687_000129 Ga0495687_000129_69482_70564 357
576 3300047471 Ga0495684_0229279 Ga0495684_0229279_135_1208 357
577 3300047472 Ga0495686_0000005 Ga0495686_0000005_720694_721767 357
578 3300048917 Ga0496114_0245923 Ga0496114_0245923_472_1545 357
579 3300048918 Ga0496115_0220891 Ga0496115_0220891_128_1201 357
580 3300048929 Ga0496126_0310742 Ga0496126_0310742_195_1277 357
581 3300049523 Ga0501300_007311 Ga0501300_007311_16_1089 357
582 3300049569 Ga0501032_0009405 Ga0501032_0009405_5414_6487 357
583 3300049569 Ga0501032_0028589 Ga0501032_0028589_1374_2447 357
584 3300049570 Ga0501033_0031424 Ga0501033_0031424_2078_3151 357
585 3300049571 Ga0501034_0003157 Ga0501034_0003157_2544_3617 357
586 3300049571 Ga0501034_0009179 Ga0501034_0009179_4939_6012 357
587 3300049571 Ga0501034_0042674 Ga0501034_0042674_1956_3029 357
588 3300049571 Ga0501034_0221715 Ga0501034_0221715_588_1661 357
589 3300049572 Ga0501036_0007556 Ga0501036_0007556_6323_7396 357
590 3300049574 Ga0501038_0011371 Ga0501038_0011371_852_1925 357
591 3300049575 Ga0501039_0011919 Ga0501039_0011919_3437_4510 357
592 3300049579 Ga0501043_0021243 Ga0501043_0021243_1930_3003 357
593 3300049579 Ga0501043_0095054 Ga0501043_0095054_34_1107 357
594 3300049580 Ga0501046_0090632 Ga0501046_0090632_1167_2240 357
595 3300049581 Ga0501047_0006237 Ga0501047_0006237_9372_10445 357
596 3300049581 Ga0501047_0111573 Ga0501047_0111573_1007_2080 357
597 3300049586 Ga0501070_0082151 Ga0501070_0082151_449_1522 357
598 3300049586 Ga0501070_0092405 Ga0501070_0092405_995_2068 357
599 3300049589 Ga0501073_0045119 Ga0501073_0045119_503_1576 357
600 3300049589 Ga0501073_0052595 Ga0501073_0052595_1759_2832 357
601 3300049649 Ga0501198_000167 Ga0501198_000167_5188_6261 357
602 3300049652 Ga0501202_001568 Ga0501202_001568_2388_3461 357
603 3300049654 Ga0501207_001417 Ga0501207_001417_541_1614 357
604 3300049661 Ga0501217_003020 Ga0501217_003020_1749_2822 357
605 3300049661 Ga0501217_003022 Ga0501217_003022_634_1707 357
606 3300049662 Ga0501222_000629 Ga0501222_000629_3829_4902 357
607 3300049663 Ga0501223_000426 Ga0501223_000426_5820_6893 357
608 3300049668 Ga0501233_009818 Ga0501233_009818_772_1845 357
609 3300049669 Ga0501235_000033 Ga0501235_000033_20244_21317 357
610 3300049675 Ga0501243_000152 Ga0501243_000152_5404_6477 357
611 3300049686 Ga0501257_004677 Ga0501257_004677_245_1318 357
612 3300049688 Ga0501259_000375 Ga0501259_000375_2500_3573 357
613 3300049688 Ga0501259_001723 Ga0501259_001723_1165_2238 357
614 3300049689 Ga0501260_001544 Ga0501260_001544_398_1471 357
615 3300049704 Ga0501221_000120 Ga0501221_000120_139_1212 357
616 3300049705 Ga0501225_0003232 Ga0501225_0003232_3509_4582 357
617 3300049707 Ga0501234_000621 Ga0501234_000621_1557_2630 357
618 3300049708 Ga0501245_000053 Ga0501245_000053_6289_7362 357
619 3300049742 Ga0501080_0049017 Ga0501080_0049017_210_1283 357
620 3300049742 Ga0501080_0093829 Ga0501080_0093829_1641_2714 357
621 3300049742 Ga0501080_0174212 Ga0501080_0174212_815_1888 357
622 3300049744 Ga0501083_0059245 Ga0501083_0059245_985_2058 357
