F478223

General Info

Members Datasets Scaffolds Average Seq Length
735 296 1470 217

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0093253|Ga0495643_0093253_125_808
Length 227
Sequence VSETKPDETRPADAGPVTVVLVDDHAMFRTGVRAELAQAPSVDVVGEAADTAEAVAVVLRTKPEVVLLDVHLPGGGGGEVIRQVHPKEPGVRFLALSVSDAAEDVIGTIRAGARGYVTKSITGDDLVSAIGRVADGDAVFSPRLAGFVLDAFAGTEAPSVDDDLDRLTQREREVLRLIARGYAYKEIAKELFISVKTVETHVSAVLRKLQLSNRYELTRWATDRRLV

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
281 2643221561 Nocardioides sp. Root151 Isolate Unclassified
282 2643221696 Nocardioides sp. Root140 Isolate Unclassified
283 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
284 2739367898 Nocardioides sp. CF479 Isolate Unclassified
285 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
286 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
287 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
288 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
289 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
290 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
291 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
292 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
293 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
294 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
295 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
296 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0.95
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 8.71
Nodule 0.14
Rhizoplane 10.34
Rhizosphere 77.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0093253 3300046522 Bacteria 1551
2 JGI24738J21930_10010742 3300002075 Bacteria 2030
3 JGI24744J21845_10008086 3300002077 Bacteria 2172
4 Ga0070658_10474628 3300005327 Bacteria 1079
5 Ga0070683_100009817 3300005329 Bacteria 8201
6 Ga0070683_100023908 3300005329 Bacteria 5470
7 Ga0070683_100036540 3300005329 Bacteria 4495
8 Ga0070683_100096868 3300005329 Bacteria 2775
9 Ga0070683_100136532 3300005329 Bacteria 2323
10 Ga0070683_100201360 3300005329 Bacteria 1890
11 Ga0070683_100376421 3300005329 Bacteria 1353
12 Ga0070670_100111300 3300005331 Bacteria 2359
13 Ga0068869_100176885 3300005334 Bacteria 1671
14 Ga0070680_100073191 3300005336 Bacteria 2817
15 Ga0070682_100002682 3300005337 Bacteria 9845
16 Ga0070682_100013692 3300005337 Bacteria 4674
17 Ga0070682_100069770 3300005337 Bacteria 2245
18 Ga0070682_100293176 3300005337 Bacteria 1191
19 Ga0070682_100398046 3300005337 Bacteria 1041
20 Ga0068868_100065622 3300005338 Bacteria 2884
21 Ga0068868_100184226 3300005338 Bacteria 1733
22 Ga0070660_100036084 3300005339 Bacteria 3744
23 Ga0070660_100048141 3300005339 Bacteria 3273
24 Ga0070660_100161448 3300005339 Bacteria 1806
25 Ga0070691_10026426 3300005341 Bacteria 2705
26 Ga0070661_100092126 3300005344 Bacteria 2245
27 Ga0070692_10005693 3300005345 Bacteria 5346
28 Ga0070692_10025132 3300005345 Bacteria 2934
29 Ga0070692_10097940 3300005345 Bacteria 1604
30 Ga0070675_100147591 3300005354 Bacteria 2015
31 Ga0070675_100263189 3300005354 Bacteria 1512
32 Ga0070671_100045236 3300005355 Bacteria 3659
33 Ga0070673_100029253 3300005364 Bacteria 4107
34 Ga0070659_100089414 3300005366 Bacteria 2467
35 Ga0070659_100093200 3300005366 Bacteria 2417
36 Ga0070659_100166232 3300005366 Bacteria 1805
37 Ga0070659_100200249 3300005366 Bacteria 1644
38 Ga0070659_100338641 3300005366 Bacteria 1260
39 Ga0070659_100438344 3300005366 Bacteria 1106
40 Ga0070667_100007583 3300005367 Bacteria 8999
41 Ga0070667_100065010 3300005367 Bacteria 3097
42 Ga0070667_100405868 3300005367 Bacteria 1241
43 Ga0070714_100001446 3300005435 Bacteria 17298
44 Ga0070701_10122806 3300005438 Bacteria 1466
45 Ga0070701_10185773 3300005438 Bacteria 1220
46 Ga0070700_100034575 3300005441 Bacteria 3053
47 Ga0070700_100137214 3300005441 Bacteria 1658
48 Ga0070663_100019332 3300005455 Bacteria 4486
49 Ga0070663_100049350 3300005455 Bacteria 2988
50 Ga0070663_100575854 3300005455 Bacteria 944
51 Ga0070678_100155551 3300005456 Bacteria 1846
52 Ga0070678_100341965 3300005456 Bacteria 1284
53 Ga0070662_100164417 3300005457 Bacteria 1738
54 Ga0070681_10114956 3300005458 Bacteria 2629
55 Ga0070681_10260928 3300005458 Bacteria 1645
56 Ga0070681_10656618 3300005458 Bacteria 964
57 Ga0068867_100074370 3300005459 Bacteria 2547
58 Ga0070685_10064620 3300005466 Bacteria 2152
59 Ga0070698_100000363 3300005471 Bacteria 46987
60 Ga0070679_100112171 3300005530 Bacteria 2713
61 Ga0070679_100160437 3300005530 Bacteria 2223
62 Ga0070679_100436345 3300005530 Bacteria 1255
63 Ga0070679_100987741 3300005530 Bacteria 786
64 Ga0070684_100028263 3300005535 Bacteria 4743
65 Ga0070684_100178752 3300005535 Bacteria 1929
66 Ga0068853_100022084 3300005539 Bacteria 5310
67 Ga0070672_100019305 3300005543 Bacteria 4945
68 Ga0070686_100055918 3300005544 Bacteria 2530
69 Ga0070693_100018875 3300005547 Bacteria 3608
70 Ga0070665_100000450 3300005548 Bacteria 59867
71 Ga0070665_100212342 3300005548 Bacteria 1936
72 Ga0070665_100366668 3300005548 Bacteria 1447
73 Ga0070704_100584115 3300005549 Bacteria 980
74 Ga0068855_100113651 3300005563 Bacteria 3106
75 Ga0068855_100206224 3300005563 Bacteria 2211
76 Ga0068855_100233922 3300005563 Bacteria 2056
77 Ga0068855_100276624 3300005563 Bacteria 1866
78 Ga0070664_100158709 3300005564 Bacteria 2000
79 Ga0070664_100176753 3300005564 Bacteria 1896
80 Ga0070664_100529217 3300005564 Bacteria 1089
81 Ga0068857_100009886 3300005577 Bacteria 8283
82 Ga0068857_100537716 3300005577 Bacteria 1100
83 Ga0068854_100084599 3300005578 Bacteria 2347
84 Ga0068854_100206351 3300005578 Bacteria 1548
85 Ga0068856_100028796 3300005614 Bacteria 5427
86 Ga0068856_100841420 3300005614 Bacteria 937
87 Ga0068856_101246478 3300005614 Bacteria 759
88 Ga0070702_100011043 3300005615 Bacteria 4481
89 Ga0068852_100050155 3300005616 Bacteria 3574
90 Ga0068852_101138780 3300005616 Bacteria 801
91 Ga0068859_100054057 3300005617 Bacteria 4039
92 Ga0068864_100111739 3300005618 Bacteria 2435
93 Ga0068861_100561646 3300005719 Bacteria 1042
94 Ga0068870_10003307 3300005840 Bacteria 6812
95 Ga0068870_10011892 3300005840 Bacteria 4050
96 Ga0068870_10239403 3300005840 Bacteria 1120
97 Ga0068863_100076596 3300005841 Bacteria 3164
98 Ga0068858_100077027 3300005842 Bacteria 3097
99 Ga0068858_100120615 3300005842 Bacteria 2452
100 Ga0068860_100000304 3300005843 Bacteria 68193
101 Ga0068860_100100284 3300005843 Bacteria 2762
102 Ga0081540_1050807 3300005983 Bacteria 2055
103 Ga0081539_10036418 3300005985 Bacteria 2945
104 Ga0075365_10025922 3300006038 Bacteria 3715
105 Ga0075365_10027382 3300006038 Bacteria 3627
106 Ga0075365_10043487 3300006038 Bacteria 2941
107 Ga0075365_10063640 3300006038 Bacteria 2470
108 Ga0075365_10192855 3300006038 Bacteria 1426
109 Ga0075365_10215429 3300006038 Bacteria 1346
110 Ga0075365_10262099 3300006038 Bacteria 1215
111 Ga0075365_10275209 3300006038 Bacteria 1184
