F478279

General Info

Members Datasets Scaffolds Average Seq Length
736 308 702 376

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0002631|Ga0373930_0002631_377_1612
Length 411
Sequence VSLEPTECARGATLPNQEAVIVSCARTAVGTAGRGSLVDVDALELGTRAVAEAVRRSGLEATRFDDVVLAEGLYGGGDIARYAAIEAGLVNVPGVALNRHCAAGLSSIQVAAASIMAGQDEVVIAGGTQSSSTMPRVSRRVPGTDEWDDWMSPSHRDQPDAPNRDMSITVGWNAAHKAGLTREELDAWSLRSHQRAIAGIDGGAFAEEIFPLEVTRRDGSTFTFDVDEHPRRDTTLEKLAALKVLHPEIEGFSITAGNASGINDGAAALVLASRAVAEAEGLEPLATIRSWASVGTDPADTGLAPTLAIPKALQRAGLGIDDVDLWEINEAFAAVPVAACKILGIDDALVNPLGSGCSLGHPIAMTGSRMVITLVHELLRRGGGTAVAAMCVGGGMASALVFDVPGGKGKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2517572101 Frankia sp. DC12 Isolate Nodule
4 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
5 2547132424 Nocardia nova SH22a Isolate Unclassified
6 2626541554 Frankia sp. AvcI.1 Isolate Nodule
7 2671180195 Frankia sp. CcI49 Isolate Nodule
8 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
9 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
10 2687453737 Frankia sp. BMG5.36 Isolate Nodule
11 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
12 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
13 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
14 2773857922 Frankia sp. CcI49 Isolate Nodule
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
17 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
18 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
19 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
20 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
21 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
22 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
23 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
24 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
265 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
266 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 8002775197 Frankia nepalensis CN7 Isolate Nodule
308 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 0
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 2.45
Rhizoplane 10.87
Rhizosphere 67.53
Stem 0
Stem Tuber 0
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3625322 2162886007 Bacteria 15368
2 JGI24751J29686_10000014 3300002459 Bacteria 113284
3 JGI24751J29686_10000278 3300002459 Bacteria 19873
4 JGI24751J29686_10001207 3300002459 Bacteria 5477
5 Ga0065704_10000190 3300005289 Bacteria 213919
6 Ga0065704_10005194 3300005289 Bacteria 7905
7 Ga0065704_10070334 3300005289 Bacteria 31764
8 Ga0065707_10098180 3300005295 Bacteria 3106
9 Ga0070690_100270976 3300005330 Bacteria 1207
10 Ga0070670_100000008 3300005331 Bacteria 292132
11 Ga0070670_100059841 3300005331 Bacteria 3270
12 Ga0070666_10027913 3300005335 Bacteria 3701
13 Ga0070666_10194596 3300005335 Bacteria 1426
14 Ga0068868_100000580 3300005338 Bacteria 24531
15 Ga0070660_100006063 3300005339 Bacteria 8358
16 Ga0070689_100005290 3300005340 Bacteria 8794
17 Ga0070661_100060445 3300005344 Bacteria 2781
18 Ga0070692_10026676 3300005345 Bacteria 2858
19 Ga0070668_100002611 3300005347 Bacteria 13240
20 Ga0070668_100008779 3300005347 Bacteria 7505
21 Ga0070668_100027860 3300005347 Bacteria 4288
22 Ga0070668_100042570 3300005347 Bacteria 3481
23 Ga0070668_100134112 3300005347 Bacteria 1990
24 Ga0070668_100146827 3300005347 Bacteria 1904
25 Ga0070668_100199137 3300005347 Bacteria 1644
26 Ga0070669_100000045 3300005353 Bacteria 119932
27 Ga0070669_100000088 3300005353 Bacteria 88307
28 Ga0070669_100001874 3300005353 Bacteria 15156
29 Ga0070669_100010072 3300005353 Bacteria 6722
30 Ga0070669_100015078 3300005353 Bacteria 5507
31 Ga0070675_100068110 3300005354 Bacteria 2947
32 Ga0070675_100220447 3300005354 Bacteria 1652
33 Ga0070675_100244165 3300005354 Bacteria 1570
34 Ga0070671_100000039 3300005355 Bacteria 93404
35 Ga0070671_100000105 3300005355 Bacteria 53467
36 Ga0070671_100001125 3300005355 Bacteria 19843
37 Ga0070671_100001654 3300005355 Bacteria 16853
38 Ga0070671_100006020 3300005355 Bacteria 9669
39 Ga0070671_100148436 3300005355 Bacteria 1979
40 Ga0070674_100002296 3300005356 Bacteria 10558
41 Ga0070659_100012617 3300005366 Bacteria 6266
42 Ga0070659_100021093 3300005366 Bacteria 4956
43 Ga0070667_100000080 3300005367 Bacteria 119264
44 Ga0070667_100000285 3300005367 Bacteria 57054
45 Ga0070667_100000381 3300005367 Bacteria 48409
46 Ga0070667_100013720 3300005367 Bacteria 6697
47 Ga0070667_100023532 3300005367 Bacteria 5112
48 Ga0070667_100127526 3300005367 Bacteria 2218
49 Ga0070667_100247297 3300005367 Bacteria 1594
50 Ga0070710_10015784 3300005437 Bacteria 3829
51 Ga0070710_10017207 3300005437 Bacteria 3695
52 Ga0070701_10075935 3300005438 Bacteria 1808
53 Ga0070711_100003082 3300005439 Bacteria 9632
54 Ga0070700_100004233 3300005441 Bacteria 7491
55 Ga0070663_100015257 3300005455 Bacteria 4954
56 Ga0070678_100000938 3300005456 Bacteria 14978
57 Ga0070662_100003140 3300005457 Bacteria 10265
58 Ga0070685_10010992 3300005466 Bacteria 4723
59 Ga0070685_10218095 3300005466 Bacteria 1249
60 Ga0070706_100011874 3300005467 Bacteria 8084
61 Ga0070707_100109770 3300005468 Bacteria 2675
62 Ga0070698_100025488 3300005471 Bacteria 6164
63 Ga0070698_100315979 3300005471 Bacteria 1493
64 Ga0070697_100059593 3300005536 Bacteria 3109
65 Ga0070686_100008872 3300005544 Bacteria 5635
66 Ga0070696_100001497 3300005546 Bacteria 15326
67 Ga0070693_100007815 3300005547 Bacteria 5243
68 Ga0070665_100000190 3300005548 Bacteria 109791
69 Ga0070665_100000424 3300005548 Bacteria 61687
70 Ga0070665_100003418 3300005548 Bacteria 16964
71 Ga0070665_100006109 3300005548 Bacteria 12315
72 Ga0070665_100006279 3300005548 Bacteria 12146
73 Ga0070665_100007974 3300005548 Bacteria 10732
74 Ga0070665_100009543 3300005548 Bacteria 9816
75 Ga0070665_100011576 3300005548 Bacteria 8919
76 Ga0070665_100033612 3300005548 Bacteria 5160
77 Ga0070665_100050820 3300005548 Bacteria 4160
78 Ga0068855_100123934 3300005563 Bacteria 2956
79 Ga0068855_100217341 3300005563 Bacteria 2145
80 Ga0070664_100003085 3300005564 Bacteria 13467
81 Ga0068854_100000515 3300005578 Bacteria 23453
82 Ga0068859_100000182 3300005617 Bacteria 61758
83 Ga0068859_100003207 3300005617 Bacteria 16651
84 Ga0068859_100042209 3300005617 Bacteria 4581
85 Ga0068859_100065412 3300005617 Bacteria 3670
86 Ga0068859_100245866 3300005617 Bacteria 1879
87 Ga0068859_100265666 3300005617 Bacteria 1808
88 Ga0068859_100349707 3300005617 Bacteria 1573
89 Ga0068864_100000027 3300005618 Bacteria 229759
90 Ga0068864_100000147 3300005618 Bacteria 67035
91 Ga0068864_100172658 3300005618 Bacteria 1972
92 Ga0068866_10015834 3300005718 Bacteria 3359
93 Ga0068861_100002353 3300005719 Bacteria 12296
94 Ga0068861_100003853 3300005719 Bacteria 10021
95 Ga0068861_100260154 3300005719 Bacteria 1485
96 Ga0068863_100000304 3300005841 Bacteria 50637
97 Ga0068863_100000749 3300005841 Bacteria 32440
98 Ga0068863_100001268 3300005841 Bacteria 25179
99 Ga0068863_100002883 3300005841 Bacteria 17029
100 Ga0068863_100004437 3300005841 Bacteria 13834
101 Ga0068863_100008023 3300005841 Bacteria 10316
102 Ga0068863_100011021 3300005841 Bacteria 8768
103 Ga0068863_100012171 3300005841 Bacteria 8309
104 Ga0068863_100062140 3300005841 Bacteria 3533
105 Ga0068863_100112882 3300005841 Bacteria 2588
106 Ga0068858_100000039 3300005842 Bacteria 136946
107 Ga0068858_100000196 3300005842 Bacteria 64743
108 Ga0068858_100001492 3300005842 Bacteria 24117
109 Ga0068858_100011931 3300005842 Bacteria 8191
110 Ga0068858_100028649 3300005842 Bacteria 5172
111 Ga0068858_100040789 3300005842 Bacteria 4306
112 Ga0068858_100043383 3300005842 Bacteria 4170
113 Ga0068858_100044917 3300005842 Bacteria 4094
114 Ga0068860_100000016 3300005843 Bacteria 310468
115 Ga0068860_100000395 3300005843 Bacteria 57094
116 Ga0068860_100006227 3300005843 Bacteria 11990
117 Ga0068860_100015652 3300005843 Bacteria 7405
118 Ga0068860_100062410 3300005843 Bacteria 3541
119 Ga0068860_100085398 3300005843 Bacteria 3003
120 Ga0068860_100179565 3300005843 Bacteria 2046
121 Ga0068860_100324115 3300005843 Bacteria 1512
122 Ga0068862_100000071 3300005844 Bacteria 120449
123 Ga0068862_100000152 3300005844 Bacteria 78660
124 Ga0068862_100000618 3300005844 Bacteria 36987
125 Ga0068862_100009048 3300005844 Bacteria 8244
126 Ga0068862_100019937 3300005844 Bacteria 5597
127 Ga0068862_100071180 3300005844 Bacteria 3003
128 Ga0068862_100470009 3300005844 Bacteria 1188
129 Ga0081455_10028658 3300005937 Bacteria 5084
130 Ga0081455_10049076 3300005937 Bacteria 3641
131 Ga0081539_10006295 3300005985 Bacteria 11470
132 Ga0075365_10041990 3300006038 Bacteria 2989
133 Ga0075365_10123180 3300006038 Bacteria 1790
134 Ga0075368_10016871 3300006042 Bacteria 2726
135 Ga0075363_100000250 3300006048 Bacteria 15257
136 Ga0075363_100001893 3300006048 Bacteria 8272
137 Ga0075364_10001157 3300006051 Bacteria 14108
138 Ga0075364_10006803 3300006051 Bacteria 6745
139 Ga0075364_10010186 3300006051 Bacteria 5670
140 Ga0075364_10054298 3300006051 Bacteria 2620
141 Ga0070712_100005346 3300006175 Bacteria 7950
142 Ga0070712_100158962 3300006175 Bacteria 1743
143 Ga0075369_10000752 3300006186 Bacteria 10535
144 Ga0075369_10006461 3300006186 Bacteria 4434
145 Ga0075369_10027769 3300006186 Bacteria 2367
146 Ga0075366_10030273 3300006195 Bacteria 3182
147 Ga0075370_10018799 3300006353 Bacteria 3752
148 Ga0075370_10183223 3300006353 Bacteria 1233
149 Ga0075428_100000178 3300006844 Bacteria 59510
150 Ga0075428_100001834 3300006844 Bacteria 22753
151 Ga0075428_100406215 3300006844 Bacteria 1459
152 Ga0075430_100003945 3300006846 Bacteria 12517
153 Ga0075430_100013488 3300006846 Bacteria 6966
154 Ga0075431_100009323 3300006847 Bacteria 9847
155 Ga0075431_100014125 3300006847 Bacteria 8072
156 Ga0075431_100056144 3300006847 Bacteria 4062
157 Ga0075431_100060760 3300006847 Bacteria 3900
158 Ga0075429_100000899 3300006880 Bacteria 23528
159 Ga0075429_100002833 3300006880 Bacteria 14677
160 Ga0075429_100033499 3300006880 Bacteria 4465
161 Ga0075429_100050170 3300006880 Bacteria 3631
162 Ga0075429_100169518 3300006880 Bacteria 1912
163 Ga0068865_100002422 3300006881 Bacteria 11018
164 Ga0097620_100000182 3300006931 Bacteria 61758
165 Ga0097620_100003207 3300006931 Bacteria 16651
166 Ga0097620_100042207 3300006931 Bacteria 4581
167 Ga0097620_100065409 3300006931 Bacteria 3670
168 Ga0097620_100245882 3300006931 Bacteria 1879
