F478279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 736 | 308 | 702 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300034816|Ga0373930_0002631|Ga0373930_0002631_377_1612 |
| Length | 411 |
| Sequence | VSLEPTECARGATLPNQEAVIVSCARTAVGTAGRGSLVDVDALELGTRAVAEAVRRSGLEATRFDDVVLAEGLYGGGDIARYAAIEAGLVNVPGVALNRHCAAGLSSIQVAAASIMAGQDEVVIAGGTQSSSTMPRVSRRVPGTDEWDDWMSPSHRDQPDAPNRDMSITVGWNAAHKAGLTREELDAWSLRSHQRAIAGIDGGAFAEEIFPLEVTRRDGSTFTFDVDEHPRRDTTLEKLAALKVLHPEIEGFSITAGNASGINDGAAALVLASRAVAEAEGLEPLATIRSWASVGTDPADTGLAPTLAIPKALQRAGLGIDDVDLWEINEAFAAVPVAACKILGIDDALVNPLGSGCSLGHPIAMTGSRMVITLVHELLRRGGGTAVAAMCVGGGMASALVFDVPGGKGKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 3 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 4 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 5 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 6 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 7 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 8 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 9 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 10 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 11 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 12 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 13 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 14 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 15 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 16 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 17 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 18 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 19 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 20 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 21 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 22 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 23 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 24 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 25 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 174 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 190 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 255 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 256 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 257 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 261 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 265 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 266 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 308 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.38 |
| Metatranscriptomes | 0 |
| Isolates | 4.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.3 |
| Nodule | 2.45 |
| Rhizoplane | 10.87 |
| Rhizosphere | 67.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3625322 | 2162886007 | Bacteria | 15368 |
| 2 | JGI24751J29686_10000014 | 3300002459 | Bacteria | 113284 |
| 3 | JGI24751J29686_10000278 | 3300002459 | Bacteria | 19873 |
| 4 | JGI24751J29686_10001207 | 3300002459 | Bacteria | 5477 |
| 5 | Ga0065704_10000190 | 3300005289 | Bacteria | 213919 |
| 6 | Ga0065704_10005194 | 3300005289 | Bacteria | 7905 |
| 7 | Ga0065704_10070334 | 3300005289 | Bacteria | 31764 |
| 8 | Ga0065707_10098180 | 3300005295 | Bacteria | 3106 |
| 9 | Ga0070690_100270976 | 3300005330 | Bacteria | 1207 |
| 10 | Ga0070670_100000008 | 3300005331 | Bacteria | 292132 |
| 11 | Ga0070670_100059841 | 3300005331 | Bacteria | 3270 |
| 12 | Ga0070666_10027913 | 3300005335 | Bacteria | 3701 |
| 13 | Ga0070666_10194596 | 3300005335 | Bacteria | 1426 |
| 14 | Ga0068868_100000580 | 3300005338 | Bacteria | 24531 |
| 15 | Ga0070660_100006063 | 3300005339 | Bacteria | 8358 |
| 16 | Ga0070689_100005290 | 3300005340 | Bacteria | 8794 |
| 17 | Ga0070661_100060445 | 3300005344 | Bacteria | 2781 |
| 18 | Ga0070692_10026676 | 3300005345 | Bacteria | 2858 |
| 19 | Ga0070668_100002611 | 3300005347 | Bacteria | 13240 |
| 20 | Ga0070668_100008779 | 3300005347 | Bacteria | 7505 |
| 21 | Ga0070668_100027860 | 3300005347 | Bacteria | 4288 |
| 22 | Ga0070668_100042570 | 3300005347 | Bacteria | 3481 |
| 23 | Ga0070668_100134112 | 3300005347 | Bacteria | 1990 |
| 24 | Ga0070668_100146827 | 3300005347 | Bacteria | 1904 |
| 25 | Ga0070668_100199137 | 3300005347 | Bacteria | 1644 |
| 26 | Ga0070669_100000045 | 3300005353 | Bacteria | 119932 |
| 27 | Ga0070669_100000088 | 3300005353 | Bacteria | 88307 |
| 28 | Ga0070669_100001874 | 3300005353 | Bacteria | 15156 |
| 29 | Ga0070669_100010072 | 3300005353 | Bacteria | 6722 |
| 30 | Ga0070669_100015078 | 3300005353 | Bacteria | 5507 |
| 31 | Ga0070675_100068110 | 3300005354 | Bacteria | 2947 |
| 32 | Ga0070675_100220447 | 3300005354 | Bacteria | 1652 |
| 33 | Ga0070675_100244165 | 3300005354 | Bacteria | 1570 |
| 34 | Ga0070671_100000039 | 3300005355 | Bacteria | 93404 |
| 35 | Ga0070671_100000105 | 3300005355 | Bacteria | 53467 |
| 36 | Ga0070671_100001125 | 3300005355 | Bacteria | 19843 |
| 37 | Ga0070671_100001654 | 3300005355 | Bacteria | 16853 |
| 38 | Ga0070671_100006020 | 3300005355 | Bacteria | 9669 |
| 39 | Ga0070671_100148436 | 3300005355 | Bacteria | 1979 |
| 40 | Ga0070674_100002296 | 3300005356 | Bacteria | 10558 |
| 41 | Ga0070659_100012617 | 3300005366 | Bacteria | 6266 |
| 42 | Ga0070659_100021093 | 3300005366 | Bacteria | 4956 |
| 43 | Ga0070667_100000080 | 3300005367 | Bacteria | 119264 |
| 44 | Ga0070667_100000285 | 3300005367 | Bacteria | 57054 |
| 45 | Ga0070667_100000381 | 3300005367 | Bacteria | 48409 |
| 46 | Ga0070667_100013720 | 3300005367 | Bacteria | 6697 |
| 47 | Ga0070667_100023532 | 3300005367 | Bacteria | 5112 |
| 48 | Ga0070667_100127526 | 3300005367 | Bacteria | 2218 |
| 49 | Ga0070667_100247297 | 3300005367 | Bacteria | 1594 |
| 50 | Ga0070710_10015784 | 3300005437 | Bacteria | 3829 |
| 51 | Ga0070710_10017207 | 3300005437 | Bacteria | 3695 |
| 52 | Ga0070701_10075935 | 3300005438 | Bacteria | 1808 |
| 53 | Ga0070711_100003082 | 3300005439 | Bacteria | 9632 |
| 54 | Ga0070700_100004233 | 3300005441 | Bacteria | 7491 |
| 55 | Ga0070663_100015257 | 3300005455 | Bacteria | 4954 |
| 56 | Ga0070678_100000938 | 3300005456 | Bacteria | 14978 |
| 57 | Ga0070662_100003140 | 3300005457 | Bacteria | 10265 |
| 58 | Ga0070685_10010992 | 3300005466 | Bacteria | 4723 |
| 59 | Ga0070685_10218095 | 3300005466 | Bacteria | 1249 |
| 60 | Ga0070706_100011874 | 3300005467 | Bacteria | 8084 |
| 61 | Ga0070707_100109770 | 3300005468 | Bacteria | 2675 |
| 62 | Ga0070698_100025488 | 3300005471 | Bacteria | 6164 |
| 63 | Ga0070698_100315979 | 3300005471 | Bacteria | 1493 |
| 64 | Ga0070697_100059593 | 3300005536 | Bacteria | 3109 |
| 65 | Ga0070686_100008872 | 3300005544 | Bacteria | 5635 |
| 66 | Ga0070696_100001497 | 3300005546 | Bacteria | 15326 |
| 67 | Ga0070693_100007815 | 3300005547 | Bacteria | 5243 |
| 68 | Ga0070665_100000190 | 3300005548 | Bacteria | 109791 |
| 69 | Ga0070665_100000424 | 3300005548 | Bacteria | 61687 |
| 70 | Ga0070665_100003418 | 3300005548 | Bacteria | 16964 |
| 71 | Ga0070665_100006109 | 3300005548 | Bacteria | 12315 |
| 72 | Ga0070665_100006279 | 3300005548 | Bacteria | 12146 |
| 73 | Ga0070665_100007974 | 3300005548 | Bacteria | 10732 |
| 74 | Ga0070665_100009543 | 3300005548 | Bacteria | 9816 |
| 75 | Ga0070665_100011576 | 3300005548 | Bacteria | 8919 |
| 76 | Ga0070665_100033612 | 3300005548 | Bacteria | 5160 |
| 77 | Ga0070665_100050820 | 3300005548 | Bacteria | 4160 |
| 78 | Ga0068855_100123934 | 3300005563 | Bacteria | 2956 |
| 79 | Ga0068855_100217341 | 3300005563 | Bacteria | 2145 |
| 80 | Ga0070664_100003085 | 3300005564 | Bacteria | 13467 |
| 81 | Ga0068854_100000515 | 3300005578 | Bacteria | 23453 |
| 82 | Ga0068859_100000182 | 3300005617 | Bacteria | 61758 |
| 83 | Ga0068859_100003207 | 3300005617 | Bacteria | 16651 |
| 84 | Ga0068859_100042209 | 3300005617 | Bacteria | 4581 |
| 85 | Ga0068859_100065412 | 3300005617 | Bacteria | 3670 |
| 86 | Ga0068859_100245866 | 3300005617 | Bacteria | 1879 |
| 87 | Ga0068859_100265666 | 3300005617 | Bacteria | 1808 |
| 88 | Ga0068859_100349707 | 3300005617 | Bacteria | 1573 |
| 89 | Ga0068864_100000027 | 3300005618 | Bacteria | 229759 |
| 90 | Ga0068864_100000147 | 3300005618 | Bacteria | 67035 |
| 91 | Ga0068864_100172658 | 3300005618 | Bacteria | 1972 |
| 92 | Ga0068866_10015834 | 3300005718 | Bacteria | 3359 |
| 93 | Ga0068861_100002353 | 3300005719 | Bacteria | 12296 |
| 94 | Ga0068861_100003853 | 3300005719 | Bacteria | 10021 |
| 95 | Ga0068861_100260154 | 3300005719 | Bacteria | 1485 |
| 96 | Ga0068863_100000304 | 3300005841 | Bacteria | 50637 |
| 97 | Ga0068863_100000749 | 3300005841 | Bacteria | 32440 |
| 98 | Ga0068863_100001268 | 3300005841 | Bacteria | 25179 |
| 99 | Ga0068863_100002883 | 3300005841 | Bacteria | 17029 |
| 100 | Ga0068863_100004437 | 3300005841 | Bacteria | 13834 |
| 101 | Ga0068863_100008023 | 3300005841 | Bacteria | 10316 |
| 102 | Ga0068863_100011021 | 3300005841 | Bacteria | 8768 |
| 103 | Ga0068863_100012171 | 3300005841 | Bacteria | 8309 |
| 104 | Ga0068863_100062140 | 3300005841 | Bacteria | 3533 |
| 105 | Ga0068863_100112882 | 3300005841 | Bacteria | 2588 |
| 106 | Ga0068858_100000039 | 3300005842 | Bacteria | 136946 |
| 107 | Ga0068858_100000196 | 3300005842 | Bacteria | 64743 |
| 108 | Ga0068858_100001492 | 3300005842 | Bacteria | 24117 |
| 109 | Ga0068858_100011931 | 3300005842 | Bacteria | 8191 |
| 110 | Ga0068858_100028649 | 3300005842 | Bacteria | 5172 |
| 111 | Ga0068858_100040789 | 3300005842 | Bacteria | 4306 |
| 112 | Ga0068858_100043383 | 3300005842 | Bacteria | 4170 |
| 113 | Ga0068858_100044917 | 3300005842 | Bacteria | 4094 |
| 114 | Ga0068860_100000016 | 3300005843 | Bacteria | 310468 |
| 115 | Ga0068860_100000395 | 3300005843 | Bacteria | 57094 |
| 116 | Ga0068860_100006227 | 3300005843 | Bacteria | 11990 |
| 117 | Ga0068860_100015652 | 3300005843 | Bacteria | 7405 |
| 118 | Ga0068860_100062410 | 3300005843 | Bacteria | 3541 |
| 119 | Ga0068860_100085398 | 3300005843 | Bacteria | 3003 |
| 120 | Ga0068860_100179565 | 3300005843 | Bacteria | 2046 |
| 121 | Ga0068860_100324115 | 3300005843 | Bacteria | 1512 |
| 122 | Ga0068862_100000071 | 3300005844 | Bacteria | 120449 |
| 123 | Ga0068862_100000152 | 3300005844 | Bacteria | 78660 |
| 124 | Ga0068862_100000618 | 3300005844 | Bacteria | 36987 |
| 125 | Ga0068862_100009048 | 3300005844 | Bacteria | 8244 |
| 126 | Ga0068862_100019937 | 3300005844 | Bacteria | 5597 |
| 127 | Ga0068862_100071180 | 3300005844 | Bacteria | 3003 |
| 128 | Ga0068862_100470009 | 3300005844 | Bacteria | 1188 |
| 129 | Ga0081455_10028658 | 3300005937 | Bacteria | 5084 |
| 130 | Ga0081455_10049076 | 3300005937 | Bacteria | 3641 |
| 131 | Ga0081539_10006295 | 3300005985 | Bacteria | 11470 |
| 132 | Ga0075365_10041990 | 3300006038 | Bacteria | 2989 |
| 133 | Ga0075365_10123180 | 3300006038 | Bacteria | 1790 |
| 134 | Ga0075368_10016871 | 3300006042 | Bacteria | 2726 |
| 135 | Ga0075363_100000250 | 3300006048 | Bacteria | 15257 |
| 136 | Ga0075363_100001893 | 3300006048 | Bacteria | 8272 |
| 137 | Ga0075364_10001157 | 3300006051 | Bacteria | 14108 |
| 138 | Ga0075364_10006803 | 3300006051 | Bacteria | 6745 |
| 139 | Ga0075364_10010186 | 3300006051 | Bacteria | 5670 |
| 140 | Ga0075364_10054298 | 3300006051 | Bacteria | 2620 |
| 141 | Ga0070712_100005346 | 3300006175 | Bacteria | 7950 |
| 142 | Ga0070712_100158962 | 3300006175 | Bacteria | 1743 |
| 143 | Ga0075369_10000752 | 3300006186 | Bacteria | 10535 |
| 144 | Ga0075369_10006461 | 3300006186 | Bacteria | 4434 |
| 145 | Ga0075369_10027769 | 3300006186 | Bacteria | 2367 |
| 146 | Ga0075366_10030273 | 3300006195 | Bacteria | 3182 |
| 147 | Ga0075370_10018799 | 3300006353 | Bacteria | 3752 |
| 148 | Ga0075370_10183223 | 3300006353 | Bacteria | 1233 |
| 149 | Ga0075428_100000178 | 3300006844 | Bacteria | 59510 |
| 150 | Ga0075428_100001834 | 3300006844 | Bacteria | 22753 |
| 151 | Ga0075428_100406215 | 3300006844 | Bacteria | 1459 |
| 152 | Ga0075430_100003945 | 3300006846 | Bacteria | 12517 |
| 153 | Ga0075430_100013488 | 3300006846 | Bacteria | 6966 |
| 154 | Ga0075431_100009323 | 3300006847 | Bacteria | 9847 |
| 155 | Ga0075431_100014125 | 3300006847 | Bacteria | 8072 |
| 156 | Ga0075431_100056144 | 3300006847 | Bacteria | 4062 |
| 157 | Ga0075431_100060760 | 3300006847 | Bacteria | 3900 |
| 158 | Ga0075429_100000899 | 3300006880 | Bacteria | 23528 |
| 159 | Ga0075429_100002833 | 3300006880 | Bacteria | 14677 |
| 160 | Ga0075429_100033499 | 3300006880 | Bacteria | 4465 |
| 161 | Ga0075429_100050170 | 3300006880 | Bacteria | 3631 |
| 162 | Ga0075429_100169518 | 3300006880 | Bacteria | 1912 |
| 163 | Ga0068865_100002422 | 3300006881 | Bacteria | 11018 |