112 Ga0075368_10003543 3300006042 Bacteria 5228
113 Ga0075368_10018608 3300006042 Bacteria 2611
114 Ga0075368_10019857 3300006042 Bacteria 2539
115 Ga0075368_10280626 3300006042 Bacteria 716
116 Ga0075363_100002765 3300006048 Bacteria 7273
117 Ga0075363_100007893 3300006048 Bacteria 4928
118 Ga0075363_100011133 3300006048 Bacteria 4299
119 Ga0075363_100099949 3300006048 Bacteria 1604
120 Ga0075364_10009391 3300006051 Bacteria 5865
121 Ga0075364_10034188 3300006051 Bacteria 3278
122 Ga0075364_10039261 3300006051 Bacteria 3068
123 Ga0075364_10039542 3300006051 Bacteria 3058
124 Ga0075364_10065390 3300006051 Bacteria 2387
125 Ga0075364_10066532 3300006051 Bacteria 2367
126 Ga0075364_10089036 3300006051 Bacteria 2047
127 Ga0075364_10142496 3300006051 Bacteria 1613
128 Ga0075364_10477882 3300006051 Bacteria 852
129 Ga0070712_100568552 3300006175 Bacteria 957
130 Ga0075362_10058501 3300006177 Bacteria 1738
131 Ga0075362_10059421 3300006177 Bacteria 1726
132 Ga0075367_10009420 3300006178 Bacteria 5105
133 Ga0075367_10030512 3300006178 Bacteria 3091
134 Ga0097621_101045862 3300006237 Bacteria 765
135 Ga0075370_10006935 3300006353 Bacteria 5739
136 Ga0075370_10015383 3300006353 Bacteria 4096
137 Ga0075370_10015524 3300006353 Bacteria 4079
138 Ga0068871_100072529 3300006358 Bacteria 2836
139 Ga0068871_100084567 3300006358 Bacteria 2633
140 Ga0075428_100965489 3300006844 Bacteria 903
141 Ga0075431_100111265 3300006847 Bacteria 2826
142 Ga0075434_100067274 3300006871 Bacteria 3569
143 Ga0068865_100003722 3300006881 Bacteria 9154
144 Ga0068865_100464631 3300006881 Bacteria 1049
145 Ga0068865_100856564 3300006881 Bacteria 788
146 Ga0075436_100066751 3300006914 Bacteria 2487
147 Ga0097620_100054056 3300006931 Bacteria 4039
148 Ga0075435_100037138 3300007076 Bacteria 3877
149 Ga0105251_10110283 3300009011 Bacteria 1254
150 Ga0105240_10010898 3300009093 Bacteria 12736
151 Ga0105240_10103159 3300009093 Bacteria 3466
152 Ga0105240_10698213 3300009093 Bacteria 1108
153 Ga0111539_10057392 3300009094 Bacteria 4624
154 Ga0111539_10167102 3300009094 Bacteria 2571
155 Ga0111539_10637774 3300009094 Bacteria 1240
156 Ga0105245_10000359 3300009098 Bacteria 42584
157 Ga0105245_10119505 3300009098 Bacteria 2460
158 Ga0105245_10623655 3300009098 Bacteria 1107
159 Ga0105245_10953672 3300009098 Bacteria 901
160 Ga0105247_10046783 3300009101 Bacteria 2656
161 Ga0114129_10076786 3300009147 Bacteria 4649
162 Ga0105243_10020111 3300009148 Bacteria 5061
163 Ga0105243_10097702 3300009148 Bacteria 2431
164 Ga0105243_10439882 3300009148 Bacteria 1221
165 Ga0105241_10034837 3300009174 Bacteria 3785
166 Ga0105248_10061101 3300009177 Bacteria 4230
167 Ga0105248_10212297 3300009177 Bacteria 2181
168 Ga0105248_10227251 3300009177 Bacteria 2101
169 Ga0105237_10015753 3300009545 Bacteria 7862
170 Ga0105237_10074076 3300009545 Bacteria 3396
171 Ga0105237_10193530 3300009545 Bacteria 2033
172 Ga0105237_10645230 3300009545 Bacteria 1065
173 Ga0105237_11041106 3300009545 Bacteria 825
174 Ga0105238_10104253 3300009551 Bacteria 2817
175 Ga0105238_10217634 3300009551 Bacteria 1886
176 Ga0105249_10362547 3300009553 Bacteria 1471
177 Ga0105249_10482721 3300009553 Bacteria 1282
178 Ga0105249_10759378 3300009553 Bacteria 1032
179 Ga0105249_11689487 3300009553 Bacteria 706
180 Ga0105029_103857 3300009984 Bacteria 1017
181 Ga0105239_10012602 3300010375 Bacteria 9408
182 Ga0105239_10012785 3300010375 Bacteria 9339
183 Ga0105239_10026655 3300010375 Bacteria 6361
184 Ga0105239_10174678 3300010375 Bacteria 2403
185 Ga0105239_10728758 3300010375 Bacteria 1134
186 Ga0105246_10003745 3300011119 Bacteria 9219
187 Ga0157316_1017087 3300012510 Bacteria 753
188 Ga0157373_10085704 3300013100 Bacteria 2220
189 Ga0157371_10079734 3300013102 Bacteria 2319
190 Ga0157371_10121099 3300013102 Bacteria 1860
191 Ga0157370_10063407 3300013104 Bacteria 3502
192 Ga0157370_10282298 3300013104 Bacteria 1534
193 Ga0157370_10332198 3300013104 Bacteria 1401
194 Ga0157369_10339687 3300013105 Bacteria 1560
195 Ga0157369_10661706 3300013105 Bacteria 1077
196 Ga0157374_10065627 3300013296 Bacteria 3409
197 Ga0157378_10339060 3300013297 Bacteria 1465
198 Ga0163162_10002746 3300013306 Bacteria 16703
199 Ga0157372_10035893 3300013307 Bacteria 5460
200 Ga0157372_10101197 3300013307 Bacteria 3289
201 Ga0157372_10166981 3300013307 Bacteria 2545
202 Ga0157372_10205672 3300013307 Bacteria 2281
203 Ga0157372_10752040 3300013307 Bacteria 1133
204 Ga0157375_10008143 3300013308 Bacteria 9170
205 Ga0157375_10154397 3300013308 Bacteria 2433
206 Ga0157375_10500986 3300013308 Bacteria 1379
207 Ga0157380_10051037 3300014326 Bacteria 3269
208 Ga0157380_10257426 3300014326 Bacteria 1583
209 Ga0157380_10882182 3300014326 Bacteria 919
210 Ga0157380_11590112 3300014326 Bacteria 709
211 Ga0157377_10087620 3300014745 Bacteria 1832
212 Ga0157377_10515834 3300014745 Bacteria 838
213 Ga0157379_10039351 3300014968 Bacteria 4218
214 Ga0157376_10349216 3300014969 Bacteria 1415
215 Ga0163161_10009496 3300017792 Bacteria 6731
216 Ga0163161_10171846 3300017792 Bacteria 1657
217 Ga0163161_10531334 3300017792 Bacteria 962
218 Ga0206356_10664571 3300020070 Bacteria 1562
219 Ga0206354_10301906 3300020081 Bacteria 1062
220 Ga0206354_10855475 3300020081 Bacteria 1286
221 Ga0206353_10122393 3300020082 Bacteria 4372
222 Ga0206353_11030654 3300020082 Bacteria 1223
223 Ga0206353_11521123 3300020082 Bacteria 8188
224 Ga0206353_11743485 3300020082 Bacteria 1224
225 Ga0213876_10081593 3300021384 Bacteria 1710
226 Ga0213875_10049861 3300021388 Bacteria 1962
227 Ga0207697_10027155 3300025315 Bacteria 2341
228 Ga0207656_10055751 3300025321 Bacteria 1721
229 Ga0207692_10085843 3300025898 Bacteria 1694
230 Ga0207710_10081738 3300025900 Bacteria 1500
231 Ga0207688_10015206 3300025901 Bacteria 4175
232 Ga0207688_10015922 3300025901 Bacteria 4077
233 Ga0207688_10123391 3300025901 Bacteria 1513
234 Ga0207688_10197705 3300025901 Bacteria 1204
235 Ga0207647_10041476 3300025904 Bacteria 2893
236 Ga0207647_10063353 3300025904 Bacteria 2249
237 Ga0207647_10067410 3300025904 Bacteria 2169
238 Ga0207647_10100243 3300025904 Bacteria 1719
239 Ga0207647_10202195 3300025904 Bacteria 1149
240 Ga0207645_10018549 3300025907 Bacteria 4575
241 Ga0207643_10000100 3300025908 Bacteria 58884
242 Ga0207643_10003328 3300025908 Bacteria 8661
243 Ga0207705_10048003 3300025909 Bacteria 3071
244 Ga0207705_10048274 3300025909 Bacteria 3061
245 Ga0207654_10184265 3300025911 Bacteria 1364
246 Ga0207707_10120932 3300025912 Bacteria 2289
247 Ga0207707_10261355 3300025912 Bacteria 1502
248 Ga0207707_10278319 3300025912 Bacteria 1450
249 Ga0207695_10025646 3300025913 Bacteria 6593
250 Ga0207695_10206410 3300025913 Bacteria 1877
251 Ga0207695_10341210 3300025913 Bacteria 1386
252 Ga0207671_10025439 3300025914 Bacteria 4446
253 Ga0207671_10122276 3300025914 Bacteria 1990
254 Ga0207671_10128858 3300025914 Bacteria 1940
255 Ga0207660_10653575 3300025917 Bacteria 857