169 Ga0097620_100265667 3300006931 Bacteria 1808
170 Ga0097620_100349732 3300006931 Bacteria 1573
171 Ga0099795_10016015 3300007788 Bacteria 2362
172 Ga0105251_10002755 3300009011 Bacteria 13426
173 Ga0105250_10006915 3300009092 Bacteria 4914
174 Ga0105250_10007122 3300009092 Bacteria 4828
175 Ga0105250_10021679 3300009092 Bacteria 2592
176 Ga0111539_10001540 3300009094 Bacteria 30701
177 Ga0111539_10016996 3300009094 Bacteria 9004
178 Ga0105245_10006970 3300009098 Bacteria 9911
179 Ga0105245_10008979 3300009098 Bacteria 8719
180 Ga0105247_10000006 3300009101 Bacteria 416061
181 Ga0105247_10000028 3300009101 Bacteria 201372
182 Ga0105247_10009176 3300009101 Bacteria 6019
183 Ga0105247_10015757 3300009101 Bacteria 4526
184 Ga0105247_10046460 3300009101 Bacteria 2665
185 Ga0105247_10058511 3300009101 Bacteria 2385
186 Ga0105247_10077735 3300009101 Bacteria 2086
187 Ga0114129_10000314 3300009147 Bacteria 56573
188 Ga0114129_10017891 3300009147 Bacteria 10088
189 Ga0114129_10100678 3300009147 Bacteria 3998
190 Ga0114129_10262339 3300009147 Bacteria 2314
191 Ga0105242_10000154 3300009176 Bacteria 50757
192 Ga0105242_10124587 3300009176 Bacteria 2216
193 Ga0105248_10000025 3300009177 Bacteria 259691
194 Ga0105248_10006928 3300009177 Bacteria 12421
195 Ga0105248_10017375 3300009177 Bacteria 7930
196 Ga0105248_10166498 3300009177 Bacteria 2485
197 Ga0105248_10190197 3300009177 Bacteria 2313
198 Ga0105248_10319592 3300009177 Bacteria 1748
199 Ga0105248_10327751 3300009177 Bacteria 1725
200 Ga0105237_10000103 3300009545 Bacteria 118661
201 Ga0105237_10337020 3300009545 Bacteria 1512
202 Ga0105238_10199373 3300009551 Bacteria 1977
203 Ga0105249_10000021 3300009553 Bacteria 260448
204 Ga0105249_10000259 3300009553 Bacteria 57099
205 Ga0105239_10002423 3300010375 Bacteria 23756
206 Ga0105239_10074759 3300010375 Bacteria 3725
207 Ga0105239_10141702 3300010375 Bacteria 2679
208 Ga0105246_10218411 3300011119 Bacteria 1492
209 Ga0157369_10141139 3300013105 Bacteria 2549
210 Ga0157374_10003772 3300013296 Bacteria 12742
211 Ga0163162_10024898 3300013306 Bacteria 5912
212 Ga0163162_10026544 3300013306 Bacteria 5725
213 Ga0163162_10034434 3300013306 Bacteria 5041
214 Ga0163162_10074638 3300013306 Bacteria 3450
215 Ga0163162_10120548 3300013306 Bacteria 2727
216 Ga0163163_10002775 3300014325 Bacteria 14788
217 Ga0163163_10008807 3300014325 Bacteria 8983
218 Ga0163163_10009006 3300014325 Bacteria 8893
219 Ga0163163_10024027 3300014325 Bacteria 5798
220 Ga0163163_10040204 3300014325 Bacteria 4566
221 Ga0157380_10000198 3300014326 Bacteria 35239
222 Ga0157380_10000648 3300014326 Bacteria 21525
223 Ga0157377_10003096 3300014745 Bacteria 7475
224 Ga0157379_10007178 3300014968 Bacteria 9640
225 Ga0157379_10090567 3300014968 Bacteria 2744
226 Ga0157379_10156296 3300014968 Bacteria 2058
227 Ga0157376_10247175 3300014969 Bacteria 1664
228 Ga0163161_10001690 3300017792 Bacteria 16205
229 Ga0163161_10048897 3300017792 Bacteria 3055
230 Ga0163161_10149797 3300017792 Bacteria 1772
231 Ga0213876_10000150 3300021384 Bacteria 74357
232 Ga0213876_10060624 3300021384 Bacteria 1996
233 Ga0213875_10000173 3300021388 Bacteria 68092
234 Ga0207696_1002177 3300025711 Bacteria 9824
235 Ga0207713_1000450 3300025735 Bacteria 43056
236 Ga0207713_1016877 3300025735 Bacteria 3689
237 Ga0207692_10006272 3300025898 Bacteria 4820
238 Ga0207710_10000025 3300025900 Bacteria 314658
239 Ga0207710_10000034 3300025900 Bacteria 256915
240 Ga0207710_10000569 3300025900 Bacteria 22108
241 Ga0207710_10001186 3300025900 Bacteria 13235
242 Ga0207710_10012991 3300025900 Bacteria 3507
243 Ga0207710_10026091 3300025900 Bacteria 2523
244 Ga0207688_10000490 3300025901 Bacteria 19049
245 Ga0207688_10001081 3300025901 Bacteria 13962
246 Ga0207680_10121812 3300025903 Bacteria 1707
247 Ga0207699_10056750 3300025906 Bacteria 2335
248 Ga0207684_10116868 3300025910 Bacteria 2285
249 Ga0207671_10009098 3300025914 Bacteria 8344
250 Ga0207693_10078219 3300025915 Bacteria 2589
251 Ga0207663_10001094 3300025916 Bacteria 12456
252 Ga0207662_10067223 3300025918 Bacteria 2161
253 Ga0207657_10007152 3300025919 Bacteria 11463
254 Ga0207649_10040470 3300025920 Bacteria 2833
255 Ga0207646_10196556 3300025922 Bacteria 1821
256 Ga0207681_10000022 3300025923 Bacteria 230079
257 Ga0207681_10000075 3300025923 Bacteria 89848
258 Ga0207681_10000244 3300025923 Bacteria 41393
259 Ga0207681_10003223 3300025923 Bacteria 10233
260 Ga0207681_10007325 3300025923 Bacteria 6761
261 Ga0207681_10063953 3300025923 Bacteria 2539
262 Ga0207650_10000019 3300025925 Bacteria 344751
263 Ga0207650_10000020 3300025925 Bacteria 342596
264 Ga0207650_10015496 3300025925 Bacteria 5311
265 Ga0207659_10086443 3300025926 Bacteria 2332
266 Ga0207687_10070369 3300025927 Bacteria 2498
267 Ga0207664_10024685 3300025929 Bacteria 4519
268 Ga0207644_10000022 3300025931 Bacteria 160689
269 Ga0207644_10001508 3300025931 Bacteria 15012
270 Ga0207690_10097285 3300025932 Bacteria 2094
271 Ga0207690_10115439 3300025932 Bacteria 1940
272 Ga0207706_10001079 3300025933 Bacteria 27701
273 Ga0207706_10002746 3300025933 Bacteria 17108
274 Ga0207686_10003023 3300025934 Bacteria 9063
275 Ga0207709_10001668 3300025935 Bacteria 14959
276 Ga0207670_10020607 3300025936 Bacteria 4055
277 Ga0207670_10270949 3300025936 Bacteria 1319
278 Ga0207669_10000085 3300025937 Bacteria 47505
279 Ga0207704_10001197 3300025938 Bacteria 11568
280 Ga0207665_10001261 3300025939 Bacteria 17077
281 Ga0207665_10008338 3300025939 Bacteria 6838
282 Ga0207711_10000048 3300025941 Bacteria 149049
283 Ga0207711_10000288 3300025941 Bacteria 53814
284 Ga0207711_10002282 3300025941 Bacteria 17215
285 Ga0207711_10004155 3300025941 Bacteria 12398
286 Ga0207711_10008815 3300025941 Bacteria 8434
287 Ga0207711_10016364 3300025941 Bacteria 6164
288 Ga0207689_10101519 3300025942 Bacteria 2363
289 Ga0207689_10265989 3300025942 Bacteria 1419
290 Ga0207679_10055346 3300025945 Bacteria 2924
291 Ga0207667_10175329 3300025949 Bacteria 2203
292 Ga0207651_10203425 3300025960 Bacteria 1589
293 Ga0207712_10000005 3300025961 Bacteria 608697
294 Ga0207712_10000217 3300025961 Bacteria 57107
295 Ga0207712_10004582 3300025961 Bacteria 8724
296 Ga0207712_10067153 3300025961 Bacteria 2565
297 Ga0207668_10000172 3300025972 Bacteria 44549
298 Ga0207668_10003089 3300025972 Bacteria 9763
299 Ga0207668_10005782 3300025972 Bacteria 7286
300 Ga0207668_10075729 3300025972 Bacteria 2420
301 Ga0207668_10098666 3300025972 Bacteria 2165
302 Ga0207668_10115631 3300025972 Bacteria 2021
303 Ga0207640_10001274 3300025981 Bacteria 13695
304 Ga0207658_10000231 3300025986 Bacteria 58979
305 Ga0207658_10000481 3300025986 Bacteria 36947
306 Ga0207658_10001080 3300025986 Bacteria 22086
307 Ga0207658_10002337 3300025986 Bacteria 13930
308 Ga0207658_10012725 3300025986 Bacteria 5747
309 Ga0207658_10026785 3300025986 Bacteria 4045
310 Ga0207658_10139536 3300025986 Bacteria 1959
311 Ga0207658_10258072 3300025986 Bacteria 1484
312 Ga0207677_10042316 3300026023 Bacteria 3020
313 Ga0207703_10000039 3300026035 Bacteria 170322
314 Ga0207703_10000335 3300026035 Bacteria 51216
315 Ga0207703_10000356 3300026035 Bacteria 49172
316 Ga0207703_10018681 3300026035 Bacteria 5415
317 Ga0207703_10047238 3300026035 Bacteria 3470
318 Ga0207703_10056088 3300026035 Bacteria 3207
319 Ga0207678_10003869 3300026067 Bacteria 13462
320 Ga0207708_10000329 3300026075 Bacteria 37329
321 Ga0207708_10042797 3300026075 Bacteria 3451
322 Ga0207702_10088524 3300026078 Bacteria 2705
323 Ga0207641_10000019 3300026088 Bacteria 295899
324 Ga0207641_10000166 3300026088 Bacteria 93398
325 Ga0207641_10003530 3300026088 Bacteria 13843
326 Ga0207641_10005989 3300026088 Bacteria 10306
327 Ga0207641_10009945 3300026088 Bacteria 7827
328 Ga0207641_10038138 3300026088 Bacteria 4016
329 Ga0207641_10059297 3300026088 Bacteria 3259
330 Ga0207641_10109694 3300026088 Bacteria 2444
331 Ga0207648_10000112 3300026089 Bacteria 78746
332 Ga0207676_10000022 3300026095 Bacteria 296286
333 Ga0207676_10000187 3300026095 Bacteria 54323
334 Ga0207676_10000614 3300026095 Bacteria 29147
335 Ga0207676_10151959 3300026095 Bacteria 1995
336 Ga0207676_10180029 3300026095 Bacteria 1850
337 Ga0207675_100000117 3300026118 Bacteria 64829
338 Ga0207675_100002686 3300026118 Bacteria 17549
339 Ga0207675_100057801 3300026118 Bacteria 3619
340 Ga0207675_100295780 3300026118 Bacteria 1576
341 Ga0207675_100407654 3300026118 Bacteria 1340
342 Ga0207428_10004278 3300027907 Bacteria 13659
343 Ga0207428_10089178 3300027907 Bacteria 2397
344 Ga0268266_10000330 3300028379 Bacteria 74566
345 Ga0268266_10000409 3300028379 Bacteria 65290
346 Ga0268266_10003465 3300028379 Bacteria 15738
347 Ga0268266_10004007 3300028379 Bacteria 14248
348 Ga0268266_10007065 3300028379 Bacteria 10194
349 Ga0268266_10009705 3300028379 Bacteria 8459
350 Ga0268266_10010646 3300028379 Bacteria 8013
351 Ga0268266_10039127 3300028379 Bacteria 4039
352 Ga0268265_10000031 3300028380 Bacteria 226725
353 Ga0268265_10000037 3300028380 Bacteria 202579
354 Ga0268265_10000121 3300028380 Bacteria 97688
355 Ga0268265_10008702 3300028380 Bacteria 6862
356 Ga0268265_10079682 3300028380 Bacteria 2580
357 Ga0268265_10215184 3300028380 Bacteria 1677
358 Ga0268265_10330726 3300028380 Bacteria 1384
359 Ga0268264_10000005 3300028381 Bacteria 934972
360 Ga0268264_10000612 3300028381 Bacteria 42805
361 Ga0268264_10003121 3300028381 Bacteria 14357
362 Ga0268264_10008994 3300028381 Bacteria 8288
363 Ga0268264_10026213 3300028381 Bacteria 4761
364 Ga0268264_10074097 3300028381 Bacteria 2891
365 Ga0265334_10000111 3300028573 Bacteria 53728
366 Ga0307515_10057726 3300028794 Bacteria 5611
367 Ga0307511_10050447 3300030521 Bacteria 3351
368 Ga0307508_10003643 3300031616 Bacteria 15441
369 Ga0307508_10006545 3300031616 Bacteria 10950
370 Ga0307508_10242316 3300031616 Bacteria 1400
371 Ga0316579_10014074 3300031691 Bacteria 3450
372 Ga0307405_10084392 3300031731 Bacteria 2085
373 Ga0307413_10026386 3300031824 Bacteria 3200
374 Ga0307410_10029597 3300031852 Bacteria 3489
375 Ga0307407_10021436 3300031903 Bacteria 3332
376 Ga0307409_100018461 3300031995 Bacteria 4691
377 Ga0307409_100084939 3300031995 Bacteria 2572
378 Ga0307411_10114579 3300032005 Bacteria 1937
379 Ga0316214_1009107 3300033545 Bacteria 1338
380 Ga0373930_0002631 3300034816 Bacteria 2790
381 Ga0373928_0010905 3300035084 Bacteria 1790
382 Ga0373934_0005084 3300035086 Bacteria 4874