| 164 | Ga0097620_100000182 | 3300006931 | Bacteria | 61758 |
| 165 | Ga0097620_100003207 | 3300006931 | Bacteria | 16651 |
| 166 | Ga0097620_100042207 | 3300006931 | Bacteria | 4581 |
| 167 | Ga0097620_100065409 | 3300006931 | Bacteria | 3670 |
| 168 | Ga0097620_100245882 | 3300006931 | Bacteria | 1879 |
| 169 | Ga0097620_100265667 | 3300006931 | Bacteria | 1808 |
| 170 | Ga0097620_100349732 | 3300006931 | Bacteria | 1573 |
| 171 | Ga0099795_10016015 | 3300007788 | Bacteria | 2362 |
| 172 | Ga0105251_10002755 | 3300009011 | Bacteria | 13426 |
| 173 | Ga0105250_10006915 | 3300009092 | Bacteria | 4914 |
| 174 | Ga0105250_10007122 | 3300009092 | Bacteria | 4828 |
| 175 | Ga0105250_10021679 | 3300009092 | Bacteria | 2592 |
| 176 | Ga0111539_10001540 | 3300009094 | Bacteria | 30701 |
| 177 | Ga0111539_10016996 | 3300009094 | Bacteria | 9004 |
| 178 | Ga0105245_10006970 | 3300009098 | Bacteria | 9911 |
| 179 | Ga0105245_10008979 | 3300009098 | Bacteria | 8719 |
| 180 | Ga0105247_10000006 | 3300009101 | Bacteria | 416061 |
| 181 | Ga0105247_10000028 | 3300009101 | Bacteria | 201372 |
| 182 | Ga0105247_10009176 | 3300009101 | Bacteria | 6019 |
| 183 | Ga0105247_10015757 | 3300009101 | Bacteria | 4526 |
| 184 | Ga0105247_10046460 | 3300009101 | Bacteria | 2665 |
| 185 | Ga0105247_10058511 | 3300009101 | Bacteria | 2385 |
| 186 | Ga0105247_10077735 | 3300009101 | Bacteria | 2086 |
| 187 | Ga0114129_10000314 | 3300009147 | Bacteria | 56573 |
| 188 | Ga0114129_10017891 | 3300009147 | Bacteria | 10088 |
| 189 | Ga0114129_10100678 | 3300009147 | Bacteria | 3998 |
| 190 | Ga0114129_10262339 | 3300009147 | Bacteria | 2314 |
| 191 | Ga0105242_10000154 | 3300009176 | Bacteria | 50757 |
| 192 | Ga0105242_10124587 | 3300009176 | Bacteria | 2216 |
| 193 | Ga0105248_10000025 | 3300009177 | Bacteria | 259691 |
| 194 | Ga0105248_10006928 | 3300009177 | Bacteria | 12421 |
| 195 | Ga0105248_10017375 | 3300009177 | Bacteria | 7930 |
| 196 | Ga0105248_10166498 | 3300009177 | Bacteria | 2485 |
| 197 | Ga0105248_10190197 | 3300009177 | Bacteria | 2313 |
| 198 | Ga0105248_10319592 | 3300009177 | Bacteria | 1748 |
| 199 | Ga0105248_10327751 | 3300009177 | Bacteria | 1725 |
| 200 | Ga0105237_10000103 | 3300009545 | Bacteria | 118661 |
| 201 | Ga0105237_10337020 | 3300009545 | Bacteria | 1512 |
| 202 | Ga0105238_10199373 | 3300009551 | Bacteria | 1977 |
| 203 | Ga0105249_10000021 | 3300009553 | Bacteria | 260448 |
| 204 | Ga0105249_10000259 | 3300009553 | Bacteria | 57099 |
| 205 | Ga0105239_10002423 | 3300010375 | Bacteria | 23756 |
| 206 | Ga0105239_10074759 | 3300010375 | Bacteria | 3725 |
| 207 | Ga0105239_10141702 | 3300010375 | Bacteria | 2679 |
| 208 | Ga0105246_10218411 | 3300011119 | Bacteria | 1492 |
| 209 | Ga0157369_10141139 | 3300013105 | Bacteria | 2549 |
| 210 | Ga0157374_10003772 | 3300013296 | Bacteria | 12742 |
| 211 | Ga0163162_10024898 | 3300013306 | Bacteria | 5912 |
| 212 | Ga0163162_10026544 | 3300013306 | Bacteria | 5725 |
| 213 | Ga0163162_10034434 | 3300013306 | Bacteria | 5041 |
| 214 | Ga0163162_10074638 | 3300013306 | Bacteria | 3450 |
| 215 | Ga0163162_10120548 | 3300013306 | Bacteria | 2727 |
| 216 | Ga0163163_10002775 | 3300014325 | Bacteria | 14788 |
| 217 | Ga0163163_10008807 | 3300014325 | Bacteria | 8983 |
| 218 | Ga0163163_10009006 | 3300014325 | Bacteria | 8893 |
| 219 | Ga0163163_10024027 | 3300014325 | Bacteria | 5798 |
| 220 | Ga0163163_10040204 | 3300014325 | Bacteria | 4566 |
| 221 | Ga0157380_10000198 | 3300014326 | Bacteria | 35239 |
| 222 | Ga0157380_10000648 | 3300014326 | Bacteria | 21525 |
| 223 | Ga0157377_10003096 | 3300014745 | Bacteria | 7475 |
| 224 | Ga0157379_10007178 | 3300014968 | Bacteria | 9640 |
| 225 | Ga0157379_10090567 | 3300014968 | Bacteria | 2744 |
| 226 | Ga0157379_10156296 | 3300014968 | Bacteria | 2058 |
| 227 | Ga0157376_10247175 | 3300014969 | Bacteria | 1664 |
| 228 | Ga0163161_10001690 | 3300017792 | Bacteria | 16205 |
| 229 | Ga0163161_10048897 | 3300017792 | Bacteria | 3055 |
| 230 | Ga0163161_10149797 | 3300017792 | Bacteria | 1772 |
| 231 | Ga0213876_10000150 | 3300021384 | Bacteria | 74357 |
| 232 | Ga0213876_10060624 | 3300021384 | Bacteria | 1996 |
| 233 | Ga0213875_10000173 | 3300021388 | Bacteria | 68092 |
| 234 | Ga0207696_1002177 | 3300025711 | Bacteria | 9824 |
| 235 | Ga0207713_1000450 | 3300025735 | Bacteria | 43056 |
| 236 | Ga0207713_1016877 | 3300025735 | Bacteria | 3689 |
| 237 | Ga0207692_10006272 | 3300025898 | Bacteria | 4820 |
| 238 | Ga0207710_10000025 | 3300025900 | Bacteria | 314658 |
| 239 | Ga0207710_10000034 | 3300025900 | Bacteria | 256915 |
| 240 | Ga0207710_10000569 | 3300025900 | Bacteria | 22108 |
| 241 | Ga0207710_10001186 | 3300025900 | Bacteria | 13235 |
| 242 | Ga0207710_10012991 | 3300025900 | Bacteria | 3507 |
| 243 | Ga0207710_10026091 | 3300025900 | Bacteria | 2523 |
| 244 | Ga0207688_10000490 | 3300025901 | Bacteria | 19049 |
| 245 | Ga0207688_10001081 | 3300025901 | Bacteria | 13962 |
| 246 | Ga0207680_10121812 | 3300025903 | Bacteria | 1707 |
| 247 | Ga0207699_10056750 | 3300025906 | Bacteria | 2335 |
| 248 | Ga0207684_10116868 | 3300025910 | Bacteria | 2285 |
| 249 | Ga0207671_10009098 | 3300025914 | Bacteria | 8344 |
| 250 | Ga0207693_10078219 | 3300025915 | Bacteria | 2589 |
| 251 | Ga0207663_10001094 | 3300025916 | Bacteria | 12456 |
| 252 | Ga0207662_10067223 | 3300025918 | Bacteria | 2161 |
| 253 | Ga0207657_10007152 | 3300025919 | Bacteria | 11463 |
| 254 | Ga0207649_10040470 | 3300025920 | Bacteria | 2833 |
| 255 | Ga0207646_10196556 | 3300025922 | Bacteria | 1821 |
| 256 | Ga0207681_10000022 | 3300025923 | Bacteria | 230079 |
| 257 | Ga0207681_10000075 | 3300025923 | Bacteria | 89848 |
| 258 | Ga0207681_10000244 | 3300025923 | Bacteria | 41393 |
| 259 | Ga0207681_10003223 | 3300025923 | Bacteria | 10233 |
| 260 | Ga0207681_10007325 | 3300025923 | Bacteria | 6761 |
| 261 | Ga0207681_10063953 | 3300025923 | Bacteria | 2539 |
| 262 | Ga0207650_10000019 | 3300025925 | Bacteria | 344751 |
| 263 | Ga0207650_10000020 | 3300025925 | Bacteria | 342596 |
| 264 | Ga0207650_10015496 | 3300025925 | Bacteria | 5311 |
| 265 | Ga0207659_10086443 | 3300025926 | Bacteria | 2332 |
| 266 | Ga0207687_10070369 | 3300025927 | Bacteria | 2498 |
| 267 | Ga0207664_10024685 | 3300025929 | Bacteria | 4519 |
| 268 | Ga0207644_10000022 | 3300025931 | Bacteria | 160689 |
| 269 | Ga0207644_10001508 | 3300025931 | Bacteria | 15012 |
| 270 | Ga0207690_10097285 | 3300025932 | Bacteria | 2094 |
| 271 | Ga0207690_10115439 | 3300025932 | Bacteria | 1940 |
| 272 | Ga0207706_10001079 | 3300025933 | Bacteria | 27701 |
| 273 | Ga0207706_10002746 | 3300025933 | Bacteria | 17108 |
| 274 | Ga0207686_10003023 | 3300025934 | Bacteria | 9063 |
| 275 | Ga0207709_10001668 | 3300025935 | Bacteria | 14959 |
| 276 | Ga0207670_10020607 | 3300025936 | Bacteria | 4055 |
| 277 | Ga0207670_10270949 | 3300025936 | Bacteria | 1319 |
| 278 | Ga0207669_10000085 | 3300025937 | Bacteria | 47505 |
| 279 | Ga0207704_10001197 | 3300025938 | Bacteria | 11568 |
| 280 | Ga0207665_10001261 | 3300025939 | Bacteria | 17077 |
| 281 | Ga0207665_10008338 | 3300025939 | Bacteria | 6838 |
| 282 | Ga0207711_10000048 | 3300025941 | Bacteria | 149049 |
| 283 | Ga0207711_10000288 | 3300025941 | Bacteria | 53814 |
| 284 | Ga0207711_10002282 | 3300025941 | Bacteria | 17215 |
| 285 | Ga0207711_10004155 | 3300025941 | Bacteria | 12398 |
| 286 | Ga0207711_10008815 | 3300025941 | Bacteria | 8434 |
| 287 | Ga0207711_10016364 | 3300025941 | Bacteria | 6164 |
| 288 | Ga0207689_10101519 | 3300025942 | Bacteria | 2363 |
| 289 | Ga0207689_10265989 | 3300025942 | Bacteria | 1419 |
| 290 | Ga0207679_10055346 | 3300025945 | Bacteria | 2924 |
| 291 | Ga0207667_10175329 | 3300025949 | Bacteria | 2203 |
| 292 | Ga0207651_10203425 | 3300025960 | Bacteria | 1589 |
| 293 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 294 | Ga0207712_10000217 | 3300025961 | Bacteria | 57107 |
| 295 | Ga0207712_10004582 | 3300025961 | Bacteria | 8724 |
| 296 | Ga0207712_10067153 | 3300025961 | Bacteria | 2565 |
| 297 | Ga0207668_10000172 | 3300025972 | Bacteria | 44549 |
| 298 | Ga0207668_10003089 | 3300025972 | Bacteria | 9763 |
| 299 | Ga0207668_10005782 | 3300025972 | Bacteria | 7286 |
| 300 | Ga0207668_10075729 | 3300025972 | Bacteria | 2420 |
| 301 | Ga0207668_10098666 | 3300025972 | Bacteria | 2165 |
| 302 | Ga0207668_10115631 | 3300025972 | Bacteria | 2021 |
| 303 | Ga0207640_10001274 | 3300025981 | Bacteria | 13695 |
| 304 | Ga0207658_10000231 | 3300025986 | Bacteria | 58979 |
| 305 | Ga0207658_10000481 | 3300025986 | Bacteria | 36947 |
| 306 | Ga0207658_10001080 | 3300025986 | Bacteria | 22086 |
| 307 | Ga0207658_10002337 | 3300025986 | Bacteria | 13930 |
| 308 | Ga0207658_10012725 | 3300025986 | Bacteria | 5747 |
| 309 | Ga0207658_10026785 | 3300025986 | Bacteria | 4045 |
| 310 | Ga0207658_10139536 | 3300025986 | Bacteria | 1959 |
| 311 | Ga0207658_10258072 | 3300025986 | Bacteria | 1484 |
| 312 | Ga0207677_10042316 | 3300026023 | Bacteria | 3020 |
| 313 | Ga0207703_10000039 | 3300026035 | Bacteria | 170322 |
| 314 | Ga0207703_10000335 | 3300026035 | Bacteria | 51216 |
| 315 | Ga0207703_10000356 | 3300026035 | Bacteria | 49172 |
| 316 | Ga0207703_10018681 | 3300026035 | Bacteria | 5415 |
| 317 | Ga0207703_10047238 | 3300026035 | Bacteria | 3470 |
| 318 | Ga0207703_10056088 | 3300026035 | Bacteria | 3207 |
| 319 | Ga0207678_10003869 | 3300026067 | Bacteria | 13462 |
| 320 | Ga0207708_10000329 | 3300026075 | Bacteria | 37329 |
| 321 | Ga0207708_10042797 | 3300026075 | Bacteria | 3451 |
| 322 | Ga0207702_10088524 | 3300026078 | Bacteria | 2705 |
| 323 | Ga0207641_10000019 | 3300026088 | Bacteria | 295899 |
| 324 | Ga0207641_10000166 | 3300026088 | Bacteria | 93398 |
| 325 | Ga0207641_10003530 | 3300026088 | Bacteria | 13843 |
| 326 | Ga0207641_10005989 | 3300026088 | Bacteria | 10306 |
| 327 | Ga0207641_10009945 | 3300026088 | Bacteria | 7827 |
| 328 | Ga0207641_10038138 | 3300026088 | Bacteria | 4016 |
| 329 | Ga0207641_10059297 | 3300026088 | Bacteria | 3259 |
| 330 | Ga0207641_10109694 | 3300026088 | Bacteria | 2444 |
| 331 | Ga0207648_10000112 | 3300026089 | Bacteria | 78746 |
| 332 | Ga0207676_10000022 | 3300026095 | Bacteria | 296286 |
| 333 | Ga0207676_10000187 | 3300026095 | Bacteria | 54323 |
| 334 | Ga0207676_10000614 | 3300026095 | Bacteria | 29147 |
| 335 | Ga0207676_10151959 | 3300026095 | Bacteria | 1995 |
| 336 | Ga0207676_10180029 | 3300026095 | Bacteria | 1850 |
| 337 | Ga0207675_100000117 | 3300026118 | Bacteria | 64829 |
| 338 | Ga0207675_100002686 | 3300026118 | Bacteria | 17549 |
| 339 | Ga0207675_100057801 | 3300026118 | Bacteria | 3619 |
| 340 | Ga0207675_100295780 | 3300026118 | Bacteria | 1576 |
| 341 | Ga0207675_100407654 | 3300026118 | Bacteria | 1340 |
| 342 | Ga0207428_10004278 | 3300027907 | Bacteria | 13659 |
| 343 | Ga0207428_10089178 | 3300027907 | Bacteria | 2397 |
| 344 | Ga0268266_10000330 | 3300028379 | Bacteria | 74566 |
| 345 | Ga0268266_10000409 | 3300028379 | Bacteria | 65290 |
| 346 | Ga0268266_10003465 | 3300028379 | Bacteria | 15738 |
| 347 | Ga0268266_10004007 | 3300028379 | Bacteria | 14248 |
| 348 | Ga0268266_10007065 | 3300028379 | Bacteria | 10194 |
| 349 | Ga0268266_10009705 | 3300028379 | Bacteria | 8459 |
| 350 | Ga0268266_10010646 | 3300028379 | Bacteria | 8013 |
| 351 | Ga0268266_10039127 | 3300028379 | Bacteria | 4039 |
| 352 | Ga0268265_10000031 | 3300028380 | Bacteria | 226725 |
| 353 | Ga0268265_10000037 | 3300028380 | Bacteria | 202579 |
| 354 | Ga0268265_10000121 | 3300028380 | Bacteria | 97688 |
| 355 | Ga0268265_10008702 | 3300028380 | Bacteria | 6862 |
| 356 | Ga0268265_10079682 | 3300028380 | Bacteria | 2580 |
| 357 | Ga0268265_10215184 | 3300028380 | Bacteria | 1677 |
| 358 | Ga0268265_10330726 | 3300028380 | Bacteria | 1384 |
| 359 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 360 | Ga0268264_10000612 | 3300028381 | Bacteria | 42805 |
| 361 | Ga0268264_10003121 | 3300028381 | Bacteria | 14357 |
| 362 | Ga0268264_10008994 | 3300028381 | Bacteria | 8288 |
| 363 | Ga0268264_10026213 | 3300028381 | Bacteria | 4761 |
| 364 | Ga0268264_10074097 | 3300028381 | Bacteria | 2891 |
| 365 | Ga0265334_10000111 | 3300028573 | Bacteria | 53728 |
| 366 | Ga0307515_10057726 | 3300028794 | Bacteria | 5611 |
| 367 | Ga0307511_10050447 | 3300030521 | Bacteria | 3351 |
| 368 | Ga0307508_10003643 | 3300031616 | Bacteria | 15441 |
| 369 | Ga0307508_10006545 | 3300031616 | Bacteria | 10950 |
| 370 | Ga0307508_10242316 | 3300031616 | Bacteria | 1400 |
| 371 | Ga0316579_10014074 | 3300031691 | Bacteria | 3450 |