256 Ga0207662_10005149 3300025918 Bacteria 6938
257 Ga0207662_10039986 3300025918 Bacteria 2754
258 Ga0207662_10144930 3300025918 Bacteria 1507
259 Ga0207662_10332443 3300025918 Bacteria 1017
260 Ga0207657_10010726 3300025919 Bacteria 9124
261 Ga0207657_10060396 3300025919 Bacteria 3253
262 Ga0207657_10074462 3300025919 Bacteria 2867
263 Ga0207649_10058045 3300025920 Bacteria 2422
264 Ga0207652_10313789 3300025921 Bacteria 1415
265 Ga0207694_10089127 3300025924 Bacteria 2433
266 Ga0207650_10282776 3300025925 Bacteria 1351
267 Ga0207659_10100631 3300025926 Bacteria 2178
268 Ga0207659_10293625 3300025926 Bacteria 1333
269 Ga0207687_10002966 3300025927 Bacteria 11494
270 Ga0207687_10058267 3300025927 Bacteria 2717
271 Ga0207687_10063166 3300025927 Bacteria 2621
272 Ga0207687_10398679 3300025927 Bacteria 1131
273 Ga0207687_10754813 3300025927 Bacteria 828
274 Ga0207664_10298077 3300025929 Bacteria 1418
275 Ga0207690_10010372 3300025932 Bacteria 5534
276 Ga0207690_10014869 3300025932 Bacteria 4710
277 Ga0207690_10047931 3300025932 Bacteria 2837
278 Ga0207690_10071359 3300025932 Bacteria 2395
279 Ga0207706_10272717 3300025933 Bacteria 1476
280 Ga0207686_10033772 3300025934 Bacteria 3056
281 Ga0207709_10670833 3300025935 Bacteria 827
282 Ga0207669_10040905 3300025937 Bacteria 2693
283 Ga0207669_10448619 3300025937 Bacteria 1022
284 Ga0207704_10066534 3300025938 Bacteria 2262
285 Ga0207704_10348033 3300025938 Bacteria 1153
286 Ga0207691_10009704 3300025940 Bacteria 9236
287 Ga0207691_10016940 3300025940 Bacteria 6915
288 Ga0207711_10057824 3300025941 Bacteria 3334
289 Ga0207689_10045864 3300025942 Bacteria 3614
290 Ga0207689_10117355 3300025942 Bacteria 2188
291 Ga0207689_10332680 3300025942 Bacteria 1261
292 Ga0207661_10012431 3300025944 Bacteria 6187
293 Ga0207661_10031047 3300025944 Bacteria 4122
294 Ga0207661_10035436 3300025944 Bacteria 3889
295 Ga0207661_10041082 3300025944 Bacteria 3639
296 Ga0207661_10044358 3300025944 Bacteria 3514
297 Ga0207661_10064962 3300025944 Bacteria 2960
298 Ga0207661_10097305 3300025944 Bacteria 2464
299 Ga0207661_10140032 3300025944 Bacteria 2081
300 Ga0207661_10738946 3300025944 Bacteria 905
301 Ga0207661_10892336 3300025944 Bacteria 819
302 Ga0207679_10081212 3300025945 Bacteria 2478
303 Ga0207679_10094241 3300025945 Bacteria 2324
304 Ga0207679_10171342 3300025945 Bacteria 1787
305 Ga0207679_10270967 3300025945 Bacteria 1452
306 Ga0207679_10777112 3300025945 Bacteria 872
307 Ga0207667_10155460 3300025949 Bacteria 2353
308 Ga0207667_10249536 3300025949 Bacteria 1815
309 Ga0207667_10304779 3300025949 Bacteria 1627
310 Ga0207667_10945749 3300025949 Bacteria 851
311 Ga0207651_10023558 3300025960 Bacteria 3791
312 Ga0207651_10051552 3300025960 Bacteria 2801
313 Ga0207712_10275685 3300025961 Bacteria 1370
314 Ga0207640_10077392 3300025981 Bacteria 2261
315 Ga0207658_10009016 3300025986 Bacteria 6766
316 Ga0207658_10028588 3300025986 Bacteria 3927
317 Ga0207658_10365979 3300025986 Bacteria 1259
318 Ga0207658_10385369 3300025986 Bacteria 1229
319 Ga0207677_10714709 3300026023 Bacteria 890
320 Ga0207677_10764601 3300026023 Bacteria 862
321 Ga0207703_10106370 3300026035 Bacteria 2386
322 Ga0207639_10392818 3300026041 Bacteria 1248
323 Ga0207678_10002842 3300026067 Bacteria 15701
324 Ga0207678_10068635 3300026067 Bacteria 3041
325 Ga0207708_10000786 3300026075 Bacteria 23943
326 Ga0207708_10052761 3300026075 Bacteria 3097
327 Ga0207702_10103325 3300026078 Bacteria 2520
328 Ga0207702_10639022 3300026078 Bacteria 1046
329 Ga0207702_11341243 3300026078 Bacteria 709
330 Ga0207641_10222852 3300026088 Bacteria 1749
331 Ga0207641_10557923 3300026088 Bacteria 1118
332 Ga0207648_10123460 3300026089 Bacteria 2277
333 Ga0207648_10462872 3300026089 Bacteria 1156
334 Ga0207676_10067002 3300026095 Bacteria 2866
335 Ga0207674_10038543 3300026116 Bacteria 4957
336 Ga0207674_10260536 3300026116 Bacteria 1681
337 Ga0207674_10282679 3300026116 Bacteria 1607
338 Ga0207674_10862854 3300026116 Bacteria 873
339 Ga0207675_100197651 3300026118 Bacteria 1931
340 Ga0207675_100917568 3300026118 Bacteria 892
341 Ga0207683_10000565 3300026121 Bacteria 34282
342 Ga0207683_10094315 3300026121 Bacteria 2667
343 Ga0207683_10172921 3300026121 Bacteria 1957
344 Ga0207698_10054593 3300026142 Bacteria 3074
345 Ga0207698_10058156 3300026142 Bacteria 2995
346 Ga0207698_10182676 3300026142 Bacteria 1860
347 Ga0207698_10222333 3300026142 Bacteria 1707
348 Ga0207428_10053593 3300027907 Bacteria 3216
349 Ga0268266_10004579 3300028379 Bacteria 13206
350 Ga0268266_10058281 3300028379 Bacteria 3325
351 Ga0268266_10276895 3300028379 Bacteria 1559
352 Ga0268266_10885167 3300028379 Bacteria 863
353 Ga0268264_10038630 3300028381 Bacteria 3940
354 Ga0268264_10300168 3300028381 Bacteria 1512
355 Ga0314311_1124506 3300030733 Bacteria 991
356 Ga0307408_100393487 3300031548 Bacteria 1188
357 Ga0307408_100503294 3300031548 Bacteria 1061
358 Ga0307405_10096666 3300031731 Bacteria 1970
359 Ga0307405_10379074 3300031731 Bacteria 1100
360 Ga0307413_10040012 3300031824 Bacteria 2732
361 Ga0307413_10295835 3300031824 Bacteria 1225
362 Ga0307413_10408564 3300031824 Bacteria 1066
363 Ga0307410_10039162 3300031852 Bacteria 3110
364 Ga0307410_10299767 3300031852 Bacteria 1268
365 Ga0307410_10308953 3300031852 Bacteria 1250
366 Ga0307410_10481075 3300031852 Bacteria 1018
367 Ga0307410_10525675 3300031852 Bacteria 977
368 Ga0307406_10094187 3300031901 Bacteria 2024
369 Ga0307406_10100755 3300031901 Bacteria 1967
370 Ga0307407_10098732 3300031903 Bacteria 1807
371 Ga0307407_10466002 3300031903 Bacteria 920
372 Ga0307412_10206428 3300031911 Bacteria 1496
373 Ga0307412_10343032 3300031911 Bacteria 1196
374 Ga0307409_100071034 3300031995 Bacteria 2766
375 Ga0307409_100128509 3300031995 Bacteria 2160
376 Ga0307409_100257482 3300031995 Bacteria 1599
377 Ga0307409_100339704 3300031995 Bacteria 1412
378 Ga0307409_101194215 3300031995 Bacteria 784
379 Ga0307416_100030850 3300032002 Bacteria 4028
380 Ga0307416_100170926 3300032002 Bacteria 2023
381 Ga0307416_100302006 3300032002 Bacteria 1592
382 Ga0307416_100418949 3300032002 Bacteria 1382
383 Ga0307416_100833295 3300032002 Bacteria 1020
384 Ga0307416_101377175 3300032002 Bacteria 811
385 Ga0307414_10571288 3300032004 Bacteria 1010
386 Ga0307411_10086488 3300032005 Bacteria 2175
387 Ga0307415_100030331 3300032126 Bacteria 3469
388 Ga0307415_100031405 3300032126 Bacteria 3421
389 Ga0307415_100213819 3300032126 Bacteria 1540
390 Ga0316574_0352021 3300035398 Bacteria 932
391 Ga0373947_0695791 3300035725 Bacteria 693
392 Ga0395898_0172914 3300037466 Bacteria 2065
393 Ga0395905_0021832 3300037471 Bacteria 6055
394 Ga0395905_0405804 3300037471 Bacteria 1258
395 Ga0436364_1506248 3300037853 Bacteria 3015
396 Ga0395901_0084177 3300038443 Bacteria 3324
397 Ga0395901_0320662 3300038443 Bacteria 1603
398 Ga0395901_0808815 3300038443 Bacteria 926
399 Ga0436365_0005613 3300039437 Bacteria 2285