383 Ga0373932_0003171 3300035112 Bacteria 4000
384 Ga0373936_0035565 3300035113 Bacteria 1983
385 Ga0373957_0044104 3300035120 Bacteria 1687
386 Ga0373931_0000005 3300035691 Bacteria 480485
387 Ga0373931_0000040 3300035691 Bacteria 72842
388 Ga0373927_0000260 3300035695 Bacteria 41667
389 Ga0373933_0030241 3300035724 Bacteria 3135
390 Ga0373937_0075806 3300036401 Bacteria 3105
391 Ga0316584_0098458 3300036712 Bacteria 2189
392 Ga0316584_0117868 3300036712 Bacteria 1985
393 Ga0373925_0000257 3300037068 Bacteria 55764
394 Ga0436364_0986946 3300037853 Bacteria 208509
395 Ga0436364_1324400 3300037853 Bacteria 12797
396 Ga0436365_0236902 3300039437 Bacteria 4496
397 Ga0436365_0444660 3300039437 Bacteria 5246
398 Ga0436365_1168901 3300039437 Bacteria 3684
399 Ga0436365_1627569 3300039437 Bacteria 24179
400 Ga0436363_1081284 3300039450 Bacteria 2535
401 Ga0450903_001276 3300042138 Bacteria 4712
402 Ga0439464_0012717 3300042439 Bacteria 2245
403 Ga0466957_0011457 3300044842 Bacteria 5117
404 Ga0466967_0004333 3300045976 Bacteria 9545
405 Ga0495617_013306 3300046452 Bacteria 2799
406 Ga0495603_0008543 3300046455 Bacteria 6188
407 Ga0495603_0034983 3300046455 Bacteria 3019
408 Ga0495629_0062434 3300046459 Bacteria 2603
409 Ga0495629_0067424 3300046459 Bacteria 2497
410 Ga0495629_0092654 3300046459 Bacteria 2109
411 Ga0495641_0061385 3300046461 Bacteria 1696
412 Ga0495651_0017287 3300046462 Bacteria 5587
413 Ga0495651_0100275 3300046462 Bacteria 2157
414 Ga0495653_0024020 3300046463 Bacteria 4917
415 Ga0495582_0045848 3300046473 Bacteria 2408
416 Ga0495605_0000988 3300046474 Bacteria 19320
417 Ga0495639_0062595 3300046475 Bacteria 1707
418 Ga0495585_0019191 3300046492 Bacteria 3945
419 Ga0495594_0002391 3300046499 Bacteria 9772
420 Ga0495607_0046636 3300046501 Bacteria 2543
421 Ga0495583_0031059 3300046506 Bacteria 2594
422 Ga0495606_0028054 3300046507 Bacteria 3977
423 Ga0495606_0038994 3300046507 Bacteria 3208
424 Ga0495616_0004551 3300046513 Bacteria 8729
425 Ga0495620_0000651 3300046515 Bacteria 21435
426 Ga0495628_0144791 3300046516 Bacteria 1812
427 Ga0495628_0152687 3300046516 Bacteria 1758
428 Ga0495631_0006526 3300046518 Bacteria 6017
429 Ga0495666_0005024 3300046526 Bacteria 6694
430 Ga0495640_0135442 3300046533 Bacteria 1591
431 Ga0495587_0067866 3300046536 Bacteria 2078
432 Ga0495621_0005476 3300046539 Bacteria 3651
433 Ga0495622_0002051 3300046557 Bacteria 9846
434 Ga0495667_0012542 3300046559 Bacteria 5746
435 Ga0495668_0001973 3300046616 Bacteria 18017
436 Ga0495634_0013649 3300046642 Bacteria 5868
437 Ga0495611_0001832 3300046648 Bacteria 10174
438 Ga0495611_0013673 3300046648 Bacteria 3458
439 Ga0495625_0011471 3300046660 Bacteria 7225
440 Ga0495635_0026735 3300046663 Bacteria 4013
441 Ga0495657_0006334 3300046675 Bacteria 9272
442 Ga0495657_0054148 3300046675 Bacteria 2681
443 Ga0495623_0096843 3300046679 Bacteria 1802
444 Ga0495646_0046378 3300046680 Bacteria 2650
445 Ga0495613_0000311 3300046689 Bacteria 44152
446 Ga0495660_0053879 3300046810 Bacteria 2181
447 Ga0495604_0177648 3300047317 Bacteria 1491
448 Ga0495676_0005790 3300047321 Bacteria 11335
449 Ga0495676_0175559 3300047321 Bacteria 1505
450 Ga0495680_0027078 3300047322 Bacteria 4715
451 Ga0495680_0098371 3300047322 Bacteria 2183
452 Ga0495687_000495 3300047443 Bacteria 47456
453 Ga0495687_019990 3300047443 Bacteria 3273
454 Ga0495685_004932 3300047447 Bacteria 4335
455 Ga0495684_0033359 3300047471 Bacteria 3949
456 Ga0495686_0096259 3300047472 Bacteria 1792
457 Ga0495593_0042253 3300047673 Bacteria 2447
458 Ga0495602_0045271 3300048088 Bacteria 3983
459 Ga0495602_0057114 3300048088 Bacteria 3427
460 Ga0495626_0043768 3300048091 Bacteria 2099
461 Ga0496100_0000037 3300048903 Bacteria 95054
462 Ga0496100_0001777 3300048903 Bacteria 10759
463 Ga0496100_0004606 3300048903 Bacteria 7327
464 Ga0496100_0005684 3300048903 Bacteria 6744
465 Ga0496100_0016688 3300048903 Bacteria 4317
466 Ga0496100_0156579 3300048903 Bacteria 1629
467 Ga0496101_0000174 3300048904 Bacteria 51685
468 Ga0496101_0000233 3300048904 Bacteria 41307
469 Ga0496101_0000787 3300048904 Bacteria 18761
470 Ga0496101_0002919 3300048904 Bacteria 10513
471 Ga0496101_0004046 3300048904 Bacteria 9162
472 Ga0496101_0043160 3300048904 Bacteria 3221
473 Ga0496102_0000008 3300048905 Bacteria 417021
474 Ga0496102_0000190 3300048905 Bacteria 83444
475 Ga0496102_0000524 3300048905 Bacteria 41587
476 Ga0496102_0000528 3300048905 Bacteria 41419
477 Ga0496102_0000839 3300048905 Bacteria 29546
478 Ga0496102_0002915 3300048905 Bacteria 14509
479 Ga0496102_0014204 3300048905 Bacteria 6918
480 Ga0496102_0033970 3300048905 Bacteria 4586
481 Ga0496102_0054058 3300048905 Bacteria 3661
482 Ga0496102_0134514 3300048905 Bacteria 2316
483 Ga0496102_0244915 3300048905 Bacteria 1690
484 Ga0496102_0418099 3300048905 Bacteria 1259
485 Ga0496103_0000100 3300048906 Bacteria 93873
486 Ga0496103_0000125 3300048906 Bacteria 83408
487 Ga0496103_0000127 3300048906 Bacteria 81698
488 Ga0496103_0000168 3300048906 Bacteria 68373
489 Ga0496103_0000821 3300048906 Bacteria 22780
490 Ga0496103_0002795 3300048906 Bacteria 10857
491 Ga0496103_0003826 3300048906 Bacteria 9159
492 Ga0496103_0011948 3300048906 Bacteria 5156
493 Ga0496103_0119490 3300048906 Bacteria 1678
494 Ga0496104_0000103 3300048907 Bacteria 80447
495 Ga0496104_0010464 3300048907 Bacteria 8286
496 Ga0496104_0026810 3300048907 Bacteria 5326
497 Ga0496104_0027681 3300048907 Bacteria 5248
498 Ga0496104_0051082 3300048907 Bacteria 3901
499 Ga0496104_0092184 3300048907 Bacteria 2897
500 Ga0496105_0000121 3300048908 Bacteria 52524
501 Ga0496105_0004957 3300048908 Bacteria 10066
502 Ga0496105_0015156 3300048908 Bacteria 6136
503 Ga0496105_0057258 3300048908 Bacteria 3219
504 Ga0496106_0000556 3300048909 Bacteria 26561
505 Ga0496106_0000944 3300048909 Bacteria 21180
506 Ga0496106_0001029 3300048909 Bacteria 20528
507 Ga0496106_0001091 3300048909 Bacteria 20058
508 Ga0496106_0002016 3300048909 Bacteria 15280
509 Ga0496106_0078583 3300048909 Bacteria 2532
510 Ga0496106_0279795 3300048909 Bacteria 1337
511 Ga0496107_0000165 3300048910 Bacteria 33993
512 Ga0496107_0000998 3300048910 Bacteria 16871
513 Ga0496107_0002431 3300048910 Bacteria 12070
514 Ga0496107_0008347 3300048910 Bacteria 7166
515 Ga0496107_0009274 3300048910 Bacteria 6822
516 Ga0496107_0026619 3300048910 Bacteria 4101
517 Ga0496108_0000726 3300048911 Bacteria 25618
518 Ga0496108_0000759 3300048911 Bacteria 25117
519 Ga0496108_0002837 3300048911 Bacteria 13911
520 Ga0496108_0077156 3300048911 Bacteria 2817
521 Ga0496108_0225385 3300048911 Bacteria 1629
522 Ga0496109_0000128 3300048912 Bacteria 77887
523 Ga0496109_0002063 3300048912 Bacteria 16675
524 Ga0496110_0012303 3300048913 Bacteria 7035
525 Ga0496110_0020606 3300048913 Bacteria 5569
526 Ga0496110_0031115 3300048913 Bacteria 4603
527 Ga0496110_0042120 3300048913 Bacteria 3985
528 Ga0496110_0106790 3300048913 Bacteria 2512
529 Ga0496111_0044818 3300048914 Bacteria 3180
530 Ga0496111_0067704 3300048914 Bacteria 2594
531 Ga0496111_0078987 3300048914 Bacteria 2400
532 Ga0496111_0247148 3300048914 Bacteria 1324
533 Ga0496112_0059333 3300048915 Bacteria 3770
534 Ga0496113_0014047 3300048916 Bacteria 5449
535 Ga0496113_0110739 3300048916 Bacteria 2137
536 Ga0496113_0116079 3300048916 Bacteria 2088
537 Ga0496114_0000688 3300048917 Bacteria 25143
538 Ga0496114_0008299 3300048917 Bacteria 8230
539 Ga0496114_0009223 3300048917 Bacteria 7823
540 Ga0496115_0049534 3300048918 Bacteria 3363
541 Ga0496116_0000082 3300048919 Bacteria 222607
542 Ga0496116_0000254 3300048919 Bacteria 94909
543 Ga0496116_0000337 3300048919 Bacteria 75447
544 Ga0496116_0000924 3300048919 Bacteria 36243
545 Ga0496116_0002558 3300048919 Bacteria 18985
546 Ga0496116_0013216 3300048919 Bacteria 6676
547 Ga0496116_0057624 3300048919 Bacteria 2538
548 Ga0496117_0000026 3300048920 Bacteria 416644
549 Ga0496117_0000282 3300048920 Bacteria 94498
550 Ga0496117_0000313 3300048920 Bacteria 84841
551 Ga0496117_0000328 3300048920 Bacteria 83704
552 Ga0496117_0000342 3300048920 Bacteria 82410
553 Ga0496117_0013808 3300048920 Bacteria 7013
554 Ga0496117_0018137 3300048920 Bacteria 5848
555 Ga0496117_0020364 3300048920 Bacteria 5408
556 Ga0496117_0069786 3300048920 Bacteria 2364
557 Ga0496118_0000060 3300048921 Bacteria 222621
558 Ga0496118_0000176 3300048921 Bacteria 114551
559 Ga0496118_0000185 3300048921 Bacteria 109095
560 Ga0496118_0000308 3300048921 Bacteria 84829
561 Ga0496118_0001440 3300048921 Bacteria 35826
562 Ga0496118_0005078 3300048921 Bacteria 15154
563 Ga0496118_0011496 3300048921 Bacteria 8629
564 Ga0496118_0019275 3300048921 Bacteria 6105
565 Ga0496118_0019594 3300048921 Bacteria 6040
566 Ga0496118_0047825 3300048921 Bacteria 3311
567 Ga0496118_0092139 3300048921 Bacteria 2081
568 Ga0496119_0000123 3300048922 Bacteria 108805
569 Ga0496119_0000657 3300048922 Bacteria 46380
570 Ga0496119_0006958 3300048922 Bacteria 10318
571 Ga0496119_0007772 3300048922 Bacteria 9561
572 Ga0496119_0008123 3300048922 Bacteria 9293
573 Ga0496119_0011159 3300048922 Bacteria 7481
574 Ga0496119_0011881 3300048922 Bacteria 7145
575 Ga0496119_0042842 3300048922 Bacteria 2866
576 Ga0496119_0045199 3300048922 Bacteria 2764
577 Ga0496120_0000362 3300048923 Bacteria 73745
578 Ga0496120_0001855 3300048923 Bacteria 23516
579 Ga0496120_0005926 3300048923 Bacteria 9532
580 Ga0496120_0008130 3300048923 Bacteria 7695
581 Ga0496120_0008564 3300048923 Bacteria 7404
582 Ga0496120_0075055 3300048923 Bacteria 1846
583 Ga0496121_0000118 3300048924 Bacteria 175421
584 Ga0496121_0000181 3300048924 Bacteria 140533
585 Ga0496121_0000311 3300048924 Bacteria 101361
586 Ga0496121_0000334 3300048924 Bacteria 98442
587 Ga0496121_0000488 3300048924 Bacteria 76655
588 Ga0496121_0000963 3300048924 Bacteria 51700
589 Ga0496121_0001460 3300048924 Bacteria 39925
590 Ga0496121_0001602 3300048924 Bacteria 37551
591 Ga0496121_0010710 3300048924 Bacteria 10287
592 Ga0496121_0022632 3300048924 Bacteria 6085
593 Ga0496121_0082188 3300048924 Bacteria 2547
594 Ga0496121_0141792 3300048924 Bacteria 1781
595 Ga0496122_0006172 3300048925 Bacteria 13929
596 Ga0496122_0107713 3300048925 Bacteria 1840
597 Ga0496123_0005935 3300048926 Bacteria 12030
598 Ga0496123_0038327 3300048926 Bacteria 3370
599 Ga0496124_0000792 3300048927 Bacteria 51718
600 Ga0496124_0001580 3300048927 Bacteria 32891
601 Ga0496124_0007634 3300048927 Bacteria 11452