| 372 | Ga0307405_10084392 | 3300031731 | Bacteria | 2085 |
| 373 | Ga0307413_10026386 | 3300031824 | Bacteria | 3200 |
| 374 | Ga0307410_10029597 | 3300031852 | Bacteria | 3489 |
| 375 | Ga0307407_10021436 | 3300031903 | Bacteria | 3332 |
| 376 | Ga0307409_100018461 | 3300031995 | Bacteria | 4691 |
| 377 | Ga0307409_100084939 | 3300031995 | Bacteria | 2572 |
| 378 | Ga0307411_10114579 | 3300032005 | Bacteria | 1937 |
| 379 | Ga0316214_1009107 | 3300033545 | Bacteria | 1338 |
| 380 | Ga0373930_0002631 | 3300034816 | Bacteria | 2790 |
| 381 | Ga0373928_0010905 | 3300035084 | Bacteria | 1790 |
| 382 | Ga0373934_0005084 | 3300035086 | Bacteria | 4874 |
| 383 | Ga0373932_0003171 | 3300035112 | Bacteria | 4000 |
| 384 | Ga0373936_0035565 | 3300035113 | Bacteria | 1983 |
| 385 | Ga0373957_0044104 | 3300035120 | Bacteria | 1687 |
| 386 | Ga0373931_0000005 | 3300035691 | Bacteria | 480485 |
| 387 | Ga0373931_0000040 | 3300035691 | Bacteria | 72842 |
| 388 | Ga0373927_0000260 | 3300035695 | Bacteria | 41667 |
| 389 | Ga0373933_0030241 | 3300035724 | Bacteria | 3135 |
| 390 | Ga0373937_0075806 | 3300036401 | Bacteria | 3105 |
| 391 | Ga0316584_0098458 | 3300036712 | Bacteria | 2189 |
| 392 | Ga0316584_0117868 | 3300036712 | Bacteria | 1985 |
| 393 | Ga0373925_0000257 | 3300037068 | Bacteria | 55764 |
| 394 | Ga0436364_0986946 | 3300037853 | Bacteria | 208509 |
| 395 | Ga0436364_1324400 | 3300037853 | Bacteria | 12797 |
| 396 | Ga0436365_0236902 | 3300039437 | Bacteria | 4496 |
| 397 | Ga0436365_0444660 | 3300039437 | Bacteria | 5246 |
| 398 | Ga0436365_1168901 | 3300039437 | Bacteria | 3684 |
| 399 | Ga0436365_1627569 | 3300039437 | Bacteria | 24179 |
| 400 | Ga0436363_1081284 | 3300039450 | Bacteria | 2535 |
| 401 | Ga0450903_001276 | 3300042138 | Bacteria | 4712 |
| 402 | Ga0439464_0012717 | 3300042439 | Bacteria | 2245 |
| 403 | Ga0466957_0011457 | 3300044842 | Bacteria | 5117 |
| 404 | Ga0466967_0004333 | 3300045976 | Bacteria | 9545 |
| 405 | Ga0495617_013306 | 3300046452 | Bacteria | 2799 |
| 406 | Ga0495603_0008543 | 3300046455 | Bacteria | 6188 |
| 407 | Ga0495603_0034983 | 3300046455 | Bacteria | 3019 |
| 408 | Ga0495629_0062434 | 3300046459 | Bacteria | 2603 |
| 409 | Ga0495629_0067424 | 3300046459 | Bacteria | 2497 |
| 410 | Ga0495629_0092654 | 3300046459 | Bacteria | 2109 |
| 411 | Ga0495641_0061385 | 3300046461 | Bacteria | 1696 |
| 412 | Ga0495651_0017287 | 3300046462 | Bacteria | 5587 |
| 413 | Ga0495651_0100275 | 3300046462 | Bacteria | 2157 |
| 414 | Ga0495653_0024020 | 3300046463 | Bacteria | 4917 |
| 415 | Ga0495582_0045848 | 3300046473 | Bacteria | 2408 |
| 416 | Ga0495605_0000988 | 3300046474 | Bacteria | 19320 |
| 417 | Ga0495639_0062595 | 3300046475 | Bacteria | 1707 |
| 418 | Ga0495585_0019191 | 3300046492 | Bacteria | 3945 |
| 419 | Ga0495594_0002391 | 3300046499 | Bacteria | 9772 |
| 420 | Ga0495607_0046636 | 3300046501 | Bacteria | 2543 |
| 421 | Ga0495583_0031059 | 3300046506 | Bacteria | 2594 |
| 422 | Ga0495606_0028054 | 3300046507 | Bacteria | 3977 |
| 423 | Ga0495606_0038994 | 3300046507 | Bacteria | 3208 |
| 424 | Ga0495616_0004551 | 3300046513 | Bacteria | 8729 |
| 425 | Ga0495620_0000651 | 3300046515 | Bacteria | 21435 |
| 426 | Ga0495628_0144791 | 3300046516 | Bacteria | 1812 |
| 427 | Ga0495628_0152687 | 3300046516 | Bacteria | 1758 |
| 428 | Ga0495631_0006526 | 3300046518 | Bacteria | 6017 |
| 429 | Ga0495666_0005024 | 3300046526 | Bacteria | 6694 |
| 430 | Ga0495640_0135442 | 3300046533 | Bacteria | 1591 |
| 431 | Ga0495587_0067866 | 3300046536 | Bacteria | 2078 |
| 432 | Ga0495621_0005476 | 3300046539 | Bacteria | 3651 |
| 433 | Ga0495622_0002051 | 3300046557 | Bacteria | 9846 |
| 434 | Ga0495667_0012542 | 3300046559 | Bacteria | 5746 |
| 435 | Ga0495668_0001973 | 3300046616 | Bacteria | 18017 |
| 436 | Ga0495634_0013649 | 3300046642 | Bacteria | 5868 |
| 437 | Ga0495611_0001832 | 3300046648 | Bacteria | 10174 |
| 438 | Ga0495611_0013673 | 3300046648 | Bacteria | 3458 |
| 439 | Ga0495625_0011471 | 3300046660 | Bacteria | 7225 |
| 440 | Ga0495635_0026735 | 3300046663 | Bacteria | 4013 |
| 441 | Ga0495657_0006334 | 3300046675 | Bacteria | 9272 |
| 442 | Ga0495657_0054148 | 3300046675 | Bacteria | 2681 |
| 443 | Ga0495623_0096843 | 3300046679 | Bacteria | 1802 |
| 444 | Ga0495646_0046378 | 3300046680 | Bacteria | 2650 |
| 445 | Ga0495613_0000311 | 3300046689 | Bacteria | 44152 |
| 446 | Ga0495660_0053879 | 3300046810 | Bacteria | 2181 |
| 447 | Ga0495604_0177648 | 3300047317 | Bacteria | 1491 |
| 448 | Ga0495676_0005790 | 3300047321 | Bacteria | 11335 |
| 449 | Ga0495676_0175559 | 3300047321 | Bacteria | 1505 |
| 450 | Ga0495680_0027078 | 3300047322 | Bacteria | 4715 |
| 451 | Ga0495680_0098371 | 3300047322 | Bacteria | 2183 |
| 452 | Ga0495687_000495 | 3300047443 | Bacteria | 47456 |
| 453 | Ga0495687_019990 | 3300047443 | Bacteria | 3273 |
| 454 | Ga0495685_004932 | 3300047447 | Bacteria | 4335 |
| 455 | Ga0495684_0033359 | 3300047471 | Bacteria | 3949 |
| 456 | Ga0495686_0096259 | 3300047472 | Bacteria | 1792 |
| 457 | Ga0495593_0042253 | 3300047673 | Bacteria | 2447 |
| 458 | Ga0495602_0045271 | 3300048088 | Bacteria | 3983 |
| 459 | Ga0495602_0057114 | 3300048088 | Bacteria | 3427 |
| 460 | Ga0495626_0043768 | 3300048091 | Bacteria | 2099 |
| 461 | Ga0496100_0000037 | 3300048903 | Bacteria | 95054 |
| 462 | Ga0496100_0001777 | 3300048903 | Bacteria | 10759 |
| 463 | Ga0496100_0004606 | 3300048903 | Bacteria | 7327 |
| 464 | Ga0496100_0005684 | 3300048903 | Bacteria | 6744 |
| 465 | Ga0496100_0016688 | 3300048903 | Bacteria | 4317 |
| 466 | Ga0496100_0156579 | 3300048903 | Bacteria | 1629 |
| 467 | Ga0496101_0000174 | 3300048904 | Bacteria | 51685 |
| 468 | Ga0496101_0000233 | 3300048904 | Bacteria | 41307 |
| 469 | Ga0496101_0000787 | 3300048904 | Bacteria | 18761 |
| 470 | Ga0496101_0002919 | 3300048904 | Bacteria | 10513 |
| 471 | Ga0496101_0004046 | 3300048904 | Bacteria | 9162 |
| 472 | Ga0496101_0043160 | 3300048904 | Bacteria | 3221 |
| 473 | Ga0496102_0000008 | 3300048905 | Bacteria | 417021 |
| 474 | Ga0496102_0000190 | 3300048905 | Bacteria | 83444 |
| 475 | Ga0496102_0000524 | 3300048905 | Bacteria | 41587 |
| 476 | Ga0496102_0000528 | 3300048905 | Bacteria | 41419 |
| 477 | Ga0496102_0000839 | 3300048905 | Bacteria | 29546 |
| 478 | Ga0496102_0002915 | 3300048905 | Bacteria | 14509 |
| 479 | Ga0496102_0014204 | 3300048905 | Bacteria | 6918 |
| 480 | Ga0496102_0033970 | 3300048905 | Bacteria | 4586 |
| 481 | Ga0496102_0054058 | 3300048905 | Bacteria | 3661 |
| 482 | Ga0496102_0134514 | 3300048905 | Bacteria | 2316 |
| 483 | Ga0496102_0244915 | 3300048905 | Bacteria | 1690 |
| 484 | Ga0496102_0418099 | 3300048905 | Bacteria | 1259 |
| 485 | Ga0496103_0000100 | 3300048906 | Bacteria | 93873 |
| 486 | Ga0496103_0000125 | 3300048906 | Bacteria | 83408 |
| 487 | Ga0496103_0000127 | 3300048906 | Bacteria | 81698 |
| 488 | Ga0496103_0000168 | 3300048906 | Bacteria | 68373 |
| 489 | Ga0496103_0000821 | 3300048906 | Bacteria | 22780 |
| 490 | Ga0496103_0002795 | 3300048906 | Bacteria | 10857 |
| 491 | Ga0496103_0003826 | 3300048906 | Bacteria | 9159 |
| 492 | Ga0496103_0011948 | 3300048906 | Bacteria | 5156 |
| 493 | Ga0496103_0119490 | 3300048906 | Bacteria | 1678 |
| 494 | Ga0496104_0000103 | 3300048907 | Bacteria | 80447 |
| 495 | Ga0496104_0010464 | 3300048907 | Bacteria | 8286 |
| 496 | Ga0496104_0026810 | 3300048907 | Bacteria | 5326 |
| 497 | Ga0496104_0027681 | 3300048907 | Bacteria | 5248 |
| 498 | Ga0496104_0051082 | 3300048907 | Bacteria | 3901 |
| 499 | Ga0496104_0092184 | 3300048907 | Bacteria | 2897 |
| 500 | Ga0496105_0000121 | 3300048908 | Bacteria | 52524 |
| 501 | Ga0496105_0004957 | 3300048908 | Bacteria | 10066 |
| 502 | Ga0496105_0015156 | 3300048908 | Bacteria | 6136 |
| 503 | Ga0496105_0057258 | 3300048908 | Bacteria | 3219 |
| 504 | Ga0496106_0000556 | 3300048909 | Bacteria | 26561 |
| 505 | Ga0496106_0000944 | 3300048909 | Bacteria | 21180 |
| 506 | Ga0496106_0001029 | 3300048909 | Bacteria | 20528 |
| 507 | Ga0496106_0001091 | 3300048909 | Bacteria | 20058 |
| 508 | Ga0496106_0002016 | 3300048909 | Bacteria | 15280 |
| 509 | Ga0496106_0078583 | 3300048909 | Bacteria | 2532 |
| 510 | Ga0496106_0279795 | 3300048909 | Bacteria | 1337 |
| 511 | Ga0496107_0000165 | 3300048910 | Bacteria | 33993 |
| 512 | Ga0496107_0000998 | 3300048910 | Bacteria | 16871 |
| 513 | Ga0496107_0002431 | 3300048910 | Bacteria | 12070 |
| 514 | Ga0496107_0008347 | 3300048910 | Bacteria | 7166 |
| 515 | Ga0496107_0009274 | 3300048910 | Bacteria | 6822 |
| 516 | Ga0496107_0026619 | 3300048910 | Bacteria | 4101 |
| 517 | Ga0496108_0000726 | 3300048911 | Bacteria | 25618 |
| 518 | Ga0496108_0000759 | 3300048911 | Bacteria | 25117 |
| 519 | Ga0496108_0002837 | 3300048911 | Bacteria | 13911 |
| 520 | Ga0496108_0077156 | 3300048911 | Bacteria | 2817 |
| 521 | Ga0496108_0225385 | 3300048911 | Bacteria | 1629 |
| 522 | Ga0496109_0000128 | 3300048912 | Bacteria | 77887 |
| 523 | Ga0496109_0002063 | 3300048912 | Bacteria | 16675 |
| 524 | Ga0496110_0012303 | 3300048913 | Bacteria | 7035 |
| 525 | Ga0496110_0020606 | 3300048913 | Bacteria | 5569 |
| 526 | Ga0496110_0031115 | 3300048913 | Bacteria | 4603 |
| 527 | Ga0496110_0042120 | 3300048913 | Bacteria | 3985 |
| 528 | Ga0496110_0106790 | 3300048913 | Bacteria | 2512 |
| 529 | Ga0496111_0044818 | 3300048914 | Bacteria | 3180 |
| 530 | Ga0496111_0067704 | 3300048914 | Bacteria | 2594 |
| 531 | Ga0496111_0078987 | 3300048914 | Bacteria | 2400 |
| 532 | Ga0496111_0247148 | 3300048914 | Bacteria | 1324 |
| 533 | Ga0496112_0059333 | 3300048915 | Bacteria | 3770 |
| 534 | Ga0496113_0014047 | 3300048916 | Bacteria | 5449 |
| 535 | Ga0496113_0110739 | 3300048916 | Bacteria | 2137 |
| 536 | Ga0496113_0116079 | 3300048916 | Bacteria | 2088 |
| 537 | Ga0496114_0000688 | 3300048917 | Bacteria | 25143 |
| 538 | Ga0496114_0008299 | 3300048917 | Bacteria | 8230 |
| 539 | Ga0496114_0009223 | 3300048917 | Bacteria | 7823 |
| 540 | Ga0496115_0049534 | 3300048918 | Bacteria | 3363 |
| 541 | Ga0496116_0000082 | 3300048919 | Bacteria | 222607 |
| 542 | Ga0496116_0000254 | 3300048919 | Bacteria | 94909 |
| 543 | Ga0496116_0000337 | 3300048919 | Bacteria | 75447 |
| 544 | Ga0496116_0000924 | 3300048919 | Bacteria | 36243 |
| 545 | Ga0496116_0002558 | 3300048919 | Bacteria | 18985 |
| 546 | Ga0496116_0013216 | 3300048919 | Bacteria | 6676 |
| 547 | Ga0496116_0057624 | 3300048919 | Bacteria | 2538 |
| 548 | Ga0496117_0000026 | 3300048920 | Bacteria | 416644 |
| 549 | Ga0496117_0000282 | 3300048920 | Bacteria | 94498 |
| 550 | Ga0496117_0000313 | 3300048920 | Bacteria | 84841 |
| 551 | Ga0496117_0000328 | 3300048920 | Bacteria | 83704 |
| 552 | Ga0496117_0000342 | 3300048920 | Bacteria | 82410 |
| 553 | Ga0496117_0013808 | 3300048920 | Bacteria | 7013 |
| 554 | Ga0496117_0018137 | 3300048920 | Bacteria | 5848 |
| 555 | Ga0496117_0020364 | 3300048920 | Bacteria | 5408 |
| 556 | Ga0496117_0069786 | 3300048920 | Bacteria | 2364 |
| 557 | Ga0496118_0000060 | 3300048921 | Bacteria | 222621 |
| 558 | Ga0496118_0000176 | 3300048921 | Bacteria | 114551 |
| 559 | Ga0496118_0000185 | 3300048921 | Bacteria | 109095 |
| 560 | Ga0496118_0000308 | 3300048921 | Bacteria | 84829 |
| 561 | Ga0496118_0001440 | 3300048921 | Bacteria | 35826 |
| 562 | Ga0496118_0005078 | 3300048921 | Bacteria | 15154 |
| 563 | Ga0496118_0011496 | 3300048921 | Bacteria | 8629 |
| 564 | Ga0496118_0019275 | 3300048921 | Bacteria | 6105 |
| 565 | Ga0496118_0019594 | 3300048921 | Bacteria | 6040 |
| 566 | Ga0496118_0047825 | 3300048921 | Bacteria | 3311 |
| 567 | Ga0496118_0092139 | 3300048921 | Bacteria | 2081 |
| 568 | Ga0496119_0000123 | 3300048922 | Bacteria | 108805 |
| 569 | Ga0496119_0000657 | 3300048922 | Bacteria | 46380 |
| 570 | Ga0496119_0006958 | 3300048922 | Bacteria | 10318 |
| 571 | Ga0496119_0007772 | 3300048922 | Bacteria | 9561 |
| 572 | Ga0496119_0008123 | 3300048922 | Bacteria | 9293 |
| 573 | Ga0496119_0011159 | 3300048922 | Bacteria | 7481 |
| 574 | Ga0496119_0011881 | 3300048922 | Bacteria | 7145 |
| 575 | Ga0496119_0042842 | 3300048922 | Bacteria | 2866 |
| 576 | Ga0496119_0045199 | 3300048922 | Bacteria | 2764 |
| 577 | Ga0496120_0000362 | 3300048923 | Bacteria | 73745 |
| 578 | Ga0496120_0001855 | 3300048923 | Bacteria | 23516 |
| 579 | Ga0496120_0005926 | 3300048923 | Bacteria | 9532 |
| 580 | Ga0496120_0008130 | 3300048923 | Bacteria | 7695 |
| 581 | Ga0496120_0008564 | 3300048923 | Bacteria | 7404 |
| 582 | Ga0496120_0075055 | 3300048923 | Bacteria | 1846 |
| 583 | Ga0496121_0000118 | 3300048924 | Bacteria | 175421 |
| 584 | Ga0496121_0000181 | 3300048924 | Bacteria | 140533 |
