F478198

General Info

Members Datasets Scaffolds Average Seq Length
735 291 1470 122

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_12741088|Ga0163162_127410881
Length 148
Sequence MGGIANFTWNDGNRWRSFCASEQEGKMADGKKVVINLATGIEDAERVLVAFLVGGAALEQGKQVAMFLTKDAVRLGLPGQAEGVACEGCPPLERLFEQFADGGGELLVCPICLNSRGLEGTELVPNARVAGATPMWEWAGDDATVFSY

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
184 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
185 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 1.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 9.39
Rhizosphere 89.93
Stem 0
Stem Tuber 0
Unclassified 11.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_12741088 3300013306 Bacteria 567
2 Ga0058863_11887458 3300004799 Bacteria 1708
3 Ga0058863_11969170 3300004799 Bacteria 1088
4 Ga0058862_12785444 3300004803 Bacteria 1404
5 Ga0070658_10028767 3300005327 Bacteria 4462
6 Ga0070658_10037593 3300005327 Bacteria 3903
7 Ga0070658_10088033 3300005327 Unclassified 2557
8 Ga0070658_10135193 3300005327 Bacteria 2056
9 Ga0070658_10833558 3300005327 Bacteria 801
10 Ga0070676_10180510 3300005328 Bacteria 1372
11 Ga0070683_100024243 3300005329 Bacteria 5432
12 Ga0070683_100045247 3300005329 Bacteria 4062
13 Ga0070683_100095223 3300005329 Bacteria 2799
14 Ga0070683_100104626 3300005329 Bacteria 2668
15 Ga0070683_100105514 3300005329 Bacteria 2656
16 Ga0070683_100145689 3300005329 Bacteria 2244
17 Ga0070683_100845746 3300005329 Bacteria 877
18 Ga0070683_100919779 3300005329 Bacteria 839
19 Ga0070683_101028966 3300005329 Bacteria 791
20 Ga0068869_100135053 3300005334 Bacteria 1900
21 Ga0068869_100467508 3300005334 Bacteria 1048
22 Ga0070680_100149222 3300005336 Bacteria 1962
23 Ga0070680_100194298 3300005336 Bacteria 1710
24 Ga0070680_100243211 3300005336 Bacteria 1521
25 Ga0070680_100254713 3300005336 Bacteria 1484
26 Ga0070680_100286796 3300005336 Bacteria 1395
27 Ga0070680_100639190 3300005336 Bacteria 914
28 Ga0070680_101607608 3300005336 Bacteria 563
29 Ga0070682_100003617 3300005337 Bacteria 8571
30 Ga0070682_100094064 3300005337 Bacteria 1966
31 Ga0070682_100098898 3300005337 Bacteria 1923
32 Ga0070682_100145037 3300005337 Bacteria 1623
33 Ga0070682_100231603 3300005337 Bacteria 1321
34 Ga0070682_100305031 3300005337 Bacteria 1170
35 Ga0068868_100002722 3300005338 Bacteria 12251
36 Ga0068868_100297367 3300005338 Unclassified 1370
37 Ga0070660_100021983 3300005339 Bacteria 4712
38 Ga0070660_100043162 3300005339 Bacteria 3445
39 Ga0070660_100045449 3300005339 Bacteria 3362
40 Ga0070660_100071645 3300005339 Bacteria 2706
41 Ga0070660_100156364 3300005339 Bacteria 1835
42 Ga0070660_100180976 3300005339 Unclassified 1706
43 Ga0070660_100302623 3300005339 Bacteria 1311
44 Ga0070660_100842708 3300005339 Unclassified 772
45 Ga0070689_101199616 3300005340 Bacteria 681
46 Ga0070691_10021193 3300005341 Bacteria 3006
47 Ga0070691_10101556 3300005341 Bacteria 1429
48 Ga0070691_10429585 3300005341 Bacteria 750
49 Ga0070691_10510756 3300005341 Bacteria 696
50 Ga0070661_100107893 3300005344 Bacteria 2077
51 Ga0070661_100263177 3300005344 Bacteria 1334
52 Ga0070661_100664842 3300005344 Bacteria 846
53 Ga0070692_10023499 3300005345 Bacteria 3021
54 Ga0070692_10195641 3300005345 Bacteria 1181
55 Ga0070668_100022237 3300005347 Bacteria 4793
56 Ga0070675_100069498 3300005354 Bacteria 2918
57 Ga0070675_100134491 3300005354 Bacteria 2109
58 Ga0070675_100841378 3300005354 Bacteria 839
59 Ga0070671_100889775 3300005355 Bacteria 778
60 Ga0070674_100028515 3300005356 Bacteria 3667
61 Ga0070674_101305776 3300005356 Bacteria 647
62 Ga0070673_100030903 3300005364 Bacteria 4014
63 Ga0070673_101687722 3300005364 Bacteria 599
64 Ga0070688_100122312 3300005365 Bacteria 1745
65 Ga0070659_100012568 3300005366 Bacteria 6277
66 Ga0070659_100067489 3300005366 Bacteria 2837
67 Ga0070659_100170452 3300005366 Bacteria 1783
68 Ga0070659_101023301 3300005366 Bacteria 726
69 Ga0070667_100401911 3300005367 Bacteria 1247
70 Ga0070714_100003759 3300005435 Bacteria 11387
71 Ga0070714_100015438 3300005435 Bacteria 6146
72 Ga0070714_100027273 3300005435 Bacteria 4728
73 Ga0070714_100262986 3300005435 Bacteria 1598
74 Ga0070714_100417547 3300005435 Bacteria 1270
75 Ga0070714_100750998 3300005435 Bacteria 943
76 Ga0070714_100773884 3300005435 Bacteria 929
77 Ga0070714_101430391 3300005435 Bacteria 675
78 Ga0070713_100175556 3300005436 Bacteria 1922
79 Ga0070713_100281881 3300005436 Bacteria 1525
80 Ga0070713_102432328 3300005436 Unclassified 506
81 Ga0070710_11497660 3300005437 Unclassified 507
82 Ga0070711_100118777 3300005439 Bacteria 1952
83 Ga0070711_101343873 3300005439 Bacteria 621
84 Ga0070711_101729083 3300005439 Unclassified 548
85 Ga0070700_100003285 3300005441 Bacteria 8332
86 Ga0070708_100294203 3300005445 Archaea 1529
87 Ga0070708_101511273 3300005445 Bacteria 626
88 Ga0070663_100089618 3300005455 Bacteria 2277
89 Ga0070678_102037178 3300005456 Unclassified 543
90 Ga0070662_100168427 3300005457 Bacteria 1718
91 Ga0070662_100851797 3300005457 Bacteria 776
92 Ga0070681_10019834 3300005458 Bacteria 6734
93 Ga0070681_10027616 3300005458 Bacteria 5706
94 Ga0070681_10063034 3300005458 Bacteria 3680
95 Ga0070681_10082524 3300005458 Bacteria 3170
96 Ga0070681_10163367 3300005458 Bacteria 2150
97 Ga0070681_10170615 3300005458 Bacteria 2097
98 Ga0070681_11124176 3300005458 Unclassified 707
99 Ga0070681_11408258 3300005458 Bacteria 621
100 Ga0070681_11460557 3300005458 Bacteria 608
101 Ga0070685_11083086 3300005466 Bacteria 605
102 Ga0070707_100117955 3300005468 Bacteria 2576
103 Ga0070707_100243545 3300005468 Bacteria 1750
104 Ga0070679_100059898 3300005530 Bacteria 3794
105 Ga0070679_100113593 3300005530 Bacteria 2693
106 Ga0070679_100162369 3300005530 Bacteria 2208
107 Ga0070679_100173870 3300005530 Bacteria 2126
108 Ga0070679_100230726 3300005530 Bacteria 1810
109 Ga0070679_100317051 3300005530 Bacteria 1509
110 Ga0070679_100345152 3300005530 Bacteria 1437
111 Ga0070679_100411174 3300005530 Bacteria 1298
112 Ga0070679_100757328 3300005530 Unclassified 914
113 Ga0070684_100151667 3300005535 Bacteria 2100
114 Ga0070684_100158673 3300005535 Bacteria 2051
115 Ga0070684_100180207 3300005535 Bacteria 1921
116 Ga0070684_100217182 3300005535 Bacteria 1744
117 Ga0070684_100381604 3300005535 Unclassified 1298
118 Ga0070684_100430603 3300005535 Bacteria 1218
119 Ga0070684_100696789 3300005535 Bacteria 947
120 Ga0070697_100073637 3300005536 Bacteria 2805
121 Ga0068853_100345634 3300005539 Bacteria 1383
122 Ga0068853_101102403 3300005539 Bacteria 765
123 Ga0070672_100109508 3300005543 Bacteria 2250
124 Ga0070695_100000424 3300005545 Bacteria 21845
125 Ga0070695_100418808 3300005545 Bacteria 1019
126 Ga0070695_100542678 3300005545 Bacteria 905
127 Ga0070696_100728216 3300005546 Bacteria 811