602 Ga0496125_0000787 3300048928 Bacteria 51697
603 Ga0496125_0001618 3300048928 Bacteria 31746
604 Ga0496125_0002534 3300048928 Bacteria 23549
605 Ga0496125_0031071 3300048928 Bacteria 4766
606 Ga0496125_0059478 3300048928 Bacteria 3078
607 Ga0496125_0077710 3300048928 Bacteria 2556
608 Ga0496125_0121478 3300048928 Bacteria 1862
609 Ga0496126_0000045 3300048929 Bacteria 331225
610 Ga0496126_0000054 3300048929 Bacteria 309327
611 Ga0496126_0000162 3300048929 Bacteria 153331
612 Ga0496126_0000356 3300048929 Bacteria 95743
613 Ga0496126_0000514 3300048929 Bacteria 75337
614 Ga0496126_0000515 3300048929 Bacteria 75262
615 Ga0496126_0000614 3300048929 Bacteria 67156
616 Ga0496126_0000986 3300048929 Bacteria 48714
617 Ga0496126_0001159 3300048929 Bacteria 43639
618 Ga0496126_0009624 3300048929 Bacteria 10249
619 Ga0496126_0211415 3300048929 Bacteria 1633
620 Ga0501290_000683 3300049513 Bacteria 5061
621 Ga0501292_000001 3300049515 Bacteria 211592
622 Ga0501294_000008 3300049517 Bacteria 22489
623 Ga0501033_0000265 3300049570 Bacteria 50268
624 Ga0501033_0012647 3300049570 Bacteria 6439
625 Ga0501033_0036706 3300049570 Bacteria 3671
626 Ga0501034_0000285 3300049571 Bacteria 90703
627 Ga0501034_0003163 3300049571 Bacteria 18924
628 Ga0501034_0152663 3300049571 Bacteria 2285
629 Ga0501043_0017932 3300049579 Bacteria 5551
630 Ga0501046_0001136 3300049580 Bacteria 25942
631 Ga0501047_0303257 3300049581 Bacteria 1439
632 Ga0501048_0001774 3300049582 Bacteria 16425
633 Ga0501068_0000188 3300049584 Bacteria 29091
634 Ga0501068_0014984 3300049584 Bacteria 4443
635 Ga0501069_0089495 3300049585 Bacteria 1740
636 Ga0501070_0000622 3300049586 Bacteria 32559
637 Ga0501070_0135445 3300049586 Bacteria 2034
638 Ga0501070_0145628 3300049586 Bacteria 1955
639 Ga0501070_0271640 3300049586 Bacteria 1384
640 Ga0501071_0098410 3300049587 Bacteria 2155
641 Ga0501072_0017898 3300049588 Bacteria 5448
642 Ga0501072_0113536 3300049588 Bacteria 2157
643 Ga0501073_0000016 3300049589 Bacteria 156984
644 Ga0501073_0128739 3300049589 Bacteria 1755
645 Ga0501224_000178 3300049664 Bacteria 7123
646 Ga0501080_0048888 3300049742 Bacteria 3935
647 Ga0501281_00011 3300049777 Bacteria 25465
648 Ga0501035_0003391 3300049822 Bacteria 15239
649 Ga0501035_0089263 3300049822 Bacteria 2715
650 Ga0501044_0000365 3300049823 Bacteria 56845
651 Ga0501044_0001366 3300049823 Bacteria 28620
652 nmdc:mga03683_31538_c1 3300050489 Bacteria 2127
653 nmdc:mga03n38_784_c1 3300050490 Bacteria 8440
654 nmdc:mga00v17_121241_c1 3300050491 Bacteria 1665
655 nmdc:mga00v17_1850_c1 3300050491 Bacteria 10936
656 nmdc:mga00v17_26162_c1 3300050491 Bacteria 3397
657 nmdc:mga00v17_72028_c1 3300050491 Bacteria 2143
658 nmdc:mga00v17_9401_c1 3300050491 Bacteria 5288
659 nmdc:mga0yw44_143393_c1 3300050492 Bacteria 1553
660 nmdc:mga0yw44_379_c1 3300050492 Bacteria 15437
661 nmdc:mga0yw44_4379_c1 3300050492 Bacteria 6464
662 nmdc:mga0yw44_91087_c1 3300050492 Bacteria 1927
663 nmdc:mga07m45_36043_c1 3300050496 Bacteria 2753
664 nmdc:mga05p37_44394_c1 3300050507 Bacteria 5468
665 nmdc:mga05p37_6318_c1 3300050507 Bacteria 13955
666 nmdc:mga09592_1473_c1 3300050508 Bacteria 18914
667 nmdc:mga09592_336181_c1 3300050508 Bacteria 1307
668 nmdc:mga09592_87029_c1 3300050508 Bacteria 2667
669 nmdc:mga09592_894_c1 3300050508 Bacteria 23387
670 nmdc:mga0qj67_167711_c1 3300050509 Bacteria 1783
671 nmdc:mga0qj67_1880_c1 3300050509 Bacteria 14892
672 nmdc:mga0qj67_270965_c1 3300050509 Bacteria 1377
673 nmdc:mga0qj67_767_c1 3300050509 Bacteria 16669
674 nmdc:mga06r32_162409_c1 3300050510 Bacteria 2216
675 nmdc:mga06r32_31038_c1 3300050510 Bacteria 5017
676 nmdc:mga06r32_35846_c1 3300050510 Bacteria 4681
677 nmdc:mga06r32_642_c1 3300050510 Bacteria 30428
678 nmdc:mga06r32_66478_c1 3300050510 Bacteria 3479
679 nmdc:mga06r32_7652_c1 3300050510 Bacteria 9715
680 nmdc:mga08y16_125678_c1 3300050511 Bacteria 2668
681 nmdc:mga08y16_32403_c1 3300050511 Bacteria 5495
682 nmdc:mga08y16_6521_c1 3300050511 Bacteria 12240
683 nmdc:mga08y16_75835_c1 3300050511 Bacteria 3505
684 nmdc:mga0n895_250488_c1 3300050512 Bacteria 1797
685 nmdc:mga0sz30_17376_c1 3300050516 Bacteria 2868
686 nmdc:mga0sz30_31624_c1 3300050516 Bacteria 2191
687 Ga0495601_0000168 3300053077 Bacteria 35128
688 Ga0495601_0116930 3300053077 Bacteria 1730
689 Ga0500635_0001707 3300053080 Bacteria 5324
690 Ga0495595_0002019 3300053084 Bacteria 7880
691 Ga0495619_0069293 3300053085 Bacteria 2357
692 Ga0495619_0106818 3300053085 Bacteria 1909
693 Ga0500643_004742 3300053087 Bacteria 6038
694 Ga0500583_0041327 3300053092 Bacteria 2094
695 Ga0500618_002022 3300053125 Bacteria 8229
696 Ga0500652_000103 3300053131 Bacteria 33562
697 Ga0500568_0000037 3300053139 Bacteria 135208
698 Ga0500616_0001970 3300053153 Bacteria 18263
699 Ga0500616_0002921 3300053153 Bacteria 13636
700 Ga0500616_0007130 3300053153 Bacteria 7153
701 Ga0500616_0041435 3300053153 Bacteria 2471
702 Ga0501084_0000082 3300054114 Bacteria 69523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100057801 Ga0207675_1000578012 285
2 3300048924 Ga0496121_0000488 Ga0496121_0000488_41680_42852 285
3 3300030521 Ga0307511_10050447 Ga0307511_100504472 287
4 3300031616 Ga0307508_10242316 Ga0307508_102423162 287
5 3300005617 Ga0068859_100265666 Ga0068859_1002656663 289
6 3300006931 Ga0097620_100265667 Ga0097620_1002656673 289
7 3300006353 Ga0075370_10183223 Ga0075370_101832231 290
8 3300048905 Ga0496102_0418099 Ga0496102_0418099_194_1246 294
9 3300005842 Ga0068858_100000196 Ga0068858_10000019631 297
10 3300009545 Ga0105237_10337020 Ga0105237_103370202 297
11 3300026035 Ga0207703_10000356 Ga0207703_1000035629 297
12 3300005330 Ga0070690_100270976 Ga0070690_1002709761 298
13 3300005841 Ga0068863_100000749 Ga0068863_1000007497 298
14 3300009092 Ga0105250_10007122 Ga0105250_100071224 298
15 3300025941 Ga0207711_10008815 Ga0207711_100088155 298
16 3300026088 Ga0207641_10000019 Ga0207641_10000019230 298
17 3300026095 Ga0207676_10000614 Ga0207676_1000061421 298
18 3300031616 Ga0307508_10006545 Ga0307508_100065457 299
19 3300009094 Ga0111539_10016996 Ga0111539_100169962 302
20 3300050511 nmdc:mga08y16_32403_c1 nmdc:mga08y16_32403_c1_3426_4604 302
21 3300017792 Ga0163161_10048897 Ga0163161_100488972 303
22 3300048917 Ga0496114_0000688 Ga0496114_0000688_19290_20393 303
23 3300048922 Ga0496119_0045199 Ga0496119_0045199_866_2059 303
24 3300048923 Ga0496120_0075055 Ga0496120_0075055_555_1748 303
25 3300048928 Ga0496125_0031071 Ga0496125_0031071_412_1605 303
26 3300021388 Ga0213875_10000173 Ga0213875_100001738 304
27 3300037853 Ga0436364_0986946 Ga0436364_0986946_73799_74974 304
28 3300048905 Ga0496102_0134514 Ga0496102_0134514_197_1336 304
29 3300048906 Ga0496103_0119490 Ga0496103_0119490_150_1289 304
30 3300048921 Ga0496118_0000185 Ga0496118_0000185_84603_85742 304
31 3300049584 Ga0501068_0014984 Ga0501068_0014984_1403_2542 304
32 iso_pu_bacteria 2523231044 2523384381 305
33 3300006048 Ga0075363_100001893 Ga0075363_1000018936 306
34 3300006051 Ga0075364_10006803 Ga0075364_100068036 306
35 3300011119 Ga0105246_10218411 Ga0105246_102184112 306
36 3300021384 Ga0213876_10060624 Ga0213876_100606241 306
37 3300039437 Ga0436365_1168901 Ga0436365_1168901_1725_2783 306
38 3300050490 nmdc:mga03n38_784_c1 nmdc:mga03n38_784_c1_3349_4488 306
39 3300050491 nmdc:mga00v17_9401_c1 nmdc:mga00v17_9401_c1_1835_2974 306
40 3300050492 nmdc:mga0yw44_143393_c1 nmdc:mga0yw44_143393_c1_225_1364 306
41 3300005331 Ga0070670_100059841 Ga0070670_1000598412 307
42 3300005339 Ga0070660_100006063 Ga0070660_1000060635 307
43 3300005344 Ga0070661_100060445 Ga0070661_1000604453 307
44 3300005347 Ga0070668_100002611 Ga0070668_1000026119 307
45 3300005353 Ga0070669_100015078 Ga0070669_1000150782 307
46 3300005355 Ga0070671_100001654 Ga0070671_10000165414 307
47 3300005366 Ga0070659_100012617 Ga0070659_1000126176 307
48 3300005367 Ga0070667_100013720 Ga0070667_1000137201 307
49 3300005457 Ga0070662_100003140 Ga0070662_1000031408 307
50 3300005548 Ga0070665_100000190 Ga0070665_10000019033 307
51 3300005564 Ga0070664_100003085 Ga0070664_10000308512 307
52 3300005841 Ga0068863_100002883 Ga0068863_1000028839 307
53 3300005842 Ga0068858_100044917 Ga0068858_1000449173 307
54 3300005843 Ga0068860_100085398 Ga0068860_1000853982 307
55 3300005844 Ga0068862_100009048 Ga0068862_1000090482 307
56 3300009101 Ga0105247_10009176 Ga0105247_100091764 307
57 3300010375 Ga0105239_10141702 Ga0105239_101417023 307
58 3300025735 Ga0207713_1000450 Ga0207713_100045015 307
59 3300025900 Ga0207710_10012991 Ga0207710_100129912 307
60 3300025919 Ga0207657_10007152 Ga0207657_100071526 307
61 3300025920 Ga0207649_10040470 Ga0207649_100404702 307
62 3300025923 Ga0207681_10003223 Ga0207681_100032232 307
63 3300025925 Ga0207650_10015496 Ga0207650_100154962 307
64 3300025931 Ga0207644_10001508 Ga0207644_1000150814 307
65 3300025932 Ga0207690_10097285 Ga0207690_100972852 307
66 3300025933 Ga0207706_10002746 Ga0207706_1000274612 307
67 3300025941 Ga0207711_10002282 Ga0207711_1000228217 307
68 3300025945 Ga0207679_10055346 Ga0207679_100553462 307
69 3300025972 Ga0207668_10005782 Ga0207668_100057824 307
70 3300025986 Ga0207658_10026785 Ga0207658_100267852 307
71 3300026035 Ga0207703_10018681 Ga0207703_100186812 307
72 3300026067 Ga0207678_10003869 Ga0207678_1000386910 307
73 3300026088 Ga0207641_10038138 Ga0207641_100381383 307
74 3300028379 Ga0268266_10000330 Ga0268266_1000033022 307
75 3300028380 Ga0268265_10008702 Ga0268265_100087027 307
76 3300037853 Ga0436364_1324400 Ga0436364_1324400_6603_7742 307
77 3300042439 Ga0439464_0012717 Ga0439464_0012717_90_1259 307
78 3300036712 Ga0316584_0117868 Ga0316584_0117868_231_1412 308
79 3300039437 Ga0436365_0236902 Ga0436365_0236902_2230_3405 308
80 3300005437 Ga0070710_10015784 Ga0070710_100157843 311
81 3300006175 Ga0070712_100158962 Ga0070712_1001589622 311
82 3300025906 Ga0207699_10056750 Ga0207699_100567501 311
83 3300025915 Ga0207693_10078219 Ga0207693_100782191 311
84 3300025929 Ga0207664_10024685 Ga0207664_100246853 311
85 3300025939 Ga0207665_10008338 Ga0207665_100083383 311
86 3300006847 Ga0075431_100056144 Ga0075431_1000561442 312
87 3300009147 Ga0114129_10100678 Ga0114129_101006784 312
88 3300050508 nmdc:mga09592_336181_c1 nmdc:mga09592_336181_c1_131_1270 312
89 3300050510 nmdc:mga06r32_35846_c1 nmdc:mga06r32_35846_c1_2704_3843 312
90 3300039437 Ga0436365_1627569 Ga0436365_1627569_18235_19413 313