400 Ga0439438_020715 3300041405 Bacteria 1843
401 Ga0451853_0740919 3300041512 Bacteria 1524
402 Ga0451853_0786083 3300041512 Bacteria 972
403 Ga0451853_4119957 3300041512 Bacteria 2352
404 Ga0439445_0038825 3300042004 Bacteria 1260
405 Ga0439448_0011570 3300042005 Bacteria 2631
406 Ga0450914_007739 3300042118 Bacteria 978
407 Ga0439458_0009932 3300042157 Bacteria 2119
408 Ga0439434_0003200 3300042435 Bacteria 4809
409 Ga0466972_0009367 3300044658 Bacteria 4923
410 Ga0466972_0062815 3300044658 Bacteria 1779
411 Ga0466972_0064381 3300044658 Bacteria 1755
412 Ga0466972_0093198 3300044658 Bacteria 1428
413 Ga0466965_0005158 3300044683 Bacteria 5864
414 Ga0466965_0016158 3300044683 Bacteria 3548
415 Ga0466965_0045897 3300044683 Bacteria 2162
416 Ga0466965_0374484 3300044683 Bacteria 783
417 Ga0466966_0008820 3300044684 Bacteria 6676
418 Ga0466966_0009895 3300044684 Bacteria 6320
419 Ga0466966_0016377 3300044684 Bacteria 4899
420 Ga0466966_0019540 3300044684 Bacteria 4457
421 Ga0466966_0027302 3300044684 Bacteria 3723
422 Ga0466966_0082754 3300044684 Bacteria 1997
423 Ga0466966_0121636 3300044684 Bacteria 1603
424 Ga0466966_0466367 3300044684 Bacteria 759
425 Ga0466961_0005682 3300044693 Bacteria 7887
426 Ga0466961_0012524 3300044693 Bacteria 5427
427 Ga0466961_0030207 3300044693 Bacteria 3483
428 Ga0466961_0078603 3300044693 Bacteria 2089
429 Ga0466961_0080179 3300044693 Bacteria 2066
430 Ga0466961_0108550 3300044693 Bacteria 1747
431 Ga0466961_0268145 3300044693 Bacteria 1046
432 Ga0466961_0378045 3300044693 Bacteria 860
433 Ga0466961_0424427 3300044693 Bacteria 806
434 Ga0466963_0010373 3300044694 Bacteria 5639
435 Ga0466963_0021922 3300044694 Bacteria 4038
436 Ga0466963_0105852 3300044694 Bacteria 1928
437 Ga0466963_0201424 3300044694 Bacteria 1392
438 Ga0466963_0239434 3300044694 Bacteria 1272
439 Ga0466964_0005603 3300044706 Bacteria 4666
440 Ga0466964_0043570 3300044706 Bacteria 1821
441 Ga0466964_0219482 3300044706 Bacteria 922
442 Ga0466971_0019657 3300044719 Bacteria 3001
443 Ga0466971_0139750 3300044719 Bacteria 1127
444 Ga0466968_0020207 3300044735 Bacteria 2686
445 Ga0466968_0082192 3300044735 Bacteria 1417
446 Ga0466970_0007594 3300044765 Bacteria 5435
447 Ga0466970_0009506 3300044765 Bacteria 4916
448 Ga0466970_0027086 3300044765 Bacteria 3006
449 Ga0466970_0039692 3300044765 Bacteria 2499
450 Ga0466970_0048016 3300044765 Bacteria 2276
451 Ga0466970_0054941 3300044765 Bacteria 2126
452 Ga0466970_0191582 3300044765 Bacteria 1136
453 Ga0466970_0324227 3300044765 Bacteria 871
454 Ga0466957_0016712 3300044842 Bacteria 4292
455 Ga0466957_0025147 3300044842 Bacteria 3528
456 Ga0466957_0063950 3300044842 Bacteria 2263
457 Ga0466957_0066993 3300044842 Bacteria 2215
458 Ga0466957_0067043 3300044842 Bacteria 2214
459 Ga0466960_0000389 3300044901 Bacteria 15045
460 Ga0466960_0027309 3300044901 Bacteria 2602
461 Ga0466960_0028802 3300044901 Bacteria 2544
462 Ga0466960_0055071 3300044901 Bacteria 1933
463 Ga0466960_0075534 3300044901 Bacteria 1686
464 Ga0466960_0337797 3300044901 Bacteria 856
465 Ga0466959_0009269 3300045049 Bacteria 6995
466 Ga0466959_0010923 3300045049 Bacteria 6511
467 Ga0466959_0033462 3300045049 Bacteria 3801
468 Ga0466959_0052515 3300045049 Bacteria 2984
469 Ga0466959_0167677 3300045049 Bacteria 1541
470 Ga0466959_0286977 3300045049 Bacteria 1129
471 Ga0466959_0288228 3300045049 Bacteria 1126
472 Ga0466959_0324629 3300045049 Bacteria 1052
473 Ga0466959_0469566 3300045049 Bacteria 852
474 Ga0466958_0025759 3300045836 Bacteria 3470
475 Ga0466958_0097642 3300045836 Bacteria 1823
476 Ga0466958_0101486 3300045836 Bacteria 1789
477 Ga0466958_0107958 3300045836 Bacteria 1736
478 Ga0466958_0346969 3300045836 Bacteria 955
479 Ga0466967_0000727 3300045976 Bacteria 16858
480 Ga0466967_0006336 3300045976 Bacteria 8357
481 Ga0466967_0006597 3300045976 Bacteria 8243
482 Ga0466967_0026519 3300045976 Bacteria 4801
483 Ga0466967_0048979 3300045976 Bacteria 3693
484 Ga0466967_0082642 3300045976 Bacteria 2903
485 Ga0466967_0115486 3300045976 Bacteria 2472
486 Ga0466967_0152013 3300045976 Bacteria 2164
487 Ga0466967_0182440 3300045976 Bacteria 1980
488 Ga0466967_0219638 3300045976 Bacteria 1805
489 Ga0466967_0276146 3300045976 Bacteria 1611
490 Ga0466967_0385555 3300045976 Bacteria 1361
491 Ga0466967_0434117 3300045976 Bacteria 1282
492 Ga0466967_0671600 3300045976 Bacteria 1025
493 Ga0466967_1169824 3300045976 Bacteria 766
494 Ga0495603_0118031 3300046455 Bacteria 1547
495 Ga0495582_0515591 3300046473 Bacteria 691
496 Ga0495639_0181426 3300046475 Bacteria 1025
497 Ga0495664_0018905 3300046477 Bacteria 3955
498 Ga0495648_0021804 3300046524 Bacteria 4427
499 Ga0495645_0278894 3300046543 Bacteria 1100
500 Ga0495635_0348638 3300046663 Bacteria 988
501 Ga0495635_0492966 3300046663 Bacteria 807
502 Ga0495657_0107759 3300046675 Bacteria 1768
503 Ga0495658_0514730 3300046683 Bacteria 766
504 Ga0495680_0106793 3300047322 Bacteria 2080
505 Ga0496100_0082924 3300048903 Bacteria 2169
506 Ga0496100_0215927 3300048903 Bacteria 1405
507 Ga0496100_0335432 3300048903 Bacteria 1139
508 Ga0496102_0008533 3300048905 Bacteria 8785
509 Ga0496102_0062971 3300048905 Bacteria 3396
510 Ga0496102_0149808 3300048905 Bacteria 2191
511 Ga0496102_0399641 3300048905 Bacteria 1292
512 Ga0496102_0506586 3300048905 Bacteria 1129
513 Ga0496102_0589081 3300048905 Bacteria 1035
514 Ga0496102_0626871 3300048905 Bacteria 998
515 Ga0496103_0070358 3300048906 Bacteria 2189
516 Ga0496103_0417721 3300048906 Bacteria 861
517 Ga0496104_0004891 3300048907 Bacteria 11682
518 Ga0496104_0061498 3300048907 Bacteria 3560
519 Ga0496104_0064806 3300048907 Bacteria 3466
520 Ga0496104_0280978 3300048907 Bacteria 1578
521 Ga0496104_0391999 3300048907 Bacteria 1301
522 Ga0496105_0016582 3300048908 Bacteria 5882
523 Ga0496105_0031900 3300048908 Bacteria 4321
524 Ga0496105_0149894 3300048908 Bacteria 1917
525 Ga0496106_0063822 3300048909 Bacteria 2800
526 Ga0496106_0073228 3300048909 Bacteria 2620
527 Ga0496106_0140054 3300048909 Bacteria 1902
528 Ga0496106_0171225 3300048909 Bacteria 1721
529 Ga0496106_0303692 3300048909 Bacteria 1280
530 Ga0496107_0010995 3300048910 Bacteria 6296
531 Ga0496107_0056858 3300048910 Bacteria 2827
532 Ga0496107_0132739 3300048910 Bacteria 1839
533 Ga0496107_0216495 3300048910 Bacteria 1424
534 Ga0496107_0518866 3300048910 Bacteria 883
535 Ga0496107_0610816 3300048910 Bacteria 805
536 Ga0496108_0034934 3300048911 Bacteria 4177
537 Ga0496108_0039949 3300048911 Bacteria 3910
538 Ga0496108_0049105 3300048911 Bacteria 3529
539 Ga0496108_0052559 3300048911 Bacteria 3415
540 Ga0496108_0129466 3300048911 Bacteria 2169
541 Ga0496109_0009876 3300048912 Bacteria 8148
542 Ga0496109_0047925 3300048912 Bacteria 3887
543 Ga0496109_0051661 3300048912 Bacteria 3744
544 Ga0496109_0052834 3300048912 Bacteria 3705
545 Ga0496109_0069632 3300048912 Bacteria 3227
546 Ga0496109_0113315 3300048912 Bacteria 2522