128 Ga0070696_100830485 3300005546 Bacteria 762
129 Ga0070696_101118310 3300005546 Bacteria 663
130 Ga0070693_100131152 3300005547 Bacteria 1567
131 Ga0070665_100981321 3300005548 Bacteria 857
132 Ga0070704_100035743 3300005549 Bacteria 3379
133 Ga0070704_101229042 3300005549 Unclassified 684
134 Ga0068855_100024401 3300005563 Bacteria 7234
135 Ga0068855_100473650 3300005563 Bacteria 1364
136 Ga0068855_101117966 3300005563 Bacteria 823
137 Ga0070664_100017827 3300005564 Bacteria 5831
138 Ga0070664_100805857 3300005564 Bacteria 878
139 Ga0068857_100167217 3300005577 Bacteria 1998
140 Ga0068857_100211595 3300005577 Bacteria 1769
141 Ga0068857_100724882 3300005577 Unclassified 946
142 Ga0068854_100015199 3300005578 Bacteria 5094
143 Ga0068854_100073504 3300005578 Bacteria 2506
144 Ga0068856_100099760 3300005614 Bacteria 2895
145 Ga0068856_100313779 3300005614 Bacteria 1585
146 Ga0068856_100396661 3300005614 Bacteria 1399
147 Ga0068856_100492545 3300005614 Bacteria 1246
148 Ga0068856_101250953 3300005614 Unclassified 758
149 Ga0068856_102124651 3300005614 Bacteria 571
150 Ga0068856_102194946 3300005614 Bacteria 561
151 Ga0068852_100044491 3300005616 Bacteria 3771
152 Ga0068852_100065308 3300005616 Bacteria 3174
153 Ga0068852_100066403 3300005616 Bacteria 3150
154 Ga0068852_100937476 3300005616 Bacteria 884
155 Ga0068852_101297772 3300005616 Unclassified 750
156 Ga0068852_101759431 3300005616 Bacteria 642
157 Ga0068852_102685395 3300005616 Unclassified 517
158 Ga0068864_100003052 3300005618 Bacteria 13826
159 Ga0068866_10220791 3300005718 Bacteria 1143
160 Ga0068861_102557638 3300005719 Bacteria 514
161 Ga0068851_10191492 3300005834 Bacteria 1137
162 Ga0068870_10091516 3300005840 Bacteria 1701
163 Ga0068863_100104515 3300005841 Bacteria 2694
164 Ga0068860_101469953 3300005843 Bacteria 703
165 Ga0068862_101419813 3300005844 Bacteria 698
166 Ga0081540_1183454 3300005983 Bacteria 780
167 Ga0081539_10002145 3300005985 Bacteria 29161
168 Ga0070717_11068370 3300006028 Bacteria 735
169 Ga0075432_10459239 3300006058 Bacteria 560
170 Ga0070716_100930663 3300006173 Bacteria 683
171 Ga0070716_101079309 3300006173 Bacteria 639
172 Ga0070712_100024952 3300006175 Bacteria 3967
173 Ga0070712_100124127 3300006175 Bacteria 1947
174 Ga0070712_101270422 3300006175 Unclassified 641
175 Ga0070712_101469820 3300006175 Bacteria 595
176 Ga0075367_10757074 3300006178 Bacteria 618
177 Ga0068871_101033495 3300006358 Bacteria 766
178 Ga0075434_100473228 3300006871 Bacteria 1274
179 Ga0075434_101374530 3300006871 Unclassified 716
180 Ga0068865_100054573 3300006881 Bacteria 2777
181 Ga0068865_100980691 3300006881 Bacteria 739
182 Ga0075436_100981836 3300006914 Bacteria 633
183 Ga0105240_10392022 3300009093 Bacteria 1566
184 Ga0105240_10450840 3300009093 Bacteria 1440
185 Ga0105240_11083047 3300009093 Unclassified 853
186 Ga0111539_10117023 3300009094 Bacteria 3125
187 Ga0111539_10503244 3300009094 Bacteria 1411
188 Ga0111539_12212698 3300009094 Bacteria 638
189 Ga0105245_10000399 3300009098 Bacteria 40287
190 Ga0105245_10379328 3300009098 Bacteria 1408
191 Ga0105247_11648270 3300009101 Bacteria 528
192 Ga0114129_10385690 3300009147 Bacteria 1849
193 Ga0105243_10222697 3300009148 Bacteria 1669
194 Ga0105243_10872160 3300009148 Bacteria 893
195 Ga0105241_10594355 3300009174 Bacteria 999
196 Ga0105241_11260218 3300009174 Bacteria 702
197 Ga0105242_10318268 3300009176 Bacteria 1426
198 Ga0105248_10516278 3300009177 Bacteria 1347
199 Ga0105237_10232835 3300009545 Bacteria 1843
200 Ga0105237_11194911 3300009545 Bacteria 767
201 Ga0105238_10160174 3300009551 Bacteria 2226
202 Ga0105238_12012050 3300009551 Bacteria 611
203 Ga0105249_10019741 3300009553 Bacteria 6017
204 Ga0105239_10018477 3300010375 Bacteria 7700
205 Ga0105239_10045428 3300010375 Bacteria 4814
206 Ga0105239_10203384 3300010375 Bacteria 2219
207 Ga0105239_10400788 3300010375 Bacteria 1553
208 Ga0105246_10951589 3300011119 Bacteria 774
209 Ga0157373_10218392 3300013100 Unclassified 1345
210 Ga0157373_10340904 3300013100 Unclassified 1068
211 Ga0157371_10007707 3300013102 Bacteria 8662
212 Ga0157371_10392050 3300013102 Bacteria 1015
213 Ga0157371_10556306 3300013102 Bacteria 851
214 Ga0157370_10027338 3300013104 Bacteria 5626
215 Ga0157370_10266165 3300013104 Bacteria 1584
216 Ga0157370_10385316 3300013104 Bacteria 1291
217 Ga0157369_10056135 3300013105 Bacteria 4250
218 Ga0157369_10256765 3300013105 Bacteria 1823
219 Ga0157374_10007591 3300013296 Bacteria 9254
220 Ga0163162_11044232 3300013306 Bacteria 925
221 Ga0157372_10028691 3300013307 Bacteria 6075
222 Ga0157372_10175113 3300013307 Bacteria 2483
223 Ga0157372_10196317 3300013307 Bacteria 2338
224 Ga0157372_10216606 3300013307 Bacteria 2219
225 Ga0157372_10267892 3300013307 Bacteria 1984
226 Ga0157372_10278829 3300013307 Bacteria 1943
227 Ga0157372_10512645 3300013307 Bacteria 1398
228 Ga0157372_10734983 3300013307 Bacteria 1148
229 Ga0157372_10857134 3300013307 Bacteria 1055
230 Ga0157372_10962308 3300013307 Bacteria 989
231 Ga0157375_10301920 3300013308 Bacteria 1765
232 Ga0157375_10646039 3300013308 Bacteria 1214
233 Ga0163163_10127520 3300014325 Bacteria 2583
234 Ga0157380_10088592 3300014326 Bacteria 2547
235 Ga0157380_10199880 3300014326 Bacteria 1772
236 Ga0182008_10071020 3300014497 Bacteria 1713
237 Ga0157377_10000878 3300014745 Bacteria 12507
238 Ga0157377_10074132 3300014745 Bacteria 1974
239 Ga0157377_10574285 3300014745 Bacteria 800
240 Ga0157379_10885460 3300014968 Bacteria 846
241 Ga0157376_10126481 3300014969 Bacteria 2274
242 Ga0182007_10085700 3300015262 Bacteria 1035
243 Ga0206356_10568753 3300020070 Bacteria 1416
244 Ga0206354_10111116 3300020081 Bacteria 1781
245 Ga0206354_10807369 3300020081 Bacteria 824
246 Ga0206354_11165720 3300020081 Bacteria 1651
247 Ga0206353_10500991 3300020082 Bacteria 1529
248 Ga0206353_10561511 3300020082 Unclassified 565
249 Ga0206353_10597767 3300020082 Bacteria 862
250 Ga0206353_10692593 3300020082 Bacteria 1839
251 Ga0206353_11837998 3300020082 Bacteria 574
252 Ga0213873_10003537 3300021358 Unclassified 2821
253 Ga0213876_10073180 3300021384 Bacteria 1809
254 Ga0207656_10141806 3300025321 Bacteria 1133
255 Ga0207692_10041981 3300025898 Bacteria 2268
256 Ga0207642_10078569 3300025899 Bacteria 1595
257 Ga0207688_10003554 3300025901 Bacteria 8505
258 Ga0207688_10533989 3300025901 Bacteria 736
259 Ga0207647_10191463 3300025904 Bacteria 1185
260 Ga0207705_10032205 3300025909 Bacteria 3746
261 Ga0207705_10042066 3300025909 Bacteria 3280
262 Ga0207705_10048413 3300025909 Bacteria 3058
263 Ga0207705_10065301 3300025909 Bacteria 2630
264 Ga0207707_10056972 3300025912 Bacteria 3401
265 Ga0207707_10088548 3300025912 Bacteria 2704
266 Ga0207707_10354756 3300025912 Bacteria 1263
267 Ga0207707_10410964 3300025912 Bacteria 1161