| 585 | Ga0496121_0000311 | 3300048924 | Bacteria | 101361 |
| 586 | Ga0496121_0000334 | 3300048924 | Bacteria | 98442 |
| 587 | Ga0496121_0000488 | 3300048924 | Bacteria | 76655 |
| 588 | Ga0496121_0000963 | 3300048924 | Bacteria | 51700 |
| 589 | Ga0496121_0001460 | 3300048924 | Bacteria | 39925 |
| 590 | Ga0496121_0001602 | 3300048924 | Bacteria | 37551 |
| 591 | Ga0496121_0010710 | 3300048924 | Bacteria | 10287 |
| 592 | Ga0496121_0022632 | 3300048924 | Bacteria | 6085 |
| 593 | Ga0496121_0082188 | 3300048924 | Bacteria | 2547 |
| 594 | Ga0496121_0141792 | 3300048924 | Bacteria | 1781 |
| 595 | Ga0496122_0006172 | 3300048925 | Bacteria | 13929 |
| 596 | Ga0496122_0107713 | 3300048925 | Bacteria | 1840 |
| 597 | Ga0496123_0005935 | 3300048926 | Bacteria | 12030 |
| 598 | Ga0496123_0038327 | 3300048926 | Bacteria | 3370 |
| 599 | Ga0496124_0000792 | 3300048927 | Bacteria | 51718 |
| 600 | Ga0496124_0001580 | 3300048927 | Bacteria | 32891 |
| 601 | Ga0496124_0007634 | 3300048927 | Bacteria | 11452 |
| 602 | Ga0496125_0000787 | 3300048928 | Bacteria | 51697 |
| 603 | Ga0496125_0001618 | 3300048928 | Bacteria | 31746 |
| 604 | Ga0496125_0002534 | 3300048928 | Bacteria | 23549 |
| 605 | Ga0496125_0031071 | 3300048928 | Bacteria | 4766 |
| 606 | Ga0496125_0059478 | 3300048928 | Bacteria | 3078 |
| 607 | Ga0496125_0077710 | 3300048928 | Bacteria | 2556 |
| 608 | Ga0496125_0121478 | 3300048928 | Bacteria | 1862 |
| 609 | Ga0496126_0000045 | 3300048929 | Bacteria | 331225 |
| 610 | Ga0496126_0000054 | 3300048929 | Bacteria | 309327 |
| 611 | Ga0496126_0000162 | 3300048929 | Bacteria | 153331 |
| 612 | Ga0496126_0000356 | 3300048929 | Bacteria | 95743 |
| 613 | Ga0496126_0000514 | 3300048929 | Bacteria | 75337 |
| 614 | Ga0496126_0000515 | 3300048929 | Bacteria | 75262 |
| 615 | Ga0496126_0000614 | 3300048929 | Bacteria | 67156 |
| 616 | Ga0496126_0000986 | 3300048929 | Bacteria | 48714 |
| 617 | Ga0496126_0001159 | 3300048929 | Bacteria | 43639 |
| 618 | Ga0496126_0009624 | 3300048929 | Bacteria | 10249 |
| 619 | Ga0496126_0211415 | 3300048929 | Bacteria | 1633 |
| 620 | Ga0501290_000683 | 3300049513 | Bacteria | 5061 |
| 621 | Ga0501292_000001 | 3300049515 | Bacteria | 211592 |
| 622 | Ga0501294_000008 | 3300049517 | Bacteria | 22489 |
| 623 | Ga0501033_0000265 | 3300049570 | Bacteria | 50268 |
| 624 | Ga0501033_0012647 | 3300049570 | Bacteria | 6439 |
| 625 | Ga0501033_0036706 | 3300049570 | Bacteria | 3671 |
| 626 | Ga0501034_0000285 | 3300049571 | Bacteria | 90703 |
| 627 | Ga0501034_0003163 | 3300049571 | Bacteria | 18924 |
| 628 | Ga0501034_0152663 | 3300049571 | Bacteria | 2285 |
| 629 | Ga0501043_0017932 | 3300049579 | Bacteria | 5551 |
| 630 | Ga0501046_0001136 | 3300049580 | Bacteria | 25942 |
| 631 | Ga0501047_0303257 | 3300049581 | Bacteria | 1439 |
| 632 | Ga0501048_0001774 | 3300049582 | Bacteria | 16425 |
| 633 | Ga0501068_0000188 | 3300049584 | Bacteria | 29091 |
| 634 | Ga0501068_0014984 | 3300049584 | Bacteria | 4443 |
| 635 | Ga0501069_0089495 | 3300049585 | Bacteria | 1740 |
| 636 | Ga0501070_0000622 | 3300049586 | Bacteria | 32559 |
| 637 | Ga0501070_0135445 | 3300049586 | Bacteria | 2034 |
| 638 | Ga0501070_0145628 | 3300049586 | Bacteria | 1955 |
| 639 | Ga0501070_0271640 | 3300049586 | Bacteria | 1384 |
| 640 | Ga0501071_0098410 | 3300049587 | Bacteria | 2155 |
| 641 | Ga0501072_0017898 | 3300049588 | Bacteria | 5448 |
| 642 | Ga0501072_0113536 | 3300049588 | Bacteria | 2157 |
| 643 | Ga0501073_0000016 | 3300049589 | Bacteria | 156984 |
| 644 | Ga0501073_0128739 | 3300049589 | Bacteria | 1755 |
| 645 | Ga0501224_000178 | 3300049664 | Bacteria | 7123 |
| 646 | Ga0501080_0048888 | 3300049742 | Bacteria | 3935 |
| 647 | Ga0501281_00011 | 3300049777 | Bacteria | 25465 |
| 648 | Ga0501035_0003391 | 3300049822 | Bacteria | 15239 |
| 649 | Ga0501035_0089263 | 3300049822 | Bacteria | 2715 |
| 650 | Ga0501044_0000365 | 3300049823 | Bacteria | 56845 |
| 651 | Ga0501044_0001366 | 3300049823 | Bacteria | 28620 |
| 652 | nmdc:mga03683_31538_c1 | 3300050489 | Bacteria | 2127 |
| 653 | nmdc:mga03n38_784_c1 | 3300050490 | Bacteria | 8440 |
| 654 | nmdc:mga00v17_121241_c1 | 3300050491 | Bacteria | 1665 |
| 655 | nmdc:mga00v17_1850_c1 | 3300050491 | Bacteria | 10936 |
| 656 | nmdc:mga00v17_26162_c1 | 3300050491 | Bacteria | 3397 |
| 657 | nmdc:mga00v17_72028_c1 | 3300050491 | Bacteria | 2143 |
| 658 | nmdc:mga00v17_9401_c1 | 3300050491 | Bacteria | 5288 |
| 659 | nmdc:mga0yw44_143393_c1 | 3300050492 | Bacteria | 1553 |
| 660 | nmdc:mga0yw44_379_c1 | 3300050492 | Bacteria | 15437 |
| 661 | nmdc:mga0yw44_4379_c1 | 3300050492 | Bacteria | 6464 |
| 662 | nmdc:mga0yw44_91087_c1 | 3300050492 | Bacteria | 1927 |
| 663 | nmdc:mga07m45_36043_c1 | 3300050496 | Bacteria | 2753 |
| 664 | nmdc:mga05p37_44394_c1 | 3300050507 | Bacteria | 5468 |
| 665 | nmdc:mga05p37_6318_c1 | 3300050507 | Bacteria | 13955 |
| 666 | nmdc:mga09592_1473_c1 | 3300050508 | Bacteria | 18914 |
| 667 | nmdc:mga09592_336181_c1 | 3300050508 | Bacteria | 1307 |
| 668 | nmdc:mga09592_87029_c1 | 3300050508 | Bacteria | 2667 |
| 669 | nmdc:mga09592_894_c1 | 3300050508 | Bacteria | 23387 |
| 670 | nmdc:mga0qj67_167711_c1 | 3300050509 | Bacteria | 1783 |
| 671 | nmdc:mga0qj67_1880_c1 | 3300050509 | Bacteria | 14892 |
| 672 | nmdc:mga0qj67_270965_c1 | 3300050509 | Bacteria | 1377 |
| 673 | nmdc:mga0qj67_767_c1 | 3300050509 | Bacteria | 16669 |
| 674 | nmdc:mga06r32_162409_c1 | 3300050510 | Bacteria | 2216 |
| 675 | nmdc:mga06r32_31038_c1 | 3300050510 | Bacteria | 5017 |
| 676 | nmdc:mga06r32_35846_c1 | 3300050510 | Bacteria | 4681 |
| 677 | nmdc:mga06r32_642_c1 | 3300050510 | Bacteria | 30428 |
| 678 | nmdc:mga06r32_66478_c1 | 3300050510 | Bacteria | 3479 |
| 679 | nmdc:mga06r32_7652_c1 | 3300050510 | Bacteria | 9715 |
| 680 | nmdc:mga08y16_125678_c1 | 3300050511 | Bacteria | 2668 |
| 681 | nmdc:mga08y16_32403_c1 | 3300050511 | Bacteria | 5495 |
| 682 | nmdc:mga08y16_6521_c1 | 3300050511 | Bacteria | 12240 |
| 683 | nmdc:mga08y16_75835_c1 | 3300050511 | Bacteria | 3505 |
| 684 | nmdc:mga0n895_250488_c1 | 3300050512 | Bacteria | 1797 |
| 685 | nmdc:mga0sz30_17376_c1 | 3300050516 | Bacteria | 2868 |
| 686 | nmdc:mga0sz30_31624_c1 | 3300050516 | Bacteria | 2191 |
| 687 | Ga0495601_0000168 | 3300053077 | Bacteria | 35128 |
| 688 | Ga0495601_0116930 | 3300053077 | Bacteria | 1730 |
| 689 | Ga0500635_0001707 | 3300053080 | Bacteria | 5324 |
| 690 | Ga0495595_0002019 | 3300053084 | Bacteria | 7880 |
| 691 | Ga0495619_0069293 | 3300053085 | Bacteria | 2357 |
| 692 | Ga0495619_0106818 | 3300053085 | Bacteria | 1909 |
| 693 | Ga0500643_004742 | 3300053087 | Bacteria | 6038 |
| 694 | Ga0500583_0041327 | 3300053092 | Bacteria | 2094 |
| 695 | Ga0500618_002022 | 3300053125 | Bacteria | 8229 |
| 696 | Ga0500652_000103 | 3300053131 | Bacteria | 33562 |
| 697 | Ga0500568_0000037 | 3300053139 | Bacteria | 135208 |
| 698 | Ga0500616_0001970 | 3300053153 | Bacteria | 18263 |
| 699 | Ga0500616_0002921 | 3300053153 | Bacteria | 13636 |
| 700 | Ga0500616_0007130 | 3300053153 | Bacteria | 7153 |
| 701 | Ga0500616_0041435 | 3300053153 | Bacteria | 2471 |
| 702 | Ga0501084_0000082 | 3300054114 | Bacteria | 69523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100057801 | Ga0207675_1000578012 | 285 |
| 2 | 3300048924 | Ga0496121_0000488 | Ga0496121_0000488_41680_42852 | 285 |
| 3 | 3300030521 | Ga0307511_10050447 | Ga0307511_100504472 | 287 |
| 4 | 3300031616 | Ga0307508_10242316 | Ga0307508_102423162 | 287 |
| 5 | 3300005617 | Ga0068859_100265666 | Ga0068859_1002656663 | 289 |
| 6 | 3300006931 | Ga0097620_100265667 | Ga0097620_1002656673 | 289 |
| 7 | 3300006353 | Ga0075370_10183223 | Ga0075370_101832231 | 290 |
| 8 | 3300048905 | Ga0496102_0418099 | Ga0496102_0418099_194_1246 | 294 |
| 9 | 3300005842 | Ga0068858_100000196 | Ga0068858_10000019631 | 297 |
| 10 | 3300009545 | Ga0105237_10337020 | Ga0105237_103370202 | 297 |
| 11 | 3300026035 | Ga0207703_10000356 | Ga0207703_1000035629 | 297 |
| 12 | 3300005330 | Ga0070690_100270976 | Ga0070690_1002709761 | 298 |
| 13 | 3300005841 | Ga0068863_100000749 | Ga0068863_1000007497 | 298 |
| 14 | 3300009092 | Ga0105250_10007122 | Ga0105250_100071224 | 298 |
| 15 | 3300025941 | Ga0207711_10008815 | Ga0207711_100088155 | 298 |
| 16 | 3300026088 | Ga0207641_10000019 | Ga0207641_10000019230 | 298 |
| 17 | 3300026095 | Ga0207676_10000614 | Ga0207676_1000061421 | 298 |
| 18 | 3300031616 | Ga0307508_10006545 | Ga0307508_100065457 | 299 |
| 19 | 3300009094 | Ga0111539_10016996 | Ga0111539_100169962 | 302 |
| 20 | 3300050511 | nmdc:mga08y16_32403_c1 | nmdc:mga08y16_32403_c1_3426_4604 | 302 |
| 21 | 3300017792 | Ga0163161_10048897 | Ga0163161_100488972 | 303 |
| 22 | 3300048917 | Ga0496114_0000688 | Ga0496114_0000688_19290_20393 | 303 |
| 23 | 3300048922 | Ga0496119_0045199 | Ga0496119_0045199_866_2059 | 303 |
| 24 | 3300048923 | Ga0496120_0075055 | Ga0496120_0075055_555_1748 | 303 |
| 25 | 3300048928 | Ga0496125_0031071 | Ga0496125_0031071_412_1605 | 303 |
| 26 | 3300021388 | Ga0213875_10000173 | Ga0213875_100001738 | 304 |
| 27 | 3300037853 | Ga0436364_0986946 | Ga0436364_0986946_73799_74974 | 304 |
| 28 | 3300048905 | Ga0496102_0134514 | Ga0496102_0134514_197_1336 | 304 |
| 29 | 3300048906 | Ga0496103_0119490 | Ga0496103_0119490_150_1289 | 304 |
| 30 | 3300048921 | Ga0496118_0000185 | Ga0496118_0000185_84603_85742 | 304 |
| 31 | 3300049584 | Ga0501068_0014984 | Ga0501068_0014984_1403_2542 | 304 |
| 32 | iso_pu_bacteria | 2523231044 | 2523384381 | 305 |
| 33 | 3300006048 | Ga0075363_100001893 | Ga0075363_1000018936 | 306 |
| 34 | 3300006051 | Ga0075364_10006803 | Ga0075364_100068036 | 306 |
| 35 | 3300011119 | Ga0105246_10218411 | Ga0105246_102184112 | 306 |
| 36 | 3300021384 | Ga0213876_10060624 | Ga0213876_100606241 | 306 |
| 37 | 3300039437 | Ga0436365_1168901 | Ga0436365_1168901_1725_2783 | 306 |
| 38 | 3300050490 | nmdc:mga03n38_784_c1 | nmdc:mga03n38_784_c1_3349_4488 | 306 |
| 39 | 3300050491 | nmdc:mga00v17_9401_c1 | nmdc:mga00v17_9401_c1_1835_2974 | 306 |
| 40 | 3300050492 | nmdc:mga0yw44_143393_c1 | nmdc:mga0yw44_143393_c1_225_1364 | 306 |
| 41 | 3300005331 | Ga0070670_100059841 | Ga0070670_1000598412 | 307 |
| 42 | 3300005339 | Ga0070660_100006063 | Ga0070660_1000060635 | 307 |
| 43 | 3300005344 | Ga0070661_100060445 | Ga0070661_1000604453 | 307 |
| 44 | 3300005347 | Ga0070668_100002611 | Ga0070668_1000026119 | 307 |
| 45 | 3300005353 | Ga0070669_100015078 | Ga0070669_1000150782 | 307 |
| 46 | 3300005355 | Ga0070671_100001654 | Ga0070671_10000165414 | 307 |
| 47 | 3300005366 | Ga0070659_100012617 | Ga0070659_1000126176 | 307 |
| 48 | 3300005367 | Ga0070667_100013720 | Ga0070667_1000137201 | 307 |
| 49 | 3300005457 | Ga0070662_100003140 | Ga0070662_1000031408 | 307 |
| 50 | 3300005548 | Ga0070665_100000190 | Ga0070665_10000019033 | 307 |
| 51 | 3300005564 | Ga0070664_100003085 | Ga0070664_10000308512 | 307 |
| 52 | 3300005841 | Ga0068863_100002883 | Ga0068863_1000028839 | 307 |
| 53 | 3300005842 | Ga0068858_100044917 | Ga0068858_1000449173 | 307 |
| 54 | 3300005843 | Ga0068860_100085398 | Ga0068860_1000853982 | 307 |
| 55 | 3300005844 | Ga0068862_100009048 | Ga0068862_1000090482 | 307 |
| 56 | 3300009101 | Ga0105247_10009176 | Ga0105247_100091764 | 307 |
| 57 | 3300010375 | Ga0105239_10141702 | Ga0105239_101417023 | 307 |
| 58 | 3300025735 | Ga0207713_1000450 | Ga0207713_100045015 | 307 |
| 59 | 3300025900 | Ga0207710_10012991 | Ga0207710_100129912 | 307 |
| 60 | 3300025919 | Ga0207657_10007152 | Ga0207657_100071526 | 307 |
| 61 | 3300025920 | Ga0207649_10040470 | Ga0207649_100404702 | 307 |
| 62 | 3300025923 | Ga0207681_10003223 | Ga0207681_100032232 | 307 |
| 63 | 3300025925 | Ga0207650_10015496 | Ga0207650_100154962 | 307 |
| 64 | 3300025931 | Ga0207644_10001508 | Ga0207644_1000150814 | 307 |
| 65 | 3300025932 | Ga0207690_10097285 | Ga0207690_100972852 | 307 |
| 66 | 3300025933 | Ga0207706_10002746 | Ga0207706_1000274612 | 307 |
| 67 | 3300025941 | Ga0207711_10002282 | Ga0207711_1000228217 | 307 |
| 68 | 3300025945 | Ga0207679_10055346 | Ga0207679_100553462 | 307 |
| 69 | 3300025972 | Ga0207668_10005782 | Ga0207668_100057824 | 307 |
| 70 | 3300025986 | Ga0207658_10026785 | Ga0207658_100267852 | 307 |
| 71 | 3300026035 | Ga0207703_10018681 | Ga0207703_100186812 | 307 |
| 72 | 3300026067 | Ga0207678_10003869 | Ga0207678_1000386910 | 307 |
| 73 | 3300026088 | Ga0207641_10038138 | Ga0207641_100381383 | 307 |
| 74 | 3300028379 | Ga0268266_10000330 | Ga0268266_1000033022 | 307 |
| 75 | 3300028380 | Ga0268265_10008702 | Ga0268265_100087027 | 307 |