547 Ga0496109_0153136 3300048912 Bacteria 2159
548 Ga0496109_0349155 3300048912 Bacteria 1397
549 Ga0496109_0798912 3300048912 Bacteria 881
550 Ga0496110_0018218 3300048913 Bacteria 5885
551 Ga0496110_0118546 3300048913 Bacteria 2383
552 Ga0496110_0177292 3300048913 Bacteria 1935
553 Ga0496110_0404397 3300048913 Bacteria 1244
554 Ga0496111_0005153 3300048914 Bacteria 8333
555 Ga0496111_0027398 3300048914 Bacteria 4031
556 Ga0496111_0031104 3300048914 Bacteria 3800
557 Ga0496111_0088925 3300048914 Bacteria 2262
558 Ga0496111_0211399 3300048914 Bacteria 1441
559 Ga0496112_0468731 3300048915 Bacteria 1197
560 Ga0496113_0062276 3300048916 Bacteria 2817
561 Ga0496113_0077007 3300048916 Bacteria 2549
562 Ga0496113_0091951 3300048916 Bacteria 2339
563 Ga0496113_0168130 3300048916 Bacteria 1736
564 Ga0496113_0248578 3300048916 Bacteria 1420
565 Ga0496114_0018030 3300048917 Bacteria 5703
566 Ga0496114_0020867 3300048917 Bacteria 5320
567 Ga0496114_0023003 3300048917 Bacteria 5080
568 Ga0496114_0027407 3300048917 Bacteria 4666
569 Ga0496114_0029410 3300048917 Bacteria 4516
570 Ga0496114_0052772 3300048917 Bacteria 3387
571 Ga0496114_0148944 3300048917 Bacteria 2030
572 Ga0496114_0290411 3300048917 Bacteria 1443
573 Ga0496114_0291482 3300048917 Bacteria 1440
574 Ga0496114_0350137 3300048917 Bacteria 1306
575 Ga0496114_0376250 3300048917 Bacteria 1257
576 Ga0496114_0453728 3300048917 Bacteria 1135
577 Ga0496115_0001170 3300048918 Bacteria 18807
578 Ga0496115_0018278 3300048918 Bacteria 5379
579 Ga0496115_0264211 3300048918 Bacteria 1415
580 Ga0496115_0275362 3300048918 Bacteria 1382
581 Ga0496119_0000104 3300048922 Bacteria 121325
582 Ga0496120_0005467 3300048923 Bacteria 10127
583 Ga0501031_0015220 3300049568 Bacteria 4995
584 Ga0501031_0062971 3300049568 Bacteria 2417
585 Ga0501031_0392452 3300049568 Bacteria 898
586 Ga0501032_0075124 3300049569 Bacteria 2251
587 Ga0501033_0001922 3300049570 Bacteria 18091
588 Ga0501034_0018756 3300049571 Bacteria 7090
589 Ga0501034_0085044 3300049571 Bacteria 3165
590 Ga0501034_0180748 3300049571 Bacteria 2074
591 Ga0501036_0015244 3300049572 Bacteria 6418
592 Ga0501036_0132273 3300049572 Bacteria 2106
593 Ga0501036_0480201 3300049572 Bacteria 1035
594 Ga0501038_0005918 3300049574 Bacteria 11303
595 Ga0501038_0268816 3300049574 Bacteria 1345
596 Ga0501038_0562591 3300049574 Bacteria 866
597 Ga0501039_0040907 3300049575 Bacteria 3578
598 Ga0501039_0121897 3300049575 Bacteria 2044
599 Ga0501039_0138563 3300049575 Bacteria 1911
600 Ga0501039_0170345 3300049575 Bacteria 1712
601 Ga0501039_0212082 3300049575 Bacteria 1523
602 Ga0501039_0252390 3300049575 Bacteria 1387
603 Ga0501040_0079656 3300049576 Bacteria 2268
604 Ga0501040_0098835 3300049576 Bacteria 2034
605 Ga0501042_0018167 3300049578 Bacteria 4866
606 Ga0501042_0057247 3300049578 Bacteria 2782
607 Ga0501042_0095761 3300049578 Bacteria 2133
608 Ga0501043_0006006 3300049579 Bacteria 9764
609 Ga0501043_0045801 3300049579 Bacteria 3439
610 Ga0501043_0251777 3300049579 Bacteria 1360
611 Ga0501043_0484381 3300049579 Bacteria 926
612 Ga0501046_0000633 3300049580 Bacteria 34519
613 Ga0501046_0020040 3300049580 Bacteria 5537
614 Ga0501047_0234615 3300049581 Bacteria 1686
615 Ga0501047_0629933 3300049581 Bacteria 893
616 Ga0501048_0021335 3300049582 Bacteria 4741
617 Ga0501048_0063280 3300049582 Bacteria 2617
618 Ga0501048_0349230 3300049582 Bacteria 1055
619 Ga0501048_0375680 3300049582 Bacteria 1015
620 Ga0501048_0576193 3300049582 Bacteria 808
621 Ga0501067_0012114 3300049583 Bacteria 4781
622 Ga0501067_0117417 3300049583 Bacteria 1479
623 Ga0501068_0051744 3300049584 Bacteria 2485
624 Ga0501068_0141420 3300049584 Bacteria 1509
625 Ga0501069_0005208 3300049585 Bacteria 6761
626 Ga0501069_0043323 3300049585 Bacteria 2491
627 Ga0501069_0106759 3300049585 Bacteria 1592
628 Ga0501069_0265888 3300049585 Bacteria 1002
629 Ga0501070_0030673 3300049586 Bacteria 4504
630 Ga0501070_0046658 3300049586 Bacteria 3602
631 Ga0501070_0063609 3300049586 Bacteria 3056
632 Ga0501070_0074887 3300049586 Bacteria 2802
633 Ga0501070_0075161 3300049586 Bacteria 2796
634 Ga0501070_0248511 3300049586 Bacteria 1455
635 Ga0501070_0328614 3300049586 Bacteria 1243
636 Ga0501070_0339743 3300049586 Bacteria 1220
637 Ga0501070_0525340 3300049586 Bacteria 949
638 Ga0501070_0909123 3300049586 Bacteria 686
639 Ga0501071_0005496 3300049587 Bacteria 8154
640 Ga0501071_0030203 3300049587 Bacteria 3832
641 Ga0501071_0060675 3300049587 Bacteria 2738
642 Ga0501071_0265008 3300049587 Bacteria 1298
643 Ga0501071_0310804 3300049587 Bacteria 1196
644 Ga0501072_0011083 3300049588 Bacteria 6879
645 Ga0501073_0032743 3300049589 Bacteria 3705
646 Ga0501073_0113022 3300049589 Bacteria 1883
647 Ga0501073_0210246 3300049589 Bacteria 1344
648 Ga0501074_0073098 3300049590 Bacteria 2463
649 Ga0501074_0125153 3300049590 Bacteria 1838
650 Ga0501074_0293894 3300049590 Bacteria 1154
651 Ga0501074_0430433 3300049590 Bacteria 936
652 Ga0501075_0247680 3300049591 Bacteria 1358
653 Ga0501079_0076481 3300049741 Bacteria 2589
654 Ga0501079_0308937 3300049741 Bacteria 1237
655 Ga0501079_0398283 3300049741 Bacteria 1080
656 Ga0501080_0006057 3300049742 Bacteria 10841
657 Ga0501080_0070239 3300049742 Bacteria 3257
658 Ga0501080_0182781 3300049742 Bacteria 1929
659 Ga0501080_0335595 3300049742 Bacteria 1366
660 Ga0501081_0310541 3300049743 Bacteria 1158
661 Ga0501083_0252621 3300049744 Bacteria 1147
662 Ga0501083_0370333 3300049744 Bacteria 932
663 Ga0501044_0011939 3300049823 Bacteria 9414
664 Ga0501044_0187060 3300049823 Bacteria 2035
665 Ga0501045_0117317 3300049824 Bacteria 1976
666 Ga0501045_0449536 3300049824 Bacteria 958
667 nmdc:mga03683_179737_c1 3300050489 Bacteria 965
668 nmdc:mga03n38_1274_c1 3300050490 Bacteria 7089
669 nmdc:mga00v17_19640_c1 3300050491 Bacteria 3862
670 nmdc:mga00v17_243217_c1 3300050491 Bacteria 1167
671 nmdc:mga00v17_2605_c1 3300050491 Bacteria 9247
672 nmdc:mga00v17_393393_c1 3300050491 Bacteria 901
673 nmdc:mga00v17_60527_c1 3300050491 Bacteria 2326
674 nmdc:mga00v17_65549_c1 3300050491 Bacteria 1689
675 nmdc:mga0yw44_119577_c1 3300050492 Bacteria 1696
676 nmdc:mga0yw44_167598_c1 3300050492 Bacteria 1441
677 nmdc:mga0yw44_1903_c1 3300050492 Bacteria 8611
678 nmdc:mga0yw44_20892_c1 3300050492 Bacteria 3643
679 nmdc:mga0yw44_228022_c1 3300050492 Bacteria 1236
680 nmdc:mga0yw44_230278_c2 3300050492 Bacteria 768
681 nmdc:mga0yw44_29800_c1 3300050492 Bacteria 3155
682 nmdc:mga0yw44_417933_c1 3300050492 Bacteria 908
683 nmdc:mga0yw44_50103_c1 3300050492 Bacteria 2524
684 nmdc:mga0yw44_65071_c1 3300050492 Bacteria 2246
685 nmdc:mga06z11_13579_c1 3300050494 Bacteria 3582
686 nmdc:mga06z11_265827_c1 3300050494 Bacteria 1013
687 nmdc:mga06z11_371447_c1 3300050494 Bacteria 858
688 nmdc:mga06z11_523129_c1 3300050494 Bacteria 719
689 nmdc:mga06z11_70175_c1 3300050494 Bacteria 1852
690 nmdc:mga04h51_11830_c1 3300050495 Bacteria 2433
