F478198
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 291 | 1470 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_12741088|Ga0163162_127410881 |
| Length | 148 |
| Sequence | MGGIANFTWNDGNRWRSFCASEQEGKMADGKKVVINLATGIEDAERVLVAFLVGGAALEQGKQVAMFLTKDAVRLGLPGQAEGVACEGCPPLERLFEQFADGGGELLVCPICLNSRGLEGTELVPNARVAGATPMWEWAGDDATVFSY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 182 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 183 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 184 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 185 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 291 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 1.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 9.39 |
| Rhizosphere | 89.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_12741088 | 3300013306 | Bacteria | 567 |
| 2 | Ga0058863_11887458 | 3300004799 | Bacteria | 1708 |
| 3 | Ga0058863_11969170 | 3300004799 | Bacteria | 1088 |
| 4 | Ga0058862_12785444 | 3300004803 | Bacteria | 1404 |
| 5 | Ga0070658_10028767 | 3300005327 | Bacteria | 4462 |
| 6 | Ga0070658_10037593 | 3300005327 | Bacteria | 3903 |
| 7 | Ga0070658_10088033 | 3300005327 | Unclassified | 2557 |
| 8 | Ga0070658_10135193 | 3300005327 | Bacteria | 2056 |
| 9 | Ga0070658_10833558 | 3300005327 | Bacteria | 801 |
| 10 | Ga0070676_10180510 | 3300005328 | Bacteria | 1372 |
| 11 | Ga0070683_100024243 | 3300005329 | Bacteria | 5432 |
| 12 | Ga0070683_100045247 | 3300005329 | Bacteria | 4062 |
| 13 | Ga0070683_100095223 | 3300005329 | Bacteria | 2799 |
| 14 | Ga0070683_100104626 | 3300005329 | Bacteria | 2668 |
| 15 | Ga0070683_100105514 | 3300005329 | Bacteria | 2656 |
| 16 | Ga0070683_100145689 | 3300005329 | Bacteria | 2244 |
| 17 | Ga0070683_100845746 | 3300005329 | Bacteria | 877 |
| 18 | Ga0070683_100919779 | 3300005329 | Bacteria | 839 |
| 19 | Ga0070683_101028966 | 3300005329 | Bacteria | 791 |
| 20 | Ga0068869_100135053 | 3300005334 | Bacteria | 1900 |
| 21 | Ga0068869_100467508 | 3300005334 | Bacteria | 1048 |
| 22 | Ga0070680_100149222 | 3300005336 | Bacteria | 1962 |
| 23 | Ga0070680_100194298 | 3300005336 | Bacteria | 1710 |
| 24 | Ga0070680_100243211 | 3300005336 | Bacteria | 1521 |
| 25 | Ga0070680_100254713 | 3300005336 | Bacteria | 1484 |
| 26 | Ga0070680_100286796 | 3300005336 | Bacteria | 1395 |
| 27 | Ga0070680_100639190 | 3300005336 | Bacteria | 914 |
| 28 | Ga0070680_101607608 | 3300005336 | Bacteria | 563 |
| 29 | Ga0070682_100003617 | 3300005337 | Bacteria | 8571 |
| 30 | Ga0070682_100094064 | 3300005337 | Bacteria | 1966 |
| 31 | Ga0070682_100098898 | 3300005337 | Bacteria | 1923 |
| 32 | Ga0070682_100145037 | 3300005337 | Bacteria | 1623 |
| 33 | Ga0070682_100231603 | 3300005337 | Bacteria | 1321 |
| 34 | Ga0070682_100305031 | 3300005337 | Bacteria | 1170 |
| 35 | Ga0068868_100002722 | 3300005338 | Bacteria | 12251 |
| 36 | Ga0068868_100297367 | 3300005338 | Unclassified | 1370 |
| 37 | Ga0070660_100021983 | 3300005339 | Bacteria | 4712 |
| 38 | Ga0070660_100043162 | 3300005339 | Bacteria | 3445 |
| 39 | Ga0070660_100045449 | 3300005339 | Bacteria | 3362 |
| 40 | Ga0070660_100071645 | 3300005339 | Bacteria | 2706 |
| 41 | Ga0070660_100156364 | 3300005339 | Bacteria | 1835 |
| 42 | Ga0070660_100180976 | 3300005339 | Unclassified | 1706 |
| 43 | Ga0070660_100302623 | 3300005339 | Bacteria | 1311 |
| 44 | Ga0070660_100842708 | 3300005339 | Unclassified | 772 |
| 45 | Ga0070689_101199616 | 3300005340 | Bacteria | 681 |
| 46 | Ga0070691_10021193 | 3300005341 | Bacteria | 3006 |
| 47 | Ga0070691_10101556 | 3300005341 | Bacteria | 1429 |
| 48 | Ga0070691_10429585 | 3300005341 | Bacteria | 750 |
| 49 | Ga0070691_10510756 | 3300005341 | Bacteria | 696 |
| 50 | Ga0070661_100107893 | 3300005344 | Bacteria | 2077 |
| 51 | Ga0070661_100263177 | 3300005344 | Bacteria | 1334 |
| 52 | Ga0070661_100664842 | 3300005344 | Bacteria | 846 |
| 53 | Ga0070692_10023499 | 3300005345 | Bacteria | 3021 |
| 54 | Ga0070692_10195641 | 3300005345 | Bacteria | 1181 |
| 55 | Ga0070668_100022237 | 3300005347 | Bacteria | 4793 |
| 56 | Ga0070675_100069498 | 3300005354 | Bacteria | 2918 |
| 57 | Ga0070675_100134491 | 3300005354 | Bacteria | 2109 |
| 58 | Ga0070675_100841378 | 3300005354 | Bacteria | 839 |
| 59 | Ga0070671_100889775 | 3300005355 | Bacteria | 778 |
| 60 | Ga0070674_100028515 | 3300005356 | Bacteria | 3667 |
| 61 | Ga0070674_101305776 | 3300005356 | Bacteria | 647 |
| 62 | Ga0070673_100030903 | 3300005364 | Bacteria | 4014 |
| 63 | Ga0070673_101687722 | 3300005364 | Bacteria | 599 |
| 64 | Ga0070688_100122312 | 3300005365 | Bacteria | 1745 |
| 65 | Ga0070659_100012568 | 3300005366 | Bacteria | 6277 |
| 66 | Ga0070659_100067489 | 3300005366 | Bacteria | 2837 |
| 67 | Ga0070659_100170452 | 3300005366 | Bacteria | 1783 |
| 68 | Ga0070659_101023301 | 3300005366 | Bacteria | 726 |
| 69 | Ga0070667_100401911 | 3300005367 | Bacteria | 1247 |
| 70 | Ga0070714_100003759 | 3300005435 | Bacteria | 11387 |
| 71 | Ga0070714_100015438 | 3300005435 | Bacteria | 6146 |
| 72 | Ga0070714_100027273 | 3300005435 | Bacteria | 4728 |
| 73 | Ga0070714_100262986 | 3300005435 | Bacteria | 1598 |
| 74 | Ga0070714_100417547 | 3300005435 | Bacteria | 1270 |
| 75 | Ga0070714_100750998 | 3300005435 | Bacteria | 943 |
| 76 | Ga0070714_100773884 | 3300005435 | Bacteria | 929 |
| 77 | Ga0070714_101430391 | 3300005435 | Bacteria | 675 |
| 78 | Ga0070713_100175556 | 3300005436 | Bacteria | 1922 |
| 79 | Ga0070713_100281881 | 3300005436 | Bacteria | 1525 |
| 80 | Ga0070713_102432328 | 3300005436 | Unclassified | 506 |
| 81 | Ga0070710_11497660 | 3300005437 | Unclassified | 507 |
| 82 | Ga0070711_100118777 | 3300005439 | Bacteria | 1952 |
| 83 | Ga0070711_101343873 | 3300005439 | Bacteria | 621 |
| 84 | Ga0070711_101729083 | 3300005439 | Unclassified | 548 |
| 85 | Ga0070700_100003285 | 3300005441 | Bacteria | 8332 |
| 86 | Ga0070708_100294203 | 3300005445 | Archaea | 1529 |
| 87 | Ga0070708_101511273 | 3300005445 | Bacteria | 626 |
| 88 | Ga0070663_100089618 | 3300005455 | Bacteria | 2277 |
| 89 | Ga0070678_102037178 | 3300005456 | Unclassified | 543 |
| 90 | Ga0070662_100168427 | 3300005457 | Bacteria | 1718 |
| 91 | Ga0070662_100851797 | 3300005457 | Bacteria | 776 |
| 92 | Ga0070681_10019834 | 3300005458 | Bacteria | 6734 |
| 93 | Ga0070681_10027616 | 3300005458 | Bacteria | 5706 |
| 94 | Ga0070681_10063034 | 3300005458 | Bacteria | 3680 |
| 95 | Ga0070681_10082524 | 3300005458 | Bacteria | 3170 |
| 96 | Ga0070681_10163367 | 3300005458 | Bacteria | 2150 |
| 97 | Ga0070681_10170615 | 3300005458 | Bacteria | 2097 |
| 98 | Ga0070681_11124176 | 3300005458 | Unclassified | 707 |
| 99 | Ga0070681_11408258 | 3300005458 | Bacteria | 621 |
| 100 | Ga0070681_11460557 | 3300005458 | Bacteria | 608 |
| 101 | Ga0070685_11083086 | 3300005466 | Bacteria | 605 |
| 102 | Ga0070707_100117955 | 3300005468 | Bacteria | 2576 |
| 103 | Ga0070707_100243545 | 3300005468 | Bacteria | 1750 |
| 104 | Ga0070679_100059898 | 3300005530 | Bacteria | 3794 |
| 105 | Ga0070679_100113593 | 3300005530 | Bacteria | 2693 |
| 106 | Ga0070679_100162369 | 3300005530 | Bacteria | 2208 |
| 107 | Ga0070679_100173870 | 3300005530 | Bacteria | 2126 |
| 108 | Ga0070679_100230726 | 3300005530 | Bacteria | 1810 |
| 109 | Ga0070679_100317051 | 3300005530 | Bacteria | 1509 |
| 110 | Ga0070679_100345152 | 3300005530 | Bacteria | 1437 |
| 111 | Ga0070679_100411174 | 3300005530 | Bacteria | 1298 |
| 112 | Ga0070679_100757328 | 3300005530 | Unclassified | 914 |
| 113 | Ga0070684_100151667 | 3300005535 | Bacteria | 2100 |
| 114 | Ga0070684_100158673 | 3300005535 | Bacteria | 2051 |
| 115 | Ga0070684_100180207 | 3300005535 | Bacteria | 1921 |
| 116 | Ga0070684_100217182 | 3300005535 | Bacteria | 1744 |
| 117 | Ga0070684_100381604 | 3300005535 | Unclassified | 1298 |
| 118 | Ga0070684_100430603 | 3300005535 | Bacteria | 1218 |
| 119 | Ga0070684_100696789 | 3300005535 | Bacteria | 947 |
| 120 | Ga0070697_100073637 | 3300005536 | Bacteria | 2805 |
| 121 | Ga0068853_100345634 | 3300005539 | Bacteria | 1383 |
| 122 | Ga0068853_101102403 | 3300005539 | Bacteria | 765 |
| 123 | Ga0070672_100109508 | 3300005543 | Bacteria | 2250 |
| 124 | Ga0070695_100000424 | 3300005545 | Bacteria | 21845 |
| 125 | Ga0070695_100418808 | 3300005545 | Bacteria | 1019 |
| 126 | Ga0070695_100542678 | 3300005545 | Bacteria | 905 |
| 127 | Ga0070696_100728216 | 3300005546 | Bacteria | 811 |
| 128 | Ga0070696_100830485 | 3300005546 | Bacteria | 762 |
| 129 | Ga0070696_101118310 | 3300005546 | Bacteria | 663 |
| 130 | Ga0070693_100131152 | 3300005547 | Bacteria | 1567 |
| 131 | Ga0070665_100981321 | 3300005548 | Bacteria | 857 |
| 132 | Ga0070704_100035743 | 3300005549 | Bacteria | 3379 |
| 133 | Ga0070704_101229042 | 3300005549 | Unclassified | 684 |
| 134 | Ga0068855_100024401 | 3300005563 | Bacteria | 7234 |