623 3300049761 Ga0501264_002416 Ga0501264_002416_430_1503 357
624 3300049765 Ga0501268_001584 Ga0501268_001584_1055_2128 357
625 3300049822 Ga0501035_0082060 Ga0501035_0082060_539_1612 357
626 3300049822 Ga0501035_0215079 Ga0501035_0215079_171_1244 357
627 3300049822 Ga0501035_0219186 Ga0501035_0219186_402_1475 357
628 3300049823 Ga0501044_0009473 Ga0501044_0009473_8848_9921 357
629 3300049823 Ga0501044_0043392 Ga0501044_0043392_469_1542 357
630 3300049823 Ga0501044_0063526 Ga0501044_0063526_2679_3752 357
631 3300049823 Ga0501044_0092825 Ga0501044_0092825_906_1979 357
632 3300049823 Ga0501044_0097102 Ga0501044_0097102_1452_2525 357
633 3300049824 Ga0501045_0078786 Ga0501045_0078786_935_2008 357
634 3300049851 Ga0501212_002902 Ga0501212_002902_429_1502 357
635 3300050493 nmdc:mga0k408_24705_c1 nmdc:mga0k408_24705_c1_493_1566 357
636 3300050507 nmdc:mga05p37_24567_c2 nmdc:mga05p37_24567_c2_613_1686 357
637 3300050508 nmdc:mga09592_13139_c1 nmdc:mga09592_13139_c1_1240_2313 357
638 3300050510 nmdc:mga06r32_9580_c1 nmdc:mga06r32_9580_c1_5531_6604 357
639 3300050511 nmdc:mga08y16_76772_c1 nmdc:mga08y16_76772_c1_578_1651 357
640 3300053108 Ga0500562_000070 Ga0500562_000070_42774_43850 357
641 3300053118 Ga0500594_0007656 Ga0500594_0007656_1233_2309 357
642 3300053139 Ga0500568_0003989 Ga0500568_0003989_2047_3129 357
643 3300053146 Ga0500588_0004746 Ga0500588_0004746_1441_2514 357
644 3300053151 Ga0500604_0001556 Ga0500604_0001556_868_1941 357
645 3300053156 Ga0500622_0001947 Ga0500622_0001947_13763_14845 357
646 3300053727 Ga0500611_000003 Ga0500611_000003_87770_88852 357
647 3300060353 Ga0501082_0059741 Ga0501082_0059741_840_1913 357
648 3300061719 Ga0466962_0003789 Ga0466962_0003789_5884_6957 357
649 2162886007 SwRhRL2b_contig_1886170 SwRhRL2b_0728.00009280 358
650 3300001979 JGI24740J21852_10000359 JGI24740J21852_1000035912 358
651 3300002738 JGI25154J39366_1000023 JGI25154J39366_1000023122 358
652 3300003215 JGI25153J46596_10017854 JGI25153J46596_100178542 358
653 3300003215 JGI25153J46596_10023624 JGI25153J46596_100236241 358
654 3300003323 rootH1_10042049 rootH1_100420497 358
655 3300003354 JGI25160J50197_1006556 JGI25160J50197_10065565 358
656 3300003771 Ga0055526_1019922 Ga0055526_10199221 358
657 3300003790 Ga0055528_1003039 Ga0055528_10030397 358
658 3300003791 Ga0055530_10000118 Ga0055530_1000011852 358
659 3300003794 Ga0055531_10000054 Ga0055531_1000005451 358
660 3300003794 Ga0055531_10031787 Ga0055531_100317872 358
661 3300004625 Ga0055543_1012077 Ga0055543_10120772 358
662 3300005262 Ga0065165_1000027 Ga0065165_100002794 358
663 3300005289 Ga0065704_10070159 Ga0065704_10070159159 358
664 3300005289 Ga0065704_10077260 Ga0065704_100772603 358
665 3300005563 Ga0068855_100004683 Ga0068855_10000468314 358
666 3300009147 Ga0114129_10037600 Ga0114129_100376004 358
667 3300009545 Ga0105237_10057800 Ga0105237_100578005 358
668 3300025208 Ga0209436_101411 Ga0209436_1014112 358
669 3300025242 Ga0209258_100302 Ga0209258_10030232 358
670 3300025246 Ga0209646_1000004 Ga0209646_1000004476 358
671 3300025250 Ga0209026_1000095 Ga0209026_100009584 358