| 76 | 3300037853 | Ga0436364_1324400 | Ga0436364_1324400_6603_7742 | 307 |
| 77 | 3300042439 | Ga0439464_0012717 | Ga0439464_0012717_90_1259 | 307 |
| 78 | 3300036712 | Ga0316584_0117868 | Ga0316584_0117868_231_1412 | 308 |
| 79 | 3300039437 | Ga0436365_0236902 | Ga0436365_0236902_2230_3405 | 308 |
| 80 | 3300005437 | Ga0070710_10015784 | Ga0070710_100157843 | 311 |
| 81 | 3300006175 | Ga0070712_100158962 | Ga0070712_1001589622 | 311 |
| 82 | 3300025906 | Ga0207699_10056750 | Ga0207699_100567501 | 311 |
| 83 | 3300025915 | Ga0207693_10078219 | Ga0207693_100782191 | 311 |
| 84 | 3300025929 | Ga0207664_10024685 | Ga0207664_100246853 | 311 |
| 85 | 3300025939 | Ga0207665_10008338 | Ga0207665_100083383 | 311 |
| 86 | 3300006847 | Ga0075431_100056144 | Ga0075431_1000561442 | 312 |
| 87 | 3300009147 | Ga0114129_10100678 | Ga0114129_101006784 | 312 |
| 88 | 3300050508 | nmdc:mga09592_336181_c1 | nmdc:mga09592_336181_c1_131_1270 | 312 |
| 89 | 3300050510 | nmdc:mga06r32_35846_c1 | nmdc:mga06r32_35846_c1_2704_3843 | 312 |
| 90 | 3300039437 | Ga0436365_1627569 | Ga0436365_1627569_18235_19413 | 313 |
| 91 | 3300049570 | Ga0501033_0036706 | Ga0501033_0036706_1299_2438 | 313 |
| 92 | 3300049586 | Ga0501070_0135445 | Ga0501070_0135445_248_1387 | 313 |
| 93 | 3300049822 | Ga0501035_0089263 | Ga0501035_0089263_665_1804 | 313 |
| 94 | iso_pu_bacteria | 2784746768 | 2785374599 | 313 |
| 95 | 3300005471 | Ga0070698_100315979 | Ga0070698_1003159791 | 314 |
| 96 | 3300028573 | Ga0265334_10000111 | Ga0265334_1000011121 | 315 |
| 97 | 3300031691 | Ga0316579_10014074 | Ga0316579_100140742 | 315 |
| 98 | 3300036712 | Ga0316584_0098458 | Ga0316584_0098458_60_1220 | 315 |
| 99 | 3300046473 | Ga0495582_0045848 | Ga0495582_0045848_761_1900 | 315 |
| 100 | 3300053139 | Ga0500568_0000037 | Ga0500568_0000037_5044_6222 | 315 |
| 101 | 3300005355 | Ga0070671_100001125 | Ga0070671_10000112514 | 316 |
| 102 | 3300005548 | Ga0070665_100006109 | Ga0070665_10000610911 | 316 |
| 103 | 3300005618 | Ga0068864_100172658 | Ga0068864_1001726582 | 316 |
| 104 | 3300005841 | Ga0068863_100012171 | Ga0068863_1000121713 | 316 |
| 105 | 3300026095 | Ga0207676_10151959 | Ga0207676_101519592 | 316 |
| 106 | 3300028379 | Ga0268266_10003465 | Ga0268266_100034656 | 316 |
| 107 | 3300028381 | Ga0268264_10003121 | Ga0268264_1000312113 | 316 |
| 108 | iso_pu_bacteria | 2744054611 | 2744955431 | 316 |
| 109 | iso_pu_bacteria | 2954691527 | 2954691618 | 316 |
| 110 | iso_pu_bacteria | 2954701450 | 2954706713 | 316 |
| 111 | 3300005563 | Ga0068855_100217341 | Ga0068855_1002173413 | 317 |
| 112 | 3300009545 | Ga0105237_10000103 | Ga0105237_1000010363 | 317 |
| 113 | 3300010375 | Ga0105239_10002423 | Ga0105239_100024232 | 317 |
| 114 | 3300025914 | Ga0207671_10009098 | Ga0207671_100090984 | 317 |
| 115 | 3300025949 | Ga0207667_10175329 | Ga0207667_101753293 | 317 |
| 116 | iso_pu_bacteria | 2523231044 | 2523382984 | 317 |
| 117 | iso_pu_bacteria | 2811994879 | 2812361075 | 317 |
| 118 | iso_pu_bacteria | 2946072368 | 2946073299 | 317 |
| 119 | iso_pu_bacteria | 3002998708 | 3003006610 | 317 |
| 120 | 3300005289 | Ga0065704_10000190 | Ga0065704_1000019020 | 318 |
| 121 | 3300031616 | Ga0307508_10003643 | Ga0307508_100036437 | 318 |
| 122 | 3300044842 | Ga0466957_0011457 | Ga0466957_0011457_1173_2345 | 318 |
| 123 | 3300049587 | Ga0501071_0098410 | Ga0501071_0098410_753_1931 | 318 |
| 124 | 3300049588 | Ga0501072_0113536 | Ga0501072_0113536_941_2119 | 318 |
| 125 | iso_pu_bacteria | 2842134933 | 2842140200 | 318 |
| 126 | 3300005985 | Ga0081539_10006295 | Ga0081539_100062955 | 319 |
| 127 | 3300046455 | Ga0495603_0034983 | Ga0495603_0034983_687_1844 | 319 |
| 128 | 3300046459 | Ga0495629_0067424 | Ga0495629_0067424_533_1690 | 319 |
| 129 | 3300046461 | Ga0495641_0061385 | Ga0495641_0061385_165_1322 | 319 |
| 130 | 3300046475 | Ga0495639_0062595 | Ga0495639_0062595_108_1265 | 319 |
| 131 | 3300047673 | Ga0495593_0042253 | Ga0495593_0042253_775_1914 | 319 |
| 132 | 3300005335 | Ga0070666_10027913 | Ga0070666_100279132 | 320 |
| 133 | 3300005338 | Ga0068868_100000580 | Ga0068868_10000058016 | 320 |
| 134 | 3300005340 | Ga0070689_100005290 | Ga0070689_1000052901 | 320 |
| 135 | 3300005345 | Ga0070692_10026676 | Ga0070692_100266762 | 320 |
| 136 | 3300005354 | Ga0070675_100244165 | Ga0070675_1002441652 | 320 |
| 137 | 3300005356 | Ga0070674_100002296 | Ga0070674_1000022963 | 320 |
| 138 | 3300005366 | Ga0070659_100021093 | Ga0070659_1000210934 | 320 |
| 139 | 3300005437 | Ga0070710_10017207 | Ga0070710_100172073 | 320 |
| 140 | 3300005438 | Ga0070701_10075935 | Ga0070701_100759352 | 320 |
| 141 | 3300005439 | Ga0070711_100003082 | Ga0070711_1000030823 | 320 |
| 142 | 3300005441 | Ga0070700_100004233 | Ga0070700_1000042333 | 320 |
| 143 | 3300005455 | Ga0070663_100015257 | Ga0070663_1000152573 | 320 |
| 144 | 3300005456 | Ga0070678_100000938 | Ga0070678_10000093813 | 320 |
| 145 | 3300005466 | Ga0070685_10010992 | Ga0070685_100109926 | 320 |
| 146 | 3300005546 | Ga0070696_100001497 | Ga0070696_10000149714 | 320 |
| 147 | 3300005547 | Ga0070693_100007815 | Ga0070693_1000078152 | 320 |
| 148 | 3300005548 | Ga0070665_100006279 | Ga0070665_1000062792 | 320 |
| 149 | 3300005563 | Ga0068855_100123934 | Ga0068855_1001239342 | 320 |
| 150 | 3300005578 | Ga0068854_100000515 | Ga0068854_10000051521 | 320 |
| 151 | 3300005719 | Ga0068861_100002353 | Ga0068861_10000235313 | 320 |
| 152 | 3300005842 | Ga0068858_100011931 | Ga0068858_10001193111 | 320 |
| 153 | 3300005843 | Ga0068860_100006227 | Ga0068860_10000622710 | 320 |
| 154 | 3300005937 | Ga0081455_10028658 | Ga0081455_100286582 | 320 |
| 155 | 3300006051 | Ga0075364_10054298 | Ga0075364_100542983 | 320 |
| 156 | 3300006175 | Ga0070712_100005346 | Ga0070712_10000534610 | 320 |
| 157 | 3300006186 | Ga0075369_10027769 | Ga0075369_100277693 | 320 |
| 158 | 3300006881 | Ga0068865_100002422 | Ga0068865_10000242213 | 320 |
| 159 | 3300009176 | Ga0105242_10000154 | Ga0105242_1000015442 | 320 |
| 160 | 3300009551 | Ga0105238_10199373 | Ga0105238_101993732 | 320 |
| 161 | 3300010375 | Ga0105239_10074759 | Ga0105239_100747594 | 320 |
| 162 | 3300013105 | Ga0157369_10141139 | Ga0157369_101411392 | 320 |
| 163 | 3300014326 | Ga0157380_10000198 | Ga0157380_1000019821 | 320 |
| 164 | 3300014969 | Ga0157376_10247175 | Ga0157376_102471752 | 320 |
| 165 | 3300025901 | Ga0207688_10000490 | Ga0207688_1000049011 | 320 |
| 166 | 3300025916 | Ga0207663_10001094 | Ga0207663_100010941 | 320 |
| 167 | 3300025918 | Ga0207662_10067223 | Ga0207662_100672232 | 320 |
| 168 | 3300025927 | Ga0207687_10070369 | Ga0207687_100703693 | 320 |
| 169 | 3300025932 | Ga0207690_10115439 | Ga0207690_101154392 | 320 |
| 170 | 3300025933 | Ga0207706_10001079 | Ga0207706_1000107911 | 320 |
| 171 | 3300025934 | Ga0207686_10003023 | Ga0207686_1000302310 | 320 |
| 172 | 3300025935 | Ga0207709_10001668 | Ga0207709_100016687 | 320 |
| 173 | 3300025936 | Ga0207670_10020607 | Ga0207670_100206072 | 320 |
| 174 | 3300025937 | Ga0207669_10000085 | Ga0207669_1000008531 | 320 |
| 175 | 3300025938 | Ga0207704_10001197 | Ga0207704_1000119711 | 320 |
| 176 | 3300025939 | Ga0207665_10001261 | Ga0207665_1000126113 | 320 |
| 177 | 3300025941 | Ga0207711_10016364 | Ga0207711_100163649 | 320 |
| 178 | 3300025942 | Ga0207689_10101519 | Ga0207689_101015192 | 320 |
| 179 | 3300025961 | Ga0207712_10004582 | Ga0207712_100045824 | 320 |
| 180 | 3300025972 | Ga0207668_10003089 | Ga0207668_1000308910 | 320 |
| 181 | 3300025981 | Ga0207640_10001274 | Ga0207640_1000127414 | 320 |
| 182 | 3300025986 | Ga0207658_10002337 | Ga0207658_1000233714 | 320 |
| 183 | 3300025986 | Ga0207658_10139536 | Ga0207658_101395361 | 320 |
| 184 | 3300026075 | Ga0207708_10000329 | Ga0207708_1000032918 | 320 |
| 185 | 3300026078 | Ga0207702_10088524 | Ga0207702_100885242 | 320 |
| 186 | 3300026088 | Ga0207641_10109694 | Ga0207641_101096942 | 320 |
| 187 | 3300026089 | Ga0207648_10000112 | Ga0207648_1000011239 | 320 |
| 188 | 3300026118 | Ga0207675_100000117 | Ga0207675_10000011743 | 320 |
| 189 | 3300028379 | Ga0268266_10007065 | Ga0268266_100070652 | 320 |
| 190 | 3300028381 | Ga0268264_10008994 | Ga0268264_1000899410 | 320 |
| 191 | 3300045976 | Ga0466967_0004333 | Ga0466967_0004333_6318_7457 | 320 |
| 192 | 3300046507 | Ga0495606_0038994 | Ga0495606_0038994_1228_2367 | 320 |
| 193 | 3300046648 | Ga0495611_0001832 | Ga0495611_0001832_1450_2601 | 320 |
| 194 | 3300048903 | Ga0496100_0004606 | Ga0496100_0004606_1649_2824 | 320 |
| 195 | 3300048904 | Ga0496101_0004046 | Ga0496101_0004046_1530_2705 | 320 |
| 196 | 3300048905 | Ga0496102_0002915 | Ga0496102_0002915_5755_6894 | 320 |
| 197 | 3300048905 | Ga0496102_0033970 | Ga0496102_0033970_3356_4495 | 320 |
| 198 | 3300048906 | Ga0496103_0003826 | Ga0496103_0003826_2498_3637 | 320 |
| 199 | 3300048907 | Ga0496104_0027681 | Ga0496104_0027681_1967_3142 | 320 |
| 200 | 3300048907 | Ga0496104_0092184 | Ga0496104_0092184_1510_2649 | 320 |
| 201 | 3300048908 | Ga0496105_0004957 | Ga0496105_0004957_3256_4431 | 320 |
| 202 | 3300048909 | Ga0496106_0000556 | Ga0496106_0000556_11187_12326 | 320 |
| 203 | 3300048909 | Ga0496106_0002016 | Ga0496106_0002016_1669_2844 | 320 |
| 204 | 3300048910 | Ga0496107_0002431 | Ga0496107_0002431_6879_8018 | 320 |
| 205 | 3300048910 | Ga0496107_0008347 | Ga0496107_0008347_2777_3952 | 320 |
| 206 | 3300048914 | Ga0496111_0044818 | Ga0496111_0044818_1735_2874 | 320 |
| 207 | 3300048917 | Ga0496114_0008299 | Ga0496114_0008299_41_1180 | 320 |
| 208 | 3300048917 | Ga0496114_0009223 | Ga0496114_0009223_2950_4125 | 320 |
| 209 | 3300048918 | Ga0496115_0049534 | Ga0496115_0049534_1732_2907 | 320 |
| 210 | 3300049570 | Ga0501033_0012647 | Ga0501033_0012647_479_1618 | 320 |
| 211 | 3300049571 | Ga0501034_0003163 | Ga0501034_0003163_14595_15734 | 320 |
| 212 | 3300049579 | Ga0501043_0017932 | Ga0501043_0017932_3632_4771 | 320 |
| 213 | 3300049580 | Ga0501046_0001136 | Ga0501046_0001136_23383_24522 | 320 |
| 214 | 3300049582 | Ga0501048_0001774 | Ga0501048_0001774_1268_2407 | 320 |
| 215 | 3300049586 | Ga0501070_0000622 | Ga0501070_0000622_23244_24383 | 320 |
| 216 | 3300049586 | Ga0501070_0145628 | Ga0501070_0145628_78_1217 | 320 |
| 217 | 3300049822 | Ga0501035_0003391 | Ga0501035_0003391_10910_12049 | 320 |
| 218 | 3300049823 | Ga0501044_0001366 | Ga0501044_0001366_4263_5402 | 320 |
| 219 | 3300050496 | nmdc:mga07m45_36043_c1 | nmdc:mga07m45_36043_c1_1182_2321 | 320 |
| 220 | 3300053087 | Ga0500643_004742 | Ga0500643_004742_1299_2438 | 320 |
| 221 | 3300053153 | Ga0500616_0001970 | Ga0500616_0001970_5471_6610 | 320 |
| 222 | 3300053153 | Ga0500616_0041435 | Ga0500616_0041435_956_2095 | 320 |
| 223 | 3300009101 | Ga0105247_10015757 | Ga0105247_100157574 | 321 |
| 224 | 3300014968 | Ga0157379_10007178 | Ga0157379_100071786 | 321 |
| 225 | 3300028794 | Ga0307515_10057726 | Ga0307515_100577264 | 321 |
| 226 | 3300042138 | Ga0450903_001276 | Ga0450903_001276_781_1926 | 321 |
| 227 | 3300046492 | Ga0495585_0019191 | Ga0495585_0019191_1804_3000 | 321 |
| 228 | 3300046516 | Ga0495628_0152687 | Ga0495628_0152687_461_1603 | 321 |
| 229 | 3300046810 | Ga0495660_0053879 | Ga0495660_0053879_818_2014 | 321 |
| 230 | 3300047443 | Ga0495687_000495 | Ga0495687_000495_16135_17307 | 321 |
| 231 | 3300048903 | Ga0496100_0005684 | Ga0496100_0005684_1293_2483 | 321 |
| 232 | 3300048904 | Ga0496101_0000787 | Ga0496101_0000787_16466_17656 | 321 |
| 233 | 3300048905 | Ga0496102_0000190 | Ga0496102_0000190_32758_33948 | 321 |
| 234 | 3300048906 | Ga0496103_0000125 | Ga0496103_0000125_32750_33940 | 321 |
| 235 | 3300048913 | Ga0496110_0031115 | Ga0496110_0031115_608_1798 | 321 |
| 236 | 3300048919 | Ga0496116_0000337 | Ga0496116_0000337_26931_28121 | 321 |
| 237 | 3300048920 | Ga0496117_0000313 | Ga0496117_0000313_34094_35284 | 321 |
| 238 | 3300048921 | Ga0496118_0000308 | Ga0496118_0000308_49497_50687 | 321 |
| 239 | 3300048922 | Ga0496119_0011159 | Ga0496119_0011159_5502_6692 | 321 |
| 240 | 3300048923 | Ga0496120_0008130 | Ga0496120_0008130_3598_4788 | 321 |
| 241 | 3300048924 | Ga0496121_0001602 | Ga0496121_0001602_19577_20767 | 321 |
| 242 | 3300048927 | Ga0496124_0007634 | Ga0496124_0007634_1756_2946 | 321 |
| 243 | 3300048928 | Ga0496125_0059478 | Ga0496125_0059478_451_1641 | 321 |
| 244 | 3300048929 | Ga0496126_0000514 | Ga0496126_0000514_26827_28017 | 321 |
| 245 | 3300053077 | Ga0495601_0000168 | Ga0495601_0000168_18186_19328 | 321 |
| 246 | 3300053085 | Ga0495619_0106818 | Ga0495619_0106818_678_1817 | 321 |
| 247 | 3300053153 | Ga0500616_0002921 | Ga0500616_0002921_10629_11807 | 321 |
| 248 | iso_pu_bacteria | 2523231044 | 2523387893 | 321 |