91 3300049570 Ga0501033_0036706 Ga0501033_0036706_1299_2438 313
92 3300049586 Ga0501070_0135445 Ga0501070_0135445_248_1387 313
93 3300049822 Ga0501035_0089263 Ga0501035_0089263_665_1804 313
94 iso_pu_bacteria 2784746768 2785374599 313
95 3300005471 Ga0070698_100315979 Ga0070698_1003159791 314
96 3300028573 Ga0265334_10000111 Ga0265334_1000011121 315
97 3300031691 Ga0316579_10014074 Ga0316579_100140742 315
98 3300036712 Ga0316584_0098458 Ga0316584_0098458_60_1220 315
99 3300046473 Ga0495582_0045848 Ga0495582_0045848_761_1900 315
100 3300053139 Ga0500568_0000037 Ga0500568_0000037_5044_6222 315
101 3300005355 Ga0070671_100001125 Ga0070671_10000112514 316
102 3300005548 Ga0070665_100006109 Ga0070665_10000610911 316
103 3300005618 Ga0068864_100172658 Ga0068864_1001726582 316
104 3300005841 Ga0068863_100012171 Ga0068863_1000121713 316
105 3300026095 Ga0207676_10151959 Ga0207676_101519592 316
106 3300028379 Ga0268266_10003465 Ga0268266_100034656 316
107 3300028381 Ga0268264_10003121 Ga0268264_1000312113 316
108 iso_pu_bacteria 2744054611 2744955431 316
109 iso_pu_bacteria 2954691527 2954691618 316
110 iso_pu_bacteria 2954701450 2954706713 316
111 3300005563 Ga0068855_100217341 Ga0068855_1002173413 317
112 3300009545 Ga0105237_10000103 Ga0105237_1000010363 317
113 3300010375 Ga0105239_10002423 Ga0105239_100024232 317
114 3300025914 Ga0207671_10009098 Ga0207671_100090984 317
115 3300025949 Ga0207667_10175329 Ga0207667_101753293 317
116 iso_pu_bacteria 2523231044 2523382984 317
117 iso_pu_bacteria 2811994879 2812361075 317
118 iso_pu_bacteria 2946072368 2946073299 317
119 iso_pu_bacteria 3002998708 3003006610 317
120 3300005289 Ga0065704_10000190 Ga0065704_1000019020 318
121 3300031616 Ga0307508_10003643 Ga0307508_100036437 318
122 3300044842 Ga0466957_0011457 Ga0466957_0011457_1173_2345 318
123 3300049587 Ga0501071_0098410 Ga0501071_0098410_753_1931 318
124 3300049588 Ga0501072_0113536 Ga0501072_0113536_941_2119 318
125 iso_pu_bacteria 2842134933 2842140200 318
126 3300005985 Ga0081539_10006295 Ga0081539_100062955 319
127 3300046455 Ga0495603_0034983 Ga0495603_0034983_687_1844 319
128 3300046459 Ga0495629_0067424 Ga0495629_0067424_533_1690 319
129 3300046461 Ga0495641_0061385 Ga0495641_0061385_165_1322 319
130 3300046475 Ga0495639_0062595 Ga0495639_0062595_108_1265 319
131 3300047673 Ga0495593_0042253 Ga0495593_0042253_775_1914 319
132 3300005335 Ga0070666_10027913 Ga0070666_100279132 320
133 3300005338 Ga0068868_100000580 Ga0068868_10000058016 320
134 3300005340 Ga0070689_100005290 Ga0070689_1000052901 320
135 3300005345 Ga0070692_10026676 Ga0070692_100266762 320
136 3300005354 Ga0070675_100244165 Ga0070675_1002441652 320
137 3300005356 Ga0070674_100002296 Ga0070674_1000022963 320
138 3300005366 Ga0070659_100021093 Ga0070659_1000210934 320
139 3300005437 Ga0070710_10017207 Ga0070710_100172073 320
140 3300005438 Ga0070701_10075935 Ga0070701_100759352 320
141 3300005439 Ga0070711_100003082 Ga0070711_1000030823 320
142 3300005441 Ga0070700_100004233 Ga0070700_1000042333 320
143 3300005455 Ga0070663_100015257 Ga0070663_1000152573 320
144 3300005456 Ga0070678_100000938 Ga0070678_10000093813 320
145 3300005466 Ga0070685_10010992 Ga0070685_100109926 320
146 3300005546 Ga0070696_100001497 Ga0070696_10000149714 320
147 3300005547 Ga0070693_100007815 Ga0070693_1000078152 320
148 3300005548 Ga0070665_100006279 Ga0070665_1000062792 320
149 3300005563 Ga0068855_100123934 Ga0068855_1001239342 320
150 3300005578 Ga0068854_100000515 Ga0068854_10000051521 320
151 3300005719 Ga0068861_100002353 Ga0068861_10000235313 320
152 3300005842 Ga0068858_100011931 Ga0068858_10001193111 320
153 3300005843 Ga0068860_100006227 Ga0068860_10000622710 320
154 3300005937 Ga0081455_10028658 Ga0081455_100286582 320
155 3300006051 Ga0075364_10054298 Ga0075364_100542983 320
156 3300006175 Ga0070712_100005346 Ga0070712_10000534610 320
157 3300006186 Ga0075369_10027769 Ga0075369_100277693 320
158 3300006881 Ga0068865_100002422 Ga0068865_10000242213 320
159 3300009176 Ga0105242_10000154 Ga0105242_1000015442 320
160 3300009551 Ga0105238_10199373 Ga0105238_101993732 320
161 3300010375 Ga0105239_10074759 Ga0105239_100747594 320
162 3300013105 Ga0157369_10141139 Ga0157369_101411392 320
163 3300014326 Ga0157380_10000198 Ga0157380_1000019821 320
164 3300014969 Ga0157376_10247175 Ga0157376_102471752 320
165 3300025901 Ga0207688_10000490 Ga0207688_1000049011 320
166 3300025916 Ga0207663_10001094 Ga0207663_100010941 320
167 3300025918 Ga0207662_10067223 Ga0207662_100672232 320
168 3300025927 Ga0207687_10070369 Ga0207687_100703693 320
169 3300025932 Ga0207690_10115439 Ga0207690_101154392 320
170 3300025933 Ga0207706_10001079 Ga0207706_1000107911 320
171 3300025934 Ga0207686_10003023 Ga0207686_1000302310 320
172 3300025935 Ga0207709_10001668 Ga0207709_100016687 320
173 3300025936 Ga0207670_10020607 Ga0207670_100206072 320
174 3300025937 Ga0207669_10000085 Ga0207669_1000008531 320
175 3300025938 Ga0207704_10001197 Ga0207704_1000119711 320
176 3300025939 Ga0207665_10001261 Ga0207665_1000126113 320
177 3300025941 Ga0207711_10016364 Ga0207711_100163649 320
178 3300025942 Ga0207689_10101519 Ga0207689_101015192 320
179 3300025961 Ga0207712_10004582 Ga0207712_100045824 320
180 3300025972 Ga0207668_10003089 Ga0207668_1000308910 320
181 3300025981 Ga0207640_10001274 Ga0207640_1000127414 320
182 3300025986 Ga0207658_10002337 Ga0207658_1000233714 320
183 3300025986 Ga0207658_10139536 Ga0207658_101395361 320
184 3300026075 Ga0207708_10000329 Ga0207708_1000032918 320
185 3300026078 Ga0207702_10088524 Ga0207702_100885242 320
186 3300026088 Ga0207641_10109694 Ga0207641_101096942 320
187 3300026089 Ga0207648_10000112 Ga0207648_1000011239 320
188 3300026118 Ga0207675_100000117 Ga0207675_10000011743 320
189 3300028379 Ga0268266_10007065 Ga0268266_100070652 320
190 3300028381 Ga0268264_10008994 Ga0268264_1000899410 320
191 3300045976 Ga0466967_0004333 Ga0466967_0004333_6318_7457 320
192 3300046507 Ga0495606_0038994 Ga0495606_0038994_1228_2367 320
193 3300046648 Ga0495611_0001832 Ga0495611_0001832_1450_2601 320
194 3300048903 Ga0496100_0004606 Ga0496100_0004606_1649_2824 320
195 3300048904 Ga0496101_0004046 Ga0496101_0004046_1530_2705 320
196 3300048905 Ga0496102_0002915 Ga0496102_0002915_5755_6894 320
197 3300048905 Ga0496102_0033970 Ga0496102_0033970_3356_4495 320
198 3300048906 Ga0496103_0003826 Ga0496103_0003826_2498_3637 320
199 3300048907 Ga0496104_0027681 Ga0496104_0027681_1967_3142 320
200 3300048907 Ga0496104_0092184 Ga0496104_0092184_1510_2649 320
201 3300048908 Ga0496105_0004957 Ga0496105_0004957_3256_4431 320
202 3300048909 Ga0496106_0000556 Ga0496106_0000556_11187_12326 320
203 3300048909 Ga0496106_0002016 Ga0496106_0002016_1669_2844 320
204 3300048910 Ga0496107_0002431 Ga0496107_0002431_6879_8018 320
205 3300048910 Ga0496107_0008347 Ga0496107_0008347_2777_3952 320
206 3300048914 Ga0496111_0044818 Ga0496111_0044818_1735_2874 320
207 3300048917 Ga0496114_0008299 Ga0496114_0008299_41_1180 320
208 3300048917 Ga0496114_0009223 Ga0496114_0009223_2950_4125 320
209 3300048918 Ga0496115_0049534 Ga0496115_0049534_1732_2907 320
210 3300049570 Ga0501033_0012647 Ga0501033_0012647_479_1618 320
211 3300049571 Ga0501034_0003163 Ga0501034_0003163_14595_15734 320
212 3300049579 Ga0501043_0017932 Ga0501043_0017932_3632_4771 320
213 3300049580 Ga0501046_0001136 Ga0501046_0001136_23383_24522 320
214 3300049582 Ga0501048_0001774 Ga0501048_0001774_1268_2407 320
215 3300049586 Ga0501070_0000622 Ga0501070_0000622_23244_24383 320
216 3300049586 Ga0501070_0145628 Ga0501070_0145628_78_1217 320
217 3300049822 Ga0501035_0003391 Ga0501035_0003391_10910_12049 320
218 3300049823 Ga0501044_0001366 Ga0501044_0001366_4263_5402 320
219 3300050496 nmdc:mga07m45_36043_c1 nmdc:mga07m45_36043_c1_1182_2321 320
220 3300053087 Ga0500643_004742 Ga0500643_004742_1299_2438 320
221 3300053153 Ga0500616_0001970 Ga0500616_0001970_5471_6610 320
222 3300053153 Ga0500616_0041435 Ga0500616_0041435_956_2095 320
223 3300009101 Ga0105247_10015757 Ga0105247_100157574 321
224 3300014968 Ga0157379_10007178 Ga0157379_100071786 321
225 3300028794 Ga0307515_10057726 Ga0307515_100577264 321
226 3300042138 Ga0450903_001276 Ga0450903_001276_781_1926 321
227 3300046492 Ga0495585_0019191 Ga0495585_0019191_1804_3000 321
228 3300046516 Ga0495628_0152687 Ga0495628_0152687_461_1603 321
229 3300046810 Ga0495660_0053879 Ga0495660_0053879_818_2014 321
230 3300047443 Ga0495687_000495 Ga0495687_000495_16135_17307 321
231 3300048903 Ga0496100_0005684 Ga0496100_0005684_1293_2483 321
232 3300048904 Ga0496101_0000787 Ga0496101_0000787_16466_17656 321
233 3300048905 Ga0496102_0000190 Ga0496102_0000190_32758_33948 321
234 3300048906 Ga0496103_0000125 Ga0496103_0000125_32750_33940 321
235 3300048913 Ga0496110_0031115 Ga0496110_0031115_608_1798 321
236 3300048919 Ga0496116_0000337 Ga0496116_0000337_26931_28121 321
237 3300048920 Ga0496117_0000313 Ga0496117_0000313_34094_35284 321
238 3300048921 Ga0496118_0000308 Ga0496118_0000308_49497_50687 321
239 3300048922 Ga0496119_0011159 Ga0496119_0011159_5502_6692 321
240 3300048923 Ga0496120_0008130 Ga0496120_0008130_3598_4788 321
241 3300048924 Ga0496121_0001602 Ga0496121_0001602_19577_20767 321
242 3300048927 Ga0496124_0007634 Ga0496124_0007634_1756_2946 321
243 3300048928 Ga0496125_0059478 Ga0496125_0059478_451_1641 321
244 3300048929 Ga0496126_0000514 Ga0496126_0000514_26827_28017 321
245 3300053077 Ga0495601_0000168 Ga0495601_0000168_18186_19328 321
246 3300053085 Ga0495619_0106818 Ga0495619_0106818_678_1817 321
247 3300053153 Ga0500616_0002921 Ga0500616_0002921_10629_11807 321
248 iso_pu_bacteria 2523231044 2523387893 321
249 3300005466 Ga0070685_10218095 Ga0070685_102180951 322
250 3300005548 Ga0070665_100009543 Ga0070665_10000954311 322
251 3300005617 Ga0068859_100065412 Ga0068859_1000654122 322
252 3300005718 Ga0068866_10015834 Ga0068866_100158343 322
253 3300005841 Ga0068863_100062140 Ga0068863_1000621402 322
254 3300005844 Ga0068862_100470009 Ga0068862_1004700091 322
255 3300006048 Ga0075363_100000250 Ga0075363_10000025018 322
256 3300006186 Ga0075369_10006461 Ga0075369_100064613 322
257 3300006931 Ga0097620_100065409 Ga0097620_1000654092 322
258 3300009098 Ga0105245_10006970 Ga0105245_100069705 322
259 3300009101 Ga0105247_10058511 Ga0105247_100585112 322
260 3300013296 Ga0157374_10003772 Ga0157374_1000377212 322
261 3300013306 Ga0163162_10026544 Ga0163162_100265447 322