672 3300025254 Ga0209148_1000131 Ga0209148_100013149 358
673 3300025273 Ga0209673_1000078 Ga0209673_1000078194 358
674 3300025295 Ga0209564_1003616 Ga0209564_10036162 358
675 3300025297 Ga0209758_1005348 Ga0209758_100534813 358
676 3300025297 Ga0209758_1005622 Ga0209758_10056229 358
677 3300025297 Ga0209758_1009342 Ga0209758_10093424 358
678 3300025298 Ga0209050_1000097 Ga0209050_1000097208 358
679 3300025302 Ga0207426_1000313 Ga0207426_10003137 358
680 3300025302 Ga0207426_1000541 Ga0207426_100054114 358
681 3300025302 Ga0207426_1010348 Ga0207426_10103482 358
682 3300025302 Ga0207426_1015383 Ga0207426_10153832 358
683 3300025304 Ga0209257_1000070 Ga0209257_100007057 358
684 3300025304 Ga0209257_1004414 Ga0209257_100441416 358
685 3300025904 Ga0207647_10013211 Ga0207647_100132115 358
686 3300025913 Ga0207695_10006435 Ga0207695_100064353 358
687 3300025914 Ga0207671_10000102 Ga0207671_1000010220 358
688 3300025949 Ga0207667_10004715 Ga0207667_100047155 358
689 3300026116 Ga0207674_10139245 Ga0207674_101392452 358
690 3300028379 Ga0268266_10003786 Ga0268266_1000378615 358
691 3300031507 Ga0307509_10121615 Ga0307509_101216152 358
692 3300041404 Ga0439436_0005908 Ga0439436_0005908_2305_3399 358
693 3300042007 Ga0439449_0021694 Ga0439449_0021694_723_1817 358
694 3300042014 Ga0439457_001270 Ga0439457_001270_127_1221 358
695 3300042015 Ga0439462_0003887 Ga0439462_0003887_60_1154 358
696 3300044656 Ga0466969_0002500 Ga0466969_0002500_3688_4782 358
697 3300044658 Ga0466972_0000044 Ga0466972_0000044_66607_67701 358
698 3300044658 Ga0466972_0100299 Ga0466972_0100299_164_1258 358
699 3300044684 Ga0466966_0002591 Ga0466966_0002591_3110_4204 358
700 3300044693 Ga0466961_0032307 Ga0466961_0032307_2014_3108 358
701 3300044735 Ga0466968_0008477 Ga0466968_0008477_700_1791 358
702 3300044765 Ga0466970_0004594 Ga0466970_0004594_700_1791 358
703 3300044842 Ga0466957_0014978 Ga0466957_0014978_1121_2215 358
704 3300044901 Ga0466960_0022501 Ga0466960_0022501_390_1484 358
705 3300045049 Ga0466959_0000045 Ga0466959_0000045_5317_6411 358
706 3300046453 Ga0495627_006679 Ga0495627_006679_3018_4094 358
707 3300046558 Ga0495633_0000125 Ga0495633_0000125_88253_89329 358
708 3300047318 Ga0495636_0000026 Ga0495636_0000026_6674_7786 358
709 3300047320 Ga0495672_0036643 Ga0495672_0036643_403_1494 358
710 3300048924 Ga0496121_0000081 Ga0496121_0000081_42165_43241 358
711 3300048929 Ga0496126_0012204 Ga0496126_0012204_2798_3874 358
712 3300049571 Ga0501034_0153559 Ga0501034_0153559_332_1408 358
713 3300049581 Ga0501047_0078887 Ga0501047_0078887_2022_3116 358
714 3300049705 Ga0501225_0003564 Ga0501225_0003564_1997_3091 358
715 3300049758 Ga0501241_002043 Ga0501241_002043_1902_2978 358
716 3300049758 Ga0501241_012824 Ga0501241_012824_227_1303 358
717 3300049823 Ga0501044_0004638 Ga0501044_0004638_120_1214 358
718 3300050507 nmdc:mga05p37_58974_c1 nmdc:mga05p37_58974_c1_759_1853 358
719 3300053086 Ga0500578_0000026 Ga0500578_0000026_108085_109179 358
720 3300053088 Ga0500644_0000026 Ga0500644_0000026_36697_37773 358
721 3300053092 Ga0500583_0000001 Ga0500583_0000001_143866_144960 358