691 nmdc:mga04h51_39291_c1 3300050495 Bacteria 1537
692 nmdc:mga07m45_73681_c1 3300050496 Bacteria 1944
693 nmdc:mga07m45_85565_c1 3300050496 Bacteria 1803
694 nmdc:mga07m45_9631_c1 3300050496 Bacteria 5021
695 nmdc:mga05p37_220164_c1 3300050507 Bacteria 2291
696 nmdc:mga08y16_29745_c1 3300050511 Bacteria 5751
697 nmdc:mga08y16_496685_c1 3300050511 Bacteria 1240
698 nmdc:mga08x19_117537_c1 3300050514 Bacteria 1779
699 nmdc:mga0a205_83665_c1 3300050515 Bacteria 2035
700 Ga0495601_0317901 3300053077 Bacteria 1014
701 Ga0495595_0078290 3300053084 Bacteria 1572
702 Ga0495595_0112457 3300053084 Bacteria 1321
703 Ga0495619_0005036 3300053085 Bacteria 8391
704 Ga0495619_0415006 3300053085 Bacteria 929
705 Ga0500644_0000678 3300053088 Bacteria 12375
706 Ga0500573_0101552 3300053140 Bacteria 1618
707 Ga0500573_0173864 3300053140 Bacteria 1162
708 Ga0500620_041692 3300053155 Bacteria 1509
709 Ga0501084_0075926 3300054114 Bacteria 2816
710 Ga0501084_0253839 3300054114 Bacteria 1484
711 Ga0501084_0530923 3300054114 Bacteria 995
712 Ga0590075_109851 3300059424 Bacteria 720
713 Ga0590077_026068 3300059426 Bacteria 1262
714 Ga0501082_0009085 3300060353 Bacteria 8574
715 Ga0501082_0435360 3300060353 Bacteria 1145
716 Ga0501082_0863155 3300060353 Bacteria 792
717 Ga0466962_0139255 3300061719 Bacteria 1175
718 Ga0530510_0145546 3300061734 Bacteria 1748
719 2515856568 2515154155 Bacteria 7985436
720 2643824120 2643221561 Bacteria 4984412
721 2644533426 2643221696 Bacteria 5431823
722 2676473601 2675903058 Bacteria 6822861
723 2740167227 2739367898 Bacteria 4367674
724 2774394499 2773857762 Bacteria 5971770
725 2809194647 2808606439 Bacteria 5952208
726 2812349388 2811994878 Bacteria 5992952
727 2827632114 2827628540 Bacteria 6858585
728 2837269130 2837268691 Bacteria 7850704
729 2855391155 2855386786 Bacteria 4752232
730 2857485783 2857481737 Bacteria 4761446
731 2868092705 2868088558 Bacteria 7609351
732 2891972900 2891968417 Bacteria 5821697
733 2984579769 2984576629 Bacteria 4248407
734 2990257375 2990256926 Bacteria 4252839
735 8054613898 8054609563 Bacteria 5170090
736 Ga0495643_0093253
737 JGI24738J21930_10010742
738 JGI24744J21845_10008086
739 Ga0070658_10474628
740 Ga0070683_100009817
741 Ga0070683_100023908
742 Ga0070683_100036540
743 Ga0070683_100096868
744 Ga0070683_100136532
745 Ga0070683_100201360
746 Ga0070683_100376421
747 Ga0070670_100111300
748 Ga0068869_100176885
749 Ga0070680_100073191
750 Ga0070682_100002682
751 Ga0070682_100013692
752 Ga0070682_100069770
753 Ga0070682_100293176
754 Ga0070682_100398046
755 Ga0068868_100065622
756 Ga0068868_100184226
757 Ga0070660_100036084
758 Ga0070660_100048141
759 Ga0070660_100161448
760 Ga0070691_10026426
761 Ga0070661_100092126
762 Ga0070692_10005693
763 Ga0070692_10025132
764 Ga0070692_10097940
765 Ga0070675_100147591
766 Ga0070675_100263189
767 Ga0070671_100045236
768 Ga0070673_100029253
769 Ga0070659_100089414
770 Ga0070659_100093200
771 Ga0070659_100166232
772 Ga0070659_100200249
773 Ga0070659_100338641
774 Ga0070659_100438344
775 Ga0070667_100007583
776 Ga0070667_100065010
777 Ga0070667_100405868
778 Ga0070714_100001446
779 Ga0070701_10122806
780 Ga0070701_10185773
781 Ga0070700_100034575
782 Ga0070700_100137214
783 Ga0070663_100019332
784 Ga0070663_100049350
785 Ga0070663_100575854
786 Ga0070678_100155551
787 Ga0070678_100341965
788 Ga0070662_100164417
789 Ga0070681_10114956
790 Ga0070681_10260928
791 Ga0070681_10656618
792 Ga0068867_100074370
793 Ga0070685_10064620
794 Ga0070698_100000363
795 Ga0070679_100112171
796 Ga0070679_100160437
797 Ga0070679_100436345
798 Ga0070679_100987741
799 Ga0070684_100028263
800 Ga0070684_100178752
801 Ga0068853_100022084
802 Ga0070672_100019305
803 Ga0070686_100055918
804 Ga0070693_100018875
805 Ga0070665_100000450
806 Ga0070665_100212342
807 Ga0070665_100366668
808 Ga0070704_100584115
809 Ga0068855_100113651
810 Ga0068855_100206224
811 Ga0068855_100233922
812 Ga0068855_100276624
813 Ga0070664_100158709
814 Ga0070664_100176753
815 Ga0070664_100529217
816 Ga0068857_100009886
817 Ga0068857_100537716
818 Ga0068854_100084599
819 Ga0068854_100206351
820 Ga0068856_100028796
821 Ga0068856_100841420
822 Ga0068856_101246478
823 Ga0070702_100011043
824 Ga0068852_100050155
825 Ga0068852_101138780
826 Ga0068859_100054057
827 Ga0068864_100111739
828 Ga0068861_100561646
829 Ga0068870_10003307
830 Ga0068870_10011892
831 Ga0068870_10239403
832 Ga0068863_100076596
833 Ga0068858_100077027
834 Ga0068858_100120615
835 Ga0068860_100000304
836 Ga0068860_100100284
837 Ga0081540_1050807
838 Ga0081539_10036418
839 Ga0075365_10025922
840 Ga0075365_10027382
841 Ga0075365_10043487
842 Ga0075365_10063640
843 Ga0075365_10192855
844 Ga0075365_10215429
845 Ga0075365_10262099
846 Ga0075365_10275209
847 Ga0075368_10003543
848 Ga0075368_10018608
849 Ga0075368_10019857
850 Ga0075368_10280626
851 Ga0075363_100002765
852 Ga0075363_100007893
853 Ga0075363_100011133
854 Ga0075363_100099949
855 Ga0075364_10009391
856 Ga0075364_10034188
857 Ga0075364_10039261
858 Ga0075364_10039542
859 Ga0075364_10065390
860 Ga0075364_10066532
861 Ga0075364_10089036
862 Ga0075364_10142496
863 Ga0075364_10477882
864 Ga0070712_100568552
865 Ga0075362_10058501
866 Ga0075362_10059421
867 Ga0075367_10009420
868 Ga0075367_10030512
869 Ga0097621_101045862
870 Ga0075370_10006935
871 Ga0075370_10015383
872 Ga0075370_10015524
873 Ga0068871_100072529
874 Ga0068871_100084567
875 Ga0075428_100965489
876 Ga0075431_100111265
877 Ga0075434_100067274
878 Ga0068865_100003722
879 Ga0068865_100464631
880 Ga0068865_100856564
881 Ga0075436_100066751
882 Ga0097620_100054056
883 Ga0075435_100037138
884 Ga0105251_10110283
885 Ga0105240_10010898
886 Ga0105240_10103159
887 Ga0105240_10698213
888 Ga0111539_10057392
889 Ga0111539_10167102
890 Ga0111539_10637774
891 Ga0105245_10000359
892 Ga0105245_10119505
893 Ga0105245_10623655
894 Ga0105245_10953672
895 Ga0105247_10046783
896 Ga0114129_10076786
897 Ga0105243_10020111
898 Ga0105243_10097702
899 Ga0105243_10439882
900 Ga0105241_10034837
901 Ga0105248_10061101
902 Ga0105248_10212297
903 Ga0105248_10227251
904 Ga0105237_10015753
905 Ga0105237_10074076
906 Ga0105237_10193530
907 Ga0105237_10645230
908 Ga0105237_11041106
909 Ga0105238_10104253
910 Ga0105238_10217634
911 Ga0105249_10362547
912 Ga0105249_10482721
913 Ga0105249_10759378
914 Ga0105249_11689487
915 Ga0105029_103857
916 Ga0105239_10012602
917 Ga0105239_10012785
918 Ga0105239_10026655
919 Ga0105239_10174678
920 Ga0105239_10728758
921 Ga0105246_10003745
922 Ga0157316_1017087
923 Ga0157373_10085704
924 Ga0157371_10079734
925 Ga0157371_10121099
926 Ga0157370_10063407
927 Ga0157370_10282298
928 Ga0157370_10332198
929 Ga0157369_10339687
930 Ga0157369_10661706
931 Ga0157374_10065627
932 Ga0157378_10339060
933 Ga0163162_10002746
934 Ga0157372_10035893
935 Ga0157372_10101197
936 Ga0157372_10166981
937 Ga0157372_10205672
938 Ga0157372_10752040
939 Ga0157375_10008143