| 135 | Ga0068855_100473650 | 3300005563 | Bacteria | 1364 |
| 136 | Ga0068855_101117966 | 3300005563 | Bacteria | 823 |
| 137 | Ga0070664_100017827 | 3300005564 | Bacteria | 5831 |
| 138 | Ga0070664_100805857 | 3300005564 | Bacteria | 878 |
| 139 | Ga0068857_100167217 | 3300005577 | Bacteria | 1998 |
| 140 | Ga0068857_100211595 | 3300005577 | Bacteria | 1769 |
| 141 | Ga0068857_100724882 | 3300005577 | Unclassified | 946 |
| 142 | Ga0068854_100015199 | 3300005578 | Bacteria | 5094 |
| 143 | Ga0068854_100073504 | 3300005578 | Bacteria | 2506 |
| 144 | Ga0068856_100099760 | 3300005614 | Bacteria | 2895 |
| 145 | Ga0068856_100313779 | 3300005614 | Bacteria | 1585 |
| 146 | Ga0068856_100396661 | 3300005614 | Bacteria | 1399 |
| 147 | Ga0068856_100492545 | 3300005614 | Bacteria | 1246 |
| 148 | Ga0068856_101250953 | 3300005614 | Unclassified | 758 |
| 149 | Ga0068856_102124651 | 3300005614 | Bacteria | 571 |
| 150 | Ga0068856_102194946 | 3300005614 | Bacteria | 561 |
| 151 | Ga0068852_100044491 | 3300005616 | Bacteria | 3771 |
| 152 | Ga0068852_100065308 | 3300005616 | Bacteria | 3174 |
| 153 | Ga0068852_100066403 | 3300005616 | Bacteria | 3150 |
| 154 | Ga0068852_100937476 | 3300005616 | Bacteria | 884 |
| 155 | Ga0068852_101297772 | 3300005616 | Unclassified | 750 |
| 156 | Ga0068852_101759431 | 3300005616 | Bacteria | 642 |
| 157 | Ga0068852_102685395 | 3300005616 | Unclassified | 517 |
| 158 | Ga0068864_100003052 | 3300005618 | Bacteria | 13826 |
| 159 | Ga0068866_10220791 | 3300005718 | Bacteria | 1143 |
| 160 | Ga0068861_102557638 | 3300005719 | Bacteria | 514 |
| 161 | Ga0068851_10191492 | 3300005834 | Bacteria | 1137 |
| 162 | Ga0068870_10091516 | 3300005840 | Bacteria | 1701 |
| 163 | Ga0068863_100104515 | 3300005841 | Bacteria | 2694 |
| 164 | Ga0068860_101469953 | 3300005843 | Bacteria | 703 |
| 165 | Ga0068862_101419813 | 3300005844 | Bacteria | 698 |
| 166 | Ga0081540_1183454 | 3300005983 | Bacteria | 780 |
| 167 | Ga0081539_10002145 | 3300005985 | Bacteria | 29161 |
| 168 | Ga0070717_11068370 | 3300006028 | Bacteria | 735 |
| 169 | Ga0075432_10459239 | 3300006058 | Bacteria | 560 |
| 170 | Ga0070716_100930663 | 3300006173 | Bacteria | 683 |
| 171 | Ga0070716_101079309 | 3300006173 | Bacteria | 639 |
| 172 | Ga0070712_100024952 | 3300006175 | Bacteria | 3967 |
| 173 | Ga0070712_100124127 | 3300006175 | Bacteria | 1947 |
| 174 | Ga0070712_101270422 | 3300006175 | Unclassified | 641 |
| 175 | Ga0070712_101469820 | 3300006175 | Bacteria | 595 |
| 176 | Ga0075367_10757074 | 3300006178 | Bacteria | 618 |
| 177 | Ga0068871_101033495 | 3300006358 | Bacteria | 766 |
| 178 | Ga0075434_100473228 | 3300006871 | Bacteria | 1274 |
| 179 | Ga0075434_101374530 | 3300006871 | Unclassified | 716 |
| 180 | Ga0068865_100054573 | 3300006881 | Bacteria | 2777 |
| 181 | Ga0068865_100980691 | 3300006881 | Bacteria | 739 |
| 182 | Ga0075436_100981836 | 3300006914 | Bacteria | 633 |
| 183 | Ga0105240_10392022 | 3300009093 | Bacteria | 1566 |
| 184 | Ga0105240_10450840 | 3300009093 | Bacteria | 1440 |
| 185 | Ga0105240_11083047 | 3300009093 | Unclassified | 853 |
| 186 | Ga0111539_10117023 | 3300009094 | Bacteria | 3125 |
| 187 | Ga0111539_10503244 | 3300009094 | Bacteria | 1411 |
| 188 | Ga0111539_12212698 | 3300009094 | Bacteria | 638 |
| 189 | Ga0105245_10000399 | 3300009098 | Bacteria | 40287 |
| 190 | Ga0105245_10379328 | 3300009098 | Bacteria | 1408 |
| 191 | Ga0105247_11648270 | 3300009101 | Bacteria | 528 |
| 192 | Ga0114129_10385690 | 3300009147 | Bacteria | 1849 |
| 193 | Ga0105243_10222697 | 3300009148 | Bacteria | 1669 |
| 194 | Ga0105243_10872160 | 3300009148 | Bacteria | 893 |
| 195 | Ga0105241_10594355 | 3300009174 | Bacteria | 999 |
| 196 | Ga0105241_11260218 | 3300009174 | Bacteria | 702 |
| 197 | Ga0105242_10318268 | 3300009176 | Bacteria | 1426 |
| 198 | Ga0105248_10516278 | 3300009177 | Bacteria | 1347 |
| 199 | Ga0105237_10232835 | 3300009545 | Bacteria | 1843 |
| 200 | Ga0105237_11194911 | 3300009545 | Bacteria | 767 |
| 201 | Ga0105238_10160174 | 3300009551 | Bacteria | 2226 |
| 202 | Ga0105238_12012050 | 3300009551 | Bacteria | 611 |
| 203 | Ga0105249_10019741 | 3300009553 | Bacteria | 6017 |
| 204 | Ga0105239_10018477 | 3300010375 | Bacteria | 7700 |
| 205 | Ga0105239_10045428 | 3300010375 | Bacteria | 4814 |
| 206 | Ga0105239_10203384 | 3300010375 | Bacteria | 2219 |
| 207 | Ga0105239_10400788 | 3300010375 | Bacteria | 1553 |
| 208 | Ga0105246_10951589 | 3300011119 | Bacteria | 774 |
| 209 | Ga0157373_10218392 | 3300013100 | Unclassified | 1345 |
| 210 | Ga0157373_10340904 | 3300013100 | Unclassified | 1068 |
| 211 | Ga0157371_10007707 | 3300013102 | Bacteria | 8662 |
| 212 | Ga0157371_10392050 | 3300013102 | Bacteria | 1015 |
| 213 | Ga0157371_10556306 | 3300013102 | Bacteria | 851 |
| 214 | Ga0157370_10027338 | 3300013104 | Bacteria | 5626 |
| 215 | Ga0157370_10266165 | 3300013104 | Bacteria | 1584 |
| 216 | Ga0157370_10385316 | 3300013104 | Bacteria | 1291 |
| 217 | Ga0157369_10056135 | 3300013105 | Bacteria | 4250 |
| 218 | Ga0157369_10256765 | 3300013105 | Bacteria | 1823 |
| 219 | Ga0157374_10007591 | 3300013296 | Bacteria | 9254 |
| 220 | Ga0163162_11044232 | 3300013306 | Bacteria | 925 |
| 221 | Ga0157372_10028691 | 3300013307 | Bacteria | 6075 |
| 222 | Ga0157372_10175113 | 3300013307 | Bacteria | 2483 |
| 223 | Ga0157372_10196317 | 3300013307 | Bacteria | 2338 |
| 224 | Ga0157372_10216606 | 3300013307 | Bacteria | 2219 |
| 225 | Ga0157372_10267892 | 3300013307 | Bacteria | 1984 |
| 226 | Ga0157372_10278829 | 3300013307 | Bacteria | 1943 |
| 227 | Ga0157372_10512645 | 3300013307 | Bacteria | 1398 |
| 228 | Ga0157372_10734983 | 3300013307 | Bacteria | 1148 |
| 229 | Ga0157372_10857134 | 3300013307 | Bacteria | 1055 |
| 230 | Ga0157372_10962308 | 3300013307 | Bacteria | 989 |
| 231 | Ga0157375_10301920 | 3300013308 | Bacteria | 1765 |
| 232 | Ga0157375_10646039 | 3300013308 | Bacteria | 1214 |
| 233 | Ga0163163_10127520 | 3300014325 | Bacteria | 2583 |
| 234 | Ga0157380_10088592 | 3300014326 | Bacteria | 2547 |
| 235 | Ga0157380_10199880 | 3300014326 | Bacteria | 1772 |
| 236 | Ga0182008_10071020 | 3300014497 | Bacteria | 1713 |
| 237 | Ga0157377_10000878 | 3300014745 | Bacteria | 12507 |
| 238 | Ga0157377_10074132 | 3300014745 | Bacteria | 1974 |
| 239 | Ga0157377_10574285 | 3300014745 | Bacteria | 800 |
| 240 | Ga0157379_10885460 | 3300014968 | Bacteria | 846 |
| 241 | Ga0157376_10126481 | 3300014969 | Bacteria | 2274 |
| 242 | Ga0182007_10085700 | 3300015262 | Bacteria | 1035 |
| 243 | Ga0206356_10568753 | 3300020070 | Bacteria | 1416 |
| 244 | Ga0206354_10111116 | 3300020081 | Bacteria | 1781 |
| 245 | Ga0206354_10807369 | 3300020081 | Bacteria | 824 |
| 246 | Ga0206354_11165720 | 3300020081 | Bacteria | 1651 |
| 247 | Ga0206353_10500991 | 3300020082 | Bacteria | 1529 |
| 248 | Ga0206353_10561511 | 3300020082 | Unclassified | 565 |
| 249 | Ga0206353_10597767 | 3300020082 | Bacteria | 862 |
| 250 | Ga0206353_10692593 | 3300020082 | Bacteria | 1839 |
| 251 | Ga0206353_11837998 | 3300020082 | Bacteria | 574 |
| 252 | Ga0213873_10003537 | 3300021358 | Unclassified | 2821 |
| 253 | Ga0213876_10073180 | 3300021384 | Bacteria | 1809 |
| 254 | Ga0207656_10141806 | 3300025321 | Bacteria | 1133 |
| 255 | Ga0207692_10041981 | 3300025898 | Bacteria | 2268 |
| 256 | Ga0207642_10078569 | 3300025899 | Bacteria | 1595 |
| 257 | Ga0207688_10003554 | 3300025901 | Bacteria | 8505 |
| 258 | Ga0207688_10533989 | 3300025901 | Bacteria | 736 |
| 259 | Ga0207647_10191463 | 3300025904 | Bacteria | 1185 |
| 260 | Ga0207705_10032205 | 3300025909 | Bacteria | 3746 |
| 261 | Ga0207705_10042066 | 3300025909 | Bacteria | 3280 |
| 262 | Ga0207705_10048413 | 3300025909 | Bacteria | 3058 |
| 263 | Ga0207705_10065301 | 3300025909 | Bacteria | 2630 |
| 264 | Ga0207707_10056972 | 3300025912 | Bacteria | 3401 |
| 265 | Ga0207707_10088548 | 3300025912 | Bacteria | 2704 |
| 266 | Ga0207707_10354756 | 3300025912 | Bacteria | 1263 |
| 267 | Ga0207707_10410964 | 3300025912 | Bacteria | 1161 |
| 268 | Ga0207707_10432908 | 3300025912 | Bacteria | 1126 |
| 269 | Ga0207707_10530868 | 3300025912 | Bacteria | 1001 |
| 270 | Ga0207707_10982138 | 3300025912 | Bacteria | 694 |
| 271 | Ga0207695_10663629 | 3300025913 | Bacteria | 924 |
| 272 | Ga0207671_10236747 | 3300025914 | Bacteria | 1433 |
| 273 | Ga0207693_10037709 | 3300025915 | Bacteria | 3809 |
| 274 | Ga0207693_10042999 | 3300025915 | Bacteria | 3557 |
| 275 | Ga0207693_10303001 | 3300025915 | Bacteria | 1251 |
| 276 | Ga0207693_11035537 | 3300025915 | Bacteria | 625 |
| 277 | Ga0207663_10186527 | 3300025916 | Bacteria | 1486 |
| 278 | Ga0207660_10148624 | 3300025917 | Bacteria | 1798 |
| 279 | Ga0207660_10268051 | 3300025917 | Bacteria | 1352 |
| 280 | Ga0207660_10360002 | 3300025917 | Bacteria | 1167 |
| 281 | Ga0207660_10482925 | 3300025917 | Bacteria | 1004 |
| 282 | Ga0207660_11036180 | 3300025917 | Unclassified | 669 |
| 283 | Ga0207657_10000616 | 3300025919 | Bacteria | 37754 |
| 284 | Ga0207657_10005027 | 3300025919 | Bacteria | 13875 |
| 285 | Ga0207657_10062173 | 3300025919 | Bacteria | 3198 |
| 286 | Ga0207657_10095206 | 3300025919 | Bacteria | 2478 |
| 287 | Ga0207657_10140046 | 3300025919 | Bacteria | 1977 |
| 288 | Ga0207657_10198000 | 3300025919 | Bacteria | 1617 |
| 289 | Ga0207657_10396320 | 3300025919 | Bacteria | 1086 |
| 290 | Ga0207649_10209560 | 3300025920 | Bacteria | 1382 |
| 291 | Ga0207649_10308715 | 3300025920 | Bacteria | 1159 |
| 292 | Ga0207649_10541379 | 3300025920 | Bacteria | 890 |
| 293 | Ga0207649_11221560 | 3300025920 | Bacteria | 594 |
| 294 | Ga0207652_10028796 | 3300025921 | Bacteria | 4637 |
| 295 | Ga0207652_10086073 | 3300025921 | Bacteria | 2755 |
| 296 | Ga0207652_10087925 | 3300025921 | Bacteria | 2725 |
| 297 | Ga0207652_10188661 | 3300025921 | Bacteria | 1854 |
| 298 | Ga0207652_10267587 | 3300025921 | Bacteria | 1542 |
| 299 | Ga0207652_10271086 | 3300025921 | Bacteria | 1531 |
| 300 | Ga0207652_10633682 | 3300025921 | Unclassified | 957 |
| 301 | Ga0207652_10681217 | 3300025921 | Bacteria | 918 |
| 302 | Ga0207652_10789622 | 3300025921 | Bacteria | 843 |
| 303 | Ga0207646_10228539 | 3300025922 | Bacteria | 1681 |
| 304 | Ga0207694_10346539 | 3300025924 | Bacteria | 1229 |
| 305 | Ga0207659_10053517 | 3300025926 | Bacteria | 2879 |
| 306 | Ga0207659_10298396 | 3300025926 | Bacteria | 1322 |
| 307 | Ga0207687_10343121 | 3300025927 | Bacteria | 1215 |
| 308 | Ga0207700_11520229 | 3300025928 | Unclassified | 594 |
| 309 | Ga0207664_10009761 | 3300025929 | Bacteria | 6752 |
| 310 | Ga0207664_10272831 | 3300025929 | Bacteria | 1482 |
| 311 | Ga0207664_11116013 | 3300025929 | Unclassified | 705 |
| 312 | Ga0207664_11241722 | 3300025929 | Bacteria | 664 |
| 313 | Ga0207664_11880517 | 3300025929 | Bacteria | 521 |
| 314 | Ga0207644_10581977 | 3300025931 | Bacteria | 928 |
| 315 | Ga0207690_10046129 | 3300025932 | Bacteria | 2884 |
| 316 | Ga0207690_10154865 | 3300025932 | Bacteria | 1702 |
| 317 | Ga0207690_10186296 | 3300025932 | Bacteria | 1566 |
| 318 | Ga0207690_10553279 | 3300025932 | Bacteria | 935 |
| 319 | Ga0207690_11076450 | 3300025932 | Bacteria | 670 |
| 320 | Ga0207706_10020489 | 3300025933 | Bacteria | 5944 |
| 321 | Ga0207706_10190826 | 3300025933 | Bacteria | 1798 |
| 322 | Ga0207706_10261017 | 3300025933 | Bacteria | 1512 |
| 323 | Ga0207686_10659301 | 3300025934 | Bacteria | 828 |
| 324 | Ga0207709_10841938 | 3300025935 | Bacteria | 743 |
| 325 | Ga0207670_11275158 | 3300025936 | Bacteria | 623 |
| 326 | Ga0207704_10227371 | 3300025938 | Bacteria | 1385 |
| 327 | Ga0207704_10632007 | 3300025938 | Bacteria | 880 |
| 328 | Ga0207665_10289241 | 3300025939 | Bacteria | 1222 |
| 329 | Ga0207691_10444743 | 3300025940 | Bacteria | 1103 |
| 330 | Ga0207689_10094428 | 3300025942 | Bacteria | 2456 |
| 331 | Ga0207661_10007076 | 3300025944 | Bacteria | 7967 |
| 332 | Ga0207661_10261792 | 3300025944 | Bacteria | 1541 |
| 333 | Ga0207661_10351850 | 3300025944 | Bacteria | 1329 |
| 334 | Ga0207661_10356983 | 3300025944 | Bacteria | 1320 |
| 335 | Ga0207661_10644426 | 3300025944 | Bacteria | 973 |
| 336 | Ga0207661_10740590 | 3300025944 | Bacteria | 904 |
| 337 | Ga0207661_10939683 | 3300025944 | Bacteria | 796 |
| 338 | Ga0207679_10611392 | 3300025945 | Bacteria | 983 |
| 339 | Ga0207679_10650753 | 3300025945 | Bacteria | 953 |
| 340 | Ga0207679_11466560 | 3300025945 | Bacteria | 626 |
| 341 | Ga0207667_10339094 | 3300025949 | Bacteria | 1534 |
| 342 | Ga0207667_10389575 | 3300025949 | Bacteria | 1419 |
| 343 | Ga0207667_10523801 | 3300025949 | Bacteria | 1201 |
| 344 | Ga0207667_10810118 | 3300025949 | Bacteria | 933 |
| 345 | Ga0207651_10075564 | 3300025960 | Bacteria | 2405 |
| 346 | Ga0207712_10258022 | 3300025961 | Bacteria | 1412 |
| 347 | Ga0207712_11162185 | 3300025961 | Bacteria | 688 |
| 348 | Ga0207668_10729513 | 3300025972 | Bacteria | 873 |
| 349 | Ga0207640_10086859 | 3300025981 | Bacteria | 2155 |
| 350 | Ga0207640_10336778 | 3300025981 | Bacteria | 1207 |
| 351 | Ga0207640_10647259 | 3300025981 | Bacteria | 900 |
| 352 | Ga0207658_10136068 | 3300025986 | Bacteria | 1981 |
| 353 | Ga0207677_10018268 | 3300026023 | Bacteria | 4205 |
| 354 | Ga0207677_10268414 | 3300026023 | Unclassified | 1394 |
| 355 | Ga0207639_10094581 | 3300026041 | Bacteria | 2399 |
| 356 | Ga0207678_10114692 | 3300026067 | Bacteria | 2298 |
| 357 | Ga0207678_10539195 | 3300026067 | Bacteria | 1020 |
| 358 | Ga0207708_10004340 | 3300026075 | Bacteria | 10445 |
| 359 | Ga0207702_10092577 | 3300026078 | Bacteria | 2649 |
| 360 | Ga0207702_10348230 | 3300026078 | Bacteria | 1417 |
| 361 | Ga0207702_10476105 | 3300026078 | Bacteria | 1215 |
| 362 | Ga0207702_10775160 | 3300026078 | Bacteria | 947 |
| 363 | Ga0207702_12351949 | 3300026078 | Unclassified | 520 |
| 364 | Ga0207641_10955210 | 3300026088 | Bacteria | 853 |
| 365 | Ga0207676_10016651 | 3300026095 | Bacteria | 5325 |
| 366 | Ga0207674_10199199 | 3300026116 | Bacteria | 1952 |
| 367 | Ga0207674_10475405 | 3300026116 | Bacteria | 1208 |
| 368 | Ga0207674_10894587 | 3300026116 | Bacteria | 856 |
| 369 | Ga0207675_101488216 | 3300026118 | Bacteria | 698 |
| 370 | Ga0207698_10079161 | 3300026142 | Bacteria | 2642 |
| 371 | Ga0207698_10100116 | 3300026142 | Bacteria | 2399 |
| 372 | Ga0207698_10480593 | 3300026142 | Bacteria | 1205 |
| 373 | Ga0207698_10482257 | 3300026142 | Bacteria | 1203 |
| 374 | Ga0207698_10784240 | 3300026142 | Bacteria | 954 |
| 375 | Ga0207698_11153313 | 3300026142 | Bacteria | 788 |
| 376 | Ga0207428_10562948 | 3300027907 | Bacteria | 823 |
| 377 | Ga0207428_10977921 | 3300027907 | Bacteria | 595 |
| 378 | Ga0268266_10115220 | 3300028379 | Bacteria | 2386 |
| 379 | Ga0265319_1192764 | 3300028563 | Bacteria | 626 |
| 380 | Ga0265327_10046320 | 3300031251 | Bacteria | 2303 |
| 381 | Ga0265327_10113236 | 3300031251 | Bacteria | 1293 |
| 382 | Ga0307408_100495219 | 3300031548 | Bacteria | 1069 |
| 383 | Ga0307410_10214493 | 3300031852 | Bacteria | 1477 |
| 384 | Ga0307409_100300535 | 3300031995 | Bacteria | 1493 |
| 385 | Ga0307409_100430449 | 3300031995 | Bacteria | 1268 |
| 386 | Ga0307409_100803505 | 3300031995 | Bacteria | 948 |
| 387 | Ga0307409_102283537 | 3300031995 | Bacteria | 570 |
| 388 | Ga0307416_100039339 | 3300032002 | Bacteria | 3660 |
| 389 | Ga0307416_100502949 | 3300032002 | Unclassified | 1277 |
| 390 | Ga0307416_103471767 | 3300032002 | Unclassified | 527 |
| 391 | Ga0307414_10593139 | 3300032004 | Bacteria | 993 |
| 392 | Ga0307411_10790334 | 3300032005 | Bacteria | 835 |
| 393 | Ga0373956_0411268 | 3300035119 | Unclassified | 645 |
| 394 | Ga0373943_0155203 | 3300035170 | Bacteria | 1243 |
| 395 | Ga0373943_0728591 | 3300035170 | Unclassified | 588 |
| 396 | Ga0373946_0094931 | 3300035171 | Bacteria | 1328 |
| 397 | Ga0373935_1265503 | 3300035692 | Unclassified | 550 |
| 398 | Ga0373927_0521211 | 3300035695 | Bacteria | 786 |
| 399 | Ga0373933_0042533 | 3300035724 | Bacteria | 2686 |
| 400 | Ga0373933_0264819 | 3300035724 | Bacteria | 1109 |
| 401 | Ga0373947_0004284 | 3300035725 | Bacteria | 8379 |
| 402 | Ga0373947_0382163 | 3300035725 | Unclassified | 948 |
| 403 | Ga0373947_0599111 | 3300035725 | Unclassified | 751 |
| 404 | Ga0373937_0015707 | 3300036401 | Bacteria | 6704 |
| 405 | Ga0373937_0183361 | 3300036401 | Bacteria | 1966 |
| 406 | Ga0373937_1320582 | 3300036401 | Unclassified | 669 |
| 407 | Ga0373925_0059214 | 3300037068 | Bacteria | 2873 |
| 408 | Ga0395899_0095060 | 3300037312 | Bacteria | 2156 |
| 409 | Ga0395899_0242323 | 3300037312 | Bacteria | 1240 |
| 410 | Ga0395899_0257633 | 3300037312 | Bacteria | 1194 |
| 411 | Ga0395900_0004581 | 3300037418 | Bacteria | 14587 |
| 412 | Ga0395900_0011165 | 3300037418 | Bacteria | 9184 |
| 413 | Ga0395900_0025308 | 3300037418 | Bacteria | 6077 |
| 414 | Ga0395900_0066519 | 3300037418 | Bacteria | 3703 |
| 415 | Ga0395900_0231179 | 3300037418 | Bacteria | 1859 |
| 416 | Ga0395900_0292369 | 3300037418 | Bacteria | 1618 |
| 417 | Ga0395900_0448972 | 3300037418 | Bacteria | 1246 |
| 418 | Ga0395900_0485459 | 3300037418 | Bacteria | 1187 |
| 419 | Ga0395900_0592182 | 3300037418 | Bacteria | 1050 |
| 420 | Ga0395900_0895444 | 3300037418 | Bacteria | 811 |
| 421 | Ga0395900_0933366 | 3300037418 | Unclassified | 790 |
| 422 | Ga0395900_1357795 | 3300037418 | Unclassified | 624 |
| 423 | Ga0395898_0015468 | 3300037466 | Bacteria | 7826 |
| 424 | Ga0395898_0209797 | 3300037466 | Bacteria | 1858 |
| 425 | Ga0395898_0213695 | 3300037466 | Bacteria | 1840 |
| 426 | Ga0395898_0276144 | 3300037466 | Bacteria | 1603 |
| 427 | Ga0395898_0296870 | 3300037466 | Bacteria | 1541 |
| 428 | Ga0395898_0315653 | 3300037466 | Bacteria | 1491 |
| 429 | Ga0395898_0444593 | 3300037466 | Bacteria | 1235 |
| 430 | Ga0395898_1181058 | 3300037466 | Bacteria | 697 |
| 431 | Ga0395898_1566391 | 3300037466 | Unclassified | 584 |
| 432 | Ga0395898_1634979 | 3300037466 | Bacteria | 568 |
| 433 | Ga0395898_1646229 | 3300037466 | Unclassified | 565 |
| 434 | Ga0395905_0129871 | 3300037471 | Bacteria | 2370 |
| 435 | Ga0395905_0204536 | 3300037471 | Bacteria | 1851 |
| 436 | Ga0395905_0451682 | 3300037471 | Bacteria | 1183 |
| 437 | Ga0395905_0808176 | 3300037471 | Unclassified | 841 |
| 438 | Ga0395905_0843201 | 3300037471 | Archaea | 819 |
| 439 | Ga0395905_0943965 | 3300037471 | Bacteria | 765 |
| 440 | Ga0395905_1387646 | 3300037471 | Bacteria | 607 |
| 441 | Ga0436364_1414925 | 3300037853 | Bacteria | 4145 |
| 442 | Ga0395901_0090556 | 3300038443 | Bacteria | 3201 |
| 443 | Ga0395901_0097434 | 3300038443 | Unclassified | 3083 |
| 444 | Ga0395901_0119515 | 3300038443 | Bacteria | 2769 |
| 445 | Ga0395901_0147624 | 3300038443 | Bacteria | 2471 |
| 446 | Ga0395901_0164572 | 3300038443 | Bacteria | 2329 |
| 447 | Ga0395901_0179164 | 3300038443 | Bacteria | 2223 |
| 448 | Ga0395901_0228817 | 3300038443 | Bacteria | 1942 |
| 449 | Ga0395901_0299014 | 3300038443 | Bacteria | 1669 |
| 450 | Ga0395901_0399670 | 3300038443 | Bacteria | 1412 |
| 451 | Ga0395901_0632944 | 3300038443 | Unclassified | 1075 |
| 452 | Ga0395901_0709784 | 3300038443 | Unclassified | 1002 |
| 453 | Ga0395901_1140794 | 3300038443 | Unclassified | 748 |
| 454 | Ga0242420_059446 | 3300038996 | Bacteria | 760 |
| 455 | Ga0436365_0714445 | 3300039437 | Bacteria | 7977 |
| 456 | Ga0436362_0503031 | 3300039453 | Bacteria | 5085 |
| 457 | Ga0439466_0033431 | 3300041411 | Bacteria | 1747 |
| 458 | Ga0439455_0008465 | 3300042012 | Bacteria | 2207 |
| 459 | Ga0450900_018817 | 3300042136 | Bacteria | 950 |
| 460 | Ga0450902_022454 | 3300042137 | Unclassified | 1045 |
| 461 | Ga0450905_030199 | 3300042142 | Bacteria | 833 |
| 462 | Ga0439458_0007645 | 3300042157 | Bacteria | 2407 |
| 463 | Ga0450916_024826 | 3300042530 | Unclassified | 843 |
| 464 | Ga0466972_0138629 | 3300044658 | Bacteria | 1145 |
| 465 | Ga0466965_0249811 | 3300044683 | Bacteria | 951 |
| 466 | Ga0466966_0068629 | 3300044684 | Bacteria | 2225 |
| 467 | Ga0466961_0190762 | 3300044693 | Bacteria | 1270 |
| 468 | Ga0466961_0461301 | 3300044693 | Unclassified | 769 |
| 469 | Ga0466961_0772080 | 3300044693 | Bacteria | 574 |
| 470 | Ga0466963_0000216 | 3300044694 | Bacteria | 24575 |
| 471 | Ga0466963_0003034 | 3300044694 | Bacteria | 9508 |
| 472 | Ga0466963_0005085 | 3300044694 | Bacteria | 7689 |
| 473 | Ga0466963_0010001 | 3300044694 | Bacteria | 5733 |
| 474 | Ga0466963_0018759 | 3300044694 | Bacteria | 4330 |
| 475 | Ga0466963_0126516 | 3300044694 | Bacteria | 1762 |
| 476 | Ga0466963_0216514 | 3300044694 | Bacteria | 1341 |
| 477 | Ga0466963_0246636 | 3300044694 | Bacteria | 1253 |
| 478 | Ga0466963_0346027 | 3300044694 | Bacteria | 1047 |
| 479 | Ga0466963_0457372 | 3300044694 | Bacteria | 901 |
| 480 | Ga0466964_0129995 | 3300044706 | Unclassified | 1146 |
| 481 | Ga0466964_0208506 | 3300044706 | Unclassified | 942 |
| 482 | Ga0466964_0414133 | 3300044706 | Unclassified | 707 |
| 483 | Ga0466964_0462187 | 3300044706 | Bacteria | 675 |
| 484 | Ga0466964_0594332 | 3300044706 | Unclassified | 606 |
| 485 | Ga0466971_0332830 | 3300044719 | Bacteria | 733 |
| 486 | Ga0466968_0042855 | 3300044735 | Unclassified | 1914 |
| 487 | Ga0466968_0045852 | 3300044735 | Bacteria | 1856 |
| 488 | Ga0466968_0370131 | 3300044735 | Bacteria | 699 |
| 489 | Ga0466968_0385825 | 3300044735 | Bacteria | 685 |
| 490 | Ga0466957_0008644 | 3300044842 | Bacteria | 5798 |
| 491 | Ga0466957_0128365 | 3300044842 | Bacteria | 1622 |
| 492 | Ga0466957_0517889 | 3300044842 | Bacteria | 828 |
| 493 | Ga0466957_0586223 | 3300044842 | Bacteria | 780 |
| 494 | Ga0466957_0687716 | 3300044842 | Bacteria | 721 |
| 495 | Ga0466960_0005077 | 3300044901 | Bacteria | 5201 |
| 496 | Ga0466960_0100085 | 3300044901 | Bacteria | 1491 |
| 497 | Ga0466959_0006508 | 3300045049 | Bacteria | 8097 |
| 498 | Ga0466959_0417787 | 3300045049 | Bacteria | 911 |
| 499 | Ga0466958_0000593 | 3300045836 | Bacteria | 15427 |
| 500 | Ga0466958_0003623 | 3300045836 | Bacteria | 8053 |
| 501 | Ga0466958_0015716 | 3300045836 | Bacteria | 4344 |
| 502 | Ga0466958_0020469 | 3300045836 | Bacteria | 3858 |
| 503 | Ga0466958_0049299 | 3300045836 | Bacteria | 2547 |
| 504 | Ga0466958_0573156 | 3300045836 | Bacteria | 734 |
| 505 | Ga0466958_0582133 | 3300045836 | Bacteria | 728 |
| 506 | Ga0466958_0670181 | 3300045836 | Bacteria | 675 |
| 507 | Ga0466958_0965171 | 3300045836 | Unclassified | 556 |
| 508 | Ga0466967_0001892 | 3300045976 | Bacteria | 12648 |
| 509 | Ga0466967_0002719 | 3300045976 | Bacteria | 11183 |
| 510 | Ga0466967_0015893 | 3300045976 | Bacteria | 5915 |
| 511 | Ga0466967_0031509 | 3300045976 | Bacteria | 4464 |
| 512 | Ga0466967_0052537 | 3300045976 | Bacteria | 3577 |
| 513 | Ga0466967_0060617 | 3300045976 | Bacteria | 3354 |
| 514 | Ga0466967_0104194 | 3300045976 | Bacteria | 2596 |
| 515 | Ga0466967_0135177 | 3300045976 | Bacteria | 2292 |
| 516 | Ga0466967_0154456 | 3300045976 | Bacteria | 2148 |
| 517 | Ga0466967_0205434 | 3300045976 | Bacteria | 1867 |
| 518 | Ga0466967_0217773 | 3300045976 | Unclassified | 1813 |
| 519 | Ga0466967_0312411 | 3300045976 | Bacteria | 1514 |
| 520 | Ga0466967_0404872 | 3300045976 | Bacteria | 1328 |
| 521 | Ga0466967_1023843 | 3300045976 | Bacteria | 822 |
| 522 | Ga0466967_1086748 | 3300045976 | Unclassified | 797 |
| 523 | Ga0466967_2603886 | 3300045976 | Bacteria | 500 |
| 524 | Ga0495592_0097932 | 3300046454 | Bacteria | 2094 |
| 525 | Ga0495592_0410992 | 3300046454 | Bacteria | 855 |
| 526 | Ga0495592_0494431 | 3300046454 | Bacteria | 760 |
| 527 | Ga0495629_0296914 | 3300046459 | Bacteria | 1107 |
| 528 | Ga0495641_0271985 | 3300046461 | Bacteria | 762 |
| 529 | Ga0495641_0443650 | 3300046461 | Unclassified | 590 |
| 530 | Ga0495651_0033867 | 3300046462 | Bacteria | 3983 |
| 531 | Ga0495664_0309778 | 3300046477 | Bacteria | 953 |
| 532 | Ga0495608_0023197 | 3300046511 | Bacteria | 4254 |
| 533 | Ga0495618_0042778 | 3300046514 | Bacteria | 2857 |
| 534 | Ga0495630_0564603 | 3300046517 | Bacteria | 873 |
| 535 | Ga0495644_0421967 | 3300046523 | Bacteria | 529 |
| 536 | Ga0495652_0716798 | 3300046529 | Unclassified | 672 |
| 537 | Ga0495665_0371739 | 3300046531 | Unclassified | 727 |
| 538 | Ga0495640_0152776 | 3300046533 | Bacteria | 1482 |
| 539 | Ga0495586_0359032 | 3300046535 | Bacteria | 837 |
| 540 | Ga0495645_0295261 | 3300046543 | Bacteria | 1061 |
| 541 | Ga0495645_0660488 | 3300046543 | Bacteria | 638 |
| 542 | Ga0495667_0180112 | 3300046559 | Bacteria | 1356 |
| 543 | Ga0495634_0041306 | 3300046642 | Bacteria | 3133 |
| 544 | Ga0495634_0522562 | 3300046642 | Bacteria | 694 |
| 545 | Ga0495635_0228437 | 3300046663 | Bacteria | 1257 |
| 546 | Ga0495588_0168716 | 3300046674 | Bacteria | 1157 |
| 547 | Ga0495588_0297663 | 3300046674 | Bacteria | 850 |
| 548 | Ga0495657_0268632 | 3300046675 | Bacteria | 1023 |
| 549 | Ga0495599_0324716 | 3300046678 | Unclassified | 926 |
| 550 | Ga0495646_0180033 | 3300046680 | Bacteria | 1161 |
| 551 | Ga0495647_0260027 | 3300046681 | Bacteria | 774 |
| 552 | Ga0495658_0417283 | 3300046683 | Unclassified | 856 |
| 553 | Ga0495658_1119664 | 3300046683 | Bacteria | 502 |
| 554 | Ga0495613_0074441 | 3300046689 | Bacteria | 2473 |
| 555 | Ga0495613_0468342 | 3300046689 | Bacteria | 852 |
| 556 | Ga0495613_0662349 | 3300046689 | Archaea | 690 |
| 557 | Ga0495624_0210750 | 3300046690 | Bacteria | 1179 |
| 558 | Ga0495624_0754124 | 3300046690 | Unclassified | 576 |
| 559 | Ga0495589_0210840 | 3300046794 | Bacteria | 915 |
| 560 | Ga0495600_0147051 | 3300046809 | Bacteria | 1527 |
| 561 | Ga0495581_0135800 | 3300047315 | Bacteria | 1434 |
| 562 | Ga0495581_0573474 | 3300047315 | Bacteria | 654 |
| 563 | Ga0495674_0036626 | 3300047319 | Bacteria | 4415 |
| 564 | Ga0495674_0500437 | 3300047319 | Bacteria | 972 |
| 565 | Ga0495676_0199751 | 3300047321 | Bacteria | 1390 |
| 566 | Ga0495680_0004651 | 3300047322 | Bacteria | 13073 |
| 567 | Ga0495680_0198603 | 3300047322 | Bacteria | 1440 |
| 568 | Ga0495684_0004177 | 3300047471 | Bacteria | 11278 |
| 569 | Ga0495684_0066144 | 3300047471 | Bacteria | 2748 |
| 570 | Ga0495593_0314921 | 3300047673 | Unclassified | 782 |
| 571 | Ga0495602_0186632 | 3300048088 | Bacteria | 1594 |
| 572 | Ga0495614_0318385 | 3300048089 | Bacteria | 721 |
| 573 | Ga0496100_0626616 | 3300048903 | Bacteria | 836 |
| 574 | Ga0496101_0101004 | 3300048904 | Bacteria | 2159 |
| 575 | Ga0496101_0103308 | 3300048904 | Bacteria | 2136 |
| 576 | Ga0496101_0189906 | 3300048904 | Bacteria | 1585 |
| 577 | Ga0496101_0846960 | 3300048904 | Bacteria | 720 |
| 578 | Ga0496102_0136172 | 3300048905 | Bacteria | 2301 |
| 579 | Ga0496102_0147304 | 3300048905 | Unclassified | 2210 |
| 580 | Ga0496102_0155881 | 3300048905 | Unclassified | 2147 |
| 581 | Ga0496102_0176698 | 3300048905 | Bacteria | 2011 |
| 582 | Ga0496102_0215673 | 3300048905 | Bacteria | 1809 |
| 583 | Ga0496102_0853379 | 3300048905 | Bacteria | 833 |
| 584 | Ga0496103_0040413 | 3300048906 | Bacteria | 2866 |
| 585 | Ga0496103_0066619 | 3300048906 | Bacteria | 2248 |
| 586 | Ga0496103_0075598 | 3300048906 | Bacteria | 2113 |
| 587 | Ga0496104_0001747 | 3300048907 | Bacteria | 18769 |
| 588 | Ga0496104_0028656 | 3300048907 | Bacteria | 5161 |
| 589 | Ga0496104_0075088 | 3300048907 | Bacteria | 3219 |
| 590 | Ga0496104_0106822 | 3300048907 | Bacteria | 2683 |
| 591 | Ga0496104_0985603 | 3300048907 | Bacteria | 747 |
| 592 | Ga0496104_1147947 | 3300048907 | Unclassified | 680 |
| 593 | Ga0496105_0025625 | 3300048908 | Bacteria | 4803 |
| 594 | Ga0496105_0193978 | 3300048908 | Bacteria | 1660 |
| 595 | Ga0496105_0289079 | 3300048908 | Bacteria | 1320 |
| 596 | Ga0496105_0458827 | 3300048908 | Bacteria | 1005 |
| 597 | Ga0496105_0711051 | 3300048908 | Bacteria | 770 |
| 598 | Ga0496106_0052338 | 3300048909 | Bacteria | 3080 |
| 599 | Ga0496106_0070185 | 3300048909 | Bacteria | 2675 |
| 600 | Ga0496106_0947125 | 3300048909 | Unclassified | 679 |
| 601 | Ga0496107_0038063 | 3300048910 | Bacteria | 3452 |
| 602 | Ga0496107_0221789 | 3300048910 | Bacteria | 1407 |
| 603 | Ga0496108_0050444 | 3300048911 | Bacteria | 3483 |
| 604 | Ga0496108_0091404 | 3300048911 | Bacteria | 2587 |
| 605 | Ga0496108_0780668 | 3300048911 | Bacteria | 825 |
| 606 | Ga0496108_1280866 | 3300048911 | Bacteria | 617 |
| 607 | Ga0496109_0013462 | 3300048912 | Bacteria | 7097 |
| 608 | Ga0496109_0032837 | 3300048912 | Bacteria | 4668 |
| 609 | Ga0496109_0037943 | 3300048912 | Bacteria | 4354 |
| 610 | Ga0496109_0448200 | 3300048912 | Unclassified | 1219 |
| 611 | Ga0496109_1004806 | 3300048912 | Unclassified | 772 |
| 612 | Ga0496109_1259789 | 3300048912 | Bacteria | 676 |
| 613 | Ga0496109_1432998 | 3300048912 | Unclassified | 626 |
| 614 | Ga0496110_0001864 | 3300048913 | Bacteria | 15575 |
| 615 | Ga0496110_0028523 | 3300048913 | Bacteria | 4795 |
| 616 | Ga0496110_0096882 | 3300048913 | Bacteria | 2643 |
| 617 | Ga0496110_0988260 | 3300048913 | Unclassified | 749 |
| 618 | Ga0496110_1783730 | 3300048913 | Bacteria | 525 |
| 619 | Ga0496111_0021517 | 3300048914 | Bacteria | 4505 |
| 620 | Ga0496111_0022564 | 3300048914 | Unclassified | 4409 |
| 621 | Ga0496111_0156637 | 3300048914 | Bacteria | 1690 |
| 622 | Ga0496112_0019502 | 3300048915 | Bacteria | 6402 |
| 623 | Ga0496112_0040963 | 3300048915 | Bacteria | 4530 |
| 624 | Ga0496112_0057344 | 3300048915 | Bacteria | 3834 |
| 625 | Ga0496112_0239346 | 3300048915 | Bacteria | 1768 |
| 626 | Ga0496112_0300756 | 3300048915 | Bacteria | 1550 |
| 627 | Ga0496112_0331432 | 3300048915 | Bacteria | 1466 |
| 628 | Ga0496112_0349788 | 3300048915 | Bacteria | 1420 |
| 629 | Ga0496112_0506222 | 3300048915 | Bacteria | 1143 |
| 630 | Ga0496112_0624393 | 3300048915 | Bacteria | 1008 |
| 631 | Ga0496112_1031889 | 3300048915 | Bacteria | 742 |
| 632 | Ga0496113_0011096 | 3300048916 | Bacteria | 5992 |
| 633 | Ga0496113_0216977 | 3300048916 | Bacteria | 1524 |
| 634 | Ga0496113_0610324 | 3300048916 | Unclassified | 873 |
| 635 | Ga0496113_0918490 | 3300048916 | Bacteria | 692 |
| 636 | Ga0496113_1250790 | 3300048916 | Bacteria | 578 |
| 637 | Ga0496113_1258954 | 3300048916 | Unclassified | 576 |
| 638 | Ga0496114_0018442 | 3300048917 | Bacteria | 5642 |
| 639 | Ga0496114_0062984 | 3300048917 | Bacteria | 3105 |
| 640 | Ga0496114_0197765 | 3300048917 | Bacteria | 1760 |
| 641 | Ga0496114_0200325 | 3300048917 | Bacteria | 1749 |
| 642 | Ga0501032_0004469 | 3300049569 | Bacteria | 10534 |
| 643 | Ga0501033_0000620 | 3300049570 | Bacteria | 32902 |
| 644 | Ga0501034_0402007 | 3300049571 | Bacteria | 1292 |
| 645 | Ga0501036_0000199 | 3300049572 | Bacteria | 39810 |
| 646 | Ga0501036_0081141 | 3300049572 | Bacteria | 2741 |
| 647 | Ga0501036_0525277 | 3300049572 | Unclassified | 984 |
| 648 | Ga0501036_1274849 | 3300049572 | Bacteria | 598 |
| 649 | Ga0501037_0000502 | 3300049573 | Bacteria | 31651 |
| 650 | Ga0501038_0000536 | 3300049574 | Bacteria | 33408 |
| 651 | Ga0501038_0195265 | 3300049574 | Bacteria | 1627 |
| 652 | Ga0501039_0000244 | 3300049575 | Bacteria | 39686 |
| 653 | Ga0501040_0000131 | 3300049576 | Bacteria | 39844 |
| 654 | Ga0501040_0181767 | 3300049576 | Bacteria | 1491 |
| 655 | Ga0501040_0762000 | 3300049576 | Unclassified | 700 |
| 656 | Ga0501041_0000057 | 3300049577 | Bacteria | 40833 |
| 657 | Ga0501041_0560543 | 3300049577 | Unclassified | 728 |
| 658 | Ga0501042_0000219 | 3300049578 | Bacteria | 27244 |
| 659 | Ga0501043_0000969 | 3300049579 | Bacteria | 25396 |
| 660 | Ga0501046_0001266 | 3300049580 | Bacteria | 24488 |
| 661 | Ga0501046_0533255 | 3300049580 | Bacteria | 838 |
| 662 | Ga0501047_0003817 | 3300049581 | Bacteria | 14166 |
| 663 | Ga0501048_0000427 | 3300049582 | Bacteria | 29599 |
| 664 | Ga0501048_0605823 | 3300049582 | Bacteria | 786 |
| 665 | Ga0501067_0001469 | 3300049583 | Bacteria | 12801 |
| 666 | Ga0501067_0012155 | 3300049583 | Bacteria | 4773 |
| 667 | Ga0501067_0094852 | 3300049583 | Bacteria | 1656 |
| 668 | Ga0501067_0174377 | 3300049583 | Bacteria | 1198 |
| 669 | Ga0501068_0000209 | 3300049584 | Bacteria | 28255 |
| 670 | Ga0501068_0000557 | 3300049584 | Bacteria | 18931 |
| 671 | Ga0501069_0001116 | 3300049585 | Bacteria | 12961 |
| 672 | Ga0501069_0011197 | 3300049585 | Bacteria | 4757 |
| 673 | Ga0501069_0322268 | 3300049585 | Bacteria | 908 |
| 674 | Ga0501069_0378436 | 3300049585 | Unclassified | 836 |
| 675 | Ga0501069_0379923 | 3300049585 | Bacteria | 834 |
| 676 | Ga0501069_0489364 | 3300049585 | Bacteria | 733 |
| 677 | Ga0501069_0512847 | 3300049585 | Bacteria | 716 |
| 678 | Ga0501070_0002942 | 3300049586 | Bacteria | 14829 |
| 679 | Ga0501071_0000177 | 3300049587 | Bacteria | 28212 |
| 680 | Ga0501072_0000350 | 3300049588 | Bacteria | 32841 |
| 681 | Ga0501072_0019140 | 3300049588 | Bacteria | 5289 |
| 682 | Ga0501072_1053472 | 3300049588 | Unclassified | 633 |
| 683 | Ga0501073_0006956 | 3300049589 | Bacteria | 8423 |
| 684 | Ga0501073_1223807 | 3300049589 | Unclassified | 515 |
| 685 | Ga0501074_0000106 | 3300049590 | Bacteria | 40924 |
| 686 | Ga0501074_0186091 | 3300049590 | Bacteria | 1481 |
| 687 | Ga0501074_0503581 | 3300049590 | Bacteria | 858 |
| 688 | Ga0501075_0000127 | 3300049591 | Bacteria | 37478 |
| 689 | Ga0501075_0058257 | 3300049591 | Bacteria | 2909 |
| 690 | Ga0501075_0670811 | 3300049591 | Unclassified | 790 |
| 691 | Ga0501076_0000524 | 3300049592 | Bacteria | 24362 |
| 692 | Ga0501076_0065182 | 3300049592 | Bacteria | 2904 |
| 693 | Ga0501076_0078029 | 3300049592 | Bacteria | 2657 |
| 694 | Ga0501077_0000230 | 3300049593 | Bacteria | 32925 |
| 695 | Ga0501077_0225403 | 3300049593 | Bacteria | 1191 |
| 696 | Ga0501259_126057 | 3300049688 | Bacteria | 614 |
| 697 | Ga0501079_0000239 | 3300049741 | Bacteria | 33053 |
| 698 | Ga0501079_0134397 | 3300049741 | Bacteria | 1925 |
| 699 | Ga0501080_0000538 | 3300049742 | Bacteria | 29769 |
| 700 | Ga0501081_0000066 | 3300049743 | Bacteria | 40032 |
| 701 | Ga0501081_0353168 | 3300049743 | Bacteria | 1084 |
| 702 | Ga0501081_1357597 | 3300049743 | Bacteria | 539 |
| 703 | Ga0501083_0000328 | 3300049744 | Bacteria | 30083 |
| 704 | Ga0501035_0010284 | 3300049822 | Bacteria | 8678 |
| 705 | Ga0501035_0355086 | 3300049822 | Bacteria | 1226 |
| 706 | Ga0501044_0008232 | 3300049823 | Bacteria | 11439 |
| 707 | Ga0501044_0837448 | 3300049823 | Bacteria | 797 |
| 708 | Ga0501045_0000114 | 3300049824 | Bacteria | 40806 |
| 709 | Ga0501045_1071156 | 3300049824 | Unclassified | 590 |
| 710 | nmdc:mga06z11_903648_c1 | 3300050494 | Bacteria | 538 |
| 711 | nmdc:mga08y16_2177956_c1 | 3300050511 | Bacteria | 501 |
| 712 | nmdc:mga08y16_224248_c1 | 3300050511 | Bacteria | 1945 |
| 713 | nmdc:mga08y16_751833_c1 | 3300050511 | Bacteria | 971 |
| 714 | Ga0495595_0013673 | 3300053084 | Bacteria | 3432 |
| 715 | Ga0495595_0345716 | 3300053084 | Bacteria | 750 |
| 716 | Ga0495619_0013887 | 3300053085 | Bacteria | 5082 |
| 717 | Ga0495619_0043485 | 3300053085 | Bacteria | 2945 |
| 718 | Ga0495619_0140202 | 3300053085 | Bacteria | 1664 |
| 719 | Ga0495619_0183732 | 3300053085 | Unclassified | 1447 |
| 720 | Ga0495619_0261314 | 3300053085 | Bacteria | 1200 |
| 721 | Ga0501084_0000247 | 3300054114 | Bacteria | 40897 |
| 722 | Ga0501084_0764231 | 3300054114 | Bacteria | 814 |
| 723 | Ga0501084_0970026 | 3300054114 | Unclassified | 715 |
| 724 | Ga0501084_1611718 | 3300054114 | Unclassified | 543 |
| 725 | Ga0501082_0001708 | 3300060353 | Bacteria | 19373 |
| 726 | Ga0501082_1673284 | 3300060353 | Unclassified | 555 |
| 727 | Ga0466962_0013379 | 3300061719 | Bacteria | 3950 |
| 728 | Ga0466962_0072213 | 3300061719 | Bacteria | 1649 |
| 729 | Ga0466962_0073234 | 3300061719 | Bacteria | 1637 |
| 730 | Ga0466962_0216355 | 3300061719 | Bacteria | 938 |
| 731 | Ga0530510_0000154 | 3300061734 | Bacteria | 41103 |
| 732 | Ga0530510_0233825 | 3300061734 | Bacteria | 1367 |
| 733 | Ga0530510_0641643 | 3300061734 | Bacteria | 808 |
| 734 | Ga0530510_0649341 | 3300061734 | Bacteria | 803 |
| 735 | Ga0530510_0744263 | 3300061734 | Bacteria | 747 |
| 736 | Ga0163162_12741088 | |||
| 737 | Ga0058863_11887458 | |||
| 738 | Ga0058863_11969170 | |||
| 739 | Ga0058862_12785444 | |||
| 740 | Ga0070658_10028767 | |||
| 741 | Ga0070658_10037593 | |||
| 742 | Ga0070658_10088033 | |||
| 743 | Ga0070658_10135193 | |||
| 744 | Ga0070658_10833558 | |||
| 745 | Ga0070676_10180510 | |||
| 746 | Ga0070683_100024243 | |||
| 747 | Ga0070683_100045247 | |||
| 748 | Ga0070683_100095223 | |||
| 749 | Ga0070683_100104626 | |||
| 750 | Ga0070683_100105514 | |||
| 751 | Ga0070683_100145689 | |||
| 752 | Ga0070683_100845746 | |||
| 753 | Ga0070683_100919779 | |||
| 754 | Ga0070683_101028966 | |||
| 755 | Ga0068869_100135053 | |||
| 756 | Ga0068869_100467508 | |||
| 757 | Ga0070680_100149222 | |||
| 758 | Ga0070680_100194298 | |||
| 759 | Ga0070680_100243211 | |||
| 760 | Ga0070680_100254713 | |||
| 761 | Ga0070680_100286796 | |||
| 762 | Ga0070680_100639190 | |||
| 763 | Ga0070680_101607608 | |||
| 764 | Ga0070682_100003617 | |||
| 765 | Ga0070682_100094064 | |||
| 766 | Ga0070682_100098898 | |||
| 767 | Ga0070682_100145037 | |||
| 768 | Ga0070682_100231603 | |||
| 769 | Ga0070682_100305031 | |||
| 770 | Ga0068868_100002722 | |||
| 771 | Ga0068868_100297367 | |||
| 772 | Ga0070660_100021983 | |||
| 773 | Ga0070660_100043162 | |||
| 774 | Ga0070660_100045449 | |||
| 775 | Ga0070660_100071645 | |||
| 776 | Ga0070660_100156364 | |||
| 777 | Ga0070660_100180976 | |||
| 778 | Ga0070660_100302623 | |||
| 779 | Ga0070660_100842708 | |||
| 780 | Ga0070689_101199616 | |||
| 781 | Ga0070691_10021193 | |||
| 782 | Ga0070691_10101556 | |||
| 783 | Ga0070691_10429585 | |||
| 784 | Ga0070691_10510756 | |||
| 785 | Ga0070661_100107893 | |||
| 786 | Ga0070661_100263177 | |||
| 787 | Ga0070661_100664842 | |||
| 788 | Ga0070692_10023499 | |||
| 789 | Ga0070692_10195641 | |||
| 790 | Ga0070668_100022237 | |||
| 791 | Ga0070675_100069498 | |||
| 792 | Ga0070675_100134491 | |||
| 793 | Ga0070675_100841378 | |||
| 794 | Ga0070671_100889775 | |||
| 795 | Ga0070674_100028515 | |||
| 796 | Ga0070674_101305776 | |||
| 797 | Ga0070673_100030903 | |||
| 798 | Ga0070673_101687722 | |||
| 799 | Ga0070688_100122312 | |||
| 800 | Ga0070659_100012568 | |||
| 801 | Ga0070659_100067489 | |||
| 802 | Ga0070659_100170452 | |||
| 803 | Ga0070659_101023301 | |||
| 804 | Ga0070667_100401911 | |||
| 805 | Ga0070714_100003759 | |||
| 806 | Ga0070714_100015438 | |||
| 807 | Ga0070714_100027273 | |||
| 808 | Ga0070714_100262986 | |||
| 809 | Ga0070714_100417547 | |||
| 810 | Ga0070714_100750998 | |||
| 811 | Ga0070714_100773884 | |||
| 812 | Ga0070714_101430391 | |||
| 813 | Ga0070713_100175556 | |||
| 814 | Ga0070713_100281881 | |||
| 815 | Ga0070713_102432328 | |||
| 816 | Ga0070710_11497660 | |||
| 817 | Ga0070711_100118777 | |||
| 818 | Ga0070711_101343873 | |||
| 819 | Ga0070711_101729083 | |||
| 820 | Ga0070700_100003285 | |||
| 821 | Ga0070708_100294203 | |||
| 822 | Ga0070708_101511273 | |||
| 823 | Ga0070663_100089618 | |||
| 824 | Ga0070678_102037178 | |||
| 825 | Ga0070662_100168427 | |||
| 826 | Ga0070662_100851797 | |||
| 827 | Ga0070681_10019834 | |||
| 828 | Ga0070681_10027616 | |||
| 829 | Ga0070681_10063034 | |||
| 830 | Ga0070681_10082524 | |||
| 831 | Ga0070681_10163367 | |||
| 832 | Ga0070681_10170615 | |||
| 833 | Ga0070681_11124176 | |||
| 834 | Ga0070681_11408258 | |||
| 835 | Ga0070681_11460557 | |||
| 836 | Ga0070685_11083086 | |||
| 837 | Ga0070707_100117955 | |||
| 838 | Ga0070707_100243545 | |||
| 839 | Ga0070679_100059898 | |||
| 840 | Ga0070679_100113593 | |||
| 841 | Ga0070679_100162369 | |||
| 842 | Ga0070679_100173870 | |||
| 843 | Ga0070679_100230726 | |||
| 844 | Ga0070679_100317051 | |||
| 845 | Ga0070679_100345152 | |||
| 846 | Ga0070679_100411174 | |||
| 847 | Ga0070679_100757328 | |||
| 848 | Ga0070684_100151667 | |||
| 849 | Ga0070684_100158673 | |||
| 850 | Ga0070684_100180207 | |||
| 851 | Ga0070684_100217182 | |||
| 852 | Ga0070684_100381604 | |||
| 853 | Ga0070684_100430603 | |||
| 854 | Ga0070684_100696789 | |||
| 855 | Ga0070697_100073637 | |||
| 856 | Ga0068853_100345634 | |||
| 857 | Ga0068853_101102403 | |||
| 858 | Ga0070672_100109508 | |||
| 859 | Ga0070695_100000424 | |||
| 860 | Ga0070695_100418808 | |||
| 861 | Ga0070695_100542678 | |||
| 862 | Ga0070696_100728216 | |||
| 863 | Ga0070696_100830485 | |||
| 864 | Ga0070696_101118310 | |||
| 865 | Ga0070693_100131152 | |||
| 866 | Ga0070665_100981321 | |||
| 867 | Ga0070704_100035743 | |||
| 868 | Ga0070704_101229042 | |||
| 869 | Ga0068855_100024401 | |||
| 870 | Ga0068855_100473650 | |||
| 871 | Ga0068855_101117966 | |||
| 872 | Ga0070664_100017827 | |||
| 873 | Ga0070664_100805857 | |||
| 874 | Ga0068857_100167217 | |||
| 875 | Ga0068857_100211595 | |||
| 876 | Ga0068857_100724882 | |||
| 877 | Ga0068854_100015199 | |||
| 878 | Ga0068854_100073504 | |||
| 879 | Ga0068856_100099760 | |||
| 880 | Ga0068856_100313779 | |||
| 881 | Ga0068856_100396661 | |||
| 882 | Ga0068856_100492545 | |||
| 883 | Ga0068856_101250953 | |||
| 884 | Ga0068856_102124651 | |||
| 885 | Ga0068856_102194946 | |||
| 886 | Ga0068852_100044491 | |||
| 887 | Ga0068852_100065308 | |||
| 888 | Ga0068852_100066403 | |||
| 889 | Ga0068852_100937476 | |||
| 890 | Ga0068852_101297772 | |||
| 891 | Ga0068852_101759431 | |||
| 892 | Ga0068852_102685395 | |||
| 893 | Ga0068864_100003052 | |||
| 894 | Ga0068866_10220791 | |||
| 895 | Ga0068861_102557638 | |||
| 896 | Ga0068851_10191492 | |||
| 897 | Ga0068870_10091516 | |||
| 898 | Ga0068863_100104515 | |||
| 899 | Ga0068860_101469953 | |||
| 900 | Ga0068862_101419813 | |||
| 901 | Ga0081540_1183454 | |||
| 902 | Ga0081539_10002145 | |||
| 903 | Ga0070717_11068370 | |||
| 904 | Ga0075432_10459239 | |||
| 905 | Ga0070716_100930663 | |||
| 906 | Ga0070716_101079309 | |||
| 907 | Ga0070712_100024952 | |||
| 908 | Ga0070712_100124127 | |||
| 909 | Ga0070712_101270422 | |||
| 910 | Ga0070712_101469820 | |||
| 911 | Ga0075367_10757074 | |||
| 912 | Ga0068871_101033495 | |||
| 913 | Ga0075434_100473228 | |||
| 914 | Ga0075434_101374530 | |||
| 915 | Ga0068865_100054573 | |||
| 916 | Ga0068865_100980691 | |||
| 917 | Ga0075436_100981836 | |||
| 918 | Ga0105240_10392022 | |||
| 919 | Ga0105240_10450840 | |||
| 920 | Ga0105240_11083047 | |||
| 921 | Ga0111539_10117023 | |||
| 922 | Ga0111539_10503244 | |||
| 923 | Ga0111539_12212698 | |||
| 924 | Ga0105245_10000399 | |||
| 925 | Ga0105245_10379328 | |||
| 926 | Ga0105247_11648270 | |||
| 927 | Ga0114129_10385690 | |||
| 928 | Ga0105243_10222697 | |||
| 929 | Ga0105243_10872160 | |||
| 930 | Ga0105241_10594355 | |||
| 931 | Ga0105241_11260218 | |||
| 932 | Ga0105242_10318268 | |||
| 933 | Ga0105248_10516278 | |||
| 934 | Ga0105237_10232835 | |||
| 935 | Ga0105237_11194911 | |||
| 936 | Ga0105238_10160174 | |||
| 937 | Ga0105238_12012050 | |||
| 938 | Ga0105249_10019741 | |||
| 939 | Ga0105239_10018477 | |||
| 940 | Ga0105239_10045428 | |||
| 941 | Ga0105239_10203384 | |||
| 942 | Ga0105239_10400788 | |||
| 943 | Ga0105246_10951589 | |||
| 944 | Ga0157373_10218392 | |||
| 945 | Ga0157373_10340904 | |||
| 946 | Ga0157371_10007707 | |||
| 947 | Ga0157371_10392050 | |||
| 948 | Ga0157371_10556306 | |||
| 949 | Ga0157370_10027338 | |||
| 950 | Ga0157370_10266165 | |||
| 951 | Ga0157370_10385316 | |||
| 952 | Ga0157369_10056135 | |||
| 953 | Ga0157369_10256765 | |||
| 954 | Ga0157374_10007591 | |||
| 955 | Ga0163162_11044232 | |||
| 956 | Ga0157372_10028691 | |||
| 957 | Ga0157372_10175113 | |||
| 958 | Ga0157372_10196317 | |||
| 959 | Ga0157372_10216606 | |||
| 960 | Ga0157372_10267892 | |||
| 961 | Ga0157372_10278829 | |||
| 962 | Ga0157372_10512645 | |||
| 963 | Ga0157372_10734983 | |||
| 964 | Ga0157372_10857134 | |||
| 965 | Ga0157372_10962308 | |||
| 966 | Ga0157375_10301920 | |||
| 967 | Ga0157375_10646039 | |||
| 968 | Ga0163163_10127520 | |||
| 969 | Ga0157380_10088592 | |||
| 970 | Ga0157380_10199880 | |||
| 971 | Ga0182008_10071020 | |||
| 972 | Ga0157377_10000878 | |||
| 973 | Ga0157377_10074132 | |||
| 974 | Ga0157377_10574285 | |||
| 975 | Ga0157379_10885460 | |||
| 976 | Ga0157376_10126481 | |||
| 977 | Ga0182007_10085700 | |||
| 978 | Ga0206356_10568753 | |||
| 979 | Ga0206354_10111116 | |||
| 980 | Ga0206354_10807369 | |||
| 981 | Ga0206354_11165720 | |||
| 982 | Ga0206353_10500991 | |||
| 983 | Ga0206353_10561511 | |||
| 984 | Ga0206353_10597767 | |||
| 985 | Ga0206353_10692593 | |||
| 986 | Ga0206353_11837998 | |||
| 987 | Ga0213873_10003537 | |||
| 988 | Ga0213876_10073180 | |||
| 989 | Ga0207656_10141806 | |||
| 990 | Ga0207692_10041981 | |||
| 991 | Ga0207642_10078569 | |||
| 992 | Ga0207688_10003554 | |||
| 993 | Ga0207688_10533989 | |||
| 994 | Ga0207647_10191463 | |||
| 995 | Ga0207705_10032205 | |||
| 996 | Ga0207705_10042066 | |||
| 997 | Ga0207705_10048413 | |||
| 998 | Ga0207705_10065301 | |||
| 999 | Ga0207707_10056972 | |||
| 1000 | Ga0207707_10088548 | |||
| 1001 | Ga0207707_10354756 | |||
| 1002 | Ga0207707_10410964 | |||
| 1003 | Ga0207707_10432908 | |||
| 1004 | Ga0207707_10530868 | |||
| 1005 | Ga0207707_10982138 | |||
| 1006 | Ga0207695_10663629 | |||
| 1007 | Ga0207671_10236747 | |||
| 1008 | Ga0207693_10037709 | |||
| 1009 | Ga0207693_10042999 | |||
| 1010 | Ga0207693_10303001 | |||
| 1011 | Ga0207693_11035537 | |||
| 1012 | Ga0207663_10186527 | |||
| 1013 | Ga0207660_10148624 | |||
| 1014 | Ga0207660_10268051 | |||
| 1015 | Ga0207660_10360002 | |||
| 1016 | Ga0207660_10482925 | |||
| 1017 | Ga0207660_11036180 | |||
| 1018 | Ga0207657_10000616 | |||
| 1019 | Ga0207657_10005027 | |||
| 1020 | Ga0207657_10062173 | |||
| 1021 | Ga0207657_10095206 | |||
| 1022 | Ga0207657_10140046 | |||
| 1023 | Ga0207657_10198000 | |||
| 1024 | Ga0207657_10396320 | |||
| 1025 | Ga0207649_10209560 | |||
| 1026 | Ga0207649_10308715 | |||
| 1027 | Ga0207649_10541379 | |||
| 1028 | Ga0207649_11221560 | |||
| 1029 | Ga0207652_10028796 | |||
| 1030 | Ga0207652_10086073 | |||
| 1031 | Ga0207652_10087925 | |||
| 1032 | Ga0207652_10188661 | |||
| 1033 | Ga0207652_10267587 | |||
| 1034 | Ga0207652_10271086 | |||
| 1035 | Ga0207652_10633682 | |||
| 1036 | Ga0207652_10681217 | |||
| 1037 | Ga0207652_10789622 | |||
| 1038 | Ga0207646_10228539 | |||
| 1039 | Ga0207694_10346539 | |||
| 1040 | Ga0207659_10053517 | |||
| 1041 | Ga0207659_10298396 | |||
| 1042 | Ga0207687_10343121 | |||
| 1043 | Ga0207700_11520229 | |||
| 1044 | Ga0207664_10009761 | |||
| 1045 | Ga0207664_10272831 | |||
| 1046 | Ga0207664_11116013 | |||
| 1047 | Ga0207664_11241722 | |||
| 1048 | Ga0207664_11880517 | |||
| 1049 | Ga0207644_10581977 | |||
| 1050 | Ga0207690_10046129 | |||
| 1051 | Ga0207690_10154865 | |||
| 1052 | Ga0207690_10186296 | |||
| 1053 | Ga0207690_10553279 | |||
| 1054 | Ga0207690_11076450 | |||
| 1055 | Ga0207706_10020489 | |||
| 1056 | Ga0207706_10190826 | |||
| 1057 | Ga0207706_10261017 | |||
| 1058 | Ga0207686_10659301 | |||
| 1059 | Ga0207709_10841938 | |||
| 1060 | Ga0207670_11275158 | |||
| 1061 | Ga0207704_10227371 | |||
| 1062 | Ga0207704_10632007 | |||
| 1063 | Ga0207665_10289241 | |||
| 1064 | Ga0207691_10444743 | |||
| 1065 | Ga0207689_10094428 | |||
| 1066 | Ga0207661_10007076 | |||
| 1067 | Ga0207661_10261792 | |||
| 1068 | Ga0207661_10351850 | |||
| 1069 | Ga0207661_10356983 | |||
| 1070 | Ga0207661_10644426 | |||
| 1071 | Ga0207661_10740590 | |||
| 1072 | Ga0207661_10939683 | |||
| 1073 | Ga0207679_10611392 | |||
| 1074 | Ga0207679_10650753 | |||
| 1075 | Ga0207679_11466560 | |||
| 1076 | Ga0207667_10339094 | |||
| 1077 | Ga0207667_10389575 | |||
| 1078 | Ga0207667_10523801 | |||
| 1079 | Ga0207667_10810118 | |||
| 1080 | Ga0207651_10075564 | |||
| 1081 | Ga0207712_10258022 | |||
| 1082 | Ga0207712_11162185 | |||
| 1083 | Ga0207668_10729513 | |||
| 1084 | Ga0207640_10086859 | |||
| 1085 | Ga0207640_10336778 | |||
| 1086 | Ga0207640_10647259 | |||
| 1087 | Ga0207658_10136068 | |||
| 1088 | Ga0207677_10018268 | |||
| 1089 | Ga0207677_10268414 | |||
| 1090 | Ga0207639_10094581 | |||
| 1091 | Ga0207678_10114692 | |||
| 1092 | Ga0207678_10539195 | |||
| 1093 | Ga0207708_10004340 | |||
| 1094 | Ga0207702_10092577 | |||
| 1095 | Ga0207702_10348230 | |||
| 1096 | Ga0207702_10476105 | |||
| 1097 | Ga0207702_10775160 | |||
| 1098 | Ga0207702_12351949 | |||
| 1099 | Ga0207641_10955210 | |||
| 1100 | Ga0207676_10016651 | |||
| 1101 | Ga0207674_10199199 | |||
| 1102 | Ga0207674_10475405 | |||
| 1103 | Ga0207674_10894587 | |||
| 1104 | Ga0207675_101488216 | |||
| 1105 | Ga0207698_10079161 | |||
| 1106 | Ga0207698_10100116 | |||
| 1107 | Ga0207698_10480593 | |||
| 1108 | Ga0207698_10482257 | |||
| 1109 | Ga0207698_10784240 | |||
| 1110 | Ga0207698_11153313 | |||
| 1111 | Ga0207428_10562948 | |||
| 1112 | Ga0207428_10977921 | |||
| 1113 | Ga0268266_10115220 | |||
| 1114 | Ga0265319_1192764 | |||
| 1115 | Ga0265327_10046320 | |||
| 1116 | Ga0265327_10113236 | |||
| 1117 | Ga0307408_100495219 | |||
| 1118 | Ga0307410_10214493 | |||
| 1119 | Ga0307409_100300535 | |||
| 1120 | Ga0307409_100430449 | |||
| 1121 | Ga0307409_100803505 | |||
| 1122 | Ga0307409_102283537 | |||
| 1123 | Ga0307416_100039339 | |||
| 1124 | Ga0307416_100502949 | |||
| 1125 | Ga0307416_103471767 | |||
| 1126 | Ga0307414_10593139 | |||
| 1127 | Ga0307411_10790334 | |||
| 1128 | Ga0373956_0411268 | |||
| 1129 | Ga0373943_0155203 | |||
| 1130 | Ga0373943_0728591 | |||
| 1131 | Ga0373946_0094931 | |||
| 1132 | Ga0373935_1265503 | |||
| 1133 | Ga0373927_0521211 | |||
| 1134 | Ga0373933_0042533 | |||
| 1135 | Ga0373933_0264819 | |||
| 1136 | Ga0373947_0004284 | |||
| 1137 | Ga0373947_0382163 | |||
| 1138 | Ga0373947_0599111 | |||
| 1139 | Ga0373937_0015707 | |||
| 1140 | Ga0373937_0183361 | |||
| 1141 | Ga0373937_1320582 | |||
| 1142 | Ga0373925_0059214 | |||
| 1143 | Ga0395899_0095060 | |||
| 1144 | Ga0395899_0242323 | |||
| 1145 | Ga0395899_0257633 | |||
| 1146 | Ga0395900_0004581 | |||
| 1147 | Ga0395900_0011165 | |||
| 1148 | Ga0395900_0025308 | |||
| 1149 | Ga0395900_0066519 | |||
| 1150 | Ga0395900_0231179 | |||
| 1151 | Ga0395900_0292369 | |||
| 1152 | Ga0395900_0448972 | |||
| 1153 | Ga0395900_0485459 | |||
| 1154 | Ga0395900_0592182 | |||
| 1155 | Ga0395900_0895444 | |||
| 1156 | Ga0395900_0933366 | |||
| 1157 | Ga0395900_1357795 | |||
| 1158 | Ga0395898_0015468 | |||
| 1159 | Ga0395898_0209797 | |||
| 1160 | Ga0395898_0213695 | |||
| 1161 | Ga0395898_0276144 | |||
| 1162 | Ga0395898_0296870 | |||
| 1163 | Ga0395898_0315653 | |||
| 1164 | Ga0395898_0444593 | |||
| 1165 | Ga0395898_1181058 | |||
| 1166 | Ga0395898_1566391 | |||
| 1167 | Ga0395898_1634979 | |||
| 1168 | Ga0395898_1646229 | |||
| 1169 | Ga0395905_0129871 | |||
| 1170 | Ga0395905_0204536 | |||
| 1171 | Ga0395905_0451682 | |||
| 1172 | Ga0395905_0808176 | |||
| 1173 | Ga0395905_0843201 | |||
| 1174 | Ga0395905_0943965 | |||
| 1175 | Ga0395905_1387646 | |||
| 1176 | Ga0436364_1414925 | |||
| 1177 | Ga0395901_0090556 | |||
| 1178 | Ga0395901_0097434 | |||
| 1179 | Ga0395901_0119515 | |||
| 1180 | Ga0395901_0147624 | |||
| 1181 | Ga0395901_0164572 | |||
| 1182 | Ga0395901_0179164 | |||
| 1183 | Ga0395901_0228817 | |||
| 1184 | Ga0395901_0299014 | |||
| 1185 | Ga0395901_0399670 | |||
| 1186 | Ga0395901_0632944 | |||
| 1187 | Ga0395901_0709784 | |||
| 1188 | Ga0395901_1140794 | |||
| 1189 | Ga0242420_059446 | |||
| 1190 | Ga0436365_0714445 | |||
| 1191 | Ga0436362_0503031 | |||
| 1192 | Ga0439466_0033431 | |||
| 1193 | Ga0439455_0008465 | |||
| 1194 | Ga0450900_018817 | |||
| 1195 | Ga0450902_022454 | |||
| 1196 | Ga0450905_030199 | |||
| 1197 | Ga0439458_0007645 | |||
| 1198 | Ga0450916_024826 | |||
| 1199 | Ga0466972_0138629 | |||
| 1200 | Ga0466965_0249811 | |||
| 1201 | Ga0466966_0068629 | |||
| 1202 | Ga0466961_0190762 | |||
| 1203 | Ga0466961_0461301 | |||
| 1204 | Ga0466961_0772080 | |||
| 1205 | Ga0466963_0000216 | |||
| 1206 | Ga0466963_0003034 | |||
| 1207 | Ga0466963_0005085 | |||
| 1208 | Ga0466963_0010001 | |||
| 1209 | Ga0466963_0018759 | |||
| 1210 | Ga0466963_0126516 | |||
| 1211 | Ga0466963_0216514 | |||
| 1212 | Ga0466963_0246636 | |||
| 1213 | Ga0466963_0346027 | |||
| 1214 | Ga0466963_0457372 | |||
| 1215 | Ga0466964_0129995 | |||
| 1216 | Ga0466964_0208506 | |||
| 1217 | Ga0466964_0414133 | |||
| 1218 | Ga0466964_0462187 | |||
| 1219 | Ga0466964_0594332 | |||
| 1220 | Ga0466971_0332830 | |||
| 1221 | Ga0466968_0042855 | |||
| 1222 | Ga0466968_0045852 | |||
| 1223 | Ga0466968_0370131 | |||
| 1224 | Ga0466968_0385825 | |||
| 1225 | Ga0466957_0008644 | |||
| 1226 | Ga0466957_0128365 | |||
| 1227 | Ga0466957_0517889 | |||
| 1228 | Ga0466957_0586223 | |||
| 1229 | Ga0466957_0687716 | |||
| 1230 | Ga0466960_0005077 | |||
| 1231 | Ga0466960_0100085 | |||
| 1232 | Ga0466959_0006508 | |||
| 1233 | Ga0466959_0417787 | |||
| 1234 | Ga0466958_0000593 | |||
| 1235 | Ga0466958_0003623 | |||
| 1236 | Ga0466958_0015716 | |||
| 1237 | Ga0466958_0020469 | |||
| 1238 | Ga0466958_0049299 | |||
| 1239 | Ga0466958_0573156 | |||
| 1240 | Ga0466958_0582133 | |||
| 1241 | Ga0466958_0670181 | |||
| 1242 | Ga0466958_0965171 | |||
| 1243 | Ga0466967_0001892 | |||
| 1244 | Ga0466967_0002719 | |||
| 1245 | Ga0466967_0015893 | |||
| 1246 | Ga0466967_0031509 | |||
| 1247 | Ga0466967_0052537 | |||
| 1248 | Ga0466967_0060617 | |||
| 1249 | Ga0466967_0104194 | |||
| 1250 | Ga0466967_0135177 | |||
| 1251 | Ga0466967_0154456 | |||
| 1252 | Ga0466967_0205434 | |||
| 1253 | Ga0466967_0217773 | |||
| 1254 | Ga0466967_0312411 | |||
| 1255 | Ga0466967_0404872 | |||
| 1256 | Ga0466967_1023843 | |||
| 1257 | Ga0466967_1086748 | |||
| 1258 | Ga0466967_2603886 | |||
| 1259 | Ga0495592_0097932 | |||
| 1260 | Ga0495592_0410992 | |||
| 1261 | Ga0495592_0494431 | |||
| 1262 | Ga0495629_0296914 | |||
| 1263 | Ga0495641_0271985 | |||
| 1264 | Ga0495641_0443650 | |||
| 1265 | Ga0495651_0033867 | |||
| 1266 | Ga0495664_0309778 | |||
| 1267 | Ga0495608_0023197 | |||
| 1268 | Ga0495618_0042778 | |||
| 1269 | Ga0495630_0564603 | |||
| 1270 | Ga0495644_0421967 | |||
| 1271 | Ga0495652_0716798 | |||
| 1272 | Ga0495665_0371739 | |||
| 1273 | Ga0495640_0152776 | |||
| 1274 | Ga0495586_0359032 | |||
| 1275 | Ga0495645_0295261 | |||
| 1276 | Ga0495645_0660488 | |||
| 1277 | Ga0495667_0180112 | |||
| 1278 | Ga0495634_0041306 | |||
| 1279 | Ga0495634_0522562 | |||
| 1280 | Ga0495635_0228437 | |||
| 1281 | Ga0495588_0168716 | |||
| 1282 | Ga0495588_0297663 | |||
| 1283 | Ga0495657_0268632 | |||
| 1284 | Ga0495599_0324716 | |||
| 1285 | Ga0495646_0180033 | |||
| 1286 | Ga0495647_0260027 | |||
| 1287 | Ga0495658_0417283 | |||
| 1288 | Ga0495658_1119664 | |||
| 1289 | Ga0495613_0074441 | |||
| 1290 | Ga0495613_0468342 | |||
| 1291 | Ga0495613_0662349 | |||
| 1292 | Ga0495624_0210750 | |||
| 1293 | Ga0495624_0754124 | |||
| 1294 | Ga0495589_0210840 | |||
| 1295 | Ga0495600_0147051 | |||
| 1296 | Ga0495581_0135800 | |||
| 1297 | Ga0495581_0573474 | |||
| 1298 | Ga0495674_0036626 | |||
| 1299 | Ga0495674_0500437 | |||
| 1300 | Ga0495676_0199751 | |||
| 1301 | Ga0495680_0004651 | |||
| 1302 | Ga0495680_0198603 | |||
| 1303 | Ga0495684_0004177 | |||
| 1304 | Ga0495684_0066144 | |||
| 1305 | Ga0495593_0314921 | |||
| 1306 | Ga0495602_0186632 | |||
| 1307 | Ga0495614_0318385 | |||
| 1308 | Ga0496100_0626616 | |||
| 1309 | Ga0496101_0101004 | |||
| 1310 | Ga0496101_0103308 | |||
| 1311 | Ga0496101_0189906 | |||
| 1312 | Ga0496101_0846960 | |||
| 1313 | Ga0496102_0136172 | |||
| 1314 | Ga0496102_0147304 | |||
| 1315 | Ga0496102_0155881 | |||
| 1316 | Ga0496102_0176698 | |||
| 1317 | Ga0496102_0215673 | |||
| 1318 | Ga0496102_0853379 | |||
| 1319 | Ga0496103_0040413 | |||
| 1320 | Ga0496103_0066619 | |||
| 1321 | Ga0496103_0075598 | |||
| 1322 | Ga0496104_0001747 | |||
| 1323 | Ga0496104_0028656 | |||
| 1324 | Ga0496104_0075088 | |||
| 1325 | Ga0496104_0106822 | |||
| 1326 | Ga0496104_0985603 | |||
| 1327 | Ga0496104_1147947 | |||
| 1328 | Ga0496105_0025625 | |||
| 1329 | Ga0496105_0193978 | |||
| 1330 | Ga0496105_0289079 | |||
| 1331 | Ga0496105_0458827 | |||
| 1332 | Ga0496105_0711051 | |||
| 1333 | Ga0496106_0052338 | |||
| 1334 | Ga0496106_0070185 | |||
| 1335 | Ga0496106_0947125 | |||
| 1336 | Ga0496107_0038063 | |||
| 1337 | Ga0496107_0221789 | |||
| 1338 | Ga0496108_0050444 | |||
| 1339 | Ga0496108_0091404 | |||
| 1340 | Ga0496108_0780668 | |||
| 1341 | Ga0496108_1280866 | |||
| 1342 | Ga0496109_0013462 | |||
| 1343 | Ga0496109_0032837 | |||
| 1344 | Ga0496109_0037943 | |||
| 1345 | Ga0496109_0448200 | |||
| 1346 | Ga0496109_1004806 | |||
| 1347 | Ga0496109_1259789 | |||
| 1348 | Ga0496109_1432998 | |||
| 1349 | Ga0496110_0001864 | |||
| 1350 | Ga0496110_0028523 | |||
| 1351 | Ga0496110_0096882 | |||
| 1352 | Ga0496110_0988260 | |||
| 1353 | Ga0496110_1783730 | |||
| 1354 | Ga0496111_0021517 | |||
| 1355 | Ga0496111_0022564 | |||
| 1356 | Ga0496111_0156637 | |||
| 1357 | Ga0496112_0019502 | |||
| 1358 | Ga0496112_0040963 | |||
| 1359 | Ga0496112_0057344 | |||
| 1360 | Ga0496112_0239346 | |||
| 1361 | Ga0496112_0300756 | |||
| 1362 | Ga0496112_0331432 | |||
| 1363 | Ga0496112_0349788 | |||
| 1364 | Ga0496112_0506222 | |||
| 1365 | Ga0496112_0624393 | |||
| 1366 | Ga0496112_1031889 | |||
| 1367 | Ga0496113_0011096 | |||
| 1368 | Ga0496113_0216977 | |||
| 1369 | Ga0496113_0610324 | |||
| 1370 | Ga0496113_0918490 | |||
| 1371 | Ga0496113_1250790 | |||
| 1372 | Ga0496113_1258954 | |||
| 1373 | Ga0496114_0018442 | |||
| 1374 | Ga0496114_0062984 | |||
| 1375 | Ga0496114_0197765 | |||
| 1376 | Ga0496114_0200325 | |||
| 1377 | Ga0501032_0004469 | |||
| 1378 | Ga0501033_0000620 | |||
| 1379 | Ga0501034_0402007 | |||
| 1380 | Ga0501036_0000199 | |||
| 1381 | Ga0501036_0081141 | |||
| 1382 | Ga0501036_0525277 | |||
| 1383 | Ga0501036_1274849 | |||
| 1384 | Ga0501037_0000502 | |||
| 1385 | Ga0501038_0000536 | |||
| 1386 | Ga0501038_0195265 | |||
| 1387 | Ga0501039_0000244 | |||
| 1388 | Ga0501040_0000131 | |||
| 1389 | Ga0501040_0181767 | |||
| 1390 | Ga0501040_0762000 | |||
| 1391 | Ga0501041_0000057 | |||
| 1392 | Ga0501041_0560543 | |||
| 1393 | Ga0501042_0000219 | |||
| 1394 | Ga0501043_0000969 | |||
| 1395 | Ga0501046_0001266 | |||
| 1396 | Ga0501046_0533255 | |||
| 1397 | Ga0501047_0003817 | |||
| 1398 | Ga0501048_0000427 | |||
| 1399 | Ga0501048_0605823 | |||
| 1400 | Ga0501067_0001469 | |||
| 1401 | Ga0501067_0012155 | |||
| 1402 | Ga0501067_0094852 | |||
| 1403 | Ga0501067_0174377 | |||
| 1404 | Ga0501068_0000209 | |||
| 1405 | Ga0501068_0000557 | |||
| 1406 | Ga0501069_0001116 | |||
| 1407 | Ga0501069_0011197 | |||
| 1408 | Ga0501069_0322268 | |||
| 1409 | Ga0501069_0378436 | |||
| 1410 | Ga0501069_0379923 | |||
| 1411 | Ga0501069_0489364 | |||
| 1412 | Ga0501069_0512847 | |||
| 1413 | Ga0501070_0002942 | |||
| 1414 | Ga0501071_0000177 | |||
| 1415 | Ga0501072_0000350 | |||
| 1416 | Ga0501072_0019140 | |||
| 1417 | Ga0501072_1053472 | |||
| 1418 | Ga0501073_0006956 | |||
| 1419 | Ga0501073_1223807 | |||
| 1420 | Ga0501074_0000106 | |||
| 1421 | Ga0501074_0186091 | |||
| 1422 | Ga0501074_0503581 | |||
| 1423 | Ga0501075_0000127 | |||
| 1424 | Ga0501075_0058257 | |||
| 1425 | Ga0501075_0670811 | |||
| 1426 | Ga0501076_0000524 | |||
| 1427 | Ga0501076_0065182 | |||
| 1428 | Ga0501076_0078029 | |||
| 1429 | Ga0501077_0000230 | |||
| 1430 | Ga0501077_0225403 | |||
| 1431 | Ga0501259_126057 | |||
| 1432 | Ga0501079_0000239 | |||
| 1433 | Ga0501079_0134397 | |||
| 1434 | Ga0501080_0000538 | |||
| 1435 | Ga0501081_0000066 | |||
| 1436 | Ga0501081_0353168 | |||
| 1437 | Ga0501081_1357597 | |||
| 1438 | Ga0501083_0000328 | |||
| 1439 | Ga0501035_0010284 | |||
| 1440 | Ga0501035_0355086 | |||
| 1441 | Ga0501044_0008232 | |||
| 1442 | Ga0501044_0837448 | |||
| 1443 | Ga0501045_0000114 | |||
| 1444 | Ga0501045_1071156 | |||
| 1445 | nmdc:mga06z11_903648_c1 | |||
| 1446 | nmdc:mga08y16_2177956_c1 | |||
| 1447 | nmdc:mga08y16_224248_c1 | |||
| 1448 | nmdc:mga08y16_751833_c1 | |||
| 1449 | Ga0495595_0013673 | |||
| 1450 | Ga0495595_0345716 | |||
| 1451 | Ga0495619_0013887 | |||
| 1452 | Ga0495619_0043485 | |||
| 1453 | Ga0495619_0140202 | |||
| 1454 | Ga0495619_0183732 | |||
| 1455 | Ga0495619_0261314 | |||
| 1456 | Ga0501084_0000247 | |||
| 1457 | Ga0501084_0764231 | |||
| 1458 | Ga0501084_0970026 | |||
| 1459 | Ga0501084_1611718 | |||
| 1460 | Ga0501082_0001708 | |||
| 1461 | Ga0501082_1673284 | |||
| 1462 | Ga0466962_0013379 | |||
| 1463 | Ga0466962_0072213 | |||
| 1464 | Ga0466962_0073234 | |||
| 1465 | Ga0466962_0216355 | |||
| 1466 | Ga0530510_0000154 | |||
| 1467 | Ga0530510_0233825 | |||
| 1468 | Ga0530510_0641643 | |||
| 1469 | Ga0530510_0649341 | |||
| 1470 | Ga0530510_0744263 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jx7-assembly1.cif.gz_E | crystal structure of ychn protein from e.coli | 0.8283 | 5 | 122 |
| 3mc3-assembly1.cif.gz_A | crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution | 0.8281 | 4 | 122 |
| 1jx7-assembly1.cif.gz_E | crystal structure of ychn protein from e.coli | 0.8159 | 5 | 122 |
| 3mc3-assembly1.cif.gz_A | crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution | 0.8103 | 4 | 122 |
| 2qs7-assembly2.cif.gz_D | crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution | 0.8026 | 5 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10941_1_278_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8682 | 4 | 42 | 3.40.50.2000 |
| af_Q58396_1_114_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8638 | 5 | 122 | 3.40.1260.10 |
| af_Q58170_143_270_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8619 | 4 | 115 | 3.40.1260.10 |
| af_Q58396_1_114_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.857 | 5 | 122 | 3.40.1260.10 |
| af_O01613_18_146_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8318 | 4 | 42 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1S265-F1-model_v4 | deleted | 0.9947 | 4 | 84 |
|
| AF-A0A1H5MH28-F1-model_v4 | Predicted peroxiredoxin | 0.9925 | 6 | 122 |
|
| AF-A0A6I3IN15-F1-model_v4 | Peroxiredoxin | 0.9916 | 5 | 122 |
|
| AF-Q0RSC7-F1-model_v4 | Uncharacterized protein | 0.9907 | 4 | 122 |
|
| AF-A1SLX6-F1-model_v4 | Peroxiredoxins-like protein | 0.99 | 5 | 122 |
|