| 249 | 3300005466 | Ga0070685_10218095 | Ga0070685_102180951 | 322 |
| 250 | 3300005548 | Ga0070665_100009543 | Ga0070665_10000954311 | 322 |
| 251 | 3300005617 | Ga0068859_100065412 | Ga0068859_1000654122 | 322 |
| 252 | 3300005718 | Ga0068866_10015834 | Ga0068866_100158343 | 322 |
| 253 | 3300005841 | Ga0068863_100062140 | Ga0068863_1000621402 | 322 |
| 254 | 3300005844 | Ga0068862_100470009 | Ga0068862_1004700091 | 322 |
| 255 | 3300006048 | Ga0075363_100000250 | Ga0075363_10000025018 | 322 |
| 256 | 3300006186 | Ga0075369_10006461 | Ga0075369_100064613 | 322 |
| 257 | 3300006931 | Ga0097620_100065409 | Ga0097620_1000654092 | 322 |
| 258 | 3300009098 | Ga0105245_10006970 | Ga0105245_100069705 | 322 |
| 259 | 3300009101 | Ga0105247_10058511 | Ga0105247_100585112 | 322 |
| 260 | 3300013296 | Ga0157374_10003772 | Ga0157374_1000377212 | 322 |
| 261 | 3300013306 | Ga0163162_10026544 | Ga0163162_100265447 | 322 |
| 262 | 3300013306 | Ga0163162_10120548 | Ga0163162_101205483 | 322 |
| 263 | 3300014745 | Ga0157377_10003096 | Ga0157377_100030965 | 322 |
| 264 | 3300014968 | Ga0157379_10090567 | Ga0157379_100905672 | 322 |
| 265 | 3300025900 | Ga0207710_10026091 | Ga0207710_100260913 | 322 |
| 266 | 3300025901 | Ga0207688_10001081 | Ga0207688_1000108111 | 322 |
| 267 | 3300025936 | Ga0207670_10270949 | Ga0207670_102709492 | 322 |
| 268 | 3300026023 | Ga0207677_10042316 | Ga0207677_100423163 | 322 |
| 269 | 3300026075 | Ga0207708_10042797 | Ga0207708_100427971 | 322 |
| 270 | 3300026088 | Ga0207641_10059297 | Ga0207641_100592972 | 322 |
| 271 | 3300028379 | Ga0268266_10009705 | Ga0268266_100097056 | 322 |
| 272 | 3300028380 | Ga0268265_10215184 | Ga0268265_102151842 | 322 |
| 273 | 3300031995 | Ga0307409_100084939 | Ga0307409_1000849393 | 322 |
| 274 | 3300039450 | Ga0436363_1081284 | Ga0436363_1081284_526_1677 | 322 |
| 275 | 3300048909 | Ga0496106_0078583 | Ga0496106_0078583_38_1189 | 322 |
| 276 | 3300048911 | Ga0496108_0000759 | Ga0496108_0000759_21806_22957 | 322 |
| 277 | 3300048912 | Ga0496109_0002063 | Ga0496109_0002063_4505_5656 | 322 |
| 278 | 3300048913 | Ga0496110_0012303 | Ga0496110_0012303_1337_2488 | 322 |
| 279 | 3300048916 | Ga0496113_0110739 | Ga0496113_0110739_902_2053 | 322 |
| 280 | 3300048920 | Ga0496117_0013808 | Ga0496117_0013808_4649_5821 | 322 |
| 281 | 3300048921 | Ga0496118_0019275 | Ga0496118_0019275_3807_4979 | 322 |
| 282 | 3300048922 | Ga0496119_0007772 | Ga0496119_0007772_3111_4283 | 322 |
| 283 | 3300050491 | nmdc:mga00v17_72028_c1 | nmdc:mga00v17_72028_c1_104_1255 | 322 |
| 284 | 3300050516 | nmdc:mga0sz30_31624_c1 | nmdc:mga0sz30_31624_c1_900_2051 | 322 |
| 285 | 3300005347 | Ga0070668_100134112 | Ga0070668_1001341124 | 323 |
| 286 | 3300005355 | Ga0070671_100000039 | Ga0070671_1000000394 | 323 |
| 287 | 3300005841 | Ga0068863_100004437 | Ga0068863_1000044373 | 323 |
| 288 | 3300005841 | Ga0068863_100112882 | Ga0068863_1001128823 | 323 |
| 289 | 3300005842 | Ga0068858_100028649 | Ga0068858_1000286492 | 323 |
| 290 | 3300005843 | Ga0068860_100015652 | Ga0068860_1000156525 | 323 |
| 291 | 3300013306 | Ga0163162_10024898 | Ga0163162_100248982 | 323 |
| 292 | 3300025923 | Ga0207681_10000244 | Ga0207681_1000024413 | 323 |
| 293 | 3300025931 | Ga0207644_10000022 | Ga0207644_10000022122 | 323 |
| 294 | 3300025972 | Ga0207668_10115631 | Ga0207668_101156313 | 323 |
| 295 | 3300025986 | Ga0207658_10258072 | Ga0207658_102580721 | 323 |
| 296 | 3300026035 | Ga0207703_10047238 | Ga0207703_100472382 | 323 |
| 297 | 3300026088 | Ga0207641_10003530 | Ga0207641_1000353013 | 323 |
| 298 | 3300028381 | Ga0268264_10026213 | Ga0268264_100262134 | 323 |
| 299 | 3300046452 | Ga0495617_013306 | Ga0495617_013306_296_1492 | 323 |
| 300 | 3300046474 | Ga0495605_0000988 | Ga0495605_0000988_4243_5439 | 323 |
| 301 | 3300046506 | Ga0495583_0031059 | Ga0495583_0031059_1027_2223 | 323 |
| 302 | 3300046507 | Ga0495606_0028054 | Ga0495606_0028054_2254_3450 | 323 |
| 303 | 3300046513 | Ga0495616_0004551 | Ga0495616_0004551_2703_3899 | 323 |
| 304 | 3300046515 | Ga0495620_0000651 | Ga0495620_0000651_8966_10162 | 323 |
| 305 | 3300046518 | Ga0495631_0006526 | Ga0495631_0006526_4109_5305 | 323 |
| 306 | 3300046616 | Ga0495668_0001973 | Ga0495668_0001973_4463_5659 | 323 |
| 307 | 3300046660 | Ga0495625_0011471 | Ga0495625_0011471_3047_4243 | 323 |
| 308 | 3300047443 | Ga0495687_019990 | Ga0495687_019990_1522_2718 | 323 |
| 309 | 3300047447 | Ga0495685_004932 | Ga0495685_004932_2788_3984 | 323 |
| 310 | 3300047472 | Ga0495686_0096259 | Ga0495686_0096259_126_1322 | 323 |
| 311 | 3300048091 | Ga0495626_0043768 | Ga0495626_0043768_259_1455 | 323 |
| 312 | 3300048903 | Ga0496100_0016688 | Ga0496100_0016688_784_1980 | 323 |
| 313 | 3300048903 | Ga0496100_0156579 | Ga0496100_0156579_259_1428 | 323 |
| 314 | 3300048904 | Ga0496101_0002919 | Ga0496101_0002919_3990_5186 | 323 |
| 315 | 3300048905 | Ga0496102_0000008 | Ga0496102_0000008_162005_163201 | 323 |
| 316 | 3300048906 | Ga0496103_0000100 | Ga0496103_0000100_59114_60310 | 323 |
| 317 | 3300048906 | Ga0496103_0011948 | Ga0496103_0011948_3139_4308 | 323 |
| 318 | 3300048907 | Ga0496104_0010464 | Ga0496104_0010464_4747_5943 | 323 |
| 319 | 3300048907 | Ga0496104_0026810 | Ga0496104_0026810_3128_4297 | 323 |
| 320 | 3300048908 | Ga0496105_0057258 | Ga0496105_0057258_930_2099 | 323 |
| 321 | 3300048909 | Ga0496106_0001091 | Ga0496106_0001091_12431_13600 | 323 |
| 322 | 3300048910 | Ga0496107_0000165 | Ga0496107_0000165_2070_3239 | 323 |
| 323 | 3300048911 | Ga0496108_0077156 | Ga0496108_0077156_1633_2802 | 323 |
| 324 | 3300048911 | Ga0496108_0225385 | Ga0496108_0225385_406_1602 | 323 |
| 325 | 3300048913 | Ga0496110_0106790 | Ga0496110_0106790_1076_2245 | 323 |
| 326 | 3300048916 | Ga0496113_0014047 | Ga0496113_0014047_3560_4729 | 323 |
| 327 | 3300048919 | Ga0496116_0000082 | Ga0496116_0000082_59419_60615 | 323 |
| 328 | 3300048920 | Ga0496117_0000026 | Ga0496117_0000026_161971_163167 | 323 |
| 329 | 3300048921 | Ga0496118_0000060 | Ga0496118_0000060_161990_163186 | 323 |
| 330 | 3300048922 | Ga0496119_0000657 | Ga0496119_0000657_30780_31976 | 323 |
| 331 | 3300048923 | Ga0496120_0008564 | Ga0496120_0008564_2523_3719 | 323 |
| 332 | 3300048929 | Ga0496126_0000054 | Ga0496126_0000054_54370_55566 | 323 |
| 333 | iso_pu_bacteria | 8002775197 | 8002779358 | 323 |
| 334 | 3300021384 | Ga0213876_10000150 | Ga0213876_1000015063 | 324 |
| 335 | 3300039437 | Ga0436365_0444660 | Ga0436365_0444660_1620_2789 | 324 |
| 336 | 3300046455 | Ga0495603_0008543 | Ga0495603_0008543_1110_2294 | 324 |
| 337 | 3300046459 | Ga0495629_0062434 | Ga0495629_0062434_273_1457 | 324 |
| 338 | 3300046499 | Ga0495594_0002391 | Ga0495594_0002391_3895_5079 | 324 |
| 339 | 3300046526 | Ga0495666_0005024 | Ga0495666_0005024_1486_2670 | 324 |
| 340 | 3300046533 | Ga0495640_0135442 | Ga0495640_0135442_31_1215 | 324 |
| 341 | 3300046557 | Ga0495622_0002051 | Ga0495622_0002051_3969_5153 | 324 |
| 342 | 3300047321 | Ga0495676_0005790 | Ga0495676_0005790_1420_2604 | 324 |
| 343 | 3300049581 | Ga0501047_0303257 | Ga0501047_0303257_109_1293 | 324 |
| 344 | 3300053092 | Ga0500583_0041327 | Ga0500583_0041327_229_1407 | 324 |
| 345 | 3300049513 | Ga0501290_000683 | Ga0501290_000683_1455_2627 | 325 |
| 346 | 3300049517 | Ga0501294_000008 | Ga0501294_000008_15957_17129 | 325 |
| 347 | 3300049571 | Ga0501034_0152663 | Ga0501034_0152663_99_1271 | 325 |
| 348 | 3300049664 | Ga0501224_000178 | Ga0501224_000178_5918_7090 | 325 |
| 349 | 3300049777 | Ga0501281_00011 | Ga0501281_00011_15783_16955 | 325 |
| 350 | iso_pu_bacteria | 2919713450 | 2919714508 | 326 |
| 351 | 3300002459 | JGI24751J29686_10001207 | JGI24751J29686_100012073 | 327 |
| 352 | 3300005335 | Ga0070666_10194596 | Ga0070666_101945961 | 327 |
| 353 | 3300005353 | Ga0070669_100001874 | Ga0070669_1000018742 | 327 |
| 354 | 3300005355 | Ga0070671_100148436 | Ga0070671_1001484362 | 327 |
| 355 | 3300005367 | Ga0070667_100000080 | Ga0070667_10000008035 | 327 |
| 356 | 3300005367 | Ga0070667_100000285 | Ga0070667_10000028515 | 327 |
| 357 | 3300005367 | Ga0070667_100127526 | Ga0070667_1001275262 | 327 |
| 358 | 3300005544 | Ga0070686_100008872 | Ga0070686_1000088723 | 327 |
| 359 | 3300005548 | Ga0070665_100007974 | Ga0070665_1000079747 | 327 |
| 360 | 3300005548 | Ga0070665_100011576 | Ga0070665_1000115765 | 327 |
| 361 | 3300005617 | Ga0068859_100000182 | Ga0068859_10000018228 | 327 |
| 362 | 3300005617 | Ga0068859_100349707 | Ga0068859_1003497072 | 327 |
| 363 | 3300005841 | Ga0068863_100000304 | Ga0068863_10000030434 | 327 |
| 364 | 3300005841 | Ga0068863_100011021 | Ga0068863_1000110213 | 327 |
| 365 | 3300005842 | Ga0068858_100040789 | Ga0068858_1000407892 | 327 |
| 366 | 3300005843 | Ga0068860_100000016 | Ga0068860_10000001684 | 327 |
| 367 | 3300005843 | Ga0068860_100062410 | Ga0068860_1000624102 | 327 |
| 368 | 3300005843 | Ga0068860_100324115 | Ga0068860_1003241152 | 327 |
| 369 | 3300005844 | Ga0068862_100000071 | Ga0068862_10000007174 | 327 |
| 370 | 3300005844 | Ga0068862_100071180 | Ga0068862_1000711802 | 327 |
| 371 | 3300006038 | Ga0075365_10041990 | Ga0075365_100419903 | 327 |
| 372 | 3300006051 | Ga0075364_10001157 | Ga0075364_1000115715 | 327 |
| 373 | 3300006051 | Ga0075364_10010186 | Ga0075364_100101865 | 327 |
| 374 | 3300006186 | Ga0075369_10000752 | Ga0075369_1000075210 | 327 |
| 375 | 3300006931 | Ga0097620_100000182 | Ga0097620_10000018228 | 327 |
| 376 | 3300006931 | Ga0097620_100349732 | Ga0097620_1003497321 | 327 |
| 377 | 3300007788 | Ga0099795_10016015 | Ga0099795_100160153 | 327 |
| 378 | 3300009092 | Ga0105250_10021679 | Ga0105250_100216792 | 327 |
| 379 | 3300009101 | Ga0105247_10000028 | Ga0105247_1000002874 | 327 |
| 380 | 3300009101 | Ga0105247_10077735 | Ga0105247_100777352 | 327 |
| 381 | 3300009177 | Ga0105248_10000025 | Ga0105248_1000002536 | 327 |
| 382 | 3300009553 | Ga0105249_10000021 | Ga0105249_10000021218 | 327 |
| 383 | 3300014325 | Ga0163163_10002775 | Ga0163163_100027757 | 327 |
| 384 | 3300014325 | Ga0163163_10009006 | Ga0163163_100090062 | 327 |
| 385 | 3300014968 | Ga0157379_10156296 | Ga0157379_101562961 | 327 |
| 386 | 3300025900 | Ga0207710_10000034 | Ga0207710_1000003474 | 327 |
| 387 | 3300025903 | Ga0207680_10121812 | Ga0207680_101218122 | 327 |
| 388 | 3300025941 | Ga0207711_10000048 | Ga0207711_1000004879 | 327 |
| 389 | 3300025961 | Ga0207712_10000005 | Ga0207712_10000005596 | 327 |
| 390 | 3300025986 | Ga0207658_10000231 | Ga0207658_1000023150 | 327 |
| 391 | 3300025986 | Ga0207658_10001080 | Ga0207658_1000108015 | 327 |
| 392 | 3300026035 | Ga0207703_10056088 | Ga0207703_100560882 | 327 |
| 393 | 3300026088 | Ga0207641_10009945 | Ga0207641_100099454 | 327 |
| 394 | 3300028379 | Ga0268266_10004007 | Ga0268266_1000400712 | 327 |
| 395 | 3300028379 | Ga0268266_10010646 | Ga0268266_100106464 | 327 |
| 396 | 3300028380 | Ga0268265_10000037 | Ga0268265_10000037108 | 327 |
| 397 | 3300028381 | Ga0268264_10000005 | Ga0268264_10000005591 | 327 |
| 398 | 3300048903 | Ga0496100_0000037 | Ga0496100_0000037_39769_40953 | 327 |
| 399 | 3300048903 | Ga0496100_0001777 | Ga0496100_0001777_1208_2392 | 327 |
| 400 | 3300048904 | Ga0496101_0000174 | Ga0496101_0000174_39793_40977 | 327 |
| 401 | 3300048904 | Ga0496101_0000233 | Ga0496101_0000233_1686_2870 | 327 |
| 402 | 3300048905 | Ga0496102_0000524 | Ga0496102_0000524_5089_6270 | 327 |
| 403 | 3300048905 | Ga0496102_0000528 | Ga0496102_0000528_1638_2822 | 327 |
| 404 | 3300048905 | Ga0496102_0014204 | Ga0496102_0014204_5189_6373 | 327 |
| 405 | 3300048905 | Ga0496102_0244915 | Ga0496102_0244915_313_1497 | 327 |
| 406 | 3300048906 | Ga0496103_0000168 | Ga0496103_0000168_47040_48224 | 327 |
| 407 | 3300048906 | Ga0496103_0000821 | Ga0496103_0000821_10881_12065 | 327 |
| 408 | 3300048906 | Ga0496103_0002795 | Ga0496103_0002795_486_1667 | 327 |
| 409 | 3300048907 | Ga0496104_0051082 | Ga0496104_0051082_835_2019 | 327 |
| 410 | 3300048908 | Ga0496105_0015156 | Ga0496105_0015156_1549_2733 | 327 |
| 411 | 3300048909 | Ga0496106_0000944 | Ga0496106_0000944_17985_19169 | 327 |
| 412 | 3300048909 | Ga0496106_0001029 | Ga0496106_0001029_8648_9832 | 327 |
| 413 | 3300048910 | Ga0496107_0000998 | Ga0496107_0000998_5333_6517 | 327 |
| 414 | 3300048910 | Ga0496107_0009274 | Ga0496107_0009274_3128_4309 | 327 |
| 415 | 3300048910 | Ga0496107_0026619 | Ga0496107_0026619_1018_2202 | 327 |
| 416 | 3300048911 | Ga0496108_0002837 | Ga0496108_0002837_2009_3193 | 327 |
| 417 | 3300048912 | Ga0496109_0000128 | Ga0496109_0000128_10709_11893 | 327 |
| 418 | 3300048913 | Ga0496110_0020606 | Ga0496110_0020606_489_1673 | 327 |