268 Ga0207707_10432908 3300025912 Bacteria 1126
269 Ga0207707_10530868 3300025912 Bacteria 1001
270 Ga0207707_10982138 3300025912 Bacteria 694
271 Ga0207695_10663629 3300025913 Bacteria 924
272 Ga0207671_10236747 3300025914 Bacteria 1433
273 Ga0207693_10037709 3300025915 Bacteria 3809
274 Ga0207693_10042999 3300025915 Bacteria 3557
275 Ga0207693_10303001 3300025915 Bacteria 1251
276 Ga0207693_11035537 3300025915 Bacteria 625
277 Ga0207663_10186527 3300025916 Bacteria 1486
278 Ga0207660_10148624 3300025917 Bacteria 1798
279 Ga0207660_10268051 3300025917 Bacteria 1352
280 Ga0207660_10360002 3300025917 Bacteria 1167
281 Ga0207660_10482925 3300025917 Bacteria 1004
282 Ga0207660_11036180 3300025917 Unclassified 669
283 Ga0207657_10000616 3300025919 Bacteria 37754
284 Ga0207657_10005027 3300025919 Bacteria 13875
285 Ga0207657_10062173 3300025919 Bacteria 3198
286 Ga0207657_10095206 3300025919 Bacteria 2478
287 Ga0207657_10140046 3300025919 Bacteria 1977
288 Ga0207657_10198000 3300025919 Bacteria 1617
289 Ga0207657_10396320 3300025919 Bacteria 1086
290 Ga0207649_10209560 3300025920 Bacteria 1382
291 Ga0207649_10308715 3300025920 Bacteria 1159
292 Ga0207649_10541379 3300025920 Bacteria 890
293 Ga0207649_11221560 3300025920 Bacteria 594
294 Ga0207652_10028796 3300025921 Bacteria 4637
295 Ga0207652_10086073 3300025921 Bacteria 2755
296 Ga0207652_10087925 3300025921 Bacteria 2725
297 Ga0207652_10188661 3300025921 Bacteria 1854
298 Ga0207652_10267587 3300025921 Bacteria 1542
299 Ga0207652_10271086 3300025921 Bacteria 1531
300 Ga0207652_10633682 3300025921 Unclassified 957
301 Ga0207652_10681217 3300025921 Bacteria 918
302 Ga0207652_10789622 3300025921 Bacteria 843
303 Ga0207646_10228539 3300025922 Bacteria 1681
304 Ga0207694_10346539 3300025924 Bacteria 1229
305 Ga0207659_10053517 3300025926 Bacteria 2879
306 Ga0207659_10298396 3300025926 Bacteria 1322
307 Ga0207687_10343121 3300025927 Bacteria 1215
308 Ga0207700_11520229 3300025928 Unclassified 594
309 Ga0207664_10009761 3300025929 Bacteria 6752
310 Ga0207664_10272831 3300025929 Bacteria 1482
311 Ga0207664_11116013 3300025929 Unclassified 705
312 Ga0207664_11241722 3300025929 Bacteria 664
313 Ga0207664_11880517 3300025929 Bacteria 521
314 Ga0207644_10581977 3300025931 Bacteria 928
315 Ga0207690_10046129 3300025932 Bacteria 2884
316 Ga0207690_10154865 3300025932 Bacteria 1702
317 Ga0207690_10186296 3300025932 Bacteria 1566
318 Ga0207690_10553279 3300025932 Bacteria 935
319 Ga0207690_11076450 3300025932 Bacteria 670
320 Ga0207706_10020489 3300025933 Bacteria 5944
321 Ga0207706_10190826 3300025933 Bacteria 1798
322 Ga0207706_10261017 3300025933 Bacteria 1512
323 Ga0207686_10659301 3300025934 Bacteria 828
324 Ga0207709_10841938 3300025935 Bacteria 743
325 Ga0207670_11275158 3300025936 Bacteria 623
326 Ga0207704_10227371 3300025938 Bacteria 1385
327 Ga0207704_10632007 3300025938 Bacteria 880
328 Ga0207665_10289241 3300025939 Bacteria 1222
329 Ga0207691_10444743 3300025940 Bacteria 1103
330 Ga0207689_10094428 3300025942 Bacteria 2456
331 Ga0207661_10007076 3300025944 Bacteria 7967
332 Ga0207661_10261792 3300025944 Bacteria 1541
333 Ga0207661_10351850 3300025944 Bacteria 1329
334 Ga0207661_10356983 3300025944 Bacteria 1320
335 Ga0207661_10644426 3300025944 Bacteria 973
336 Ga0207661_10740590 3300025944 Bacteria 904
337 Ga0207661_10939683 3300025944 Bacteria 796
338 Ga0207679_10611392 3300025945 Bacteria 983
339 Ga0207679_10650753 3300025945 Bacteria 953
340 Ga0207679_11466560 3300025945 Bacteria 626
341 Ga0207667_10339094 3300025949 Bacteria 1534
342 Ga0207667_10389575 3300025949 Bacteria 1419
343 Ga0207667_10523801 3300025949 Bacteria 1201
344 Ga0207667_10810118 3300025949 Bacteria 933
345 Ga0207651_10075564 3300025960 Bacteria 2405
346 Ga0207712_10258022 3300025961 Bacteria 1412
347 Ga0207712_11162185 3300025961 Bacteria 688
348 Ga0207668_10729513 3300025972 Bacteria 873
349 Ga0207640_10086859 3300025981 Bacteria 2155
350 Ga0207640_10336778 3300025981 Bacteria 1207
351 Ga0207640_10647259 3300025981 Bacteria 900
352 Ga0207658_10136068 3300025986 Bacteria 1981
353 Ga0207677_10018268 3300026023 Bacteria 4205
354 Ga0207677_10268414 3300026023 Unclassified 1394
355 Ga0207639_10094581 3300026041 Bacteria 2399
356 Ga0207678_10114692 3300026067 Bacteria 2298
357 Ga0207678_10539195 3300026067 Bacteria 1020
358 Ga0207708_10004340 3300026075 Bacteria 10445
359 Ga0207702_10092577 3300026078 Bacteria 2649
360 Ga0207702_10348230 3300026078 Bacteria 1417
361 Ga0207702_10476105 3300026078 Bacteria 1215
362 Ga0207702_10775160 3300026078 Bacteria 947
363 Ga0207702_12351949 3300026078 Unclassified 520
364 Ga0207641_10955210 3300026088 Bacteria 853
365 Ga0207676_10016651 3300026095 Bacteria 5325
366 Ga0207674_10199199 3300026116 Bacteria 1952
367 Ga0207674_10475405 3300026116 Bacteria 1208
368 Ga0207674_10894587 3300026116 Bacteria 856
369 Ga0207675_101488216 3300026118 Bacteria 698
370 Ga0207698_10079161 3300026142 Bacteria 2642
371 Ga0207698_10100116 3300026142 Bacteria 2399
372 Ga0207698_10480593 3300026142 Bacteria 1205
373 Ga0207698_10482257 3300026142 Bacteria 1203
374 Ga0207698_10784240 3300026142 Bacteria 954
375 Ga0207698_11153313 3300026142 Bacteria 788
376 Ga0207428_10562948 3300027907 Bacteria 823
377 Ga0207428_10977921 3300027907 Bacteria 595
378 Ga0268266_10115220 3300028379 Bacteria 2386
379 Ga0265319_1192764 3300028563 Bacteria 626
380 Ga0265327_10046320 3300031251 Bacteria 2303
381 Ga0265327_10113236 3300031251 Bacteria 1293
382 Ga0307408_100495219 3300031548 Bacteria 1069
383 Ga0307410_10214493 3300031852 Bacteria 1477
384 Ga0307409_100300535 3300031995 Bacteria 1493
385 Ga0307409_100430449 3300031995 Bacteria 1268
386 Ga0307409_100803505 3300031995 Bacteria 948
387 Ga0307409_102283537 3300031995 Bacteria 570
388 Ga0307416_100039339 3300032002 Bacteria 3660
389 Ga0307416_100502949 3300032002 Unclassified 1277
390 Ga0307416_103471767 3300032002 Unclassified 527
391 Ga0307414_10593139 3300032004 Bacteria 993
392 Ga0307411_10790334 3300032005 Bacteria 835
393 Ga0373956_0411268 3300035119 Unclassified 645
394 Ga0373943_0155203 3300035170 Bacteria 1243
395 Ga0373943_0728591 3300035170 Unclassified 588
396 Ga0373946_0094931 3300035171 Bacteria 1328
397 Ga0373935_1265503 3300035692 Unclassified 550
398 Ga0373927_0521211 3300035695 Bacteria 786
399 Ga0373933_0042533 3300035724 Bacteria 2686
400 Ga0373933_0264819 3300035724 Bacteria 1109
401 Ga0373947_0004284 3300035725 Bacteria 8379
402 Ga0373947_0382163 3300035725 Unclassified 948
403 Ga0373947_0599111 3300035725 Unclassified 751
404 Ga0373937_0015707 3300036401 Bacteria 6704
405 Ga0373937_0183361 3300036401 Bacteria 1966
406 Ga0373937_1320582 3300036401 Unclassified 669
407 Ga0373925_0059214 3300037068 Bacteria 2873
408 Ga0395899_0095060 3300037312 Bacteria 2156