940 Ga0157375_10154397
941 Ga0157375_10500986
942 Ga0157380_10051037
943 Ga0157380_10257426
944 Ga0157380_10882182
945 Ga0157380_11590112
946 Ga0157377_10087620
947 Ga0157377_10515834
948 Ga0157379_10039351
949 Ga0157376_10349216
950 Ga0163161_10009496
951 Ga0163161_10171846
952 Ga0163161_10531334
953 Ga0206356_10664571
954 Ga0206354_10301906
955 Ga0206354_10855475
956 Ga0206353_10122393
957 Ga0206353_11030654
958 Ga0206353_11521123
959 Ga0206353_11743485
960 Ga0213876_10081593
961 Ga0213875_10049861
962 Ga0207697_10027155
963 Ga0207656_10055751
964 Ga0207692_10085843
965 Ga0207710_10081738
966 Ga0207688_10015206
967 Ga0207688_10015922
968 Ga0207688_10123391
969 Ga0207688_10197705
970 Ga0207647_10041476
971 Ga0207647_10063353
972 Ga0207647_10067410
973 Ga0207647_10100243
974 Ga0207647_10202195
975 Ga0207645_10018549
976 Ga0207643_10000100
977 Ga0207643_10003328
978 Ga0207705_10048003
979 Ga0207705_10048274
980 Ga0207654_10184265
981 Ga0207707_10120932
982 Ga0207707_10261355
983 Ga0207707_10278319
984 Ga0207695_10025646
985 Ga0207695_10206410
986 Ga0207695_10341210
987 Ga0207671_10025439
988 Ga0207671_10122276
989 Ga0207671_10128858
990 Ga0207660_10653575
991 Ga0207662_10005149
992 Ga0207662_10039986
993 Ga0207662_10144930
994 Ga0207662_10332443
995 Ga0207657_10010726
996 Ga0207657_10060396
997 Ga0207657_10074462
998 Ga0207649_10058045
999 Ga0207652_10313789
1000 Ga0207694_10089127
1001 Ga0207650_10282776
1002 Ga0207659_10100631
1003 Ga0207659_10293625
1004 Ga0207687_10002966
1005 Ga0207687_10058267
1006 Ga0207687_10063166
1007 Ga0207687_10398679
1008 Ga0207687_10754813
1009 Ga0207664_10298077
1010 Ga0207690_10010372
1011 Ga0207690_10014869
1012 Ga0207690_10047931
1013 Ga0207690_10071359
1014 Ga0207706_10272717
1015 Ga0207686_10033772
1016 Ga0207709_10670833
1017 Ga0207669_10040905
1018 Ga0207669_10448619
1019 Ga0207704_10066534
1020 Ga0207704_10348033
1021 Ga0207691_10009704
1022 Ga0207691_10016940
1023 Ga0207711_10057824
1024 Ga0207689_10045864
1025 Ga0207689_10117355
1026 Ga0207689_10332680
1027 Ga0207661_10012431
1028 Ga0207661_10031047
1029 Ga0207661_10035436
1030 Ga0207661_10041082
1031 Ga0207661_10044358
1032 Ga0207661_10064962
1033 Ga0207661_10097305
1034 Ga0207661_10140032
1035 Ga0207661_10738946
1036 Ga0207661_10892336
1037 Ga0207679_10081212
1038 Ga0207679_10094241
1039 Ga0207679_10171342
1040 Ga0207679_10270967
1041 Ga0207679_10777112
1042 Ga0207667_10155460
1043 Ga0207667_10249536
1044 Ga0207667_10304779
1045 Ga0207667_10945749
1046 Ga0207651_10023558
1047 Ga0207651_10051552
1048 Ga0207712_10275685
1049 Ga0207640_10077392
1050 Ga0207658_10009016
1051 Ga0207658_10028588
1052 Ga0207658_10365979
1053 Ga0207658_10385369
1054 Ga0207677_10714709
1055 Ga0207677_10764601
1056 Ga0207703_10106370
1057 Ga0207639_10392818
1058 Ga0207678_10002842
1059 Ga0207678_10068635
1060 Ga0207708_10000786
1061 Ga0207708_10052761
1062 Ga0207702_10103325
1063 Ga0207702_10639022
1064 Ga0207702_11341243
1065 Ga0207641_10222852
1066 Ga0207641_10557923
1067 Ga0207648_10123460
1068 Ga0207648_10462872
1069 Ga0207676_10067002
1070 Ga0207674_10038543
1071 Ga0207674_10260536
1072 Ga0207674_10282679
1073 Ga0207674_10862854
1074 Ga0207675_100197651
1075 Ga0207675_100917568
1076 Ga0207683_10000565
1077 Ga0207683_10094315
1078 Ga0207683_10172921
1079 Ga0207698_10054593
1080 Ga0207698_10058156
1081 Ga0207698_10182676
1082 Ga0207698_10222333
1083 Ga0207428_10053593
1084 Ga0268266_10004579
1085 Ga0268266_10058281
1086 Ga0268266_10276895
1087 Ga0268266_10885167
1088 Ga0268264_10038630
1089 Ga0268264_10300168
1090 Ga0314311_1124506
1091 Ga0307408_100393487
1092 Ga0307408_100503294
1093 Ga0307405_10096666
1094 Ga0307405_10379074
1095 Ga0307413_10040012
1096 Ga0307413_10295835
1097 Ga0307413_10408564
1098 Ga0307410_10039162
1099 Ga0307410_10299767
1100 Ga0307410_10308953
1101 Ga0307410_10481075
1102 Ga0307410_10525675
1103 Ga0307406_10094187
1104 Ga0307406_10100755
1105 Ga0307407_10098732
1106 Ga0307407_10466002
1107 Ga0307412_10206428
1108 Ga0307412_10343032
1109 Ga0307409_100071034
1110 Ga0307409_100128509
1111 Ga0307409_100257482
1112 Ga0307409_100339704
1113 Ga0307409_101194215
1114 Ga0307416_100030850
1115 Ga0307416_100170926
1116 Ga0307416_100302006
1117 Ga0307416_100418949
1118 Ga0307416_100833295
1119 Ga0307416_101377175
1120 Ga0307414_10571288
1121 Ga0307411_10086488
1122 Ga0307415_100030331
1123 Ga0307415_100031405
1124 Ga0307415_100213819
1125 Ga0316574_0352021
1126 Ga0373947_0695791
1127 Ga0395898_0172914
1128 Ga0395905_0021832
1129 Ga0395905_0405804
1130 Ga0436364_1506248
1131 Ga0395901_0084177
1132 Ga0395901_0320662
1133 Ga0395901_0808815
1134 Ga0436365_0005613
1135 Ga0439438_020715
1136 Ga0451853_0740919
1137 Ga0451853_0786083
1138 Ga0451853_4119957
1139 Ga0439445_0038825
1140 Ga0439448_0011570
1141 Ga0450914_007739
1142 Ga0439458_0009932
1143 Ga0439434_0003200
1144 Ga0466972_0009367
1145 Ga0466972_0062815
1146 Ga0466972_0064381
1147 Ga0466972_0093198
1148 Ga0466965_0005158
1149 Ga0466965_0016158
1150 Ga0466965_0045897
1151 Ga0466965_0374484
1152 Ga0466966_0008820
1153 Ga0466966_0009895
1154 Ga0466966_0016377
1155 Ga0466966_0019540
1156 Ga0466966_0027302
1157 Ga0466966_0082754
1158 Ga0466966_0121636
1159 Ga0466966_0466367
1160 Ga0466961_0005682
1161 Ga0466961_0012524
1162 Ga0466961_0030207
1163 Ga0466961_0078603
1164 Ga0466961_0080179
1165 Ga0466961_0108550
1166 Ga0466961_0268145
1167 Ga0466961_0378045
1168 Ga0466961_0424427
1169 Ga0466963_0010373
1170 Ga0466963_0021922
1171 Ga0466963_0105852
1172 Ga0466963_0201424
1173 Ga0466963_0239434
1174 Ga0466964_0005603
1175 Ga0466964_0043570
1176 Ga0466964_0219482
1177 Ga0466971_0019657
1178 Ga0466971_0139750
1179 Ga0466968_0020207
1180 Ga0466968_0082192
1181 Ga0466970_0007594
1182 Ga0466970_0009506
1183 Ga0466970_0027086
1184 Ga0466970_0039692
1185 Ga0466970_0048016
1186 Ga0466970_0054941
1187 Ga0466970_0191582
1188 Ga0466970_0324227
1189 Ga0466957_0016712
1190 Ga0466957_0025147
1191 Ga0466957_0063950
1192 Ga0466957_0066993
1193 Ga0466957_0067043
1194 Ga0466960_0000389
1195 Ga0466960_0027309
1196 Ga0466960_0028802
1197 Ga0466960_0055071
1198 Ga0466960_0075534
1199 Ga0466960_0337797
1200 Ga0466959_0009269
1201 Ga0466959_0010923
1202 Ga0466959_0033462
1203 Ga0466959_0052515
1204 Ga0466959_0167677
1205 Ga0466959_0286977
1206 Ga0466959_0288228
1207 Ga0466959_0324629
1208 Ga0466959_0469566
1209 Ga0466958_0025759
1210 Ga0466958_0097642
1211 Ga0466958_0101486
1212 Ga0466958_0107958
1213 Ga0466958_0346969
1214 Ga0466967_0000727
1215 Ga0466967_0006336
1216 Ga0466967_0006597
1217 Ga0466967_0026519
1218 Ga0466967_0048979
1219 Ga0466967_0082642
1220 Ga0466967_0115486
1221 Ga0466967_0152013
1222 Ga0466967_0182440
1223 Ga0466967_0219638
1224 Ga0466967_0276146
1225 Ga0466967_0385555
1226 Ga0466967_0434117
1227 Ga0466967_0671600
1228 Ga0466967_1169824
1229 Ga0495603_0118031
1230 Ga0495582_0515591
1231 Ga0495639_0181426
1232 Ga0495664_0018905
1233 Ga0495648_0021804
1234 Ga0495645_0278894
1235 Ga0495635_0348638
1236 Ga0495635_0492966
1237 Ga0495657_0107759
1238 Ga0495658_0514730
1239 Ga0495680_0106793
1240 Ga0496100_0082924
1241 Ga0496100_0215927
1242 Ga0496100_0335432
1243 Ga0496102_0008533
1244 Ga0496102_0062971
1245 Ga0496102_0149808
1246 Ga0496102_0399641
1247 Ga0496102_0506586
1248 Ga0496102_0589081
1249 Ga0496102_0626871
1250 Ga0496103_0070358
1251 Ga0496103_0417721
1252 Ga0496104_0004891
1253 Ga0496104_0061498
1254 Ga0496104_0064806
1255 Ga0496104_0280978
1256 Ga0496104_0391999
1257 Ga0496105_0016582
1258 Ga0496105_0031900
1259 Ga0496105_0149894
1260 Ga0496106_0063822
1261 Ga0496106_0073228
1262 Ga0496106_0140054
1263 Ga0496106_0171225
1264 Ga0496106_0303692
1265 Ga0496107_0010995
1266 Ga0496107_0056858
1267 Ga0496107_0132739
1268 Ga0496107_0216495
1269 Ga0496107_0518866
1270 Ga0496107_0610816
1271 Ga0496108_0034934
1272 Ga0496108_0039949
1273 Ga0496108_0049105
1274 Ga0496108_0052559
1275 Ga0496108_0129466
1276 Ga0496109_0009876
1277 Ga0496109_0047925
1278 Ga0496109_0051661
1279 Ga0496109_0052834
1280 Ga0496109_0069632
1281 Ga0496109_0113315
1282 Ga0496109_0153136
1283 Ga0496109_0349155
1284 Ga0496109_0798912
1285 Ga0496110_0018218
1286 Ga0496110_0118546
1287 Ga0496110_0177292
1288 Ga0496110_0404397
1289 Ga0496111_0005153
1290 Ga0496111_0027398
1291 Ga0496111_0031104
1292 Ga0496111_0088925
1293 Ga0496111_0211399
1294 Ga0496112_0468731
1295 Ga0496113_0062276
1296 Ga0496113_0077007
1297 Ga0496113_0091951
1298 Ga0496113_0168130
1299 Ga0496113_0248578
1300 Ga0496114_0018030
1301 Ga0496114_0020867
1302 Ga0496114_0023003
1303 Ga0496114_0027407
1304 Ga0496114_0029410
1305 Ga0496114_0052772
1306 Ga0496114_0148944
1307 Ga0496114_0290411
1308 Ga0496114_0291482
1309 Ga0496114_0350137
1310 Ga0496114_0376250
1311 Ga0496114_0453728
1312 Ga0496115_0001170
1313 Ga0496115_0018278
1314 Ga0496115_0264211
1315 Ga0496115_0275362
1316 Ga0496119_0000104
1317 Ga0496120_0005467
1318 Ga0501031_0015220
1319 Ga0501031_0062971
1320 Ga0501031_0392452
1321 Ga0501032_0075124
1322 Ga0501033_0001922
1323 Ga0501034_0018756
1324 Ga0501034_0085044
1325 Ga0501034_0180748
1326 Ga0501036_0015244
1327 Ga0501036_0132273
1328 Ga0501036_0480201
1329 Ga0501038_0005918
1330 Ga0501038_0268816
1331 Ga0501038_0562591
1332 Ga0501039_0040907
1333 Ga0501039_0121897
1334 Ga0501039_0138563
1335 Ga0501039_0170345
1336 Ga0501039_0212082
1337 Ga0501039_0252390
1338 Ga0501040_0079656
1339 Ga0501040_0098835
1340 Ga0501042_0018167
1341 Ga0501042_0057247
1342 Ga0501042_0095761
1343 Ga0501043_0006006
1344 Ga0501043_0045801
1345 Ga0501043_0251777
1346 Ga0501043_0484381
1347 Ga0501046_0000633
1348 Ga0501046_0020040
1349 Ga0501047_0234615
1350 Ga0501047_0629933
1351 Ga0501048_0021335
1352 Ga0501048_0063280
1353 Ga0501048_0349230
1354 Ga0501048_0375680
1355 Ga0501048_0576193
1356 Ga0501067_0012114
1357 Ga0501067_0117417
1358 Ga0501068_0051744
1359 Ga0501068_0141420
1360 Ga0501069_0005208
1361 Ga0501069_0043323
1362 Ga0501069_0106759
1363 Ga0501069_0265888
1364 Ga0501070_0030673
1365 Ga0501070_0046658
1366 Ga0501070_0063609
1367 Ga0501070_0074887
1368 Ga0501070_0075161
1369 Ga0501070_0248511
1370 Ga0501070_0328614
1371 Ga0501070_0339743
1372 Ga0501070_0525340
1373 Ga0501070_0909123
1374 Ga0501071_0005496
1375 Ga0501071_0030203
1376 Ga0501071_0060675
1377 Ga0501071_0265008
1378 Ga0501071_0310804
1379 Ga0501072_0011083
1380 Ga0501073_0032743
1381 Ga0501073_0113022
1382 Ga0501073_0210246
1383 Ga0501074_0073098
1384 Ga0501074_0125153
1385 Ga0501074_0293894
1386 Ga0501074_0430433
1387 Ga0501075_0247680
1388 Ga0501079_0076481
1389 Ga0501079_0308937
1390 Ga0501079_0398283
1391 Ga0501080_0006057
1392 Ga0501080_0070239
1393 Ga0501080_0182781
1394 Ga0501080_0335595
1395 Ga0501081_0310541
1396 Ga0501083_0252621
1397 Ga0501083_0370333
1398 Ga0501044_0011939
1399 Ga0501044_0187060
1400 Ga0501045_0117317
1401 Ga0501045_0449536
1402 nmdc:mga03683_179737_c1
1403 nmdc:mga03n38_1274_c1
1404 nmdc:mga00v17_19640_c1
1405 nmdc:mga00v17_243217_c1
1406 nmdc:mga00v17_2605_c1
1407 nmdc:mga00v17_393393_c1
1408 nmdc:mga00v17_60527_c1
1409 nmdc:mga00v17_65549_c1
1410 nmdc:mga0yw44_119577_c1
1411 nmdc:mga0yw44_167598_c1
1412 nmdc:mga0yw44_1903_c1
1413 nmdc:mga0yw44_20892_c1
1414 nmdc:mga0yw44_228022_c1
1415 nmdc:mga0yw44_230278_c2
1416 nmdc:mga0yw44_29800_c1
1417 nmdc:mga0yw44_417933_c1
1418 nmdc:mga0yw44_50103_c1
1419 nmdc:mga0yw44_65071_c1
1420 nmdc:mga06z11_13579_c1
1421 nmdc:mga06z11_265827_c1
1422 nmdc:mga06z11_371447_c1
1423 nmdc:mga06z11_523129_c1
1424 nmdc:mga06z11_70175_c1
1425 nmdc:mga04h51_11830_c1
1426 nmdc:mga04h51_39291_c1
1427 nmdc:mga07m45_73681_c1
1428 nmdc:mga07m45_85565_c1
1429 nmdc:mga07m45_9631_c1
1430 nmdc:mga05p37_220164_c1
1431 nmdc:mga08y16_29745_c1
1432 nmdc:mga08y16_496685_c1
1433 nmdc:mga08x19_117537_c1
1434 nmdc:mga0a205_83665_c1
1435 Ga0495601_0317901
1436 Ga0495595_0078290
1437 Ga0495595_0112457
1438 Ga0495619_0005036
1439 Ga0495619_0415006
1440 Ga0500644_0000678
1441 Ga0500573_0101552
1442 Ga0500573_0173864
1443 Ga0500620_041692
1444 Ga0501084_0075926
1445 Ga0501084_0253839
1446 Ga0501084_0530923
1447 Ga0590075_109851
1448 Ga0590077_026068
1449 Ga0501082_0009085
1450 Ga0501082_0435360
1451 Ga0501082_0863155
1452 Ga0466962_0139255
1453 Ga0530510_0145546
1454 2515856568
1455 2643824120
1456 2644533426
1457 2676473601
1458 2740167227
1459 2774394499
1460 2809194647
1461 2812349388
1462 2827632114
1463 2837269130
1464 2855391155
1465 2857485783
1466 2868092705
1467 2891972900
1468 2984579769
1469 2990257375
1470 8054613898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

165

221

0.97

PF00072

Response_reg

Response regulator receiver domain

19

131

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

160

209

0.95

PF04545

Sigma70_r4

Sigma-70, region 4

164

211

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9664 150 214
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9637 152 214
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9615 150 214
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9588 150 213
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9574 151 210
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9681 152 211 1.10.10.10
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9585 154 205 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 154 210 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9526 154 210 1.10.10.10
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9512 5 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W0MTT7-F1-model_v4 Response regulator transcription factor 0.9396 1 122 GO:0000160
AF-A0A429HPZ9-F1-model_v4 deleted 0.9225 1 139
AF-A0A7X9CUN2-F1-model_v4 deleted 0.9211 4 148
AF-A0A7G8BEC4-F1-model_v4 Response regulator transcription factor 0.9197 2 131 GO:0000160
GO:0003677
AF-A0A1F2RW02-F1-model_v4 Response regulatory domain-containing protein 0.9179 2 130 GO:0000160
GO:0003677

Map