| 419 | 3300048913 | Ga0496110_0042120 | Ga0496110_0042120_2599_3783 | 327 |
| 420 | 3300048914 | Ga0496111_0067704 | Ga0496111_0067704_825_2009 | 327 |
| 421 | 3300048914 | Ga0496111_0247148 | Ga0496111_0247148_94_1278 | 327 |
| 422 | 3300048919 | Ga0496116_0000254 | Ga0496116_0000254_47040_48224 | 327 |
| 423 | 3300048919 | Ga0496116_0002558 | Ga0496116_0002558_4203_5387 | 327 |
| 424 | 3300048920 | Ga0496117_0000282 | Ga0496117_0000282_47483_48667 | 327 |
| 425 | 3300048920 | Ga0496117_0000328 | Ga0496117_0000328_59452_60633 | 327 |
| 426 | 3300048920 | Ga0496117_0020364 | Ga0496117_0020364_133_1317 | 327 |
| 427 | 3300048920 | Ga0496117_0069786 | Ga0496117_0069786_330_1514 | 327 |
| 428 | 3300048921 | Ga0496118_0000176 | Ga0496118_0000176_67536_68720 | 327 |
| 429 | 3300048921 | Ga0496118_0001440 | Ga0496118_0001440_27831_29015 | 327 |
| 430 | 3300048921 | Ga0496118_0019594 | Ga0496118_0019594_418_1602 | 327 |
| 431 | 3300048922 | Ga0496119_0006958 | Ga0496119_0006958_1613_2794 | 327 |
| 432 | 3300048923 | Ga0496120_0005926 | Ga0496120_0005926_4164_5345 | 327 |
| 433 | 3300048924 | Ga0496121_0000118 | Ga0496121_0000118_118970_120154 | 327 |
| 434 | 3300048924 | Ga0496121_0000963 | Ga0496121_0000963_10724_11908 | 327 |
| 435 | 3300048924 | Ga0496121_0082188 | Ga0496121_0082188_743_1924 | 327 |
| 436 | 3300048925 | Ga0496122_0006172 | Ga0496122_0006172_10714_11898 | 327 |
| 437 | 3300048926 | Ga0496123_0005935 | Ga0496123_0005935_4657_5841 | 327 |
| 438 | 3300048927 | Ga0496124_0000792 | Ga0496124_0000792_39793_40977 | 327 |
| 439 | 3300048928 | Ga0496125_0000787 | Ga0496125_0000787_10721_11905 | 327 |
| 440 | 3300048928 | Ga0496125_0121478 | Ga0496125_0121478_195_1376 | 327 |
| 441 | 3300048929 | Ga0496126_0000162 | Ga0496126_0000162_18277_19461 | 327 |
| 442 | 3300048929 | Ga0496126_0000515 | Ga0496126_0000515_57627_58808 | 327 |
| 443 | 3300048929 | Ga0496126_0000614 | Ga0496126_0000614_62755_63939 | 327 |
| 444 | 3300048929 | Ga0496126_0000986 | Ga0496126_0000986_36803_37987 | 327 |
| 445 | 3300049589 | Ga0501073_0128739 | Ga0501073_0128739_549_1736 | 327 |
| 446 | 3300050489 | nmdc:mga03683_31538_c1 | nmdc:mga03683_31538_c1_713_1900 | 327 |
| 447 | 3300050491 | nmdc:mga00v17_1850_c1 | nmdc:mga00v17_1850_c1_8322_9509 | 327 |
| 448 | 3300050491 | nmdc:mga00v17_26162_c1 | nmdc:mga00v17_26162_c1_1149_2336 | 327 |
| 449 | 3300050492 | nmdc:mga0yw44_4379_c1 | nmdc:mga0yw44_4379_c1_1258_2445 | 327 |
| 450 | 3300050516 | nmdc:mga0sz30_17376_c1 | nmdc:mga0sz30_17376_c1_887_2074 | 327 |
| 451 | 3300053080 | Ga0500635_0001707 | Ga0500635_0001707_3366_4550 | 327 |
| 452 | 3300053131 | Ga0500652_000103 | Ga0500652_000103_20308_21492 | 327 |
| 453 | iso_pu_bacteria | 2508501039 | 2508676577 | 327 |
| 454 | iso_pu_bacteria | 2517572101 | 2517763224 | 327 |
| 455 | iso_pu_bacteria | 2675902999 | 2676200515 | 327 |
| 456 | iso_pu_bacteria | 2687453737 | 2689956995 | 327 |
| 457 | iso_pu_bacteria | 2773857921 | 2774845093 | 327 |
| 458 | iso_pu_bacteria | 8002775197 | 8002775663 | 327 |
| 459 | 3300009092 | Ga0105250_10006915 | Ga0105250_100069152 | 328 |
| 460 | 3300009098 | Ga0105245_10008979 | Ga0105245_1000897911 | 328 |
| 461 | 3300009176 | Ga0105242_10124587 | Ga0105242_101245872 | 328 |
| 462 | 3300014325 | Ga0163163_10008807 | Ga0163163_100088076 | 328 |
| 463 | 3300048920 | Ga0496117_0018137 | Ga0496117_0018137_2194_3354 | 328 |
| 464 | 3300048921 | Ga0496118_0005078 | Ga0496118_0005078_2474_3634 | 328 |
| 465 | 3300048922 | Ga0496119_0008123 | Ga0496119_0008123_2346_3506 | 328 |
| 466 | 3300048924 | Ga0496121_0000334 | Ga0496121_0000334_81810_82970 | 328 |
| 467 | 3300050512 | nmdc:mga0n895_250488_c1 | nmdc:mga0n895_250488_c1_255_1433 | 328 |
| 468 | iso_pu_bacteria | 2508501039 | 2508676618 | 328 |
| 469 | iso_pu_bacteria | 2675902999 | 2676200486 | 328 |
| 470 | iso_pu_bacteria | 2687453737 | 2689957033 | 328 |
| 471 | iso_pu_bacteria | 2773857921 | 2774845064 | 328 |
| 472 | iso_pu_bacteria | 2915358134 | 2915361835 | 328 |
| 473 | iso_pu_bacteria | 2915358134 | 2915365202 | 328 |
| 474 | iso_pu_bacteria | 8002784119 | 8002786858 | 328 |
| 475 | 3300009094 | Ga0111539_10001540 | Ga0111539_100015408 | 329 |
| 476 | 3300025960 | Ga0207651_10203425 | Ga0207651_102034251 | 329 |
| 477 | 3300026118 | Ga0207675_100295780 | Ga0207675_1002957802 | 329 |
| 478 | 3300027907 | Ga0207428_10004278 | Ga0207428_100042786 | 329 |
| 479 | 3300046539 | Ga0495621_0005476 | Ga0495621_0005476_273_1445 | 329 |
| 480 | 3300050511 | nmdc:mga08y16_125678_c1 | nmdc:mga08y16_125678_c1_480_1664 | 329 |
| 481 | 3300050511 | nmdc:mga08y16_6521_c1 | nmdc:mga08y16_6521_c1_6673_7857 | 329 |
| 482 | iso_pu_bacteria | 2547132424 | 2548698403 | 329 |
| 483 | iso_pu_bacteria | 2671180195 | 2671840321 | 329 |
| 484 | iso_pu_bacteria | 2684623035 | 2686537427 | 329 |
| 485 | iso_pu_bacteria | 2687453743 | 2689990677 | 329 |
| 486 | iso_pu_bacteria | 2773857922 | 2774858477 | 329 |
| 487 | iso_pu_bacteria | 2895880812 | 2895890241 | 329 |
| 488 | iso_pu_bacteria | 8002784119 | 8002785845 | 329 |
| 489 | 3300005347 | Ga0070668_100027860 | Ga0070668_1000278602 | 331 |
| 490 | 3300005354 | Ga0070675_100068110 | Ga0070675_1000681102 | 331 |
| 491 | 3300005354 | Ga0070675_100220447 | Ga0070675_1002204471 | 331 |
| 492 | 3300005548 | Ga0070665_100000424 | Ga0070665_10000042426 | 331 |
| 493 | 3300005548 | Ga0070665_100050820 | Ga0070665_1000508204 | 331 |
| 494 | 3300005719 | Ga0068861_100260154 | Ga0068861_1002601542 | 331 |
| 495 | 3300005842 | Ga0068858_100000039 | Ga0068858_100000039110 | 331 |
| 496 | 3300005842 | Ga0068858_100043383 | Ga0068858_1000433832 | 331 |
| 497 | 3300005843 | Ga0068860_100179565 | Ga0068860_1001795652 | 331 |
| 498 | 3300005937 | Ga0081455_10049076 | Ga0081455_100490762 | 331 |
| 499 | 3300006038 | Ga0075365_10123180 | Ga0075365_101231802 | 331 |
| 500 | 3300006042 | Ga0075368_10016871 | Ga0075368_100168713 | 331 |
| 501 | 3300006195 | Ga0075366_10030273 | Ga0075366_100302732 | 331 |
| 502 | 3300006353 | Ga0075370_10018799 | Ga0075370_100187992 | 331 |
| 503 | 3300006844 | Ga0075428_100001834 | Ga0075428_10000183411 | 331 |
| 504 | 3300006844 | Ga0075428_100406215 | Ga0075428_1004062152 | 331 |
| 505 | 3300006846 | Ga0075430_100003945 | Ga0075430_1000039456 | 331 |
| 506 | 3300006846 | Ga0075430_100013488 | Ga0075430_1000134885 | 331 |
| 507 | 3300006847 | Ga0075431_100009323 | Ga0075431_1000093233 | 331 |
| 508 | 3300006847 | Ga0075431_100014125 | Ga0075431_1000141256 | 331 |
| 509 | 3300006847 | Ga0075431_100060760 | Ga0075431_1000607604 | 331 |
| 510 | 3300006880 | Ga0075429_100000899 | Ga0075429_1000008998 | 331 |
| 511 | 3300006880 | Ga0075429_100002833 | Ga0075429_10000283311 | 331 |
| 512 | 3300006880 | Ga0075429_100033499 | Ga0075429_1000334994 | 331 |
| 513 | 3300006880 | Ga0075429_100050170 | Ga0075429_1000501703 | 331 |
| 514 | 3300006880 | Ga0075429_100169518 | Ga0075429_1001695182 | 331 |
| 515 | 3300009147 | Ga0114129_10000314 | Ga0114129_100003142 | 331 |
| 516 | 3300009147 | Ga0114129_10017891 | Ga0114129_100178915 | 331 |
| 517 | 3300009147 | Ga0114129_10262339 | Ga0114129_102623392 | 331 |
| 518 | 3300009177 | Ga0105248_10017375 | Ga0105248_100173753 | 331 |
| 519 | 3300009177 | Ga0105248_10166498 | Ga0105248_101664982 | 331 |
| 520 | 3300009177 | Ga0105248_10190197 | Ga0105248_101901972 | 331 |
| 521 | 3300009177 | Ga0105248_10327751 | Ga0105248_103277512 | 331 |
| 522 | 3300013306 | Ga0163162_10074638 | Ga0163162_100746382 | 331 |
| 523 | 3300014325 | Ga0163163_10040204 | Ga0163163_100402042 | 331 |
| 524 | 3300025900 | Ga0207710_10000569 | Ga0207710_1000056914 | 331 |
| 525 | 3300025900 | Ga0207710_10001186 | Ga0207710_100011867 | 331 |
| 526 | 3300025922 | Ga0207646_10196556 | Ga0207646_101965562 | 331 |
| 527 | 3300025923 | Ga0207681_10063953 | Ga0207681_100639532 | 331 |
| 528 | 3300025926 | Ga0207659_10086443 | Ga0207659_100864431 | 331 |
| 529 | 3300025941 | Ga0207711_10000288 | Ga0207711_100002882 | 331 |
| 530 | 3300025941 | Ga0207711_10004155 | Ga0207711_100041558 | 331 |
| 531 | 3300025942 | Ga0207689_10265989 | Ga0207689_102659891 | 331 |
| 532 | 3300025961 | Ga0207712_10067153 | Ga0207712_100671531 | 331 |
| 533 | 3300025972 | Ga0207668_10000172 | Ga0207668_100001726 | 331 |
| 534 | 3300026035 | Ga0207703_10000039 | Ga0207703_1000003953 | 331 |
| 535 | 3300026095 | Ga0207676_10180029 | Ga0207676_101800292 | 331 |
| 536 | 3300026118 | Ga0207675_100407654 | Ga0207675_1004076541 | 331 |
| 537 | 3300027907 | Ga0207428_10089178 | Ga0207428_100891782 | 331 |
| 538 | 3300028379 | Ga0268266_10000409 | Ga0268266_1000040926 | 331 |
| 539 | 3300028379 | Ga0268266_10039127 | Ga0268266_100391274 | 331 |
| 540 | 3300028380 | Ga0268265_10079682 | Ga0268265_100796822 | 331 |
| 541 | 3300028380 | Ga0268265_10330726 | Ga0268265_103307262 | 331 |
| 542 | 3300031731 | Ga0307405_10084392 | Ga0307405_100843922 | 331 |
| 543 | 3300031824 | Ga0307413_10026386 | Ga0307413_100263862 | 331 |
| 544 | 3300031852 | Ga0307410_10029597 | Ga0307410_100295972 | 331 |
| 545 | 3300031903 | Ga0307407_10021436 | Ga0307407_100214363 | 331 |
| 546 | 3300031995 | Ga0307409_100018461 | Ga0307409_1000184614 | 331 |
| 547 | 3300032005 | Ga0307411_10114579 | Ga0307411_101145792 | 331 |
| 548 | 3300034816 | Ga0373930_0002631 | Ga0373930_0002631_377_1612 | 331 |
| 549 | 3300035084 | Ga0373928_0010905 | Ga0373928_0010905_330_1517 | 331 |
| 550 | 3300035112 | Ga0373932_0003171 | Ga0373932_0003171_998_2233 | 331 |
| 551 | 3300035691 | Ga0373931_0000005 | Ga0373931_0000005_146676_147911 | 331 |
| 552 | 3300035691 | Ga0373931_0000040 | Ga0373931_0000040_62505_63692 | 331 |
| 553 | 3300046459 | Ga0495629_0092654 | Ga0495629_0092654_130_1299 | 331 |
| 554 | 3300046642 | Ga0495634_0013649 | Ga0495634_0013649_51_1220 | 331 |
| 555 | 3300046689 | Ga0495613_0000311 | Ga0495613_0000311_11195_12364 | 331 |
| 556 | 3300047321 | Ga0495676_0175559 | Ga0495676_0175559_30_1205 | 331 |
| 557 | 3300048905 | Ga0496102_0054058 | Ga0496102_0054058_428_1606 | 331 |
| 558 | 3300048909 | Ga0496106_0279795 | Ga0496106_0279795_49_1218 | 331 |
| 559 | 3300048919 | Ga0496116_0000924 | Ga0496116_0000924_17045_18223 | 331 |
| 560 | 3300048921 | Ga0496118_0047825 | Ga0496118_0047825_291_1469 | 331 |
| 561 | 3300048922 | Ga0496119_0011881 | Ga0496119_0011881_698_1879 | 331 |
| 562 | 3300048922 | Ga0496119_0042842 | Ga0496119_0042842_1365_2543 | 331 |
| 563 | 3300048923 | Ga0496120_0001855 | Ga0496120_0001855_1188_2369 | 331 |
| 564 | 3300048924 | Ga0496121_0001460 | Ga0496121_0001460_19496_20704 | 331 |
| 565 | 3300048924 | Ga0496121_0141792 | Ga0496121_0141792_267_1448 | 331 |
| 566 | 3300048928 | Ga0496125_0002534 | Ga0496125_0002534_13935_15107 | 331 |
| 567 | 3300048929 | Ga0496126_0009624 | Ga0496126_0009624_190_1362 | 331 |
| 568 | 3300048929 | Ga0496126_0211415 | Ga0496126_0211415_70_1251 | 331 |
| 569 | 3300050491 | nmdc:mga00v17_121241_c1 | nmdc:mga00v17_121241_c1_301_1479 | 331 |
| 570 | 3300050492 | nmdc:mga0yw44_379_c1 | nmdc:mga0yw44_379_c1_5075_6310 | 331 |
| 571 | 3300050492 | nmdc:mga0yw44_91087_c1 | nmdc:mga0yw44_91087_c1_713_1906 | 331 |
| 572 | 3300050507 | nmdc:mga05p37_44394_c1 | nmdc:mga05p37_44394_c1_3126_4310 | 331 |
| 573 | 3300050507 | nmdc:mga05p37_6318_c1 | nmdc:mga05p37_6318_c1_1675_2853 | 331 |
| 574 | 3300050508 | nmdc:mga09592_1473_c1 | nmdc:mga09592_1473_c1_9218_10396 | 331 |
| 575 | 3300050508 | nmdc:mga09592_87029_c1 | nmdc:mga09592_87029_c1_1417_2595 | 331 |
| 576 | 3300050508 | nmdc:mga09592_894_c1 | nmdc:mga09592_894_c1_7242_8414 | 331 |
| 577 | 3300050509 | nmdc:mga0qj67_167711_c1 | nmdc:mga0qj67_167711_c1_282_1460 | 331 |
| 578 | 3300050509 | nmdc:mga0qj67_1880_c1 | nmdc:mga0qj67_1880_c1_2131_3309 | 331 |
| 579 | 3300050509 | nmdc:mga0qj67_270965_c1 | nmdc:mga0qj67_270965_c1_168_1352 | 331 |
| 580 | 3300050509 | nmdc:mga0qj67_767_c1 | nmdc:mga0qj67_767_c1_3132_4304 | 331 |
| 581 | 3300050510 | nmdc:mga06r32_162409_c1 | nmdc:mga06r32_162409_c1_923_2107 | 331 |
| 582 | 3300050510 | nmdc:mga06r32_31038_c1 | nmdc:mga06r32_31038_c1_2855_4033 | 331 |
| 583 | 3300050510 | nmdc:mga06r32_642_c1 | nmdc:mga06r32_642_c1_7565_8737 | 331 |
| 584 | 3300050510 | nmdc:mga06r32_66478_c1 | nmdc:mga06r32_66478_c1_1186_2370 | 331 |
| 585 | 3300050510 | nmdc:mga06r32_7652_c1 | nmdc:mga06r32_7652_c1_8336_9514 | 331 |
| 586 | 3300050511 | nmdc:mga08y16_75835_c1 | nmdc:mga08y16_75835_c1_1500_2684 | 331 |
| 587 | 3300053125 | Ga0500618_002022 | Ga0500618_002022_6526_7695 | 331 |
| 588 | 3300054114 | Ga0501084_0000082 | Ga0501084_0000082_12091_13263 | 331 |
| 589 | iso_pu_bacteria | 2626541554 | 2626636369 | 331 |