262 3300013306 Ga0163162_10120548 Ga0163162_101205483 322
263 3300014745 Ga0157377_10003096 Ga0157377_100030965 322
264 3300014968 Ga0157379_10090567 Ga0157379_100905672 322
265 3300025900 Ga0207710_10026091 Ga0207710_100260913 322
266 3300025901 Ga0207688_10001081 Ga0207688_1000108111 322
267 3300025936 Ga0207670_10270949 Ga0207670_102709492 322
268 3300026023 Ga0207677_10042316 Ga0207677_100423163 322
269 3300026075 Ga0207708_10042797 Ga0207708_100427971 322
270 3300026088 Ga0207641_10059297 Ga0207641_100592972 322
271 3300028379 Ga0268266_10009705 Ga0268266_100097056 322
272 3300028380 Ga0268265_10215184 Ga0268265_102151842 322
273 3300031995 Ga0307409_100084939 Ga0307409_1000849393 322
274 3300039450 Ga0436363_1081284 Ga0436363_1081284_526_1677 322
275 3300048909 Ga0496106_0078583 Ga0496106_0078583_38_1189 322
276 3300048911 Ga0496108_0000759 Ga0496108_0000759_21806_22957 322
277 3300048912 Ga0496109_0002063 Ga0496109_0002063_4505_5656 322
278 3300048913 Ga0496110_0012303 Ga0496110_0012303_1337_2488 322
279 3300048916 Ga0496113_0110739 Ga0496113_0110739_902_2053 322
280 3300048920 Ga0496117_0013808 Ga0496117_0013808_4649_5821 322
281 3300048921 Ga0496118_0019275 Ga0496118_0019275_3807_4979 322
282 3300048922 Ga0496119_0007772 Ga0496119_0007772_3111_4283 322
283 3300050491 nmdc:mga00v17_72028_c1 nmdc:mga00v17_72028_c1_104_1255 322
284 3300050516 nmdc:mga0sz30_31624_c1 nmdc:mga0sz30_31624_c1_900_2051 322
285 3300005347 Ga0070668_100134112 Ga0070668_1001341124 323
286 3300005355 Ga0070671_100000039 Ga0070671_1000000394 323
287 3300005841 Ga0068863_100004437 Ga0068863_1000044373 323
288 3300005841 Ga0068863_100112882 Ga0068863_1001128823 323
289 3300005842 Ga0068858_100028649 Ga0068858_1000286492 323
290 3300005843 Ga0068860_100015652 Ga0068860_1000156525 323
291 3300013306 Ga0163162_10024898 Ga0163162_100248982 323
292 3300025923 Ga0207681_10000244 Ga0207681_1000024413 323
293 3300025931 Ga0207644_10000022 Ga0207644_10000022122 323
294 3300025972 Ga0207668_10115631 Ga0207668_101156313 323
295 3300025986 Ga0207658_10258072 Ga0207658_102580721 323
296 3300026035 Ga0207703_10047238 Ga0207703_100472382 323
297 3300026088 Ga0207641_10003530 Ga0207641_1000353013 323
298 3300028381 Ga0268264_10026213 Ga0268264_100262134 323
299 3300046452 Ga0495617_013306 Ga0495617_013306_296_1492 323
300 3300046474 Ga0495605_0000988 Ga0495605_0000988_4243_5439 323
301 3300046506 Ga0495583_0031059 Ga0495583_0031059_1027_2223 323
302 3300046507 Ga0495606_0028054 Ga0495606_0028054_2254_3450 323
303 3300046513 Ga0495616_0004551 Ga0495616_0004551_2703_3899 323
304 3300046515 Ga0495620_0000651 Ga0495620_0000651_8966_10162 323
305 3300046518 Ga0495631_0006526 Ga0495631_0006526_4109_5305 323
306 3300046616 Ga0495668_0001973 Ga0495668_0001973_4463_5659 323
307 3300046660 Ga0495625_0011471 Ga0495625_0011471_3047_4243 323
308 3300047443 Ga0495687_019990 Ga0495687_019990_1522_2718 323
309 3300047447 Ga0495685_004932 Ga0495685_004932_2788_3984 323
310 3300047472 Ga0495686_0096259 Ga0495686_0096259_126_1322 323
311 3300048091 Ga0495626_0043768 Ga0495626_0043768_259_1455 323
312 3300048903 Ga0496100_0016688 Ga0496100_0016688_784_1980 323
313 3300048903 Ga0496100_0156579 Ga0496100_0156579_259_1428 323
314 3300048904 Ga0496101_0002919 Ga0496101_0002919_3990_5186 323
315 3300048905 Ga0496102_0000008 Ga0496102_0000008_162005_163201 323
316 3300048906 Ga0496103_0000100 Ga0496103_0000100_59114_60310 323
317 3300048906 Ga0496103_0011948 Ga0496103_0011948_3139_4308 323
318 3300048907 Ga0496104_0010464 Ga0496104_0010464_4747_5943 323
319 3300048907 Ga0496104_0026810 Ga0496104_0026810_3128_4297 323
320 3300048908 Ga0496105_0057258 Ga0496105_0057258_930_2099 323
321 3300048909 Ga0496106_0001091 Ga0496106_0001091_12431_13600 323
322 3300048910 Ga0496107_0000165 Ga0496107_0000165_2070_3239 323
323 3300048911 Ga0496108_0077156 Ga0496108_0077156_1633_2802 323
324 3300048911 Ga0496108_0225385 Ga0496108_0225385_406_1602 323
325 3300048913 Ga0496110_0106790 Ga0496110_0106790_1076_2245 323
326 3300048916 Ga0496113_0014047 Ga0496113_0014047_3560_4729 323
327 3300048919 Ga0496116_0000082 Ga0496116_0000082_59419_60615 323
328 3300048920 Ga0496117_0000026 Ga0496117_0000026_161971_163167 323
329 3300048921 Ga0496118_0000060 Ga0496118_0000060_161990_163186 323
330 3300048922 Ga0496119_0000657 Ga0496119_0000657_30780_31976 323
331 3300048923 Ga0496120_0008564 Ga0496120_0008564_2523_3719 323
332 3300048929 Ga0496126_0000054 Ga0496126_0000054_54370_55566 323
333 iso_pu_bacteria 8002775197 8002779358 323
334 3300021384 Ga0213876_10000150 Ga0213876_1000015063 324
335 3300039437 Ga0436365_0444660 Ga0436365_0444660_1620_2789 324
336 3300046455 Ga0495603_0008543 Ga0495603_0008543_1110_2294 324
337 3300046459 Ga0495629_0062434 Ga0495629_0062434_273_1457 324
338 3300046499 Ga0495594_0002391 Ga0495594_0002391_3895_5079 324
339 3300046526 Ga0495666_0005024 Ga0495666_0005024_1486_2670 324
340 3300046533 Ga0495640_0135442 Ga0495640_0135442_31_1215 324
341 3300046557 Ga0495622_0002051 Ga0495622_0002051_3969_5153 324
342 3300047321 Ga0495676_0005790 Ga0495676_0005790_1420_2604 324
343 3300049581 Ga0501047_0303257 Ga0501047_0303257_109_1293 324
344 3300053092 Ga0500583_0041327 Ga0500583_0041327_229_1407 324
345 3300049513 Ga0501290_000683 Ga0501290_000683_1455_2627 325
346 3300049517 Ga0501294_000008 Ga0501294_000008_15957_17129 325
347 3300049571 Ga0501034_0152663 Ga0501034_0152663_99_1271 325
348 3300049664 Ga0501224_000178 Ga0501224_000178_5918_7090 325
349 3300049777 Ga0501281_00011 Ga0501281_00011_15783_16955 325
350 iso_pu_bacteria 2919713450 2919714508 326
351 3300002459 JGI24751J29686_10001207 JGI24751J29686_100012073 327
352 3300005335 Ga0070666_10194596 Ga0070666_101945961 327
353 3300005353 Ga0070669_100001874 Ga0070669_1000018742 327
354 3300005355 Ga0070671_100148436 Ga0070671_1001484362 327
355 3300005367 Ga0070667_100000080 Ga0070667_10000008035 327
356 3300005367 Ga0070667_100000285 Ga0070667_10000028515 327
357 3300005367 Ga0070667_100127526 Ga0070667_1001275262 327
358 3300005544 Ga0070686_100008872 Ga0070686_1000088723 327
359 3300005548 Ga0070665_100007974 Ga0070665_1000079747 327
360 3300005548 Ga0070665_100011576 Ga0070665_1000115765 327
361 3300005617 Ga0068859_100000182 Ga0068859_10000018228 327
362 3300005617 Ga0068859_100349707 Ga0068859_1003497072 327
363 3300005841 Ga0068863_100000304 Ga0068863_10000030434 327
364 3300005841 Ga0068863_100011021 Ga0068863_1000110213 327
365 3300005842 Ga0068858_100040789 Ga0068858_1000407892 327
366 3300005843 Ga0068860_100000016 Ga0068860_10000001684 327
367 3300005843 Ga0068860_100062410 Ga0068860_1000624102 327
368 3300005843 Ga0068860_100324115 Ga0068860_1003241152 327
369 3300005844 Ga0068862_100000071 Ga0068862_10000007174 327
370 3300005844 Ga0068862_100071180 Ga0068862_1000711802 327
371 3300006038 Ga0075365_10041990 Ga0075365_100419903 327
372 3300006051 Ga0075364_10001157 Ga0075364_1000115715 327
373 3300006051 Ga0075364_10010186 Ga0075364_100101865 327
374 3300006186 Ga0075369_10000752 Ga0075369_1000075210 327
375 3300006931 Ga0097620_100000182 Ga0097620_10000018228 327
376 3300006931 Ga0097620_100349732 Ga0097620_1003497321 327
377 3300007788 Ga0099795_10016015 Ga0099795_100160153 327
378 3300009092 Ga0105250_10021679 Ga0105250_100216792 327
379 3300009101 Ga0105247_10000028 Ga0105247_1000002874 327
380 3300009101 Ga0105247_10077735 Ga0105247_100777352 327
381 3300009177 Ga0105248_10000025 Ga0105248_1000002536 327
382 3300009553 Ga0105249_10000021 Ga0105249_10000021218 327
383 3300014325 Ga0163163_10002775 Ga0163163_100027757 327
384 3300014325 Ga0163163_10009006 Ga0163163_100090062 327
385 3300014968 Ga0157379_10156296 Ga0157379_101562961 327
386 3300025900 Ga0207710_10000034 Ga0207710_1000003474 327
387 3300025903 Ga0207680_10121812 Ga0207680_101218122 327
388 3300025941 Ga0207711_10000048 Ga0207711_1000004879 327
389 3300025961 Ga0207712_10000005 Ga0207712_10000005596 327
390 3300025986 Ga0207658_10000231 Ga0207658_1000023150 327
391 3300025986 Ga0207658_10001080 Ga0207658_1000108015 327
392 3300026035 Ga0207703_10056088 Ga0207703_100560882 327
393 3300026088 Ga0207641_10009945 Ga0207641_100099454 327
394 3300028379 Ga0268266_10004007 Ga0268266_1000400712 327
395 3300028379 Ga0268266_10010646 Ga0268266_100106464 327
396 3300028380 Ga0268265_10000037 Ga0268265_10000037108 327
397 3300028381 Ga0268264_10000005 Ga0268264_10000005591 327
398 3300048903 Ga0496100_0000037 Ga0496100_0000037_39769_40953 327
399 3300048903 Ga0496100_0001777 Ga0496100_0001777_1208_2392 327
400 3300048904 Ga0496101_0000174 Ga0496101_0000174_39793_40977 327
401 3300048904 Ga0496101_0000233 Ga0496101_0000233_1686_2870 327
402 3300048905 Ga0496102_0000524 Ga0496102_0000524_5089_6270 327
403 3300048905 Ga0496102_0000528 Ga0496102_0000528_1638_2822 327
404 3300048905 Ga0496102_0014204 Ga0496102_0014204_5189_6373 327
405 3300048905 Ga0496102_0244915 Ga0496102_0244915_313_1497 327
406 3300048906 Ga0496103_0000168 Ga0496103_0000168_47040_48224 327
407 3300048906 Ga0496103_0000821 Ga0496103_0000821_10881_12065 327
408 3300048906 Ga0496103_0002795 Ga0496103_0002795_486_1667 327
409 3300048907 Ga0496104_0051082 Ga0496104_0051082_835_2019 327
410 3300048908 Ga0496105_0015156 Ga0496105_0015156_1549_2733 327
411 3300048909 Ga0496106_0000944 Ga0496106_0000944_17985_19169 327
412 3300048909 Ga0496106_0001029 Ga0496106_0001029_8648_9832 327
413 3300048910 Ga0496107_0000998 Ga0496107_0000998_5333_6517 327
414 3300048910 Ga0496107_0009274 Ga0496107_0009274_3128_4309 327
415 3300048910 Ga0496107_0026619 Ga0496107_0026619_1018_2202 327
416 3300048911 Ga0496108_0002837 Ga0496108_0002837_2009_3193 327
417 3300048912 Ga0496109_0000128 Ga0496109_0000128_10709_11893 327
418 3300048913 Ga0496110_0020606 Ga0496110_0020606_489_1673 327
419 3300048913 Ga0496110_0042120 Ga0496110_0042120_2599_3783 327
420 3300048914 Ga0496111_0067704 Ga0496111_0067704_825_2009 327
421 3300048914 Ga0496111_0247148 Ga0496111_0247148_94_1278 327
422 3300048919 Ga0496116_0000254 Ga0496116_0000254_47040_48224 327
423 3300048919 Ga0496116_0002558 Ga0496116_0002558_4203_5387 327
424 3300048920 Ga0496117_0000282 Ga0496117_0000282_47483_48667 327
425 3300048920 Ga0496117_0000328 Ga0496117_0000328_59452_60633 327
426 3300048920 Ga0496117_0020364 Ga0496117_0020364_133_1317 327
427 3300048920 Ga0496117_0069786 Ga0496117_0069786_330_1514 327