722 3300053092 Ga0500583_0004221 Ga0500583_0004221_3479_4555 358
723 3300053092 Ga0500583_0017888 Ga0500583_0017888_131_1225 358
724 3300053093 Ga0500651_0001573 Ga0500651_0001573_505_1581 358
725 3300053103 Ga0500555_013807 Ga0500555_013807_953_2047 358
726 3300053109 Ga0500569_000432 Ga0500569_000432_4692_5768 358
727 3300053131 Ga0500652_005247 Ga0500652_005247_2764_3840 358
728 3300053134 Ga0500658_0002669 Ga0500658_0002669_362_1438 358
729 3300053136 Ga0500559_0010116 Ga0500559_0010116_2255_3331 358
730 3300053142 Ga0500577_0002713 Ga0500577_0002713_719_1795 358
731 3300053147 Ga0500589_018253 Ga0500589_018253_612_1706 358
732 3300053148 Ga0500590_089851 Ga0500590_089851_320_1396 358
733 3300053153 Ga0500616_0047309 Ga0500616_0047309_874_1950 358
734 3300053156 Ga0500622_0014304 Ga0500622_0014304_312_1406 358
735 3300053160 Ga0500633_0000253 Ga0500633_0000253_846_1922 358
736 3300053177 Ga0500636_0012621 Ga0500636_0012621_2896_3972 358
737 3300053727 Ga0500611_009641 Ga0500611_009641_399_1493 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00465

Fe-ADH

Iron-containing alcohol dehydrogenase

64

229

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k8c-assembly1.cif.gz_A-2 x-ray structure of kdnb, 3-deoxy-alpha-d-manno-octulosonate 8-oxidase, from shewanella oneidensis 0.9563 1 358
3rf7-assembly1.cif.gz_A-2 crystal structure of an iron-containing alcohol dehydrogenase (sden_2133) from shewanella denitrificans os-217 at 2.12 a resolution 0.9449 1 358
3rf7-assembly1.cif.gz_A-2 crystal structure of an iron-containing alcohol dehydrogenase (sden_2133) from shewanella denitrificans os-217 at 2.12 a resolution 0.9373 1 358
3owo-assembly2.cif.gz_D structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor 0.8571 5 355
3owo-assembly2.cif.gz_D structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor 0.8393 5 355
ID Description Score Start End Superfamily
5k8cA02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9759 184 358 1.20.1090.10
5k8cA02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9703 184 358 1.20.1090.10
3rf7A02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9501 184 358 1.20.1090.10
3rf7A02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9445 184 358 1.20.1090.10
3rf7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9232 2 183 3.40.50.1970
ID Description Score Start End GO Terms
AF-M3GDM2-F1-model_v4 Alcohol dehydrogenase iron-type/glycerol dehydrogenase GldA domain-containing protein 0.9763 243 358 GO:0016491
GO:0046872
AF-A0A4Q6BAJ9-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9665 8 315 GO:0004022
GO:0046872
AF-A0A4Q6BAJ9-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9634 8 315 GO:0004022
GO:0046872
AF-A0A7W6ERF9-F1-model_v4 3-deoxy-alpha-D-manno-octulosonate 8-oxidase (EC 1.1.3.48) 0.9548 4 358 GO:0004022
GO:0046872
AF-M3GDM2-F1-model_v4 Alcohol dehydrogenase iron-type/glycerol dehydrogenase GldA domain-containing protein 0.9521 243 358 GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.84 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map