409 Ga0395899_0242323 3300037312 Bacteria 1240
410 Ga0395899_0257633 3300037312 Bacteria 1194
411 Ga0395900_0004581 3300037418 Bacteria 14587
412 Ga0395900_0011165 3300037418 Bacteria 9184
413 Ga0395900_0025308 3300037418 Bacteria 6077
414 Ga0395900_0066519 3300037418 Bacteria 3703
415 Ga0395900_0231179 3300037418 Bacteria 1859
416 Ga0395900_0292369 3300037418 Bacteria 1618
417 Ga0395900_0448972 3300037418 Bacteria 1246
418 Ga0395900_0485459 3300037418 Bacteria 1187
419 Ga0395900_0592182 3300037418 Bacteria 1050
420 Ga0395900_0895444 3300037418 Bacteria 811
421 Ga0395900_0933366 3300037418 Unclassified 790
422 Ga0395900_1357795 3300037418 Unclassified 624
423 Ga0395898_0015468 3300037466 Bacteria 7826
424 Ga0395898_0209797 3300037466 Bacteria 1858
425 Ga0395898_0213695 3300037466 Bacteria 1840
426 Ga0395898_0276144 3300037466 Bacteria 1603
427 Ga0395898_0296870 3300037466 Bacteria 1541
428 Ga0395898_0315653 3300037466 Bacteria 1491
429 Ga0395898_0444593 3300037466 Bacteria 1235
430 Ga0395898_1181058 3300037466 Bacteria 697
431 Ga0395898_1566391 3300037466 Unclassified 584
432 Ga0395898_1634979 3300037466 Bacteria 568
433 Ga0395898_1646229 3300037466 Unclassified 565
434 Ga0395905_0129871 3300037471 Bacteria 2370
435 Ga0395905_0204536 3300037471 Bacteria 1851
436 Ga0395905_0451682 3300037471 Bacteria 1183
437 Ga0395905_0808176 3300037471 Unclassified 841
438 Ga0395905_0843201 3300037471 Archaea 819
439 Ga0395905_0943965 3300037471 Bacteria 765
440 Ga0395905_1387646 3300037471 Bacteria 607
441 Ga0436364_1414925 3300037853 Bacteria 4145
442 Ga0395901_0090556 3300038443 Bacteria 3201
443 Ga0395901_0097434 3300038443 Unclassified 3083
444 Ga0395901_0119515 3300038443 Bacteria 2769
445 Ga0395901_0147624 3300038443 Bacteria 2471
446 Ga0395901_0164572 3300038443 Bacteria 2329
447 Ga0395901_0179164 3300038443 Bacteria 2223
448 Ga0395901_0228817 3300038443 Bacteria 1942
449 Ga0395901_0299014 3300038443 Bacteria 1669
450 Ga0395901_0399670 3300038443 Bacteria 1412
451 Ga0395901_0632944 3300038443 Unclassified 1075
452 Ga0395901_0709784 3300038443 Unclassified 1002
453 Ga0395901_1140794 3300038443 Unclassified 748
454 Ga0242420_059446 3300038996 Bacteria 760
455 Ga0436365_0714445 3300039437 Bacteria 7977
456 Ga0436362_0503031 3300039453 Bacteria 5085
457 Ga0439466_0033431 3300041411 Bacteria 1747
458 Ga0439455_0008465 3300042012 Bacteria 2207
459 Ga0450900_018817 3300042136 Bacteria 950
460 Ga0450902_022454 3300042137 Unclassified 1045
461 Ga0450905_030199 3300042142 Bacteria 833
462 Ga0439458_0007645 3300042157 Bacteria 2407
463 Ga0450916_024826 3300042530 Unclassified 843
464 Ga0466972_0138629 3300044658 Bacteria 1145
465 Ga0466965_0249811 3300044683 Bacteria 951
466 Ga0466966_0068629 3300044684 Bacteria 2225
467 Ga0466961_0190762 3300044693 Bacteria 1270
468 Ga0466961_0461301 3300044693 Unclassified 769
469 Ga0466961_0772080 3300044693 Bacteria 574
470 Ga0466963_0000216 3300044694 Bacteria 24575
471 Ga0466963_0003034 3300044694 Bacteria 9508
472 Ga0466963_0005085 3300044694 Bacteria 7689
473 Ga0466963_0010001 3300044694 Bacteria 5733
474 Ga0466963_0018759 3300044694 Bacteria 4330
475 Ga0466963_0126516 3300044694 Bacteria 1762
476 Ga0466963_0216514 3300044694 Bacteria 1341
477 Ga0466963_0246636 3300044694 Bacteria 1253
478 Ga0466963_0346027 3300044694 Bacteria 1047
479 Ga0466963_0457372 3300044694 Bacteria 901
480 Ga0466964_0129995 3300044706 Unclassified 1146
481 Ga0466964_0208506 3300044706 Unclassified 942
482 Ga0466964_0414133 3300044706 Unclassified 707
483 Ga0466964_0462187 3300044706 Bacteria 675
484 Ga0466964_0594332 3300044706 Unclassified 606
485 Ga0466971_0332830 3300044719 Bacteria 733
486 Ga0466968_0042855 3300044735 Unclassified 1914
487 Ga0466968_0045852 3300044735 Bacteria 1856
488 Ga0466968_0370131 3300044735 Bacteria 699
489 Ga0466968_0385825 3300044735 Bacteria 685
490 Ga0466957_0008644 3300044842 Bacteria 5798
491 Ga0466957_0128365 3300044842 Bacteria 1622
492 Ga0466957_0517889 3300044842 Bacteria 828
493 Ga0466957_0586223 3300044842 Bacteria 780
494 Ga0466957_0687716 3300044842 Bacteria 721
495 Ga0466960_0005077 3300044901 Bacteria 5201
496 Ga0466960_0100085 3300044901 Bacteria 1491
497 Ga0466959_0006508 3300045049 Bacteria 8097
498 Ga0466959_0417787 3300045049 Bacteria 911
499 Ga0466958_0000593 3300045836 Bacteria 15427
500 Ga0466958_0003623 3300045836 Bacteria 8053
501 Ga0466958_0015716 3300045836 Bacteria 4344
502 Ga0466958_0020469 3300045836 Bacteria 3858
503 Ga0466958_0049299 3300045836 Bacteria 2547
504 Ga0466958_0573156 3300045836 Bacteria 734
505 Ga0466958_0582133 3300045836 Bacteria 728
506 Ga0466958_0670181 3300045836 Bacteria 675
507 Ga0466958_0965171 3300045836 Unclassified 556
508 Ga0466967_0001892 3300045976 Bacteria 12648
509 Ga0466967_0002719 3300045976 Bacteria 11183
510 Ga0466967_0015893 3300045976 Bacteria 5915
511 Ga0466967_0031509 3300045976 Bacteria 4464
512 Ga0466967_0052537 3300045976 Bacteria 3577
513 Ga0466967_0060617 3300045976 Bacteria 3354
514 Ga0466967_0104194 3300045976 Bacteria 2596
515 Ga0466967_0135177 3300045976 Bacteria 2292
516 Ga0466967_0154456 3300045976 Bacteria 2148
517 Ga0466967_0205434 3300045976 Bacteria 1867
518 Ga0466967_0217773 3300045976 Unclassified 1813
519 Ga0466967_0312411 3300045976 Bacteria 1514
520 Ga0466967_0404872 3300045976 Bacteria 1328
521 Ga0466967_1023843 3300045976 Bacteria 822
522 Ga0466967_1086748 3300045976 Unclassified 797
523 Ga0466967_2603886 3300045976 Bacteria 500
524 Ga0495592_0097932 3300046454 Bacteria 2094
525 Ga0495592_0410992 3300046454 Bacteria 855
526 Ga0495592_0494431 3300046454 Bacteria 760
527 Ga0495629_0296914 3300046459 Bacteria 1107
528 Ga0495641_0271985 3300046461 Bacteria 762
529 Ga0495641_0443650 3300046461 Unclassified 590
530 Ga0495651_0033867 3300046462 Bacteria 3983
531 Ga0495664_0309778 3300046477 Bacteria 953
532 Ga0495608_0023197 3300046511 Bacteria 4254
533 Ga0495618_0042778 3300046514 Bacteria 2857
534 Ga0495630_0564603 3300046517 Bacteria 873
535 Ga0495644_0421967 3300046523 Bacteria 529
536 Ga0495652_0716798 3300046529 Unclassified 672
537 Ga0495665_0371739 3300046531 Unclassified 727
538 Ga0495640_0152776 3300046533 Bacteria 1482
539 Ga0495586_0359032 3300046535 Bacteria 837
540 Ga0495645_0295261 3300046543 Bacteria 1061
541 Ga0495645_0660488 3300046543 Bacteria 638
542 Ga0495667_0180112 3300046559 Bacteria 1356
543 Ga0495634_0041306 3300046642 Bacteria 3133
544 Ga0495634_0522562 3300046642 Bacteria 694
545 Ga0495635_0228437 3300046663 Bacteria 1257
546 Ga0495588_0168716 3300046674 Bacteria 1157
547 Ga0495588_0297663 3300046674 Bacteria 850
548 Ga0495657_0268632 3300046675 Bacteria 1023
549 Ga0495599_0324716 3300046678 Unclassified 926
550 Ga0495646_0180033 3300046680 Bacteria 1161
551 Ga0495647_0260027 3300046681 Bacteria 774
552 Ga0495658_0417283 3300046683 Unclassified 856
553 Ga0495658_1119664 3300046683 Bacteria 502
554 Ga0495613_0074441 3300046689 Bacteria 2473
555 Ga0495613_0468342 3300046689 Bacteria 852
556 Ga0495613_0662349 3300046689 Archaea 690
557 Ga0495624_0210750 3300046690 Bacteria 1179
558 Ga0495624_0754124 3300046690 Unclassified 576
559 Ga0495589_0210840 3300046794 Bacteria 915
560 Ga0495600_0147051 3300046809 Bacteria 1527
561 Ga0495581_0135800 3300047315 Bacteria 1434
562 Ga0495581_0573474 3300047315 Bacteria 654
563 Ga0495674_0036626 3300047319 Bacteria 4415
564 Ga0495674_0500437 3300047319 Bacteria 972
565 Ga0495676_0199751 3300047321 Bacteria 1390
566 Ga0495680_0004651 3300047322 Bacteria 13073
567 Ga0495680_0198603 3300047322 Bacteria 1440
568 Ga0495684_0004177 3300047471 Bacteria 11278
569 Ga0495684_0066144 3300047471 Bacteria 2748
570 Ga0495593_0314921 3300047673 Unclassified 782
571 Ga0495602_0186632 3300048088 Bacteria 1594
572 Ga0495614_0318385 3300048089 Bacteria 721
573 Ga0496100_0626616 3300048903 Bacteria 836
574 Ga0496101_0101004 3300048904 Bacteria 2159
575 Ga0496101_0103308 3300048904 Bacteria 2136
576 Ga0496101_0189906 3300048904 Bacteria 1585
577 Ga0496101_0846960 3300048904 Bacteria 720
578 Ga0496102_0136172 3300048905 Bacteria 2301
579 Ga0496102_0147304 3300048905 Unclassified 2210
580 Ga0496102_0155881 3300048905 Unclassified 2147
581 Ga0496102_0176698 3300048905 Bacteria 2011
582 Ga0496102_0215673 3300048905 Bacteria 1809
583 Ga0496102_0853379 3300048905 Bacteria 833
584 Ga0496103_0040413 3300048906 Bacteria 2866
585 Ga0496103_0066619 3300048906 Bacteria 2248
586 Ga0496103_0075598 3300048906 Bacteria 2113
587 Ga0496104_0001747 3300048907 Bacteria 18769
588 Ga0496104_0028656 3300048907 Bacteria 5161
589 Ga0496104_0075088 3300048907 Bacteria 3219
590 Ga0496104_0106822 3300048907 Bacteria 2683
591 Ga0496104_0985603 3300048907 Bacteria 747
592 Ga0496104_1147947 3300048907 Unclassified 680
593 Ga0496105_0025625 3300048908 Bacteria 4803
594 Ga0496105_0193978 3300048908 Bacteria 1660
595 Ga0496105_0289079 3300048908 Bacteria 1320
596 Ga0496105_0458827 3300048908 Bacteria 1005
597 Ga0496105_0711051 3300048908 Bacteria 770
598 Ga0496106_0052338 3300048909 Bacteria 3080
599 Ga0496106_0070185 3300048909 Bacteria 2675
600 Ga0496106_0947125 3300048909 Unclassified 679
601 Ga0496107_0038063 3300048910 Bacteria 3452
602 Ga0496107_0221789 3300048910 Bacteria 1407
603 Ga0496108_0050444 3300048911 Bacteria 3483
604 Ga0496108_0091404 3300048911 Bacteria 2587
605 Ga0496108_0780668 3300048911 Bacteria 825
606 Ga0496108_1280866 3300048911 Bacteria 617
607 Ga0496109_0013462 3300048912 Bacteria 7097
608 Ga0496109_0032837 3300048912 Bacteria 4668
609 Ga0496109_0037943 3300048912 Bacteria 4354
610 Ga0496109_0448200 3300048912 Unclassified 1219
611 Ga0496109_1004806 3300048912 Unclassified 772
612 Ga0496109_1259789 3300048912 Bacteria 676
613 Ga0496109_1432998 3300048912 Unclassified 626
614 Ga0496110_0001864 3300048913 Bacteria 15575
615 Ga0496110_0028523 3300048913 Bacteria 4795
616 Ga0496110_0096882 3300048913 Bacteria 2643
617 Ga0496110_0988260 3300048913 Unclassified 749
618 Ga0496110_1783730 3300048913 Bacteria 525
619 Ga0496111_0021517 3300048914 Bacteria 4505
620 Ga0496111_0022564 3300048914 Unclassified 4409
621 Ga0496111_0156637 3300048914 Bacteria 1690
622 Ga0496112_0019502 3300048915 Bacteria 6402
623 Ga0496112_0040963 3300048915 Bacteria 4530
624 Ga0496112_0057344 3300048915 Bacteria 3834
625 Ga0496112_0239346 3300048915 Bacteria 1768
626 Ga0496112_0300756 3300048915 Bacteria 1550
627 Ga0496112_0331432 3300048915 Bacteria 1466
628 Ga0496112_0349788 3300048915 Bacteria 1420
629 Ga0496112_0506222 3300048915 Bacteria 1143
630 Ga0496112_0624393 3300048915 Bacteria 1008
631 Ga0496112_1031889 3300048915 Bacteria 742
632 Ga0496113_0011096 3300048916 Bacteria 5992
633 Ga0496113_0216977 3300048916 Bacteria 1524
634 Ga0496113_0610324 3300048916 Unclassified 873
635 Ga0496113_0918490 3300048916 Bacteria 692
636 Ga0496113_1250790 3300048916 Bacteria 578
637 Ga0496113_1258954 3300048916 Unclassified 576
638 Ga0496114_0018442 3300048917 Bacteria 5642
639 Ga0496114_0062984 3300048917 Bacteria 3105
640 Ga0496114_0197765 3300048917 Bacteria 1760
641 Ga0496114_0200325 3300048917 Bacteria 1749
642 Ga0501032_0004469 3300049569 Bacteria 10534
643 Ga0501033_0000620 3300049570 Bacteria 32902
644 Ga0501034_0402007 3300049571 Bacteria 1292
645 Ga0501036_0000199 3300049572 Bacteria 39810
646 Ga0501036_0081141 3300049572 Bacteria 2741
647 Ga0501036_0525277 3300049572 Unclassified 984
648 Ga0501036_1274849 3300049572 Bacteria 598
649 Ga0501037_0000502 3300049573 Bacteria 31651
650 Ga0501038_0000536 3300049574 Bacteria 33408
651 Ga0501038_0195265 3300049574 Bacteria 1627
652 Ga0501039_0000244 3300049575 Bacteria 39686
653 Ga0501040_0000131 3300049576 Bacteria 39844
654 Ga0501040_0181767 3300049576 Bacteria 1491
655 Ga0501040_0762000 3300049576 Unclassified 700
656 Ga0501041_0000057 3300049577 Bacteria 40833
657 Ga0501041_0560543 3300049577 Unclassified 728
658 Ga0501042_0000219 3300049578 Bacteria 27244
659 Ga0501043_0000969 3300049579 Bacteria 25396
660 Ga0501046_0001266 3300049580 Bacteria 24488
661 Ga0501046_0533255 3300049580 Bacteria 838
662 Ga0501047_0003817 3300049581 Bacteria 14166
663 Ga0501048_0000427 3300049582 Bacteria 29599
664 Ga0501048_0605823 3300049582 Bacteria 786
665 Ga0501067_0001469 3300049583 Bacteria 12801
666 Ga0501067_0012155 3300049583 Bacteria 4773
667 Ga0501067_0094852 3300049583 Bacteria 1656
668 Ga0501067_0174377 3300049583 Bacteria 1198
669 Ga0501068_0000209 3300049584 Bacteria 28255
670 Ga0501068_0000557 3300049584 Bacteria 18931
671 Ga0501069_0001116 3300049585 Bacteria 12961
672 Ga0501069_0011197 3300049585 Bacteria 4757
673 Ga0501069_0322268 3300049585 Bacteria 908
674 Ga0501069_0378436 3300049585 Unclassified 836
675 Ga0501069_0379923 3300049585 Bacteria 834
676 Ga0501069_0489364 3300049585 Bacteria 733
677 Ga0501069_0512847 3300049585 Bacteria 716
678 Ga0501070_0002942 3300049586 Bacteria 14829
679 Ga0501071_0000177 3300049587 Bacteria 28212
680 Ga0501072_0000350 3300049588 Bacteria 32841
681 Ga0501072_0019140 3300049588 Bacteria 5289
682 Ga0501072_1053472 3300049588 Unclassified 633
683 Ga0501073_0006956 3300049589 Bacteria 8423
684 Ga0501073_1223807 3300049589 Unclassified 515
685 Ga0501074_0000106 3300049590 Bacteria 40924
686 Ga0501074_0186091 3300049590 Bacteria 1481
687 Ga0501074_0503581 3300049590 Bacteria 858
688 Ga0501075_0000127 3300049591 Bacteria 37478
689 Ga0501075_0058257 3300049591 Bacteria 2909
690 Ga0501075_0670811 3300049591 Unclassified 790
691 Ga0501076_0000524 3300049592 Bacteria 24362
692 Ga0501076_0065182 3300049592 Bacteria 2904
693 Ga0501076_0078029 3300049592 Bacteria 2657
694 Ga0501077_0000230 3300049593 Bacteria 32925
695 Ga0501077_0225403 3300049593 Bacteria 1191
696 Ga0501259_126057 3300049688 Bacteria 614
697 Ga0501079_0000239 3300049741 Bacteria 33053
698 Ga0501079_0134397 3300049741 Bacteria 1925
699 Ga0501080_0000538 3300049742 Bacteria 29769
700 Ga0501081_0000066 3300049743 Bacteria 40032
701 Ga0501081_0353168 3300049743 Bacteria 1084
702 Ga0501081_1357597 3300049743 Bacteria 539
703 Ga0501083_0000328 3300049744 Bacteria 30083
704 Ga0501035_0010284 3300049822 Bacteria 8678
705 Ga0501035_0355086 3300049822 Bacteria 1226
706 Ga0501044_0008232 3300049823 Bacteria 11439
707 Ga0501044_0837448 3300049823 Bacteria 797
708 Ga0501045_0000114 3300049824 Bacteria 40806
709 Ga0501045_1071156 3300049824 Unclassified 590
710 nmdc:mga06z11_903648_c1 3300050494 Bacteria 538
711 nmdc:mga08y16_2177956_c1 3300050511 Bacteria 501
712 nmdc:mga08y16_224248_c1 3300050511 Bacteria 1945
713 nmdc:mga08y16_751833_c1 3300050511 Bacteria 971
714 Ga0495595_0013673 3300053084 Bacteria 3432
715 Ga0495595_0345716 3300053084 Bacteria 750
716 Ga0495619_0013887 3300053085 Bacteria 5082
717 Ga0495619_0043485 3300053085 Bacteria 2945
718 Ga0495619_0140202 3300053085 Bacteria 1664
719 Ga0495619_0183732 3300053085 Unclassified 1447
720 Ga0495619_0261314 3300053085 Bacteria 1200
721 Ga0501084_0000247 3300054114 Bacteria 40897
722 Ga0501084_0764231 3300054114 Bacteria 814
723 Ga0501084_0970026 3300054114 Unclassified 715
724 Ga0501084_1611718 3300054114 Unclassified 543
725 Ga0501082_0001708 3300060353 Bacteria 19373
726 Ga0501082_1673284 3300060353 Unclassified 555
727 Ga0466962_0013379 3300061719 Bacteria 3950
728 Ga0466962_0072213 3300061719 Bacteria 1649
729 Ga0466962_0073234 3300061719 Bacteria 1637
730 Ga0466962_0216355 3300061719 Bacteria 938
731 Ga0530510_0000154 3300061734 Bacteria 41103
732 Ga0530510_0233825 3300061734 Bacteria 1367
733 Ga0530510_0641643 3300061734 Bacteria 808
734 Ga0530510_0649341 3300061734 Bacteria 803
735 Ga0530510_0744263 3300061734 Bacteria 747
736 Ga0163162_12741088
737 Ga0058863_11887458
738 Ga0058863_11969170
739 Ga0058862_12785444
740 Ga0070658_10028767
741 Ga0070658_10037593
742 Ga0070658_10088033
743 Ga0070658_10135193
744 Ga0070658_10833558
745 Ga0070676_10180510
746 Ga0070683_100024243
747 Ga0070683_100045247
748 Ga0070683_100095223
749 Ga0070683_100104626
750 Ga0070683_100105514
751 Ga0070683_100145689
752 Ga0070683_100845746
753 Ga0070683_100919779
754 Ga0070683_101028966
755 Ga0068869_100135053
756 Ga0068869_100467508
757 Ga0070680_100149222
758 Ga0070680_100194298
759 Ga0070680_100243211
760 Ga0070680_100254713
761 Ga0070680_100286796
762 Ga0070680_100639190
763 Ga0070680_101607608
764 Ga0070682_100003617
765 Ga0070682_100094064
766 Ga0070682_100098898
767 Ga0070682_100145037
768 Ga0070682_100231603
769 Ga0070682_100305031
770 Ga0068868_100002722
771 Ga0068868_100297367
772 Ga0070660_100021983
773 Ga0070660_100043162
774 Ga0070660_100045449
775 Ga0070660_100071645
776 Ga0070660_100156364
777 Ga0070660_100180976
778 Ga0070660_100302623
779 Ga0070660_100842708
780 Ga0070689_101199616
781 Ga0070691_10021193
782 Ga0070691_10101556
783 Ga0070691_10429585
784 Ga0070691_10510756
785 Ga0070661_100107893
786 Ga0070661_100263177
787 Ga0070661_100664842
788 Ga0070692_10023499
789 Ga0070692_10195641
790 Ga0070668_100022237
791 Ga0070675_100069498
792 Ga0070675_100134491
793 Ga0070675_100841378
794 Ga0070671_100889775
795 Ga0070674_100028515
796 Ga0070674_101305776
797 Ga0070673_100030903
798 Ga0070673_101687722
799 Ga0070688_100122312
800 Ga0070659_100012568
801 Ga0070659_100067489
802 Ga0070659_100170452
803 Ga0070659_101023301
804 Ga0070667_100401911
805 Ga0070714_100003759
806 Ga0070714_100015438
807 Ga0070714_100027273
808 Ga0070714_100262986
809 Ga0070714_100417547
810 Ga0070714_100750998
811 Ga0070714_100773884
812 Ga0070714_101430391
813 Ga0070713_100175556
814 Ga0070713_100281881
815 Ga0070713_102432328
816 Ga0070710_11497660
817 Ga0070711_100118777
818 Ga0070711_101343873
819 Ga0070711_101729083
820 Ga0070700_100003285
821 Ga0070708_100294203
822 Ga0070708_101511273
823 Ga0070663_100089618
824 Ga0070678_102037178
825 Ga0070662_100168427
826 Ga0070662_100851797
827 Ga0070681_10019834
828 Ga0070681_10027616
829 Ga0070681_10063034
830 Ga0070681_10082524
831 Ga0070681_10163367
832 Ga0070681_10170615
833 Ga0070681_11124176
834 Ga0070681_11408258
835 Ga0070681_11460557
836 Ga0070685_11083086
837 Ga0070707_100117955
838 Ga0070707_100243545
839 Ga0070679_100059898
840 Ga0070679_100113593
841 Ga0070679_100162369
842 Ga0070679_100173870
843 Ga0070679_100230726
844 Ga0070679_100317051
845 Ga0070679_100345152
846 Ga0070679_100411174
847 Ga0070679_100757328
848 Ga0070684_100151667
849 Ga0070684_100158673
850 Ga0070684_100180207
851 Ga0070684_100217182
852 Ga0070684_100381604
853 Ga0070684_100430603
854 Ga0070684_100696789
855 Ga0070697_100073637
856 Ga0068853_100345634
857 Ga0068853_101102403
858 Ga0070672_100109508
859 Ga0070695_100000424
860 Ga0070695_100418808
861 Ga0070695_100542678
862 Ga0070696_100728216
863 Ga0070696_100830485
864 Ga0070696_101118310
865 Ga0070693_100131152
866 Ga0070665_100981321
867 Ga0070704_100035743
868 Ga0070704_101229042
869 Ga0068855_100024401
870 Ga0068855_100473650
871 Ga0068855_101117966
872 Ga0070664_100017827
873 Ga0070664_100805857
874 Ga0068857_100167217
875 Ga0068857_100211595
876 Ga0068857_100724882
877 Ga0068854_100015199
878 Ga0068854_100073504
879 Ga0068856_100099760
880 Ga0068856_100313779
881 Ga0068856_100396661
882 Ga0068856_100492545
883 Ga0068856_101250953
884 Ga0068856_102124651
885 Ga0068856_102194946
886 Ga0068852_100044491
887 Ga0068852_100065308
888 Ga0068852_100066403
889 Ga0068852_100937476
890 Ga0068852_101297772
891 Ga0068852_101759431
892 Ga0068852_102685395
893 Ga0068864_100003052
894 Ga0068866_10220791
895 Ga0068861_102557638
896 Ga0068851_10191492
897 Ga0068870_10091516
898 Ga0068863_100104515
899 Ga0068860_101469953
900 Ga0068862_101419813
901 Ga0081540_1183454
902 Ga0081539_10002145
903 Ga0070717_11068370
904 Ga0075432_10459239
905 Ga0070716_100930663
906 Ga0070716_101079309
907 Ga0070712_100024952
908 Ga0070712_100124127
909 Ga0070712_101270422
910 Ga0070712_101469820
911 Ga0075367_10757074
912 Ga0068871_101033495
913 Ga0075434_100473228
914 Ga0075434_101374530
915 Ga0068865_100054573
916 Ga0068865_100980691
917 Ga0075436_100981836
918 Ga0105240_10392022
919 Ga0105240_10450840
920 Ga0105240_11083047
921 Ga0111539_10117023
922 Ga0111539_10503244
923 Ga0111539_12212698
924 Ga0105245_10000399
925 Ga0105245_10379328
926 Ga0105247_11648270
927 Ga0114129_10385690
928 Ga0105243_10222697
929 Ga0105243_10872160
930 Ga0105241_10594355
931 Ga0105241_11260218
932 Ga0105242_10318268
933 Ga0105248_10516278
934 Ga0105237_10232835
935 Ga0105237_11194911
936 Ga0105238_10160174
937 Ga0105238_12012050
938 Ga0105249_10019741
939 Ga0105239_10018477
940 Ga0105239_10045428
941 Ga0105239_10203384
942 Ga0105239_10400788
943 Ga0105246_10951589
944 Ga0157373_10218392
945 Ga0157373_10340904
946 Ga0157371_10007707
947 Ga0157371_10392050
948 Ga0157371_10556306
949 Ga0157370_10027338
950 Ga0157370_10266165
951 Ga0157370_10385316
952 Ga0157369_10056135
953 Ga0157369_10256765
954 Ga0157374_10007591
955 Ga0163162_11044232
956 Ga0157372_10028691
957 Ga0157372_10175113
958 Ga0157372_10196317
959 Ga0157372_10216606
960 Ga0157372_10267892
961 Ga0157372_10278829
962 Ga0157372_10512645
963 Ga0157372_10734983
964 Ga0157372_10857134
965 Ga0157372_10962308
966 Ga0157375_10301920
967 Ga0157375_10646039
968 Ga0163163_10127520
969 Ga0157380_10088592
970 Ga0157380_10199880
971 Ga0182008_10071020
972 Ga0157377_10000878
973 Ga0157377_10074132
974 Ga0157377_10574285
975 Ga0157379_10885460
976 Ga0157376_10126481
977 Ga0182007_10085700
978 Ga0206356_10568753
979 Ga0206354_10111116
980 Ga0206354_10807369
981 Ga0206354_11165720
982 Ga0206353_10500991
983 Ga0206353_10561511
984 Ga0206353_10597767
985 Ga0206353_10692593
986 Ga0206353_11837998
987 Ga0213873_10003537
988 Ga0213876_10073180
989 Ga0207656_10141806
990 Ga0207692_10041981
991 Ga0207642_10078569
992 Ga0207688_10003554
993 Ga0207688_10533989
994 Ga0207647_10191463
995 Ga0207705_10032205
996 Ga0207705_10042066
997 Ga0207705_10048413
998 Ga0207705_10065301
999 Ga0207707_10056972
1000 Ga0207707_10088548
1001 Ga0207707_10354756
1002 Ga0207707_10410964
1003 Ga0207707_10432908
1004 Ga0207707_10530868
1005 Ga0207707_10982138
1006 Ga0207695_10663629
1007 Ga0207671_10236747
1008 Ga0207693_10037709
1009 Ga0207693_10042999
1010 Ga0207693_10303001
1011 Ga0207693_11035537
1012 Ga0207663_10186527
1013 Ga0207660_10148624
1014 Ga0207660_10268051
1015 Ga0207660_10360002
1016 Ga0207660_10482925
1017 Ga0207660_11036180
1018 Ga0207657_10000616
1019 Ga0207657_10005027
1020 Ga0207657_10062173
1021 Ga0207657_10095206
1022 Ga0207657_10140046
1023 Ga0207657_10198000
1024 Ga0207657_10396320
1025 Ga0207649_10209560
1026 Ga0207649_10308715
1027 Ga0207649_10541379
1028 Ga0207649_11221560
1029 Ga0207652_10028796
1030 Ga0207652_10086073
1031 Ga0207652_10087925
1032 Ga0207652_10188661
1033 Ga0207652_10267587
1034 Ga0207652_10271086
1035 Ga0207652_10633682
1036 Ga0207652_10681217
1037 Ga0207652_10789622
1038 Ga0207646_10228539
1039 Ga0207694_10346539
1040 Ga0207659_10053517
1041 Ga0207659_10298396
1042 Ga0207687_10343121
1043 Ga0207700_11520229
1044 Ga0207664_10009761
1045 Ga0207664_10272831
1046 Ga0207664_11116013
1047 Ga0207664_11241722
1048 Ga0207664_11880517
1049 Ga0207644_10581977
1050 Ga0207690_10046129
1051 Ga0207690_10154865
1052 Ga0207690_10186296
1053 Ga0207690_10553279
1054 Ga0207690_11076450
1055 Ga0207706_10020489
1056 Ga0207706_10190826
1057 Ga0207706_10261017
1058 Ga0207686_10659301
1059 Ga0207709_10841938
1060 Ga0207670_11275158
1061 Ga0207704_10227371
1062 Ga0207704_10632007
1063 Ga0207665_10289241
1064 Ga0207691_10444743
1065 Ga0207689_10094428
1066 Ga0207661_10007076
1067 Ga0207661_10261792
1068 Ga0207661_10351850
1069 Ga0207661_10356983
1070 Ga0207661_10644426
1071 Ga0207661_10740590
1072 Ga0207661_10939683
1073 Ga0207679_10611392
1074 Ga0207679_10650753
1075 Ga0207679_11466560
1076 Ga0207667_10339094
1077 Ga0207667_10389575
1078 Ga0207667_10523801
1079 Ga0207667_10810118
1080 Ga0207651_10075564
1081 Ga0207712_10258022
1082 Ga0207712_11162185
1083 Ga0207668_10729513
1084 Ga0207640_10086859
1085 Ga0207640_10336778
1086 Ga0207640_10647259
1087 Ga0207658_10136068
1088 Ga0207677_10018268
1089 Ga0207677_10268414
1090 Ga0207639_10094581
1091 Ga0207678_10114692
1092 Ga0207678_10539195
1093 Ga0207708_10004340
1094 Ga0207702_10092577
1095 Ga0207702_10348230
1096 Ga0207702_10476105
1097 Ga0207702_10775160
1098 Ga0207702_12351949
1099 Ga0207641_10955210
1100 Ga0207676_10016651
1101 Ga0207674_10199199
1102 Ga0207674_10475405
1103 Ga0207674_10894587
1104 Ga0207675_101488216
1105 Ga0207698_10079161
1106 Ga0207698_10100116
1107 Ga0207698_10480593
1108 Ga0207698_10482257
1109 Ga0207698_10784240
1110 Ga0207698_11153313
1111 Ga0207428_10562948
1112 Ga0207428_10977921
1113 Ga0268266_10115220
1114 Ga0265319_1192764
1115 Ga0265327_10046320
1116 Ga0265327_10113236
1117 Ga0307408_100495219
1118 Ga0307410_10214493
1119 Ga0307409_100300535
1120 Ga0307409_100430449
1121 Ga0307409_100803505
1122 Ga0307409_102283537
1123 Ga0307416_100039339
1124 Ga0307416_100502949
1125 Ga0307416_103471767
1126 Ga0307414_10593139
1127 Ga0307411_10790334
1128 Ga0373956_0411268
1129 Ga0373943_0155203
1130 Ga0373943_0728591
1131 Ga0373946_0094931
1132 Ga0373935_1265503
1133 Ga0373927_0521211
1134 Ga0373933_0042533
1135 Ga0373933_0264819
1136 Ga0373947_0004284
1137 Ga0373947_0382163
1138 Ga0373947_0599111
1139 Ga0373937_0015707
1140 Ga0373937_0183361
1141 Ga0373937_1320582
1142 Ga0373925_0059214
1143 Ga0395899_0095060
1144 Ga0395899_0242323
1145 Ga0395899_0257633
1146 Ga0395900_0004581
1147 Ga0395900_0011165
1148 Ga0395900_0025308
1149 Ga0395900_0066519
1150 Ga0395900_0231179
1151 Ga0395900_0292369
1152 Ga0395900_0448972
1153 Ga0395900_0485459
1154 Ga0395900_0592182
1155 Ga0395900_0895444
1156 Ga0395900_0933366
1157 Ga0395900_1357795
1158 Ga0395898_0015468
1159 Ga0395898_0209797
1160 Ga0395898_0213695
1161 Ga0395898_0276144
1162 Ga0395898_0296870
1163 Ga0395898_0315653
1164 Ga0395898_0444593
1165 Ga0395898_1181058
1166 Ga0395898_1566391
1167 Ga0395898_1634979
1168 Ga0395898_1646229
1169 Ga0395905_0129871
1170 Ga0395905_0204536
1171 Ga0395905_0451682
1172 Ga0395905_0808176
1173 Ga0395905_0843201
1174 Ga0395905_0943965
1175 Ga0395905_1387646
1176 Ga0436364_1414925
1177 Ga0395901_0090556
1178 Ga0395901_0097434
1179 Ga0395901_0119515
1180 Ga0395901_0147624
1181 Ga0395901_0164572
1182 Ga0395901_0179164
1183 Ga0395901_0228817
1184 Ga0395901_0299014
1185 Ga0395901_0399670
1186 Ga0395901_0632944
1187 Ga0395901_0709784
1188 Ga0395901_1140794
1189 Ga0242420_059446
1190 Ga0436365_0714445
1191 Ga0436362_0503031
1192 Ga0439466_0033431
1193 Ga0439455_0008465
1194 Ga0450900_018817
1195 Ga0450902_022454
1196 Ga0450905_030199
1197 Ga0439458_0007645
1198 Ga0450916_024826
1199 Ga0466972_0138629
1200 Ga0466965_0249811
1201 Ga0466966_0068629
1202 Ga0466961_0190762
1203 Ga0466961_0461301
1204 Ga0466961_0772080
1205 Ga0466963_0000216
1206 Ga0466963_0003034
1207 Ga0466963_0005085
1208 Ga0466963_0010001
1209 Ga0466963_0018759
1210 Ga0466963_0126516
1211 Ga0466963_0216514
1212 Ga0466963_0246636
1213 Ga0466963_0346027
1214 Ga0466963_0457372
1215 Ga0466964_0129995
1216 Ga0466964_0208506
1217 Ga0466964_0414133
1218 Ga0466964_0462187
1219 Ga0466964_0594332
1220 Ga0466971_0332830
1221 Ga0466968_0042855
1222 Ga0466968_0045852
1223 Ga0466968_0370131
1224 Ga0466968_0385825
1225 Ga0466957_0008644
1226 Ga0466957_0128365
1227 Ga0466957_0517889
1228 Ga0466957_0586223
1229 Ga0466957_0687716
1230 Ga0466960_0005077
1231 Ga0466960_0100085
1232 Ga0466959_0006508
1233 Ga0466959_0417787
1234 Ga0466958_0000593
1235 Ga0466958_0003623
1236 Ga0466958_0015716
1237 Ga0466958_0020469
1238 Ga0466958_0049299
1239 Ga0466958_0573156
1240 Ga0466958_0582133
1241 Ga0466958_0670181
1242 Ga0466958_0965171
1243 Ga0466967_0001892
1244 Ga0466967_0002719
1245 Ga0466967_0015893
1246 Ga0466967_0031509
1247 Ga0466967_0052537
1248 Ga0466967_0060617
1249 Ga0466967_0104194
1250 Ga0466967_0135177
1251 Ga0466967_0154456
1252 Ga0466967_0205434
1253 Ga0466967_0217773
1254 Ga0466967_0312411
1255 Ga0466967_0404872
1256 Ga0466967_1023843
1257 Ga0466967_1086748
1258 Ga0466967_2603886
1259 Ga0495592_0097932
1260 Ga0495592_0410992
1261 Ga0495592_0494431
1262 Ga0495629_0296914
1263 Ga0495641_0271985
1264 Ga0495641_0443650
1265 Ga0495651_0033867
1266 Ga0495664_0309778
1267 Ga0495608_0023197
1268 Ga0495618_0042778
1269 Ga0495630_0564603
1270 Ga0495644_0421967
1271 Ga0495652_0716798
1272 Ga0495665_0371739
1273 Ga0495640_0152776
1274 Ga0495586_0359032
1275 Ga0495645_0295261
1276 Ga0495645_0660488
1277 Ga0495667_0180112
1278 Ga0495634_0041306
1279 Ga0495634_0522562
1280 Ga0495635_0228437
1281 Ga0495588_0168716
1282 Ga0495588_0297663
1283 Ga0495657_0268632
1284 Ga0495599_0324716
1285 Ga0495646_0180033
1286 Ga0495647_0260027
1287 Ga0495658_0417283
1288 Ga0495658_1119664
1289 Ga0495613_0074441
1290 Ga0495613_0468342
1291 Ga0495613_0662349
1292 Ga0495624_0210750
1293 Ga0495624_0754124
1294 Ga0495589_0210840
1295 Ga0495600_0147051
1296 Ga0495581_0135800
1297 Ga0495581_0573474
1298 Ga0495674_0036626
1299 Ga0495674_0500437
1300 Ga0495676_0199751
1301 Ga0495680_0004651
1302 Ga0495680_0198603
1303 Ga0495684_0004177
1304 Ga0495684_0066144
1305 Ga0495593_0314921
1306 Ga0495602_0186632
1307 Ga0495614_0318385
1308 Ga0496100_0626616
1309 Ga0496101_0101004
1310 Ga0496101_0103308
1311 Ga0496101_0189906
1312 Ga0496101_0846960
1313 Ga0496102_0136172
1314 Ga0496102_0147304
1315 Ga0496102_0155881
1316 Ga0496102_0176698
1317 Ga0496102_0215673
1318 Ga0496102_0853379
1319 Ga0496103_0040413
1320 Ga0496103_0066619
1321 Ga0496103_0075598
1322 Ga0496104_0001747
1323 Ga0496104_0028656
1324 Ga0496104_0075088
1325 Ga0496104_0106822
1326 Ga0496104_0985603
1327 Ga0496104_1147947
1328 Ga0496105_0025625
1329 Ga0496105_0193978
1330 Ga0496105_0289079
1331 Ga0496105_0458827
1332 Ga0496105_0711051
1333 Ga0496106_0052338
1334 Ga0496106_0070185
1335 Ga0496106_0947125
1336 Ga0496107_0038063
1337 Ga0496107_0221789
1338 Ga0496108_0050444
1339 Ga0496108_0091404
1340 Ga0496108_0780668
1341 Ga0496108_1280866
1342 Ga0496109_0013462
1343 Ga0496109_0032837
1344 Ga0496109_0037943
1345 Ga0496109_0448200
1346 Ga0496109_1004806
1347 Ga0496109_1259789
1348 Ga0496109_1432998
1349 Ga0496110_0001864
1350 Ga0496110_0028523
1351 Ga0496110_0096882
1352 Ga0496110_0988260
1353 Ga0496110_1783730
1354 Ga0496111_0021517
1355 Ga0496111_0022564
1356 Ga0496111_0156637
1357 Ga0496112_0019502
1358 Ga0496112_0040963
1359 Ga0496112_0057344
1360 Ga0496112_0239346
1361 Ga0496112_0300756
1362 Ga0496112_0331432
1363 Ga0496112_0349788
1364 Ga0496112_0506222
1365 Ga0496112_0624393
1366 Ga0496112_1031889
1367 Ga0496113_0011096
1368 Ga0496113_0216977
1369 Ga0496113_0610324
1370 Ga0496113_0918490
1371 Ga0496113_1250790
1372 Ga0496113_1258954
1373 Ga0496114_0018442
1374 Ga0496114_0062984
1375 Ga0496114_0197765
1376 Ga0496114_0200325
1377 Ga0501032_0004469
1378 Ga0501033_0000620
1379 Ga0501034_0402007
1380 Ga0501036_0000199
1381 Ga0501036_0081141
1382 Ga0501036_0525277
1383 Ga0501036_1274849
1384 Ga0501037_0000502
1385 Ga0501038_0000536
1386 Ga0501038_0195265
1387 Ga0501039_0000244
1388 Ga0501040_0000131
1389 Ga0501040_0181767
1390 Ga0501040_0762000
1391 Ga0501041_0000057
1392 Ga0501041_0560543
1393 Ga0501042_0000219
1394 Ga0501043_0000969
1395 Ga0501046_0001266
1396 Ga0501046_0533255
1397 Ga0501047_0003817
1398 Ga0501048_0000427
1399 Ga0501048_0605823
1400 Ga0501067_0001469
1401 Ga0501067_0012155
1402 Ga0501067_0094852
1403 Ga0501067_0174377
1404 Ga0501068_0000209
1405 Ga0501068_0000557
1406 Ga0501069_0001116
1407 Ga0501069_0011197
1408 Ga0501069_0322268
1409 Ga0501069_0378436
1410 Ga0501069_0379923
1411 Ga0501069_0489364
1412 Ga0501069_0512847
1413 Ga0501070_0002942
1414 Ga0501071_0000177
1415 Ga0501072_0000350
1416 Ga0501072_0019140
1417 Ga0501072_1053472
1418 Ga0501073_0006956
1419 Ga0501073_1223807
1420 Ga0501074_0000106
1421 Ga0501074_0186091
1422 Ga0501074_0503581
1423 Ga0501075_0000127
1424 Ga0501075_0058257
1425 Ga0501075_0670811
1426 Ga0501076_0000524
1427 Ga0501076_0065182
1428 Ga0501076_0078029
1429 Ga0501077_0000230
1430 Ga0501077_0225403
1431 Ga0501259_126057
1432 Ga0501079_0000239
1433 Ga0501079_0134397
1434 Ga0501080_0000538
1435 Ga0501081_0000066
1436 Ga0501081_0353168
1437 Ga0501081_1357597
1438 Ga0501083_0000328
1439 Ga0501035_0010284
1440 Ga0501035_0355086
1441 Ga0501044_0008232
1442 Ga0501044_0837448
1443 Ga0501045_0000114
1444 Ga0501045_1071156
1445 nmdc:mga06z11_903648_c1
1446 nmdc:mga08y16_2177956_c1
1447 nmdc:mga08y16_224248_c1
1448 nmdc:mga08y16_751833_c1
1449 Ga0495595_0013673
1450 Ga0495595_0345716
1451 Ga0495619_0013887
1452 Ga0495619_0043485
1453 Ga0495619_0140202
1454 Ga0495619_0183732
1455 Ga0495619_0261314
1456 Ga0501084_0000247
1457 Ga0501084_0764231
1458 Ga0501084_0970026
1459 Ga0501084_1611718
1460 Ga0501082_0001708
1461 Ga0501082_1673284
1462 Ga0466962_0013379
1463 Ga0466962_0072213
1464 Ga0466962_0073234
1465 Ga0466962_0216355
1466 Ga0530510_0000154
1467 Ga0530510_0233825
1468 Ga0530510_0641643
1469 Ga0530510_0649341
1470 Ga0530510_0744263

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

31

148

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8283 5 122
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.8281 4 122
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8159 5 122
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.8103 4 122
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8026 5 120
ID Description Score Start End Superfamily
af_Q10941_1_278_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8682 4 42 3.40.50.2000
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8638 5 122 3.40.1260.10
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8619 4 115 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.857 5 122 3.40.1260.10
af_O01613_18_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8318 4 42 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7W1S265-F1-model_v4 deleted 0.9947 4 84
AF-A0A1H5MH28-F1-model_v4 Predicted peroxiredoxin 0.9925 6 122
AF-A0A6I3IN15-F1-model_v4 Peroxiredoxin 0.9916 5 122
AF-Q0RSC7-F1-model_v4 Uncharacterized protein 0.9907 4 122
AF-A1SLX6-F1-model_v4 Peroxiredoxins-like protein 0.99 5 122

Map