428 3300048921 Ga0496118_0000176 Ga0496118_0000176_67536_68720 327
429 3300048921 Ga0496118_0001440 Ga0496118_0001440_27831_29015 327
430 3300048921 Ga0496118_0019594 Ga0496118_0019594_418_1602 327
431 3300048922 Ga0496119_0006958 Ga0496119_0006958_1613_2794 327
432 3300048923 Ga0496120_0005926 Ga0496120_0005926_4164_5345 327
433 3300048924 Ga0496121_0000118 Ga0496121_0000118_118970_120154 327
434 3300048924 Ga0496121_0000963 Ga0496121_0000963_10724_11908 327
435 3300048924 Ga0496121_0082188 Ga0496121_0082188_743_1924 327
436 3300048925 Ga0496122_0006172 Ga0496122_0006172_10714_11898 327
437 3300048926 Ga0496123_0005935 Ga0496123_0005935_4657_5841 327
438 3300048927 Ga0496124_0000792 Ga0496124_0000792_39793_40977 327
439 3300048928 Ga0496125_0000787 Ga0496125_0000787_10721_11905 327
440 3300048928 Ga0496125_0121478 Ga0496125_0121478_195_1376 327
441 3300048929 Ga0496126_0000162 Ga0496126_0000162_18277_19461 327
442 3300048929 Ga0496126_0000515 Ga0496126_0000515_57627_58808 327
443 3300048929 Ga0496126_0000614 Ga0496126_0000614_62755_63939 327
444 3300048929 Ga0496126_0000986 Ga0496126_0000986_36803_37987 327
445 3300049589 Ga0501073_0128739 Ga0501073_0128739_549_1736 327
446 3300050489 nmdc:mga03683_31538_c1 nmdc:mga03683_31538_c1_713_1900 327
447 3300050491 nmdc:mga00v17_1850_c1 nmdc:mga00v17_1850_c1_8322_9509 327
448 3300050491 nmdc:mga00v17_26162_c1 nmdc:mga00v17_26162_c1_1149_2336 327
449 3300050492 nmdc:mga0yw44_4379_c1 nmdc:mga0yw44_4379_c1_1258_2445 327
450 3300050516 nmdc:mga0sz30_17376_c1 nmdc:mga0sz30_17376_c1_887_2074 327
451 3300053080 Ga0500635_0001707 Ga0500635_0001707_3366_4550 327
452 3300053131 Ga0500652_000103 Ga0500652_000103_20308_21492 327
453 iso_pu_bacteria 2508501039 2508676577 327
454 iso_pu_bacteria 2517572101 2517763224 327
455 iso_pu_bacteria 2675902999 2676200515 327
456 iso_pu_bacteria 2687453737 2689956995 327
457 iso_pu_bacteria 2773857921 2774845093 327
458 iso_pu_bacteria 8002775197 8002775663 327
459 3300009092 Ga0105250_10006915 Ga0105250_100069152 328
460 3300009098 Ga0105245_10008979 Ga0105245_1000897911 328
461 3300009176 Ga0105242_10124587 Ga0105242_101245872 328
462 3300014325 Ga0163163_10008807 Ga0163163_100088076 328
463 3300048920 Ga0496117_0018137 Ga0496117_0018137_2194_3354 328
464 3300048921 Ga0496118_0005078 Ga0496118_0005078_2474_3634 328
465 3300048922 Ga0496119_0008123 Ga0496119_0008123_2346_3506 328
466 3300048924 Ga0496121_0000334 Ga0496121_0000334_81810_82970 328
467 3300050512 nmdc:mga0n895_250488_c1 nmdc:mga0n895_250488_c1_255_1433 328
468 iso_pu_bacteria 2508501039 2508676618 328
469 iso_pu_bacteria 2675902999 2676200486 328
470 iso_pu_bacteria 2687453737 2689957033 328
471 iso_pu_bacteria 2773857921 2774845064 328
472 iso_pu_bacteria 2915358134 2915361835 328
473 iso_pu_bacteria 2915358134 2915365202 328
474 iso_pu_bacteria 8002784119 8002786858 328
475 3300009094 Ga0111539_10001540 Ga0111539_100015408 329
476 3300025960 Ga0207651_10203425 Ga0207651_102034251 329
477 3300026118 Ga0207675_100295780 Ga0207675_1002957802 329
478 3300027907 Ga0207428_10004278 Ga0207428_100042786 329
479 3300046539 Ga0495621_0005476 Ga0495621_0005476_273_1445 329
480 3300050511 nmdc:mga08y16_125678_c1 nmdc:mga08y16_125678_c1_480_1664 329
481 3300050511 nmdc:mga08y16_6521_c1 nmdc:mga08y16_6521_c1_6673_7857 329
482 iso_pu_bacteria 2547132424 2548698403 329
483 iso_pu_bacteria 2671180195 2671840321 329
484 iso_pu_bacteria 2684623035 2686537427 329
485 iso_pu_bacteria 2687453743 2689990677 329
486 iso_pu_bacteria 2773857922 2774858477 329
487 iso_pu_bacteria 2895880812 2895890241 329
488 iso_pu_bacteria 8002784119 8002785845 329
489 3300005347 Ga0070668_100027860 Ga0070668_1000278602 331
490 3300005354 Ga0070675_100068110 Ga0070675_1000681102 331
491 3300005354 Ga0070675_100220447 Ga0070675_1002204471 331
492 3300005548 Ga0070665_100000424 Ga0070665_10000042426 331
493 3300005548 Ga0070665_100050820 Ga0070665_1000508204 331
494 3300005719 Ga0068861_100260154 Ga0068861_1002601542 331
495 3300005842 Ga0068858_100000039 Ga0068858_100000039110 331
496 3300005842 Ga0068858_100043383 Ga0068858_1000433832 331
497 3300005843 Ga0068860_100179565 Ga0068860_1001795652 331
498 3300005937 Ga0081455_10049076 Ga0081455_100490762 331
499 3300006038 Ga0075365_10123180 Ga0075365_101231802 331
500 3300006042 Ga0075368_10016871 Ga0075368_100168713 331
501 3300006195 Ga0075366_10030273 Ga0075366_100302732 331
502 3300006353 Ga0075370_10018799 Ga0075370_100187992 331
503 3300006844 Ga0075428_100001834 Ga0075428_10000183411 331
504 3300006844 Ga0075428_100406215 Ga0075428_1004062152 331
505 3300006846 Ga0075430_100003945 Ga0075430_1000039456 331
506 3300006846 Ga0075430_100013488 Ga0075430_1000134885 331
507 3300006847 Ga0075431_100009323 Ga0075431_1000093233 331
508 3300006847 Ga0075431_100014125 Ga0075431_1000141256 331
509 3300006847 Ga0075431_100060760 Ga0075431_1000607604 331
510 3300006880 Ga0075429_100000899 Ga0075429_1000008998 331
511 3300006880 Ga0075429_100002833 Ga0075429_10000283311 331
512 3300006880 Ga0075429_100033499 Ga0075429_1000334994 331
513 3300006880 Ga0075429_100050170 Ga0075429_1000501703 331
514 3300006880 Ga0075429_100169518 Ga0075429_1001695182 331
515 3300009147 Ga0114129_10000314 Ga0114129_100003142 331
516 3300009147 Ga0114129_10017891 Ga0114129_100178915 331
517 3300009147 Ga0114129_10262339 Ga0114129_102623392 331
518 3300009177 Ga0105248_10017375 Ga0105248_100173753 331
519 3300009177 Ga0105248_10166498 Ga0105248_101664982 331
520 3300009177 Ga0105248_10190197 Ga0105248_101901972 331
521 3300009177 Ga0105248_10327751 Ga0105248_103277512 331
522 3300013306 Ga0163162_10074638 Ga0163162_100746382 331
523 3300014325 Ga0163163_10040204 Ga0163163_100402042 331
524 3300025900 Ga0207710_10000569 Ga0207710_1000056914 331
525 3300025900 Ga0207710_10001186 Ga0207710_100011867 331
526 3300025922 Ga0207646_10196556 Ga0207646_101965562 331
527 3300025923 Ga0207681_10063953 Ga0207681_100639532 331
528 3300025926 Ga0207659_10086443 Ga0207659_100864431 331
529 3300025941 Ga0207711_10000288 Ga0207711_100002882 331
530 3300025941 Ga0207711_10004155 Ga0207711_100041558 331
531 3300025942 Ga0207689_10265989 Ga0207689_102659891 331
532 3300025961 Ga0207712_10067153 Ga0207712_100671531 331
533 3300025972 Ga0207668_10000172 Ga0207668_100001726 331
534 3300026035 Ga0207703_10000039 Ga0207703_1000003953 331
535 3300026095 Ga0207676_10180029 Ga0207676_101800292 331
536 3300026118 Ga0207675_100407654 Ga0207675_1004076541 331
537 3300027907 Ga0207428_10089178 Ga0207428_100891782 331
538 3300028379 Ga0268266_10000409 Ga0268266_1000040926 331
539 3300028379 Ga0268266_10039127 Ga0268266_100391274 331
540 3300028380 Ga0268265_10079682 Ga0268265_100796822 331
541 3300028380 Ga0268265_10330726 Ga0268265_103307262 331
542 3300031731 Ga0307405_10084392 Ga0307405_100843922 331
543 3300031824 Ga0307413_10026386 Ga0307413_100263862 331
544 3300031852 Ga0307410_10029597 Ga0307410_100295972 331
545 3300031903 Ga0307407_10021436 Ga0307407_100214363 331
546 3300031995 Ga0307409_100018461 Ga0307409_1000184614 331
547 3300032005 Ga0307411_10114579 Ga0307411_101145792 331
548 3300034816 Ga0373930_0002631 Ga0373930_0002631_377_1612 331
549 3300035084 Ga0373928_0010905 Ga0373928_0010905_330_1517 331
550 3300035112 Ga0373932_0003171 Ga0373932_0003171_998_2233 331
551 3300035691 Ga0373931_0000005 Ga0373931_0000005_146676_147911 331
552 3300035691 Ga0373931_0000040 Ga0373931_0000040_62505_63692 331
553 3300046459 Ga0495629_0092654 Ga0495629_0092654_130_1299 331
554 3300046642 Ga0495634_0013649 Ga0495634_0013649_51_1220 331
555 3300046689 Ga0495613_0000311 Ga0495613_0000311_11195_12364 331
556 3300047321 Ga0495676_0175559 Ga0495676_0175559_30_1205 331
557 3300048905 Ga0496102_0054058 Ga0496102_0054058_428_1606 331
558 3300048909 Ga0496106_0279795 Ga0496106_0279795_49_1218 331
559 3300048919 Ga0496116_0000924 Ga0496116_0000924_17045_18223 331
560 3300048921 Ga0496118_0047825 Ga0496118_0047825_291_1469 331
561 3300048922 Ga0496119_0011881 Ga0496119_0011881_698_1879 331
562 3300048922 Ga0496119_0042842 Ga0496119_0042842_1365_2543 331
563 3300048923 Ga0496120_0001855 Ga0496120_0001855_1188_2369 331
564 3300048924 Ga0496121_0001460 Ga0496121_0001460_19496_20704 331
565 3300048924 Ga0496121_0141792 Ga0496121_0141792_267_1448 331
566 3300048928 Ga0496125_0002534 Ga0496125_0002534_13935_15107 331
567 3300048929 Ga0496126_0009624 Ga0496126_0009624_190_1362 331
568 3300048929 Ga0496126_0211415 Ga0496126_0211415_70_1251 331
569 3300050491 nmdc:mga00v17_121241_c1 nmdc:mga00v17_121241_c1_301_1479 331
570 3300050492 nmdc:mga0yw44_379_c1 nmdc:mga0yw44_379_c1_5075_6310 331
571 3300050492 nmdc:mga0yw44_91087_c1 nmdc:mga0yw44_91087_c1_713_1906 331
572 3300050507 nmdc:mga05p37_44394_c1 nmdc:mga05p37_44394_c1_3126_4310 331
573 3300050507 nmdc:mga05p37_6318_c1 nmdc:mga05p37_6318_c1_1675_2853 331
574 3300050508 nmdc:mga09592_1473_c1 nmdc:mga09592_1473_c1_9218_10396 331
575 3300050508 nmdc:mga09592_87029_c1 nmdc:mga09592_87029_c1_1417_2595 331
576 3300050508 nmdc:mga09592_894_c1 nmdc:mga09592_894_c1_7242_8414 331
577 3300050509 nmdc:mga0qj67_167711_c1 nmdc:mga0qj67_167711_c1_282_1460 331
578 3300050509 nmdc:mga0qj67_1880_c1 nmdc:mga0qj67_1880_c1_2131_3309 331
579 3300050509 nmdc:mga0qj67_270965_c1 nmdc:mga0qj67_270965_c1_168_1352 331
580 3300050509 nmdc:mga0qj67_767_c1 nmdc:mga0qj67_767_c1_3132_4304 331
581 3300050510 nmdc:mga06r32_162409_c1 nmdc:mga06r32_162409_c1_923_2107 331
582 3300050510 nmdc:mga06r32_31038_c1 nmdc:mga06r32_31038_c1_2855_4033 331
583 3300050510 nmdc:mga06r32_642_c1 nmdc:mga06r32_642_c1_7565_8737 331
584 3300050510 nmdc:mga06r32_66478_c1 nmdc:mga06r32_66478_c1_1186_2370 331
585 3300050510 nmdc:mga06r32_7652_c1 nmdc:mga06r32_7652_c1_8336_9514 331
586 3300050511 nmdc:mga08y16_75835_c1 nmdc:mga08y16_75835_c1_1500_2684 331
587 3300053125 Ga0500618_002022 Ga0500618_002022_6526_7695 331
588 3300054114 Ga0501084_0000082 Ga0501084_0000082_12091_13263 331
589 iso_pu_bacteria 2626541554 2626636369 331
590 2162886007 SwRhRL2b_contig_3625322 SwRhRL2b_0702.00004410 332
591 3300002459 JGI24751J29686_10000014 JGI24751J29686_1000001447 332
592 3300002459 JGI24751J29686_10000278 JGI24751J29686_100002789 332
593 3300005289 Ga0065704_10005194 Ga0065704_100051942 332
594 3300005289 Ga0065704_10070334 Ga0065704_1007033421 332
595 3300005295 Ga0065707_10098180 Ga0065707_100981802 332
596 3300005331 Ga0070670_100000008 Ga0070670_100000008151 332
597 3300005347 Ga0070668_100008779 Ga0070668_1000087795 332
598 3300005347 Ga0070668_100042570 Ga0070668_1000425703 332
599 3300005347 Ga0070668_100146827 Ga0070668_1001468271 332
600 3300005347 Ga0070668_100199137 Ga0070668_1001991371 332
601 3300005353 Ga0070669_100000045 Ga0070669_10000004533 332
602 3300005353 Ga0070669_100000088 Ga0070669_10000008824 332
603 3300005353 Ga0070669_100010072 Ga0070669_1000100724 332
604 3300005355 Ga0070671_100000105 Ga0070671_10000010533 332
605 3300005355 Ga0070671_100006020 Ga0070671_1000060202 332
606 3300005367 Ga0070667_100000381 Ga0070667_10000038123 332
607 3300005367 Ga0070667_100023532 Ga0070667_1000235325 332
608 3300005367 Ga0070667_100247297 Ga0070667_1002472971 332
609 3300005467 Ga0070706_100011874 Ga0070706_1000118742 332
610 3300005468 Ga0070707_100109770 Ga0070707_1001097703 332
611 3300005471 Ga0070698_100025488 Ga0070698_1000254883 332
612 3300005536 Ga0070697_100059593 Ga0070697_1000595932 332
613 3300005548 Ga0070665_100003418 Ga0070665_1000034183 332
614 3300005548 Ga0070665_100033612 Ga0070665_1000336124 332
615 3300005617 Ga0068859_100003207 Ga0068859_10000320712 332
616 3300005617 Ga0068859_100042209 Ga0068859_1000422094 332
617 3300005617 Ga0068859_100245866 Ga0068859_1002458662 332
618 3300005618 Ga0068864_100000027 Ga0068864_100000027130 332
619 3300005618 Ga0068864_100000147 Ga0068864_10000014750 332
620 3300005719 Ga0068861_100003853 Ga0068861_1000038532 332
621 3300005841 Ga0068863_100001268 Ga0068863_10000126812 332
622 3300005841 Ga0068863_100008023 Ga0068863_1000080239 332
623 3300005842 Ga0068858_100001492 Ga0068858_10000149215 332
624 3300005843 Ga0068860_100000395 Ga0068860_1000003951 332
625 3300005844 Ga0068862_100000152 Ga0068862_10000015250 332
626 3300005844 Ga0068862_100000618 Ga0068862_1000006181 332
627 3300005844 Ga0068862_100019937 Ga0068862_1000199372 332
628 3300006844 Ga0075428_100000178 Ga0075428_10000017827 332
629 3300006931 Ga0097620_100003207 Ga0097620_10000320712 332
630 3300006931 Ga0097620_100042207 Ga0097620_1000422074 332
631 3300006931 Ga0097620_100245882 Ga0097620_1002458822 332
632 3300009011 Ga0105251_10002755 Ga0105251_100027553 332
633 3300009101 Ga0105247_10000006 Ga0105247_1000000672 332
634 3300009101 Ga0105247_10046460 Ga0105247_100464601 332
635 3300009177 Ga0105248_10006928 Ga0105248_1000692810 332
636 3300009177 Ga0105248_10319592 Ga0105248_103195922 332
637 3300009553 Ga0105249_10000259 Ga0105249_100002591 332
638 3300013306 Ga0163162_10034434 Ga0163162_100344345 332
639 3300014325 Ga0163163_10024027 Ga0163163_100240273 332
640 3300014326 Ga0157380_10000648 Ga0157380_100006484 332
641 3300017792 Ga0163161_10001690 Ga0163161_100016907 332
642 3300017792 Ga0163161_10149797 Ga0163161_101497971 332
643 3300025711 Ga0207696_1002177 Ga0207696_10021775 332
644 3300025735 Ga0207713_1016877 Ga0207713_10168772 332
645 3300025898 Ga0207692_10006272 Ga0207692_100062723 332
646 3300025900 Ga0207710_10000025 Ga0207710_10000025214 332
647 3300025910 Ga0207684_10116868 Ga0207684_101168682 332
648 3300025923 Ga0207681_10000022 Ga0207681_10000022134 332
649 3300025923 Ga0207681_10000075 Ga0207681_1000007518 332
650 3300025923 Ga0207681_10007325 Ga0207681_100073254 332
651 3300025925 Ga0207650_10000019 Ga0207650_10000019179 332
652 3300025925 Ga0207650_10000020 Ga0207650_10000020172 332
653 3300025961 Ga0207712_10000217 Ga0207712_1000021753 332
654 3300025972 Ga0207668_10075729 Ga0207668_100757292 332
655 3300025972 Ga0207668_10098666 Ga0207668_100986661 332
656 3300025986 Ga0207658_10000481 Ga0207658_100004819 332
657 3300025986 Ga0207658_10012725 Ga0207658_100127254 332
658 3300026035 Ga0207703_10000335 Ga0207703_1000033536 332
659 3300026088 Ga0207641_10000166 Ga0207641_1000016614 332
660 3300026088 Ga0207641_10005989 Ga0207641_100059899 332
661 3300026095 Ga0207676_10000022 Ga0207676_10000022124 332
662 3300026095 Ga0207676_10000187 Ga0207676_100001874 332
663 3300026118 Ga0207675_100002686 Ga0207675_1000026863 332
664 3300028380 Ga0268265_10000031 Ga0268265_10000031157 332
665 3300028380 Ga0268265_10000121 Ga0268265_1000012146 332
666 3300028381 Ga0268264_10000612 Ga0268264_1000061221 332
667 3300028381 Ga0268264_10074097 Ga0268264_100740973 332
668 3300033545 Ga0316214_1009107 Ga0316214_10091071 332
669 3300035086 Ga0373934_0005084 Ga0373934_0005084_499_1686 332
670 3300035113 Ga0373936_0035565 Ga0373936_0035565_490_1677 332
671 3300035120 Ga0373957_0044104 Ga0373957_0044104_417_1604 332
672 3300035695 Ga0373927_0000260 Ga0373927_0000260_7657_8832 332
673 3300035724 Ga0373933_0030241 Ga0373933_0030241_274_1461 332
674 3300036401 Ga0373937_0075806 Ga0373937_0075806_207_1394 332
675 3300037068 Ga0373925_0000257 Ga0373925_0000257_46920_48095 332
676 3300046462 Ga0495651_0017287 Ga0495651_0017287_2781_3968 332
677 3300046462 Ga0495651_0100275 Ga0495651_0100275_374_1555 332
678 3300046463 Ga0495653_0024020 Ga0495653_0024020_3720_4907 332
679 3300046501 Ga0495607_0046636 Ga0495607_0046636_630_1814 332
680 3300046516 Ga0495628_0144791 Ga0495628_0144791_202_1383 332
681 3300046536 Ga0495587_0067866 Ga0495587_0067866_295_1476 332
682 3300046559 Ga0495667_0012542 Ga0495667_0012542_3917_5104 332
683 3300046648 Ga0495611_0013673 Ga0495611_0013673_101_1297 332
684 3300046663 Ga0495635_0026735 Ga0495635_0026735_2226_3413 332
685 3300046675 Ga0495657_0006334 Ga0495657_0006334_6164_7351 332
686 3300046675 Ga0495657_0054148 Ga0495657_0054148_35_1216 332
687 3300046679 Ga0495623_0096843 Ga0495623_0096843_321_1502 332
688 3300046680 Ga0495646_0046378 Ga0495646_0046378_282_1469 332
689 3300047317 Ga0495604_0177648 Ga0495604_0177648_26_1207 332
690 3300047322 Ga0495680_0027078 Ga0495680_0027078_1922_3109 332
691 3300047322 Ga0495680_0098371 Ga0495680_0098371_807_1988 332
692 3300047471 Ga0495684_0033359 Ga0495684_0033359_220_1407 332
693 3300048088 Ga0495602_0045271 Ga0495602_0045271_2527_3708 332
694 3300048088 Ga0495602_0057114 Ga0495602_0057114_207_1394 332
695 3300048904 Ga0496101_0043160 Ga0496101_0043160_1697_2869 332
696 3300048905 Ga0496102_0000839 Ga0496102_0000839_25062_26234 332
697 3300048906 Ga0496103_0000127 Ga0496103_0000127_72863_74035 332
698 3300048907 Ga0496104_0000103 Ga0496104_0000103_6391_7563 332
699 3300048908 Ga0496105_0000121 Ga0496105_0000121_34703_35875 332
700 3300048911 Ga0496108_0000726 Ga0496108_0000726_19005_20177 332
701 3300048914 Ga0496111_0078987 Ga0496111_0078987_1056_2228 332
702 3300048915 Ga0496112_0059333 Ga0496112_0059333_736_1908 332
703 3300048916 Ga0496113_0116079 Ga0496113_0116079_545_1717 332
704 3300048919 Ga0496116_0013216 Ga0496116_0013216_1964_3136 332
705 3300048919 Ga0496116_0057624 Ga0496116_0057624_695_1867 332
706 3300048920 Ga0496117_0000342 Ga0496117_0000342_13453_14625 332
707 3300048921 Ga0496118_0011496 Ga0496118_0011496_525_1697 332
708 3300048921 Ga0496118_0092139 Ga0496118_0092139_746_1921 332
709 3300048922 Ga0496119_0000123 Ga0496119_0000123_49642_50814 332
710 3300048923 Ga0496120_0000362 Ga0496120_0000362_37871_39043 332
711 3300048924 Ga0496121_0000181 Ga0496121_0000181_55394_56566 332
712 3300048924 Ga0496121_0000311 Ga0496121_0000311_25603_26778 332
713 3300048924 Ga0496121_0010710 Ga0496121_0010710_2183_3355 332
714 3300048924 Ga0496121_0022632 Ga0496121_0022632_4572_5744 332
715 3300048925 Ga0496122_0107713 Ga0496122_0107713_69_1241 332
716 3300048926 Ga0496123_0038327 Ga0496123_0038327_2142_3314 332
717 3300048927 Ga0496124_0001580 Ga0496124_0001580_23820_24992 332
718 3300048928 Ga0496125_0001618 Ga0496125_0001618_11924_13099 332
719 3300048928 Ga0496125_0077710 Ga0496125_0077710_125_1297 332
720 3300048929 Ga0496126_0000045 Ga0496126_0000045_72886_74058 332
721 3300048929 Ga0496126_0000356 Ga0496126_0000356_74584_75759 332
722 3300048929 Ga0496126_0001159 Ga0496126_0001159_7402_8574 332
723 3300049515 Ga0501292_000001 Ga0501292_000001_118882_120054 332
724 3300049570 Ga0501033_0000265 Ga0501033_0000265_48717_49901 332
725 3300049571 Ga0501034_0000285 Ga0501034_0000285_30792_32084 332
726 3300049584 Ga0501068_0000188 Ga0501068_0000188_3482_4756 332
727 3300049585 Ga0501069_0089495 Ga0501069_0089495_22_1206 332
728 3300049586 Ga0501070_0271640 Ga0501070_0271640_63_1235 332
729 3300049588 Ga0501072_0017898 Ga0501072_0017898_1500_2792 332
730 3300049589 Ga0501073_0000016 Ga0501073_0000016_53056_54330 332
731 3300049742 Ga0501080_0048888 Ga0501080_0048888_124_1416 332
732 3300049823 Ga0501044_0000365 Ga0501044_0000365_44079_45263 332
733 3300053077 Ga0495601_0116930 Ga0495601_0116930_116_1297 332
734 3300053084 Ga0495595_0002019 Ga0495595_0002019_5269_6450 332
735 3300053085 Ga0495619_0069293 Ga0495619_0069293_504_1685 332
736 3300053153 Ga0500616_0007130 Ga0500616_0007130_142_1326 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

282

404

0.98

PF00108

Thiolase_N

Thiolase, N-terminal domain

19

275

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pca-assembly1.cif.gz_C crystal structure of beta-ketoadipyl-coa thiolase 0.8813 1 329
6pcc-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.8797 1 329
1ulq-assembly2.cif.gz_F crystal structure of tt0182 from thermus thermophilus hb8 0.8762 4 329
1wl4-assembly1.cif.gz_A human cytosolic acetoacetyl-coa thiolase complexed with coa 0.8755 2 330
6pca-assembly1.cif.gz_C crystal structure of beta-ketoadipyl-coa thiolase 0.8712 1 329
ID Description Score Start End Superfamily
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9692 254 329 3.40.47.10
6bjaA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9634 113 326 3.40.47.10
1pxtB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.96 244 326 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9595 240 330 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9583 228 329 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A534L8W4-F1-model_v4 Thiolase family protein 0.9732 120 332 GO:0016747
AF-A0A7Y2K5I8-F1-model_v4 Thiolase family protein 0.9629 129 329 GO:0003985
GO:0006635
AF-A0A1G7P6Q0-F1-model_v4 acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (Acetoacetyl-CoA thiolase) 0.9595 115 318 GO:0016747
AF-A0A847N7V7-F1-model_v4 Thiolase family protein 0.959 112 327 GO:0016747
AF-A0A842QYT3-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9561 114 329 GO:0016747

Feature Viewer

pLDDT pTM Quality
86.2 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map