F478315

General Info

Members Datasets Scaffolds Average Seq Length
737 329 1474 70

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_11140896|Ga0070701_111408961
Length 70
Sequence MSDHVYGVSEIVGSSPESIERAIENALARARKTMRNLDWFEVVGTRGHLTEDGAVGHYQVTVKVGFRIEG

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
184 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
185 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
195 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
198 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
199 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
200 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
206 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
207 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
208 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
305 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
306 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
307 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 4.88
Rhizosphere 89.15
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_11140896 3300005438 Unclassified 550
2 LJQas_1001166 3300000549 Bacteria 3969
3 JGI24740J21852_10098159 3300001979 Bacteria 748
4 JGI24739J22299_10110045 3300001989 Bacteria 827
5 JGI24737J22298_10113612 3300001990 Bacteria 801
6 JGI24735J21928_10011591 3300002067 Bacteria 2793
7 JGI24735J21928_10126072 3300002067 Bacteria 737
8 JGI24735J21928_10157746 3300002067 Bacteria 655
9 JGI24738J21930_10108878 3300002075 Bacteria 596
10 Ga0070658_10019535 3300005327 Bacteria 5425
11 Ga0070658_10020162 3300005327 Bacteria 5341
12 Ga0070658_10044246 3300005327 Bacteria 3598
13 Ga0070658_10349118 3300005327 Bacteria 1266
14 Ga0070683_100001806 3300005329 Bacteria 16680
15 Ga0070683_100032964 3300005329 Bacteria 4721
16 Ga0070683_100180573 3300005329 Bacteria 2003
17 Ga0070683_100538900 3300005329 Bacteria 1116
18 Ga0070683_100772474 3300005329 Bacteria 921
19 Ga0070683_101878559 3300005329 Bacteria 576
20 Ga0070670_100588783 3300005331 Bacteria 995
21 Ga0070680_100264706 3300005336 Bacteria 1455
22 Ga0070680_100620858 3300005336 Bacteria 928
23 Ga0070682_100282157 3300005337 Bacteria 1211
24 Ga0070682_100289302 3300005337 Bacteria 1198
25 Ga0070682_100567219 3300005337 Bacteria 891
26 Ga0070682_100922240 3300005337 Bacteria 719
27 Ga0068868_100072712 3300005338 Bacteria 2744
28 Ga0068868_101060422 3300005338 Bacteria 744
29 Ga0070660_100025118 3300005339 Bacteria 4427
30 Ga0070660_100451241 3300005339 Bacteria 1067
31 Ga0070660_100711897 3300005339 Bacteria 842
32 Ga0070660_100910285 3300005339 Bacteria 742
33 Ga0070661_100317638 3300005344 Bacteria 1216
34 Ga0070661_101010075 3300005344 Bacteria 690
35 Ga0070692_10012405 3300005345 Bacteria 3944
36 Ga0070692_11170661 3300005345 Bacteria 546
37 Ga0070675_100470817 3300005354 Bacteria 1129
38 Ga0070671_101411338 3300005355 Bacteria 615
39 Ga0070659_100013936 3300005366 Bacteria 5999
40 Ga0070659_100127466 3300005366 Bacteria 2065
41 Ga0070659_100157315 3300005366 Bacteria 1856
42 Ga0070659_100846768 3300005366 Bacteria 797
43 Ga0070659_100851487 3300005366 Bacteria 795
44 Ga0070659_102057949 3300005366 Bacteria 513
45 Ga0070667_101008046 3300005367 Bacteria 777
46 Ga0070709_10000127 3300005434 Bacteria 50350
47 Ga0070714_100023793 3300005435 Bacteria 5037
48 Ga0070714_100038729 3300005435 Bacteria 4009
49 Ga0070714_100095188 3300005435 Bacteria 2615
50 Ga0070713_100100561 3300005436 Bacteria 2503
51 Ga0070713_100114989 3300005436 Bacteria 2351
52 Ga0070710_10000784 3300005437 Bacteria 15212
53 Ga0070701_10417687 3300005438 Bacteria 854
54 Ga0070711_100001819 3300005439 Bacteria 11901
55 Ga0070711_100462735 3300005439 Bacteria 1040
56 Ga0070700_100505317 3300005441 Bacteria 931
57 Ga0070700_101907548 3300005441 Bacteria 514
58 Ga0070663_100114439 3300005455 Bacteria 2031
59 Ga0070663_100155250 3300005455 Bacteria 1758
60 Ga0070663_100874407 3300005455 Bacteria 775
61 Ga0070663_101378527 3300005455 Bacteria 624
62 Ga0070663_101539252 3300005455 Bacteria 592
63 Ga0070678_100290472 3300005456 Bacteria 1386
64 Ga0070678_101360049 3300005456 Bacteria 662
65 Ga0070662_100124868 3300005457 Bacteria 1977
66 Ga0070662_101221818 3300005457 Bacteria 646
67 Ga0070681_10243148 3300005458 Bacteria 1713
68 Ga0070681_10342954 3300005458 Bacteria 1404
69 Ga0070681_10359680 3300005458 Bacteria 1366
70 Ga0070681_11428379 3300005458 Bacteria 616
71 Ga0070685_10201156 3300005466 Bacteria 1295
72 Ga0070685_10405736 3300005466 Bacteria 945
73 Ga0070698_100098159 3300005471 Bacteria 2904
74 Ga0070679_100001650 3300005530 Bacteria 20104
75 Ga0070679_100167403 3300005530 Bacteria 2171
76 Ga0070679_100605442 3300005530 Bacteria 1039
77 Ga0070684_100006850 3300005535 Bacteria 8842
78 Ga0070684_100873932 3300005535 Bacteria 842
79 Ga0068853_100051178 3300005539 Bacteria 3555
80 Ga0070672_101581963 3300005543 Bacteria 588
81 Ga0070672_101934276 3300005543 Bacteria 531
82 Ga0070672_102085138 3300005543 Bacteria 511
83 Ga0070686_101330054 3300005544 Bacteria 601
84 Ga0070695_100474975 3300005545 Bacteria 962
85 Ga0070693_100608504 3300005547 Bacteria 790
86 Ga0070693_101192408 3300005547 Unclassified 584
87 Ga0070665_100002138 3300005548 Bacteria 22051
88 Ga0070704_100677800 3300005549 Bacteria 912
89 Ga0068855_100286164 3300005563 Bacteria 1828
90 Ga0068855_101333146 3300005563 Bacteria 742
91 Ga0070664_100398010 3300005564 Bacteria 1259
92 Ga0070664_100541439 3300005564 Bacteria 1076
93 Ga0068857_100459042 3300005577 Bacteria 1192
94 Ga0068857_100702479 3300005577 Bacteria 961
95 Ga0068857_101306303 3300005577 Bacteria 704
96 Ga0068857_102475428 3300005577 Bacteria 510
97 Ga0068854_100390624 3300005578 Bacteria 1149
98 Ga0068856_100155251 3300005614 Bacteria 2299
99 Ga0068856_100259246 3300005614 Bacteria 1754
100 Ga0068856_100849070 3300005614 Bacteria 932
101 Ga0070702_100008024 3300005615 Bacteria 5093
102 Ga0070702_101531041 3300005615 Bacteria 550
103 Ga0068852_101558406 3300005616 Bacteria 683
104 Ga0068864_100227988 3300005618 Bacteria 1722
105 Ga0068861_100093434 3300005719 Bacteria 2378
106 Ga0068861_101710936 3300005719 Bacteria 622
107 Ga0068870_10283988 3300005840 Bacteria 1039
108 Ga0068870_10611063 3300005840 Bacteria 742
109 Ga0068870_11036015 3300005840 Bacteria 587
110 Ga0068870_11432489 3300005840 Bacteria 507
111 Ga0068863_102068139 3300005841 Bacteria 579
112 Ga0068863_102229346 3300005841 Bacteria 558
113 Ga0068858_100044307 3300005842 Bacteria 4124
114 Ga0068858_100819400 3300005842 Unclassified 908
115 Ga0068860_100171472 3300005843 Bacteria 2096
116 Ga0068862_102580482 3300005844 Bacteria 520
117 Ga0081455_10087337 3300005937 Bacteria 2537
118 Ga0081538_10030062 3300005981 Bacteria 3696
119 Ga0081538_10102118 3300005981 Bacteria 1440
120 Ga0070717_10072323 3300006028 Bacteria 2879
121 Ga0070717_10092244 3300006028 Bacteria 2558
122 Ga0070717_10163492 3300006028 Bacteria 1932
123 Ga0075365_10004607 3300006038 Bacteria 7335
124 Ga0075365_10019433 3300006038 Bacteria 4194
125 Ga0075363_100709249 3300006048 Bacteria 608
126 Ga0075363_100957968 3300006048 Bacteria 526
127 Ga0075364_10258332 3300006051 Bacteria 1184
128 Ga0075364_11068904 3300006051 Bacteria 548
129 Ga0075364_11105733 3300006051 Bacteria 538
130 Ga0070716_100005662 3300006173 Bacteria 6069
131 Ga0070712_100131197 3300006175 Bacteria 1899
132 Ga0075367_10139910 3300006178 Bacteria 1499
133 Ga0075366_11006001 3300006195 Bacteria 520
134 Ga0097621_100572599 3300006237 Bacteria 1030
135 Ga0097621_101561190 3300006237 Bacteria 627
136 Ga0097621_101746514 3300006237 Bacteria 593
137 Ga0075370_10150112 3300006353 Bacteria 1366
138 Ga0075428_100825309 3300006844 Bacteria 985
139 Ga0075430_100149203 3300006846 Bacteria 1947
140 Ga0075431_100001884 3300006847 Bacteria 19894
141 Ga0075434_101430737 3300006871 Bacteria 701
142 Ga0068865_100301858 3300006881 Bacteria 1282
143 Ga0068865_102091545 3300006881 Bacteria 515
144 Ga0075436_100829008 3300006914 Bacteria 690
145 Ga0075435_100265803 3300007076 Bacteria 1462
146 Ga0075435_100463240 3300007076 Bacteria 1094
147 Ga0075435_101210865 3300007076 Bacteria 661
148 Ga0105240_10235027 3300009093 Bacteria 2128
149 Ga0111539_12369412 3300009094 Bacteria 616
150 Ga0105245_10001693 3300009098 Bacteria 20060
151 Ga0105245_11306864 3300009098 Bacteria 774
152 Ga0105245_11745821 3300009098 Bacteria 675
153 Ga0114129_10448839 3300009147 Bacteria 1691
154 Ga0105243_10261347 3300009148 Bacteria 1550
155 Ga0105243_10461074 3300009148 Bacteria 1195
156 Ga0105243_10635341 3300009148 Bacteria 1033
157 Ga0105243_10955721 3300009148 Bacteria 856
158 Ga0105243_10988202 3300009148 Bacteria 843
159 Ga0105243_11635850 3300009148 Bacteria 671
160 Ga0105241_12479168 3300009174 Bacteria 519
161 Ga0105242_10148050 3300009176 Bacteria 2044
162 Ga0105242_10349414 3300009176 Bacteria 1365
163 Ga0105242_11144962 3300009176 Bacteria 794
164 Ga0105242_11519823 3300009176 Bacteria 701
165 Ga0105242_11663837 3300009176 Bacteria 673
166 Ga0105242_11934198 3300009176 Bacteria 631
167 Ga0105248_10182476 3300009177 Bacteria 2365
168 Ga0105248_12465716 3300009177 Bacteria 593
169 Ga0105237_10278140 3300009545 Bacteria 1676
170 Ga0105237_10692336 3300009545 Bacteria 1026
171 Ga0105237_12037937 3300009545 Bacteria 583
172 Ga0105238_10213699 3300009551 Bacteria 1905
173 Ga0105238_11097872 3300009551 Bacteria 818
174 Ga0105238_11311519 3300009551 Bacteria 750
175 Ga0105249_10082982 3300009553 Bacteria 2982
176 Ga0105249_10103892 3300009553 Bacteria 2677
177 Ga0105249_12597613 3300009553 Bacteria 579
178 Ga0105239_10018579 3300010375 Bacteria 7680
179 Ga0105239_11398880 3300010375 Bacteria 808
180 Ga0105246_10011047 3300011119 Bacteria 5595
181 Ga0105246_11496491 3300011119 Bacteria 634
182 Ga0105246_12378886 3300011119 Bacteria 519
183 Ga0157371_10866295 3300013102 Bacteria 683
184 Ga0157370_10143651 3300013104 Bacteria 2223
185 Ga0157369_10192611 3300013105 Bacteria 2142
186 Ga0157369_11668518 3300013105 Bacteria 648
187 Ga0157374_10206344 3300013296 Bacteria 1926
188 Ga0157372_10005313 3300013307 Bacteria 13680
189 Ga0157372_10685353 3300013307 Bacteria 1193
190 Ga0157372_11447281 3300013307 Bacteria 792
191 Ga0157372_13190853 3300013307 Bacteria 523
192 Ga0157372_13489935 3300013307 Bacteria 500
193 Ga0157375_10033623 3300013308 Bacteria 4874
194 Ga0157375_10219300 3300013308 Bacteria 2060
195 Ga0157375_10701731 3300013308 Bacteria 1165
196 Ga0163163_10220407 3300014325 Bacteria 1946
197 Ga0163163_10293781 3300014325 Bacteria 1677
198 Ga0163163_10827335 3300014325 Bacteria 989
199 Ga0163163_13309283 3300014325 Bacteria 502
200 Ga0157380_10219727 3300014326 Bacteria 1699
201 Ga0157380_10536603 3300014326 Bacteria 1145
202 Ga0157380_11336238 3300014326 Bacteria 765
203 Ga0182008_10128323 3300014497 Bacteria 1263
204 Ga0182008_10553847 3300014497 Bacteria 639
205 Ga0157377_10800614 3300014745 Bacteria 695
206 Ga0157379_10080977 3300014968 Bacteria 2909
207 Ga0157376_11329016 3300014969 Bacteria 749
208 Ga0163161_10245028 3300017792 Bacteria 1395
209 Ga0163161_10733221 3300017792 Bacteria 825
210 Ga0163161_11830108 3300017792 Bacteria 540
211 Ga0206350_11265071 3300020080 Bacteria 716
212 Ga0206354_10173222 3300020081 Bacteria 1870
213 Ga0206353_11262172 3300020082 Bacteria 3168
214 Ga0206353_11864213 3300020082 Bacteria 2573
215 Ga0213876_10434724 3300021384 Bacteria 698
216 Ga0224712_10026676 3300022467 Bacteria 2045
217 Ga0207692_10037810 3300025898 Bacteria 2363
218 Ga0207642_10076824 3300025899 Bacteria 1609
219 Ga0207647_10082627 3300025904 Bacteria 1924
220 Ga0207685_10174546 3300025905 Bacteria 992
221 Ga0207699_10000282 3300025906 Bacteria 27821
222 Ga0207643_10344199 3300025908 Bacteria 935
223 Ga0207705_10023104 3300025909 Bacteria 4435
224 Ga0207705_10137949 3300025909 Bacteria 1819
225 Ga0207707_10495352 3300025912 Bacteria 1043
226 Ga0207707_11156664 3300025912 Bacteria 628
227 Ga0207671_10419011 3300025914 Bacteria 1065
228 Ga0207693_10034453 3300025915 Bacteria 3993
229 Ga0207663_10004313 3300025916 Bacteria 7059
230 Ga0207660_10402342 3300025917 Bacteria 1103
231 Ga0207660_10755303 3300025917 Bacteria 794
232 Ga0207660_11670451 3300025917 Bacteria 513
233 Ga0207657_10146687 3300025919 Bacteria 1924
234 Ga0207657_10194559 3300025919 Bacteria 1634
235 Ga0207652_10053483 3300025921 Bacteria 3468
236 Ga0207652_10517420 3300025921 Bacteria 1074
237 Ga0207694_10253049 3300025924 Bacteria 1442
238 Ga0207700_10000402 3300025928 Bacteria 25312
239 Ga0207664_10001056 3300025929 Bacteria 18371
240 Ga0207664_11602296 3300025929 Bacteria 573
241 Ga0207644_11538574 3300025931 Bacteria 558
242 Ga0207690_10758337 3300025932 Bacteria 800
243 Ga0207690_11792074 3300025932 Bacteria 513
244 Ga0207706_10375659 3300025933 Bacteria 1234
245 Ga0207686_10167696 3300025934 Bacteria 1545
246 Ga0207686_10610821 3300025934 Bacteria 859
247 Ga0207686_11400913 3300025934 Bacteria 575
248 Ga0207709_10623494 3300025935 Bacteria 856
249 Ga0207669_11073907 3300025937 Bacteria 679
250 Ga0207669_11361594 3300025937 Bacteria 604
251 Ga0207704_10131387 3300025938 Bacteria 1735
252 Ga0207704_11204676 3300025938 Bacteria 646
253 Ga0207665_10000371 3300025939 Bacteria 31095
254 Ga0207691_11046612 3300025940 Bacteria 680
255 Ga0207711_11740699 3300025941 Bacteria 567
256 Ga0207689_10354605 3300025942 Bacteria 1220
257 Ga0207661_10176154 3300025944 Bacteria 1865
258 Ga0207661_10366696 3300025944 Bacteria 1302
259 Ga0207661_12128970 3300025944 Bacteria 507
260 Ga0207679_10974876 3300025945 Bacteria 777
261 Ga0207667_10314760 3300025949 Bacteria 1599
262 Ga0207667_10497272 3300025949 Bacteria 1237
263 Ga0207712_10705528 3300025961 Bacteria 881
264 Ga0207668_11351090 3300025972 Bacteria 642
265 Ga0207658_10472205 3300025986 Bacteria 1113
266 Ga0207677_10516925 3300026023 Bacteria 1035
267 Ga0207678_10100389 3300026067 Bacteria 2472
268 Ga0207702_10223961 3300026078 Bacteria 1754
269 Ga0207641_10827778 3300026088 Bacteria 917
270 Ga0207641_11985958 3300026088 Bacteria 583
271 Ga0207676_10159255 3300026095 Bacteria 1954
272 Ga0207676_11828587 3300026095 Bacteria 606
273 Ga0207674_11026665 3300026116 Bacteria 794
274 Ga0207674_11182426 3300026116 Bacteria 734
275 Ga0207675_100324918 3300026118 Bacteria 1503
276 Ga0207683_10446091 3300026121 Bacteria 1193
277 Ga0207683_12108537 3300026121 Bacteria 512
278 Ga0268266_10001498 3300028379 Bacteria 27603
279 Ga0268266_11197011 3300028379 Bacteria 735
280 Ga0316176_1209356 3300030732 Bacteria 764
281 Ga0316181_1043557 3300030744 Bacteria 709
282 Ga0316182_1198914 3300030745 Bacteria 1059
283 Ga0265340_10010203 3300031247 Bacteria 5030
284 Ga0265340_10015515 3300031247 Bacteria 3957
285 Ga0307408_101741919 3300031548 Bacteria 594
286 Ga0265314_10224858 3300031711 Bacteria 1093
287 Ga0307405_10298044 3300031731 Bacteria 1222
288 Ga0307405_10543162 3300031731 Bacteria 939
289 Ga0307405_10656700 3300031731 Bacteria 863
290 Ga0307405_11128270 3300031731 Bacteria 675
291 Ga0307405_11489110 3300031731 Bacteria 594
292 Ga0307413_10396329 3300031824 Bacteria 1080
293 Ga0307413_10662372 3300031824 Bacteria 862
294 Ga0307413_10932041 3300031824 Bacteria 740
295 Ga0307413_11292509 3300031824 Bacteria 638
296 Ga0307413_12061777 3300031824 Bacteria 515
297 Ga0307410_10075416 3300031852 Bacteria 2351
298 Ga0307410_10444690 3300031852 Bacteria 1056
299 Ga0307410_10634651 3300031852 Bacteria 894
300 Ga0307410_10688472 3300031852 Bacteria 861
301 Ga0307410_11015179 3300031852 Bacteria 716
302 Ga0307410_11241325 3300031852 Bacteria 650
303 Ga0307410_11276041 3300031852 Bacteria 642
304 Ga0307406_10314697 3300031901 Bacteria 1208
305 Ga0307406_10792779 3300031901 Bacteria 799
306 Ga0307406_11083948 3300031901 Bacteria 691
307 Ga0307406_11125583 3300031901 Bacteria 679
308 Ga0307406_11519656 3300031901 Bacteria 590
309 Ga0307407_10037183 3300031903 Bacteria 2688
310 Ga0307407_10689299 3300031903 Bacteria 768
311 Ga0307407_11562581 3300031903 Bacteria 523
312 Ga0307412_10137793 3300031911 Bacteria 1783
313 Ga0307412_10243484 3300031911 Bacteria 1392
314 Ga0307412_11139525 3300031911 Bacteria 696
315 Ga0307412_11562851 3300031911 Bacteria 601
316 Ga0307412_11626579 3300031911 Bacteria 590
317 Ga0307409_100010585 3300031995 Bacteria 5748
318 Ga0307409_100200484 3300031995 Bacteria 1785
319 Ga0307409_100279016 3300031995 Bacteria 1543
320 Ga0307409_100402071 3300031995 Bacteria 1308
321 Ga0307409_101271810 3300031995 Bacteria 760
322 Ga0307409_101348717 3300031995 Bacteria 739
323 Ga0307416_100039667 3300032002 Bacteria 3649
324 Ga0307416_100347456 3300032002 Bacteria 1499
325 Ga0307416_100410276 3300032002 Bacteria 1395
326 Ga0307416_100502263 3300032002 Bacteria 1277
327 Ga0307416_101325225 3300032002 Bacteria 826
328 Ga0307416_102293470 3300032002 Bacteria 640
329 Ga0307416_103120655 3300032002 Bacteria 554
330 Ga0307416_103597929 3300032002 Bacteria 519
331 Ga0307414_10102521 3300032004 Bacteria 2157
332 Ga0307414_10124796 3300032004 Bacteria 1987
333 Ga0307414_10194055 3300032004 Bacteria 1646
334 Ga0307414_11542216 3300032004 Bacteria 619
335 Ga0307414_12264524 3300032004 Bacteria 507
336 Ga0307411_10130815 3300032005 Bacteria 1834
337 Ga0307411_11128422 3300032005 Bacteria 708
338 Ga0307411_11597135 3300032005 Bacteria 602
339 Ga0307411_12191524 3300032005 Bacteria 518
340 Ga0307411_12322808 3300032005 Bacteria 504
341 Ga0307415_100300924 3300032126 Bacteria 1329
342 Ga0307415_100475324 3300032126 Bacteria 1087
343 Ga0307415_100574914 3300032126 Bacteria 998
344 Ga0307415_100609973 3300032126 Bacteria 972
345 Ga0373926_0104628 3300035083 Bacteria 1060
346 Ga0373945_0486752 3300035116 Bacteria 548
347 Ga0373954_0011338 3300035118 Bacteria 3947
348 Ga0373943_0070169 3300035170 Bacteria 1772
349 Ga0373943_0419334 3300035170 Bacteria 774
350 Ga0373946_0557905 3300035171 Bacteria 591
351 Ga0373955_0896667 3300035172 Bacteria 545
352 Ga0373924_0548640 3300035410 Bacteria 520
353 Ga0373935_0139544 3300035692 Bacteria 1636
354 Ga0373935_0202722 3300035692 Bacteria 1371
355 Ga0373935_0392767 3300035692 Bacteria 995
356 Ga0373935_0983777 3300035692 Bacteria 626
357 Ga0373927_0176369 3300035695 Bacteria 1401
358 Ga0373947_0044863 3300035725 Bacteria 2644
359 Ga0373947_0221861 3300035725 Bacteria 1243
360 Ga0373925_0248747 3300037068 Bacteria 1425
361 Ga0373925_1420059 3300037068 Bacteria 568
362 Ga0395899_0073670 3300037312 Bacteria 2496
363 Ga0395900_0052896 3300037418 Bacteria 4180
364 Ga0395900_0164967 3300037418 Bacteria 2258
365 Ga0395900_0232736 3300037418 Bacteria 1852
366 Ga0395900_1744616 3300037418 Bacteria 533
367 Ga0395898_0015871 3300037466 Bacteria 7717
368 Ga0395898_0468760 3300037466 Bacteria 1199
369 Ga0395898_0586512 3300037466 Bacteria 1057
370 Ga0395898_0681992 3300037466 Bacteria 970
371 Ga0395898_0904561 3300037466 Bacteria 821
372 Ga0395898_1194213 3300037466 Bacteria 692
373 Ga0436364_0524011 3300037853 Bacteria 608
374 Ga0436364_0925193 3300037853 Bacteria 533
375 Ga0436364_1423578 3300037853 Bacteria 1076
376 Ga0395901_0106789 3300038443 Bacteria 2938
377 Ga0395901_0134818 3300038443 Bacteria 2595
378 Ga0395901_0602824 3300038443 Bacteria 1107
379 Ga0395901_0821290 3300038443 Bacteria 917
380 Ga0436365_1035431 3300039437 Bacteria 907
381 Ga0439438_080908 3300041405 Bacteria 797
382 Ga0439447_083577 3300041407 Bacteria 736
383 Ga0439461_0012394 3300041410 Bacteria 1595
384 Ga0439465_0029636 3300041413 Bacteria 1739
385 Ga0451789_0248771 3300041443 Bacteria 584
386 Ga0451789_0509550 3300041443 Bacteria 558
387 Ga0451791_0373122 3300041451 Bacteria 661
388 Ga0451791_0589256 3300041451 Bacteria 605
389 Ga0451791_1784525 3300041451 Bacteria 594
390 Ga0451797_0049139 3300041453 Bacteria 1355
391 Ga0451795_0035257 3300041456 Bacteria 652
392 Ga0451795_0684106 3300041456 Bacteria 572
393 Ga0451795_0828052 3300041456 Bacteria 531
394 Ga0451795_0860972 3300041456 Bacteria 665
395 Ga0451795_1696669 3300041456 Bacteria 566
396 Ga0451804_0821661 3300041463 Bacteria 583
397 Ga0451807_0827381 3300041486 Bacteria 562
398 Ga0451807_2091981 3300041486 Bacteria 620
399 Ga0451833_0964934 3300041491 Bacteria 569
400 Ga0451835_0671451 3300041492 Bacteria 1198
401 Ga0451837_0209718 3300041494 Bacteria 512
402 Ga0451837_0627568 3300041494 Bacteria 591
403 Ga0451837_1012088 3300041494 Bacteria 511
404 Ga0451841_0469501 3300041498 Bacteria 1045
405 Ga0451841_0515756 3300041498 Bacteria 766
406 Ga0451845_0839430 3300041501 Bacteria 543
407 Ga0451847_0314208 3300041503 Bacteria 665
408 Ga0451849_0343437 3300041505 Bacteria 531
409 Ga0451851_1334333 3300041507 Bacteria 705
410 Ga0451843_0958363 3300041509 Bacteria 1625
411 Ga0451853_0465648 3300041512 Bacteria 1319
412 Ga0451853_1078120 3300041512 Bacteria 2231
413 Ga0451853_3166153 3300041512 Bacteria 697
414 Ga0439431_0183060 3300041997 Bacteria 605
415 Ga0439442_026112 3300042002 Bacteria 1216
416 Ga0439445_0025076 3300042004 Bacteria 1520
417 Ga0439432_142806 3300042006 Bacteria 704
418 Ga0439457_133824 3300042014 Bacteria 591
419 Ga0450906_063704 3300042145 Bacteria 657
420 Ga0439446_0016939 3300042156 Bacteria 2033
421 Ga0439434_0217591 3300042435 Bacteria 647
422 Ga0466969_0295333 3300044656 Bacteria 733
423 Ga0466972_0393660 3300044658 Bacteria 649
424 Ga0466972_0539923 3300044658 Unclassified 550
425 Ga0466972_0628415 3300044658 Bacteria 508
426 Ga0466965_0007590 3300044683 Bacteria 4990
427 Ga0466965_0013853 3300044683 Bacteria 3809
428 Ga0466965_0045940 3300044683 Bacteria 2161
429 Ga0466965_0056129 3300044683 Bacteria 1961
430 Ga0466965_0376593 3300044683 Bacteria 781
431 Ga0466965_0599654 3300044683 Bacteria 626
432 Ga0466961_0056993 3300044693 Bacteria 2488
433 Ga0466961_0446687 3300044693 Bacteria 783
434 Ga0466961_0716432 3300044693 Bacteria 599
435 Ga0466961_0732583 3300044693 Bacteria 591
436 Ga0466961_0937019 3300044693 Bacteria 515
437 Ga0466963_0011791 3300044694 Bacteria 5331
438 Ga0466963_0029764 3300044694 Bacteria 3518
439 Ga0466963_0212705 3300044694 Bacteria 1353
440 Ga0466963_0241398 3300044694 Bacteria 1267
441 Ga0466963_0359914 3300044694 Bacteria 1025
442 Ga0466963_0410242 3300044694 Bacteria 955
443 Ga0466963_0932842 3300044694 Bacteria 611
444 Ga0466964_0012667 3300044706 Bacteria 3193
445 Ga0466964_0241492 3300044706 Bacteria 886
446 Ga0466964_0245380 3300044706 Bacteria 880
447 Ga0466964_0302449 3300044706 Unclassified 807
448 Ga0466964_0420606 3300044706 Bacteria 702
449 Ga0466971_0044596 3300044719 Bacteria 1991
450 Ga0466971_0107290 3300044719 Unclassified 1287
451 Ga0466971_0342813 3300044719 Bacteria 722
452 Ga0466968_0065183 3300044735 Bacteria 1577
453 Ga0466970_0004377 3300044765 Bacteria 6957
454 Ga0466970_0007199 3300044765 Bacteria 5572
455 Ga0466970_0026245 3300044765 Bacteria 3053
456 Ga0466970_0066922 3300044765 Bacteria 1929
457 Ga0466970_0124706 3300044765 Bacteria 1412
458 Ga0466970_0229215 3300044765 Bacteria 1038
459 Ga0466957_0070541 3300044842 Bacteria 2159
460 Ga0466957_0107654 3300044842 Bacteria 1765
461 Ga0466957_0208557 3300044842 Bacteria 1286
462 Ga0466957_0776773 3300044842 Bacteria 679
463 Ga0466957_0991639 3300044842 Bacteria 603
464 Ga0466957_1408443 3300044842 Bacteria 507
465 Ga0466960_0003656 3300044901 Bacteria 5932
466 Ga0466960_0049465 3300044901 Bacteria 2024
467 Ga0466960_0052035 3300044901 Bacteria 1980
468 Ga0466960_0069325 3300044901 Bacteria 1752
469 Ga0466960_0170861 3300044901 Bacteria 1173
470 Ga0466960_0201734 3300044901 Bacteria 1087
471 Ga0466960_0240612 3300044901 Bacteria 1002
472 Ga0466960_0320238 3300044901 Bacteria 878
473 Ga0466960_0889046 3300044901 Bacteria 543
474 Ga0466960_0930446 3300044901 Bacteria 531
475 Ga0466959_0170464 3300045049 Bacteria 1527
476 Ga0466959_0742886 3300045049 Bacteria 657
477 Ga0466959_0906865 3300045049 Bacteria 588
478 Ga0466958_0023786 3300045836 Bacteria 3600
479 Ga0466958_0890140 3300045836 Bacteria 581
480 Ga0466967_0015080 3300045976 Bacteria 6047
481 Ga0466967_0019494 3300045976 Bacteria 5455
482 Ga0466967_0025517 3300045976 Bacteria 4875
483 Ga0466967_0043085 3300045976 Bacteria 3906
484 Ga0466967_0062264 3300045976 Bacteria 3311
485 Ga0466967_0138809 3300045976 Bacteria 2262
486 Ga0466967_0209348 3300045976 Bacteria 1849
487 Ga0466967_0213110 3300045976 Bacteria 1833
488 Ga0466967_0391677 3300045976 Bacteria 1350
489 Ga0466967_0490703 3300045976 Bacteria 1204
490 Ga0466967_0772361 3300045976 Bacteria 953
491 Ga0466967_1041558 3300045976 Bacteria 815
492 Ga0466967_1136421 3300045976 Bacteria 778
493 Ga0466967_2268931 3300045976 Bacteria 538
494 Ga0495603_0187395 3300046455 Bacteria 1196
495 Ga0495629_0189767 3300046459 Bacteria 1422
496 Ga0495641_0105593 3300046461 Bacteria 1256
497 Ga0495653_0072448 3300046463 Bacteria 2572
498 Ga0495580_0075780 3300046472 Bacteria 2346
499 Ga0495582_0213027 3300046473 Bacteria 1104
500 Ga0495639_0203860 3300046475 Bacteria 969
501 Ga0495662_0214651 3300046476 Bacteria 948
502 Ga0495664_0049100 3300046477 Bacteria 2505
503 Ga0495664_0506104 3300046477 Bacteria 721
504 Ga0495618_0064044 3300046514 Bacteria 2335
505 Ga0495618_0250129 3300046514 Bacteria 1112
506 Ga0495620_0302720 3300046515 Bacteria 608
507 Ga0495628_0946029 3300046516 Bacteria 595
508 Ga0495630_0379659 3300046517 Bacteria 1082
509 Ga0495666_0121785 3300046526 Bacteria 1221
510 Ga0495652_0518004 3300046529 Bacteria 824
511 Ga0495652_0614973 3300046529 Bacteria 739
512 Ga0495640_0157619 3300046533 Bacteria 1456
513 Ga0495586_0166600 3300046535 Bacteria 1244
514 Ga0495645_0143442 3300046543 Bacteria 1664
515 Ga0495645_0880956 3300046543 Bacteria 532
516 Ga0495667_0776312 3300046559 Bacteria 592
517 Ga0495634_0496695 3300046642 Bacteria 715
518 Ga0495635_0036793 3300046663 Bacteria 3390
519 Ga0495635_0058795 3300046663 Bacteria 2644
520 Ga0495646_0192495 3300046680 Bacteria 1114
521 Ga0495646_0340872 3300046680 Bacteria 786
522 Ga0495647_0029189 3300046681 Bacteria 2038
523 Ga0495658_0195360 3300046683 Bacteria 1259
524 Ga0495658_0444866 3300046683 Bacteria 828
525 Ga0495613_0032371 3300046689 Bacteria 3884
526 Ga0495624_0033131 3300046690 Bacteria 3347
527 Ga0495671_0421094 3300046692 Bacteria 639
528 Ga0495600_0956669 3300046809 Bacteria 503
529 Ga0495581_0028519 3300047315 Bacteria 3235
530 Ga0495604_0394326 3300047317 Bacteria 912
531 Ga0495674_0264809 3300047319 Bacteria 1411
532 Ga0495674_0613806 3300047319 Bacteria 860
533 Ga0495676_0232251 3300047321 Bacteria 1266
534 Ga0495680_0205262 3300047322 Bacteria 1412
535 Ga0495684_0179951 3300047471 Bacteria 1567
536 Ga0495684_0183411 3300047471 Bacteria 1550
537 Ga0495593_0067201 3300047673 Bacteria 1866
538 Ga0495593_0496848 3300047673 Bacteria 611
539 Ga0495602_0179678 3300048088 Bacteria 1633
540 Ga0495614_0161208 3300048089 Bacteria 1003
541 Ga0496100_0982190 3300048903 Bacteria 664
542 Ga0496101_0072799 3300048904 Bacteria 2523
543 Ga0496102_0135848 3300048905 Bacteria 2304
544 Ga0496102_0153199 3300048905 Bacteria 2167
545 Ga0496102_0456363 3300048905 Bacteria 1199
546 Ga0496102_1652167 3300048905 Bacteria 559
547 Ga0496103_0339576 3300048906 Bacteria 966
548 Ga0496104_0809206 3300048907 Bacteria 843
549 Ga0496107_0146884 3300048910 Bacteria 1744
550 Ga0496108_0330035 3300048911 Bacteria 1330
551 Ga0496108_0345737 3300048911 Bacteria 1298
552 Ga0496109_0086240 3300048912 Bacteria 2899
553 Ga0496109_0473452 3300048912 Bacteria 1183
554 Ga0496109_0505982 3300048912 Bacteria 1140
555 Ga0496109_1224618 3300048912 Bacteria 687
556 Ga0496110_0111850 3300048913 Bacteria 2455
557 Ga0496110_0605397 3300048913 Bacteria 994
558 Ga0496111_0112682 3300048914 Bacteria 2004
559 Ga0496111_0590240 3300048914 Bacteria 814
560 Ga0496114_0165454 3300048917 Bacteria 1925
561 Ga0496114_0254335 3300048917 Bacteria 1546
562 Ga0496114_1799814 3300048917 Bacteria 500
563 Ga0496122_0020321 3300048925 Bacteria 6007
564 Ga0496123_0006607 3300048926 Bacteria 11200
565 Ga0496124_0762328 3300048927 Bacteria 605
566 Ga0496125_0374423 3300048928 Bacteria 842
567 Ga0501317_000764 3300049533 Bacteria 2465
568 Ga0501031_0122899 3300049568 Bacteria 1695
569 Ga0501031_0128037 3300049568 Bacteria 1659
570 Ga0501031_0151805 3300049568 Bacteria 1514
571 Ga0501031_0373916 3300049568 Bacteria 922
572 Ga0501031_0463001 3300049568 Bacteria 819
573 Ga0501031_0523306 3300049568 Bacteria 764
574 Ga0501032_0003721 3300049569 Bacteria 11571
575 Ga0501032_0209446 3300049569 Bacteria 1271
576 Ga0501032_0404433 3300049569 Bacteria 877
577 Ga0501033_0002287 3300049570 Bacteria 16379
578 Ga0501033_0049240 3300049570 Bacteria 3128
579 Ga0501033_0588202 3300049570 Bacteria 764
580 Ga0501034_0084000 3300049571 Bacteria 3186
581 Ga0501034_0206005 3300049571 Bacteria 1923
582 Ga0501036_0081597 3300049572 Bacteria 2733
583 Ga0501036_0215618 3300049572 Bacteria 1612
584 Ga0501036_0419313 3300049572 Bacteria 1116
585 Ga0501036_0498784 3300049572 Bacteria 1013
586 Ga0501036_0998708 3300049572 Bacteria 685
587 Ga0501037_0086250 3300049573 Bacteria 2273
588 Ga0501037_0796201 3300049573 Bacteria 624
589 Ga0501038_0001814 3300049574 Bacteria 19778
590 Ga0501038_0078537 3300049574 Bacteria 2785
591 Ga0501038_0507216 3300049574 Bacteria 922
592 Ga0501039_0021927 3300049575 Bacteria 4901
593 Ga0501039_0029131 3300049575 Bacteria 4252
594 Ga0501039_0266715 3300049575 Bacteria 1346
595 Ga0501039_0271604 3300049575 Bacteria 1333
596 Ga0501039_0667031 3300049575 Bacteria 814
597 Ga0501039_0669520 3300049575 Bacteria 812
598 Ga0501039_0682865 3300049575 Bacteria 803
599 Ga0501039_0984253 3300049575 Bacteria 656
600 Ga0501039_1144738 3300049575 Bacteria 602
601 Ga0501039_1504338 3300049575 Bacteria 517
602 Ga0501040_0108977 3300049576 Bacteria 1936
603 Ga0501040_0125632 3300049576 Bacteria 1802
604 Ga0501040_0206160 3300049576 Bacteria 1397
605 Ga0501040_0276468 3300049576 Bacteria 1199
606 Ga0501041_0537841 3300049577 Bacteria 744
607 Ga0501041_0698254 3300049577 Bacteria 649
608 Ga0501041_0831662 3300049577 Bacteria 592
609 Ga0501042_0222315 3300049578 Bacteria 1362
610 Ga0501042_0898464 3300049578 Bacteria 645
611 Ga0501043_0029528 3300049579 Bacteria 4308
612 Ga0501043_0068693 3300049579 Bacteria 2782
613 Ga0501043_1110455 3300049579 Bacteria 558
614 Ga0501043_1271120 3300049579 Bacteria 514
615 Ga0501046_0000400 3300049580 Bacteria 43372
616 Ga0501046_0025772 3300049580 Bacteria 4808
617 Ga0501046_0483650 3300049580 Bacteria 888
618 Ga0501047_0006675 3300049581 Bacteria 10845
619 Ga0501047_0126422 3300049581 Bacteria 2437
620 Ga0501047_0524280 3300049581 Bacteria 1010
621 Ga0501047_0744206 3300049581 Bacteria 796
622 Ga0501048_0050353 3300049582 Bacteria 2966
623 Ga0501048_0328961 3300049582 Bacteria 1089
624 Ga0501048_0389378 3300049582 Bacteria 996
625 Ga0501048_0391851 3300049582 Bacteria 992
626 Ga0501048_0807333 3300049582 Bacteria 674
627 Ga0501067_0009760 3300049583 Bacteria 5312
628 Ga0501067_0046830 3300049583 Bacteria 2400
629 Ga0501067_0499802 3300049583 Bacteria 680
630 Ga0501068_0005940 3300049584 Bacteria 6702
631 Ga0501068_0358603 3300049584 Bacteria 937
632 Ga0501068_0452278 3300049584 Bacteria 831
633 Ga0501069_0223665 3300049585 Bacteria 1094
634 Ga0501069_0488255 3300049585 Bacteria 734
635 Ga0501069_0515233 3300049585 Bacteria 714
636 Ga0501069_0934688 3300049585 Bacteria 528
637 Ga0501070_0005820 3300049586 Bacteria 10519
638 Ga0501070_0012371 3300049586 Bacteria 7198
639 Ga0501070_0035249 3300049586 Bacteria 4182
640 Ga0501070_0213747 3300049586 Bacteria 1582
641 Ga0501070_0354813 3300049586 Bacteria 1190
642 Ga0501070_0639594 3300049586 Bacteria 845
643 Ga0501070_0937158 3300049586 Bacteria 674
644 Ga0501071_0017351 3300049587 Bacteria 4962
645 Ga0501071_0210488 3300049587 Bacteria 1462
646 Ga0501071_0288665 3300049587 Bacteria 1242
647 Ga0501071_0391303 3300049587 Bacteria 1061
648 Ga0501071_0852089 3300049587 Bacteria 703
649 Ga0501071_1199836 3300049587 Bacteria 586
650 Ga0501071_1335733 3300049587 Bacteria 554
651 Ga0501071_1592749 3300049587 Bacteria 504
652 Ga0501072_0157552 3300049588 Bacteria 1811
653 Ga0501072_0231123 3300049588 Bacteria 1473
654 Ga0501072_0242745 3300049588 Bacteria 1435
655 Ga0501072_0264222 3300049588 Bacteria 1370
656 Ga0501072_0493593 3300049588 Bacteria 968
657 Ga0501073_0024892 3300049589 Bacteria 4295
658 Ga0501073_0057620 3300049589 Bacteria 2716
659 Ga0501074_0010032 3300049590 Bacteria 6874
660 Ga0501074_0083389 3300049590 Bacteria 2292
661 Ga0501074_0100888 3300049590 Bacteria 2066
662 Ga0501074_0459619 3300049590 Bacteria 902
663 Ga0501074_0483605 3300049590 Bacteria 877
664 Ga0501074_0600055 3300049590 Bacteria 779
665 Ga0501074_1197457 3300049590 Bacteria 533
666 Ga0501075_0270795 3300049591 Bacteria 1294
667 Ga0501075_0346647 3300049591 Bacteria 1132
668 Ga0501075_0572964 3300049591 Bacteria 861
669 Ga0501075_0919418 3300049591 Bacteria 665
670 Ga0501076_0062924 3300049592 Bacteria 2956
671 Ga0501076_0506558 3300049592 Bacteria 995
672 Ga0501076_0794821 3300049592 Bacteria 781
673 Ga0501076_0859848 3300049592 Bacteria 748
674 Ga0501076_1067597 3300049592 Bacteria 665
675 Ga0501076_1673137 3300049592 Bacteria 522
676 Ga0501077_0027914 3300049593 Bacteria 3585
677 Ga0501216_150859 3300049660 Bacteria 552
678 Ga0501217_195141 3300049661 Bacteria 628
679 Ga0501253_135215 3300049683 Bacteria 609
680 Ga0501261_117709 3300049690 Bacteria 523
681 Ga0501079_0019015 3300049741 Bacteria 5248
682 Ga0501079_0415371 3300049741 Bacteria 1056
683 Ga0501079_0507556 3300049741 Bacteria 948
684 Ga0501079_0862232 3300049741 Bacteria 713
685 Ga0501080_0018824 3300049742 Bacteria 6394
686 Ga0501080_0675020 3300049742 Bacteria 913
687 Ga0501080_1283556 3300049742 Bacteria 627
688 Ga0501080_1580170 3300049742 Bacteria 556
689 Ga0501081_1145816 3300049743 Bacteria 589
690 Ga0501081_1376407 3300049743 Bacteria 535
691 Ga0501083_0013861 3300049744 Bacteria 5636
692 Ga0501083_0139589 3300049744 Bacteria 1587
693 Ga0501083_1019344 3300049744 Bacteria 539
694 Ga0501035_0083470 3300049822 Bacteria 2818
695 Ga0501035_0381851 3300049822 Bacteria 1175
696 Ga0501035_1111067 3300049822 Bacteria 617
697 Ga0501044_0641001 3300049823 Bacteria 952
698 Ga0501045_0257992 3300049824 Bacteria 1297
699 Ga0501045_0333030 3300049824 Bacteria 1130
700 Ga0501045_0371725 3300049824 Bacteria 1064
701 Ga0501045_0372327 3300049824 Bacteria 1063
702 Ga0501045_0392586 3300049824 Bacteria 1033
703 Ga0501045_0773284 3300049824 Bacteria 707
704 Ga0501045_0800765 3300049824 Bacteria 694
705 nmdc:mga03n38_132848_c1 3300050490 Bacteria 1235
706 nmdc:mga00v17_808319_c1 3300050491 Bacteria 597
707 nmdc:mga00v17_822354_c1 3300050491 Bacteria 591
708 nmdc:mga00v17_826322_c1 3300050491 Bacteria 589
709 nmdc:mga00v17_851435_c1 3300050491 Bacteria 579
710 nmdc:mga0yw44_150493_c1 3300050492 Bacteria 1518
711 nmdc:mga0yw44_22819_c1 3300050492 Bacteria 3515
712 nmdc:mga06z11_159050_c1 3300050494 Bacteria 1290
713 nmdc:mga07m45_634268_c1 3300050496 Bacteria 616
714 nmdc:mga0qj67_51683_c1 3300050509 Bacteria 3250
715 nmdc:mga06r32_1482_c1 3300050510 Bacteria 21098
716 nmdc:mga06r32_1822623_c1 3300050510 Bacteria 544
717 nmdc:mga0rr50_1150357_c1 3300050513 Bacteria 660
718 nmdc:mga0rr50_688469_c1 3300050513 Bacteria 873
719 nmdc:mga08x19_296564_c1 3300050514 Bacteria 1122
720 Ga0495601_0037994 3300053077 Bacteria 3009
721 Ga0495601_0871836 3300053077 Bacteria 569
722 Ga0500556_0000676 3300053104 Bacteria 21088
723 Ga0501084_0012903 3300054114 Bacteria 6919
724 Ga0501084_0662596 3300054114 Bacteria 881
725 Ga0501084_1518511 3300054114 Bacteria 560
726 Ga0501082_0012185 3300060353 Bacteria 7388
727 Ga0501082_0569349 3300060353 Bacteria 991
728 Ga0466962_0022166 3300061719 Bacteria 3050
729 Ga0466962_0060186 3300061719 Bacteria 1813
730 Ga0466962_0182720 3300061719 Bacteria 1022
731 Ga0466962_0241288 3300061719 Unclassified 887
732 Ga0466962_0520402 3300061719 Bacteria 603
733 Ga0530510_0163993 3300061734 Bacteria 1644
734 Ga0530510_0272191 3300061734 Bacteria 1264
735 Ga0530510_0532515 3300061734 Bacteria 891
736 Ga0530510_0569685 3300061734 Bacteria 861
737 Ga0530510_0864519 3300061734 Bacteria 691
738 Ga0070701_11140896
739 LJQas_1001166
740 JGI24740J21852_10098159
741 JGI24739J22299_10110045
742 JGI24737J22298_10113612
743 JGI24735J21928_10011591
744 JGI24735J21928_10126072
745 JGI24735J21928_10157746
746 JGI24738J21930_10108878
747 Ga0070658_10019535
748 Ga0070658_10020162
749 Ga0070658_10044246
750 Ga0070658_10349118
751 Ga0070683_100001806
752 Ga0070683_100032964
753 Ga0070683_100180573
754 Ga0070683_100538900
755 Ga0070683_100772474
756 Ga0070683_101878559
757 Ga0070670_100588783
758 Ga0070680_100264706
759 Ga0070680_100620858
760 Ga0070682_100282157
761 Ga0070682_100289302
762 Ga0070682_100567219
763 Ga0070682_100922240
764 Ga0068868_100072712
765 Ga0068868_101060422
766 Ga0070660_100025118
767 Ga0070660_100451241
768 Ga0070660_100711897
769 Ga0070660_100910285
770 Ga0070661_100317638
771 Ga0070661_101010075
772 Ga0070692_10012405
773 Ga0070692_11170661
774 Ga0070675_100470817
775 Ga0070671_101411338
776 Ga0070659_100013936
777 Ga0070659_100127466
778 Ga0070659_100157315
779 Ga0070659_100846768
780 Ga0070659_100851487
781 Ga0070659_102057949
782 Ga0070667_101008046
783 Ga0070709_10000127
784 Ga0070714_100023793
785 Ga0070714_100038729
786 Ga0070714_100095188
787 Ga0070713_100100561
788 Ga0070713_100114989
789 Ga0070710_10000784
790 Ga0070701_10417687
791 Ga0070711_100001819
792 Ga0070711_100462735
793 Ga0070700_100505317
794 Ga0070700_101907548
795 Ga0070663_100114439
796 Ga0070663_100155250
797 Ga0070663_100874407
798 Ga0070663_101378527
799 Ga0070663_101539252
800 Ga0070678_100290472
801 Ga0070678_101360049
802 Ga0070662_100124868
803 Ga0070662_101221818
804 Ga0070681_10243148
805 Ga0070681_10342954
806 Ga0070681_10359680
807 Ga0070681_11428379
808 Ga0070685_10201156
809 Ga0070685_10405736
810 Ga0070698_100098159
811 Ga0070679_100001650
812 Ga0070679_100167403
813 Ga0070679_100605442
814 Ga0070684_100006850
815 Ga0070684_100873932
816 Ga0068853_100051178
817 Ga0070672_101581963
818 Ga0070672_101934276
819 Ga0070672_102085138
820 Ga0070686_101330054
821 Ga0070695_100474975
822 Ga0070693_100608504
823 Ga0070693_101192408
824 Ga0070665_100002138
825 Ga0070704_100677800
826 Ga0068855_100286164
827 Ga0068855_101333146
828 Ga0070664_100398010
829 Ga0070664_100541439
830 Ga0068857_100459042
831 Ga0068857_100702479
832 Ga0068857_101306303
833 Ga0068857_102475428
834 Ga0068854_100390624
835 Ga0068856_100155251
836 Ga0068856_100259246
837 Ga0068856_100849070
838 Ga0070702_100008024
839 Ga0070702_101531041
840 Ga0068852_101558406
841 Ga0068864_100227988
842 Ga0068861_100093434
843 Ga0068861_101710936
844 Ga0068870_10283988
845 Ga0068870_10611063
846 Ga0068870_11036015
847 Ga0068870_11432489
848 Ga0068863_102068139
849 Ga0068863_102229346
850 Ga0068858_100044307
851 Ga0068858_100819400
852 Ga0068860_100171472
853 Ga0068862_102580482
854 Ga0081455_10087337
855 Ga0081538_10030062
856 Ga0081538_10102118
857 Ga0070717_10072323
858 Ga0070717_10092244
859 Ga0070717_10163492
860 Ga0075365_10004607
861 Ga0075365_10019433
862 Ga0075363_100709249
863 Ga0075363_100957968
864 Ga0075364_10258332
865 Ga0075364_11068904
866 Ga0075364_11105733
867 Ga0070716_100005662
868 Ga0070712_100131197
869 Ga0075367_10139910
870 Ga0075366_11006001
871 Ga0097621_100572599
872 Ga0097621_101561190
873 Ga0097621_101746514
874 Ga0075370_10150112
875 Ga0075428_100825309
876 Ga0075430_100149203
877 Ga0075431_100001884
878 Ga0075434_101430737
879 Ga0068865_100301858
880 Ga0068865_102091545
881 Ga0075436_100829008
882 Ga0075435_100265803
883 Ga0075435_100463240
884 Ga0075435_101210865
885 Ga0105240_10235027
886 Ga0111539_12369412
887 Ga0105245_10001693
888 Ga0105245_11306864
889 Ga0105245_11745821
890 Ga0114129_10448839
891 Ga0105243_10261347
892 Ga0105243_10461074
893 Ga0105243_10635341
894 Ga0105243_10955721
895 Ga0105243_10988202
896 Ga0105243_11635850
897 Ga0105241_12479168
898 Ga0105242_10148050
899 Ga0105242_10349414
900 Ga0105242_11144962
901 Ga0105242_11519823
902 Ga0105242_11663837
903 Ga0105242_11934198
904 Ga0105248_10182476
905 Ga0105248_12465716
906 Ga0105237_10278140
907 Ga0105237_10692336
908 Ga0105237_12037937
909 Ga0105238_10213699
910 Ga0105238_11097872
911 Ga0105238_11311519
912 Ga0105249_10082982
913 Ga0105249_10103892
914 Ga0105249_12597613
915 Ga0105239_10018579
916 Ga0105239_11398880
917 Ga0105246_10011047
918 Ga0105246_11496491
919 Ga0105246_12378886
920 Ga0157371_10866295
921 Ga0157370_10143651
922 Ga0157369_10192611
923 Ga0157369_11668518
924 Ga0157374_10206344
925 Ga0157372_10005313
926 Ga0157372_10685353
927 Ga0157372_11447281
928 Ga0157372_13190853
929 Ga0157372_13489935
930 Ga0157375_10033623
931 Ga0157375_10219300
932 Ga0157375_10701731
933 Ga0163163_10220407
934 Ga0163163_10293781
935 Ga0163163_10827335
936 Ga0163163_13309283
937 Ga0157380_10219727
938 Ga0157380_10536603
939 Ga0157380_11336238
940 Ga0182008_10128323
941 Ga0182008_10553847
942 Ga0157377_10800614
943 Ga0157379_10080977
944 Ga0157376_11329016
945 Ga0163161_10245028
946 Ga0163161_10733221
947 Ga0163161_11830108
948 Ga0206350_11265071
949 Ga0206354_10173222
950 Ga0206353_11262172
951 Ga0206353_11864213
952 Ga0213876_10434724
953 Ga0224712_10026676
954 Ga0207692_10037810
955 Ga0207642_10076824
956 Ga0207647_10082627
957 Ga0207685_10174546
958 Ga0207699_10000282
959 Ga0207643_10344199
960 Ga0207705_10023104
961 Ga0207705_10137949
962 Ga0207707_10495352
963 Ga0207707_11156664
964 Ga0207671_10419011
965 Ga0207693_10034453
966 Ga0207663_10004313
967 Ga0207660_10402342
968 Ga0207660_10755303
969 Ga0207660_11670451
970 Ga0207657_10146687
971 Ga0207657_10194559
972 Ga0207652_10053483
973 Ga0207652_10517420
974 Ga0207694_10253049
975 Ga0207700_10000402
976 Ga0207664_10001056
977 Ga0207664_11602296
978 Ga0207644_11538574
979 Ga0207690_10758337
980 Ga0207690_11792074
981 Ga0207706_10375659
982 Ga0207686_10167696
983 Ga0207686_10610821
984 Ga0207686_11400913
985 Ga0207709_10623494
986 Ga0207669_11073907
987 Ga0207669_11361594
988 Ga0207704_10131387
989 Ga0207704_11204676
990 Ga0207665_10000371
991 Ga0207691_11046612
992 Ga0207711_11740699
993 Ga0207689_10354605
994 Ga0207661_10176154
995 Ga0207661_10366696
996 Ga0207661_12128970
997 Ga0207679_10974876
998 Ga0207667_10314760
999 Ga0207667_10497272
1000 Ga0207712_10705528
1001 Ga0207668_11351090
1002 Ga0207658_10472205
1003 Ga0207677_10516925
1004 Ga0207678_10100389
1005 Ga0207702_10223961
1006 Ga0207641_10827778
1007 Ga0207641_11985958
1008 Ga0207676_10159255
1009 Ga0207676_11828587
1010 Ga0207674_11026665
1011 Ga0207674_11182426
1012 Ga0207675_100324918
1013 Ga0207683_10446091
1014 Ga0207683_12108537
1015 Ga0268266_10001498
1016 Ga0268266_11197011
1017 Ga0316176_1209356
1018 Ga0316181_1043557
1019 Ga0316182_1198914
1020 Ga0265340_10010203
1021 Ga0265340_10015515
1022 Ga0307408_101741919
1023 Ga0265314_10224858
1024 Ga0307405_10298044
1025 Ga0307405_10543162
1026 Ga0307405_10656700
1027 Ga0307405_11128270
1028 Ga0307405_11489110
1029 Ga0307413_10396329
1030 Ga0307413_10662372
1031 Ga0307413_10932041
1032 Ga0307413_11292509
1033 Ga0307413_12061777
1034 Ga0307410_10075416
1035 Ga0307410_10444690
1036 Ga0307410_10634651
1037 Ga0307410_10688472
1038 Ga0307410_11015179
1039 Ga0307410_11241325
1040 Ga0307410_11276041
1041 Ga0307406_10314697
1042 Ga0307406_10792779
1043 Ga0307406_11083948
1044 Ga0307406_11125583
1045 Ga0307406_11519656
1046 Ga0307407_10037183
1047 Ga0307407_10689299
1048 Ga0307407_11562581
1049 Ga0307412_10137793
1050 Ga0307412_10243484
1051 Ga0307412_11139525
1052 Ga0307412_11562851
1053 Ga0307412_11626579
1054 Ga0307409_100010585
1055 Ga0307409_100200484
1056 Ga0307409_100279016
1057 Ga0307409_100402071
1058 Ga0307409_101271810
1059 Ga0307409_101348717
1060 Ga0307416_100039667
1061 Ga0307416_100347456
1062 Ga0307416_100410276
1063 Ga0307416_100502263
1064 Ga0307416_101325225
1065 Ga0307416_102293470
1066 Ga0307416_103120655
1067 Ga0307416_103597929
1068 Ga0307414_10102521
1069 Ga0307414_10124796
1070 Ga0307414_10194055
1071 Ga0307414_11542216
1072 Ga0307414_12264524
1073 Ga0307411_10130815
1074 Ga0307411_11128422
1075 Ga0307411_11597135
1076 Ga0307411_12191524
1077 Ga0307411_12322808
1078 Ga0307415_100300924
1079 Ga0307415_100475324
1080 Ga0307415_100574914
1081 Ga0307415_100609973
1082 Ga0373926_0104628
1083 Ga0373945_0486752
1084 Ga0373954_0011338
1085 Ga0373943_0070169
1086 Ga0373943_0419334
1087 Ga0373946_0557905
1088 Ga0373955_0896667
1089 Ga0373924_0548640
1090 Ga0373935_0139544
1091 Ga0373935_0202722
1092 Ga0373935_0392767
1093 Ga0373935_0983777
1094 Ga0373927_0176369
1095 Ga0373947_0044863
1096 Ga0373947_0221861
1097 Ga0373925_0248747
1098 Ga0373925_1420059
1099 Ga0395899_0073670
1100 Ga0395900_0052896
1101 Ga0395900_0164967
1102 Ga0395900_0232736
1103 Ga0395900_1744616
1104 Ga0395898_0015871
1105 Ga0395898_0468760
1106 Ga0395898_0586512
1107 Ga0395898_0681992
1108 Ga0395898_0904561
1109 Ga0395898_1194213
1110 Ga0436364_0524011
1111 Ga0436364_0925193
1112 Ga0436364_1423578
1113 Ga0395901_0106789
1114 Ga0395901_0134818
1115 Ga0395901_0602824
1116 Ga0395901_0821290
1117 Ga0436365_1035431
1118 Ga0439438_080908
1119 Ga0439447_083577
1120 Ga0439461_0012394
1121 Ga0439465_0029636
1122 Ga0451789_0248771
1123 Ga0451789_0509550
1124 Ga0451791_0373122
1125 Ga0451791_0589256
1126 Ga0451791_1784525
1127 Ga0451797_0049139
1128 Ga0451795_0035257
1129 Ga0451795_0684106
1130 Ga0451795_0828052
1131 Ga0451795_0860972
1132 Ga0451795_1696669
1133 Ga0451804_0821661
1134 Ga0451807_0827381
1135 Ga0451807_2091981
1136 Ga0451833_0964934
1137 Ga0451835_0671451
1138 Ga0451837_0209718
1139 Ga0451837_0627568
1140 Ga0451837_1012088
1141 Ga0451841_0469501
1142 Ga0451841_0515756
1143 Ga0451845_0839430
1144 Ga0451847_0314208
1145 Ga0451849_0343437
1146 Ga0451851_1334333
1147 Ga0451843_0958363
1148 Ga0451853_0465648
1149 Ga0451853_1078120
1150 Ga0451853_3166153
1151 Ga0439431_0183060
1152 Ga0439442_026112
1153 Ga0439445_0025076
1154 Ga0439432_142806
1155 Ga0439457_133824
1156 Ga0450906_063704
1157 Ga0439446_0016939
1158 Ga0439434_0217591
1159 Ga0466969_0295333
1160 Ga0466972_0393660
1161 Ga0466972_0539923
1162 Ga0466972_0628415
1163 Ga0466965_0007590
1164 Ga0466965_0013853
1165 Ga0466965_0045940
1166 Ga0466965_0056129
1167 Ga0466965_0376593
1168 Ga0466965_0599654
1169 Ga0466961_0056993
1170 Ga0466961_0446687
1171 Ga0466961_0716432
1172 Ga0466961_0732583
1173 Ga0466961_0937019
1174 Ga0466963_0011791
1175 Ga0466963_0029764
1176 Ga0466963_0212705
1177 Ga0466963_0241398
1178 Ga0466963_0359914
1179 Ga0466963_0410242
1180 Ga0466963_0932842
1181 Ga0466964_0012667
1182 Ga0466964_0241492
1183 Ga0466964_0245380
1184 Ga0466964_0302449
1185 Ga0466964_0420606
1186 Ga0466971_0044596
1187 Ga0466971_0107290
1188 Ga0466971_0342813
1189 Ga0466968_0065183
1190 Ga0466970_0004377
1191 Ga0466970_0007199
1192 Ga0466970_0026245
1193 Ga0466970_0066922
1194 Ga0466970_0124706
1195 Ga0466970_0229215
1196 Ga0466957_0070541
1197 Ga0466957_0107654
1198 Ga0466957_0208557
1199 Ga0466957_0776773
1200 Ga0466957_0991639
1201 Ga0466957_1408443
1202 Ga0466960_0003656
1203 Ga0466960_0049465
1204 Ga0466960_0052035
1205 Ga0466960_0069325
1206 Ga0466960_0170861
1207 Ga0466960_0201734
1208 Ga0466960_0240612
1209 Ga0466960_0320238
1210 Ga0466960_0889046
1211 Ga0466960_0930446
1212 Ga0466959_0170464
1213 Ga0466959_0742886
1214 Ga0466959_0906865
1215 Ga0466958_0023786
1216 Ga0466958_0890140
1217 Ga0466967_0015080
1218 Ga0466967_0019494
1219 Ga0466967_0025517
1220 Ga0466967_0043085
1221 Ga0466967_0062264
1222 Ga0466967_0138809
1223 Ga0466967_0209348
1224 Ga0466967_0213110
1225 Ga0466967_0391677
1226 Ga0466967_0490703
1227 Ga0466967_0772361
1228 Ga0466967_1041558
1229 Ga0466967_1136421
1230 Ga0466967_2268931
1231 Ga0495603_0187395
1232 Ga0495629_0189767
1233 Ga0495641_0105593
1234 Ga0495653_0072448
1235 Ga0495580_0075780
1236 Ga0495582_0213027
1237 Ga0495639_0203860
1238 Ga0495662_0214651
1239 Ga0495664_0049100
1240 Ga0495664_0506104
1241 Ga0495618_0064044
1242 Ga0495618_0250129
1243 Ga0495620_0302720
1244 Ga0495628_0946029
1245 Ga0495630_0379659
1246 Ga0495666_0121785
1247 Ga0495652_0518004
1248 Ga0495652_0614973
1249 Ga0495640_0157619
1250 Ga0495586_0166600
1251 Ga0495645_0143442
1252 Ga0495645_0880956
1253 Ga0495667_0776312
1254 Ga0495634_0496695
1255 Ga0495635_0036793
1256 Ga0495635_0058795
1257 Ga0495646_0192495
1258 Ga0495646_0340872
1259 Ga0495647_0029189
1260 Ga0495658_0195360
1261 Ga0495658_0444866
1262 Ga0495613_0032371
1263 Ga0495624_0033131
1264 Ga0495671_0421094
1265 Ga0495600_0956669
1266 Ga0495581_0028519
1267 Ga0495604_0394326
1268 Ga0495674_0264809
1269 Ga0495674_0613806
1270 Ga0495676_0232251
1271 Ga0495680_0205262
1272 Ga0495684_0179951
1273 Ga0495684_0183411
1274 Ga0495593_0067201
1275 Ga0495593_0496848
1276 Ga0495602_0179678
1277 Ga0495614_0161208
1278 Ga0496100_0982190
1279 Ga0496101_0072799
1280 Ga0496102_0135848
1281 Ga0496102_0153199
1282 Ga0496102_0456363
1283 Ga0496102_1652167
1284 Ga0496103_0339576
1285 Ga0496104_0809206
1286 Ga0496107_0146884
1287 Ga0496108_0330035
1288 Ga0496108_0345737
1289 Ga0496109_0086240
1290 Ga0496109_0473452
1291 Ga0496109_0505982
1292 Ga0496109_1224618
1293 Ga0496110_0111850
1294 Ga0496110_0605397
1295 Ga0496111_0112682
1296 Ga0496111_0590240
1297 Ga0496114_0165454
1298 Ga0496114_0254335
1299 Ga0496114_1799814
1300 Ga0496122_0020321
1301 Ga0496123_0006607
1302 Ga0496124_0762328
1303 Ga0496125_0374423
1304 Ga0501317_000764
1305 Ga0501031_0122899
1306 Ga0501031_0128037
1307 Ga0501031_0151805
1308 Ga0501031_0373916
1309 Ga0501031_0463001
1310 Ga0501031_0523306
1311 Ga0501032_0003721
1312 Ga0501032_0209446
1313 Ga0501032_0404433
1314 Ga0501033_0002287
1315 Ga0501033_0049240
1316 Ga0501033_0588202
1317 Ga0501034_0084000
1318 Ga0501034_0206005
1319 Ga0501036_0081597
1320 Ga0501036_0215618
1321 Ga0501036_0419313
1322 Ga0501036_0498784
1323 Ga0501036_0998708
1324 Ga0501037_0086250
1325 Ga0501037_0796201
1326 Ga0501038_0001814
1327 Ga0501038_0078537
1328 Ga0501038_0507216
1329 Ga0501039_0021927
1330 Ga0501039_0029131
1331 Ga0501039_0266715
1332 Ga0501039_0271604
1333 Ga0501039_0667031
1334 Ga0501039_0669520
1335 Ga0501039_0682865
1336 Ga0501039_0984253
1337 Ga0501039_1144738
1338 Ga0501039_1504338
1339 Ga0501040_0108977
1340 Ga0501040_0125632
1341 Ga0501040_0206160
1342 Ga0501040_0276468
1343 Ga0501041_0537841
1344 Ga0501041_0698254
1345 Ga0501041_0831662
1346 Ga0501042_0222315
1347 Ga0501042_0898464
1348 Ga0501043_0029528
1349 Ga0501043_0068693
1350 Ga0501043_1110455
1351 Ga0501043_1271120
1352 Ga0501046_0000400
1353 Ga0501046_0025772
1354 Ga0501046_0483650
1355 Ga0501047_0006675
1356 Ga0501047_0126422
1357 Ga0501047_0524280
1358 Ga0501047_0744206
1359 Ga0501048_0050353
1360 Ga0501048_0328961
1361 Ga0501048_0389378
1362 Ga0501048_0391851
1363 Ga0501048_0807333
1364 Ga0501067_0009760
1365 Ga0501067_0046830
1366 Ga0501067_0499802
1367 Ga0501068_0005940
1368 Ga0501068_0358603
1369 Ga0501068_0452278
1370 Ga0501069_0223665
1371 Ga0501069_0488255
1372 Ga0501069_0515233
1373 Ga0501069_0934688
1374 Ga0501070_0005820
1375 Ga0501070_0012371
1376 Ga0501070_0035249
1377 Ga0501070_0213747
1378 Ga0501070_0354813
1379 Ga0501070_0639594
1380 Ga0501070_0937158
1381 Ga0501071_0017351
1382 Ga0501071_0210488
1383 Ga0501071_0288665
1384 Ga0501071_0391303
1385 Ga0501071_0852089
1386 Ga0501071_1199836
1387 Ga0501071_1335733
1388 Ga0501071_1592749
1389 Ga0501072_0157552
1390 Ga0501072_0231123
1391 Ga0501072_0242745
1392 Ga0501072_0264222
1393 Ga0501072_0493593
1394 Ga0501073_0024892
1395 Ga0501073_0057620
1396 Ga0501074_0010032
1397 Ga0501074_0083389
1398 Ga0501074_0100888
1399 Ga0501074_0459619
1400 Ga0501074_0483605
1401 Ga0501074_0600055
1402 Ga0501074_1197457
1403 Ga0501075_0270795
1404 Ga0501075_0346647
1405 Ga0501075_0572964
1406 Ga0501075_0919418
1407 Ga0501076_0062924
1408 Ga0501076_0506558
1409 Ga0501076_0794821
1410 Ga0501076_0859848
1411 Ga0501076_1067597
1412 Ga0501076_1673137
1413 Ga0501077_0027914
1414 Ga0501216_150859
1415 Ga0501217_195141
1416 Ga0501253_135215
1417 Ga0501261_117709
1418 Ga0501079_0019015
1419 Ga0501079_0415371
1420 Ga0501079_0507556
1421 Ga0501079_0862232
1422 Ga0501080_0018824
1423 Ga0501080_0675020
1424 Ga0501080_1283556
1425 Ga0501080_1580170
1426 Ga0501081_1145816
1427 Ga0501081_1376407
1428 Ga0501083_0013861
1429 Ga0501083_0139589
1430 Ga0501083_1019344
1431 Ga0501035_0083470
1432 Ga0501035_0381851
1433 Ga0501035_1111067
1434 Ga0501044_0641001
1435 Ga0501045_0257992
1436 Ga0501045_0333030
1437 Ga0501045_0371725
1438 Ga0501045_0372327
1439 Ga0501045_0392586
1440 Ga0501045_0773284
1441 Ga0501045_0800765
1442 nmdc:mga03n38_132848_c1
1443 nmdc:mga00v17_808319_c1
1444 nmdc:mga00v17_822354_c1
1445 nmdc:mga00v17_826322_c1
1446 nmdc:mga00v17_851435_c1
1447 nmdc:mga0yw44_150493_c1
1448 nmdc:mga0yw44_22819_c1
1449 nmdc:mga06z11_159050_c1
1450 nmdc:mga07m45_634268_c1
1451 nmdc:mga0qj67_51683_c1
1452 nmdc:mga06r32_1482_c1
1453 nmdc:mga06r32_1822623_c1
1454 nmdc:mga0rr50_1150357_c1
1455 nmdc:mga0rr50_688469_c1
1456 nmdc:mga08x19_296564_c1
1457 Ga0495601_0037994
1458 Ga0495601_0871836
1459 Ga0500556_0000676
1460 Ga0501084_0012903
1461 Ga0501084_0662596
1462 Ga0501084_1518511
1463 Ga0501082_0012185
1464 Ga0501082_0569349
1465 Ga0466962_0022166
1466 Ga0466962_0060186
1467 Ga0466962_0182720
1468 Ga0466962_0241288
1469 Ga0466962_0520402
1470 Ga0530510_0163993
1471 Ga0530510_0272191
1472 Ga0530510_0532515
1473 Ga0530510_0569685
1474 Ga0530510_0864519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

5

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9419 3 68
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.9309 3 69
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9285 3 68
2vkf-assembly1.cif.gz_A complexes of dodecin with flavin and flavin-like ligands 0.9284 5 68
2vyx-assembly1.cif.gz_F crystal structure of the t. thermophilus dodecin w38f mutant 0.9282 3 69
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9284 5 68 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9143 5 68 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8861 1 70 3.30.1660.10
af_G2TRR0_12_69_3.30.1660.10 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8651 9 65 3.30.1660.10
af_G2TRR0_12_69_3.30.1660.10 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8399 9 65 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A521RXH4-F1-model_v4 Dodecin domain-containing protein 0.9956 11 68
AF-A0A494WTW9-F1-model_v4 Dodecin domain-containing protein 0.9919 5 66
AF-A0A087NBA7-F1-model_v4 Dodecin 0.9836 11 68
AF-A0A559RIT1-F1-model_v4 Dodecin 0.9821 9 68
AF-A0A7C6ZBD8-F1-model_v4 Dodecin domain-containing protein 0.9819 5 66

Map