| 590 | 2162886007 | SwRhRL2b_contig_3625322 | SwRhRL2b_0702.00004410 | 332 |
| 591 | 3300002459 | JGI24751J29686_10000014 | JGI24751J29686_1000001447 | 332 |
| 592 | 3300002459 | JGI24751J29686_10000278 | JGI24751J29686_100002789 | 332 |
| 593 | 3300005289 | Ga0065704_10005194 | Ga0065704_100051942 | 332 |
| 594 | 3300005289 | Ga0065704_10070334 | Ga0065704_1007033421 | 332 |
| 595 | 3300005295 | Ga0065707_10098180 | Ga0065707_100981802 | 332 |
| 596 | 3300005331 | Ga0070670_100000008 | Ga0070670_100000008151 | 332 |
| 597 | 3300005347 | Ga0070668_100008779 | Ga0070668_1000087795 | 332 |
| 598 | 3300005347 | Ga0070668_100042570 | Ga0070668_1000425703 | 332 |
| 599 | 3300005347 | Ga0070668_100146827 | Ga0070668_1001468271 | 332 |
| 600 | 3300005347 | Ga0070668_100199137 | Ga0070668_1001991371 | 332 |
| 601 | 3300005353 | Ga0070669_100000045 | Ga0070669_10000004533 | 332 |
| 602 | 3300005353 | Ga0070669_100000088 | Ga0070669_10000008824 | 332 |
| 603 | 3300005353 | Ga0070669_100010072 | Ga0070669_1000100724 | 332 |
| 604 | 3300005355 | Ga0070671_100000105 | Ga0070671_10000010533 | 332 |
| 605 | 3300005355 | Ga0070671_100006020 | Ga0070671_1000060202 | 332 |
| 606 | 3300005367 | Ga0070667_100000381 | Ga0070667_10000038123 | 332 |
| 607 | 3300005367 | Ga0070667_100023532 | Ga0070667_1000235325 | 332 |
| 608 | 3300005367 | Ga0070667_100247297 | Ga0070667_1002472971 | 332 |
| 609 | 3300005467 | Ga0070706_100011874 | Ga0070706_1000118742 | 332 |
| 610 | 3300005468 | Ga0070707_100109770 | Ga0070707_1001097703 | 332 |
| 611 | 3300005471 | Ga0070698_100025488 | Ga0070698_1000254883 | 332 |
| 612 | 3300005536 | Ga0070697_100059593 | Ga0070697_1000595932 | 332 |
| 613 | 3300005548 | Ga0070665_100003418 | Ga0070665_1000034183 | 332 |
| 614 | 3300005548 | Ga0070665_100033612 | Ga0070665_1000336124 | 332 |
| 615 | 3300005617 | Ga0068859_100003207 | Ga0068859_10000320712 | 332 |
| 616 | 3300005617 | Ga0068859_100042209 | Ga0068859_1000422094 | 332 |
| 617 | 3300005617 | Ga0068859_100245866 | Ga0068859_1002458662 | 332 |
| 618 | 3300005618 | Ga0068864_100000027 | Ga0068864_100000027130 | 332 |
| 619 | 3300005618 | Ga0068864_100000147 | Ga0068864_10000014750 | 332 |
| 620 | 3300005719 | Ga0068861_100003853 | Ga0068861_1000038532 | 332 |
| 621 | 3300005841 | Ga0068863_100001268 | Ga0068863_10000126812 | 332 |
| 622 | 3300005841 | Ga0068863_100008023 | Ga0068863_1000080239 | 332 |
| 623 | 3300005842 | Ga0068858_100001492 | Ga0068858_10000149215 | 332 |
| 624 | 3300005843 | Ga0068860_100000395 | Ga0068860_1000003951 | 332 |
| 625 | 3300005844 | Ga0068862_100000152 | Ga0068862_10000015250 | 332 |
| 626 | 3300005844 | Ga0068862_100000618 | Ga0068862_1000006181 | 332 |
| 627 | 3300005844 | Ga0068862_100019937 | Ga0068862_1000199372 | 332 |
| 628 | 3300006844 | Ga0075428_100000178 | Ga0075428_10000017827 | 332 |
| 629 | 3300006931 | Ga0097620_100003207 | Ga0097620_10000320712 | 332 |
| 630 | 3300006931 | Ga0097620_100042207 | Ga0097620_1000422074 | 332 |
| 631 | 3300006931 | Ga0097620_100245882 | Ga0097620_1002458822 | 332 |
| 632 | 3300009011 | Ga0105251_10002755 | Ga0105251_100027553 | 332 |
| 633 | 3300009101 | Ga0105247_10000006 | Ga0105247_1000000672 | 332 |
| 634 | 3300009101 | Ga0105247_10046460 | Ga0105247_100464601 | 332 |
| 635 | 3300009177 | Ga0105248_10006928 | Ga0105248_1000692810 | 332 |
| 636 | 3300009177 | Ga0105248_10319592 | Ga0105248_103195922 | 332 |
| 637 | 3300009553 | Ga0105249_10000259 | Ga0105249_100002591 | 332 |
| 638 | 3300013306 | Ga0163162_10034434 | Ga0163162_100344345 | 332 |
| 639 | 3300014325 | Ga0163163_10024027 | Ga0163163_100240273 | 332 |
| 640 | 3300014326 | Ga0157380_10000648 | Ga0157380_100006484 | 332 |
| 641 | 3300017792 | Ga0163161_10001690 | Ga0163161_100016907 | 332 |
| 642 | 3300017792 | Ga0163161_10149797 | Ga0163161_101497971 | 332 |
| 643 | 3300025711 | Ga0207696_1002177 | Ga0207696_10021775 | 332 |
| 644 | 3300025735 | Ga0207713_1016877 | Ga0207713_10168772 | 332 |
| 645 | 3300025898 | Ga0207692_10006272 | Ga0207692_100062723 | 332 |
| 646 | 3300025900 | Ga0207710_10000025 | Ga0207710_10000025214 | 332 |
| 647 | 3300025910 | Ga0207684_10116868 | Ga0207684_101168682 | 332 |
| 648 | 3300025923 | Ga0207681_10000022 | Ga0207681_10000022134 | 332 |
| 649 | 3300025923 | Ga0207681_10000075 | Ga0207681_1000007518 | 332 |
| 650 | 3300025923 | Ga0207681_10007325 | Ga0207681_100073254 | 332 |
| 651 | 3300025925 | Ga0207650_10000019 | Ga0207650_10000019179 | 332 |
| 652 | 3300025925 | Ga0207650_10000020 | Ga0207650_10000020172 | 332 |
| 653 | 3300025961 | Ga0207712_10000217 | Ga0207712_1000021753 | 332 |
| 654 | 3300025972 | Ga0207668_10075729 | Ga0207668_100757292 | 332 |
| 655 | 3300025972 | Ga0207668_10098666 | Ga0207668_100986661 | 332 |
| 656 | 3300025986 | Ga0207658_10000481 | Ga0207658_100004819 | 332 |
| 657 | 3300025986 | Ga0207658_10012725 | Ga0207658_100127254 | 332 |
| 658 | 3300026035 | Ga0207703_10000335 | Ga0207703_1000033536 | 332 |
| 659 | 3300026088 | Ga0207641_10000166 | Ga0207641_1000016614 | 332 |
| 660 | 3300026088 | Ga0207641_10005989 | Ga0207641_100059899 | 332 |
| 661 | 3300026095 | Ga0207676_10000022 | Ga0207676_10000022124 | 332 |
| 662 | 3300026095 | Ga0207676_10000187 | Ga0207676_100001874 | 332 |
| 663 | 3300026118 | Ga0207675_100002686 | Ga0207675_1000026863 | 332 |
| 664 | 3300028380 | Ga0268265_10000031 | Ga0268265_10000031157 | 332 |
| 665 | 3300028380 | Ga0268265_10000121 | Ga0268265_1000012146 | 332 |
| 666 | 3300028381 | Ga0268264_10000612 | Ga0268264_1000061221 | 332 |
| 667 | 3300028381 | Ga0268264_10074097 | Ga0268264_100740973 | 332 |
| 668 | 3300033545 | Ga0316214_1009107 | Ga0316214_10091071 | 332 |
| 669 | 3300035086 | Ga0373934_0005084 | Ga0373934_0005084_499_1686 | 332 |
| 670 | 3300035113 | Ga0373936_0035565 | Ga0373936_0035565_490_1677 | 332 |
| 671 | 3300035120 | Ga0373957_0044104 | Ga0373957_0044104_417_1604 | 332 |
| 672 | 3300035695 | Ga0373927_0000260 | Ga0373927_0000260_7657_8832 | 332 |
| 673 | 3300035724 | Ga0373933_0030241 | Ga0373933_0030241_274_1461 | 332 |
| 674 | 3300036401 | Ga0373937_0075806 | Ga0373937_0075806_207_1394 | 332 |
| 675 | 3300037068 | Ga0373925_0000257 | Ga0373925_0000257_46920_48095 | 332 |
| 676 | 3300046462 | Ga0495651_0017287 | Ga0495651_0017287_2781_3968 | 332 |
| 677 | 3300046462 | Ga0495651_0100275 | Ga0495651_0100275_374_1555 | 332 |
| 678 | 3300046463 | Ga0495653_0024020 | Ga0495653_0024020_3720_4907 | 332 |
| 679 | 3300046501 | Ga0495607_0046636 | Ga0495607_0046636_630_1814 | 332 |
| 680 | 3300046516 | Ga0495628_0144791 | Ga0495628_0144791_202_1383 | 332 |
| 681 | 3300046536 | Ga0495587_0067866 | Ga0495587_0067866_295_1476 | 332 |
| 682 | 3300046559 | Ga0495667_0012542 | Ga0495667_0012542_3917_5104 | 332 |
| 683 | 3300046648 | Ga0495611_0013673 | Ga0495611_0013673_101_1297 | 332 |
| 684 | 3300046663 | Ga0495635_0026735 | Ga0495635_0026735_2226_3413 | 332 |
| 685 | 3300046675 | Ga0495657_0006334 | Ga0495657_0006334_6164_7351 | 332 |
| 686 | 3300046675 | Ga0495657_0054148 | Ga0495657_0054148_35_1216 | 332 |
| 687 | 3300046679 | Ga0495623_0096843 | Ga0495623_0096843_321_1502 | 332 |
| 688 | 3300046680 | Ga0495646_0046378 | Ga0495646_0046378_282_1469 | 332 |
| 689 | 3300047317 | Ga0495604_0177648 | Ga0495604_0177648_26_1207 | 332 |
| 690 | 3300047322 | Ga0495680_0027078 | Ga0495680_0027078_1922_3109 | 332 |
| 691 | 3300047322 | Ga0495680_0098371 | Ga0495680_0098371_807_1988 | 332 |
| 692 | 3300047471 | Ga0495684_0033359 | Ga0495684_0033359_220_1407 | 332 |
| 693 | 3300048088 | Ga0495602_0045271 | Ga0495602_0045271_2527_3708 | 332 |
| 694 | 3300048088 | Ga0495602_0057114 | Ga0495602_0057114_207_1394 | 332 |
| 695 | 3300048904 | Ga0496101_0043160 | Ga0496101_0043160_1697_2869 | 332 |
| 696 | 3300048905 | Ga0496102_0000839 | Ga0496102_0000839_25062_26234 | 332 |
| 697 | 3300048906 | Ga0496103_0000127 | Ga0496103_0000127_72863_74035 | 332 |
| 698 | 3300048907 | Ga0496104_0000103 | Ga0496104_0000103_6391_7563 | 332 |
| 699 | 3300048908 | Ga0496105_0000121 | Ga0496105_0000121_34703_35875 | 332 |
| 700 | 3300048911 | Ga0496108_0000726 | Ga0496108_0000726_19005_20177 | 332 |
| 701 | 3300048914 | Ga0496111_0078987 | Ga0496111_0078987_1056_2228 | 332 |
| 702 | 3300048915 | Ga0496112_0059333 | Ga0496112_0059333_736_1908 | 332 |
| 703 | 3300048916 | Ga0496113_0116079 | Ga0496113_0116079_545_1717 | 332 |
| 704 | 3300048919 | Ga0496116_0013216 | Ga0496116_0013216_1964_3136 | 332 |
| 705 | 3300048919 | Ga0496116_0057624 | Ga0496116_0057624_695_1867 | 332 |
| 706 | 3300048920 | Ga0496117_0000342 | Ga0496117_0000342_13453_14625 | 332 |
| 707 | 3300048921 | Ga0496118_0011496 | Ga0496118_0011496_525_1697 | 332 |
| 708 | 3300048921 | Ga0496118_0092139 | Ga0496118_0092139_746_1921 | 332 |
| 709 | 3300048922 | Ga0496119_0000123 | Ga0496119_0000123_49642_50814 | 332 |
| 710 | 3300048923 | Ga0496120_0000362 | Ga0496120_0000362_37871_39043 | 332 |
| 711 | 3300048924 | Ga0496121_0000181 | Ga0496121_0000181_55394_56566 | 332 |
| 712 | 3300048924 | Ga0496121_0000311 | Ga0496121_0000311_25603_26778 | 332 |
| 713 | 3300048924 | Ga0496121_0010710 | Ga0496121_0010710_2183_3355 | 332 |
| 714 | 3300048924 | Ga0496121_0022632 | Ga0496121_0022632_4572_5744 | 332 |
| 715 | 3300048925 | Ga0496122_0107713 | Ga0496122_0107713_69_1241 | 332 |
| 716 | 3300048926 | Ga0496123_0038327 | Ga0496123_0038327_2142_3314 | 332 |
| 717 | 3300048927 | Ga0496124_0001580 | Ga0496124_0001580_23820_24992 | 332 |
| 718 | 3300048928 | Ga0496125_0001618 | Ga0496125_0001618_11924_13099 | 332 |
| 719 | 3300048928 | Ga0496125_0077710 | Ga0496125_0077710_125_1297 | 332 |
| 720 | 3300048929 | Ga0496126_0000045 | Ga0496126_0000045_72886_74058 | 332 |
| 721 | 3300048929 | Ga0496126_0000356 | Ga0496126_0000356_74584_75759 | 332 |
| 722 | 3300048929 | Ga0496126_0001159 | Ga0496126_0001159_7402_8574 | 332 |
| 723 | 3300049515 | Ga0501292_000001 | Ga0501292_000001_118882_120054 | 332 |
| 724 | 3300049570 | Ga0501033_0000265 | Ga0501033_0000265_48717_49901 | 332 |
| 725 | 3300049571 | Ga0501034_0000285 | Ga0501034_0000285_30792_32084 | 332 |
| 726 | 3300049584 | Ga0501068_0000188 | Ga0501068_0000188_3482_4756 | 332 |
| 727 | 3300049585 | Ga0501069_0089495 | Ga0501069_0089495_22_1206 | 332 |
| 728 | 3300049586 | Ga0501070_0271640 | Ga0501070_0271640_63_1235 | 332 |
| 729 | 3300049588 | Ga0501072_0017898 | Ga0501072_0017898_1500_2792 | 332 |
| 730 | 3300049589 | Ga0501073_0000016 | Ga0501073_0000016_53056_54330 | 332 |
| 731 | 3300049742 | Ga0501080_0048888 | Ga0501080_0048888_124_1416 | 332 |
| 732 | 3300049823 | Ga0501044_0000365 | Ga0501044_0000365_44079_45263 | 332 |
| 733 | 3300053077 | Ga0495601_0116930 | Ga0495601_0116930_116_1297 | 332 |
| 734 | 3300053084 | Ga0495595_0002019 | Ga0495595_0002019_5269_6450 | 332 |
| 735 | 3300053085 | Ga0495619_0069293 | Ga0495619_0069293_504_1685 | 332 |
| 736 | 3300053153 | Ga0500616_0007130 | Ga0500616_0007130_142_1326 | 332 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pca-assembly1.cif.gz_C | crystal structure of beta-ketoadipyl-coa thiolase | 0.8813 | 1 | 329 |
| 6pcc-assembly1.cif.gz_B | crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a | 0.8797 | 1 | 329 |
| 1ulq-assembly2.cif.gz_F | crystal structure of tt0182 from thermus thermophilus hb8 | 0.8762 | 4 | 329 |
| 1wl4-assembly1.cif.gz_A | human cytosolic acetoacetyl-coa thiolase complexed with coa | 0.8755 | 2 | 330 |
| 6pca-assembly1.cif.gz_C | crystal structure of beta-ketoadipyl-coa thiolase | 0.8712 | 1 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53871_287_399_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9692 | 254 | 329 | 3.40.47.10 |
| 6bjaA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9634 | 113 | 326 | 3.40.47.10 |
| 1pxtB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.96 | 244 | 326 | 3.40.47.10 |
| af_A0A096MJY8_281_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9595 | 240 | 330 | 3.40.47.10 |
| af_P76461_265_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9583 | 228 | 329 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534L8W4-F1-model_v4 | Thiolase family protein | 0.9732 | 120 | 332 |
GO:0016747
|
| AF-A0A7Y2K5I8-F1-model_v4 | Thiolase family protein | 0.9629 | 129 | 329 |
GO:0003985
GO:0006635 |
| AF-A0A1G7P6Q0-F1-model_v4 | acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (Acetoacetyl-CoA thiolase) | 0.9595 | 115 | 318 |
GO:0016747
|
| AF-A0A847N7V7-F1-model_v4 | Thiolase family protein | 0.959 | 112 | 327 |
GO:0016747
|
| AF-A0A842QYT3-F1-model_v4 | Acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9561 | 114 | 329 |
GO:0016747
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar