F478186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 261 | 720 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100154443|Ga0068862_1001544431 |
| Length | 440 |
| Sequence | MMQVFRALIAVILWQRMSAFPLGNSEWIHLAETVVSWQSKRMPVTTVAMLTAGGLAPCLSAAVGGLIGHYTQVAPDVRIIAYLNGYAGLLVGKSVEVTTEVRAAAGRLHAFGGSPIGNSRVRLTNVDDCLRRGLVQPGQDPLQMAAEQLRRDGVDVLHTIGGDDTNTTAADLAAYLSSHGYRLTVVGLPKTIDNDVVPIRQTLGAWSAAEQGALYARNIIAEHSSNPRMLIVHEVMGRNCGWLTAATALAHHQWVKDAQFAEWLENSAAEWDVHGVYVPERPINIAEEAKRLRKGMERHSNVNLFISEGAGAQEIVVAMEAAGEQVPRDPFGHVQLDKVNPGEWFAKQFAAALGAEKVLVQKSGYFARSAPANEADLALIRICTTYAVDAALRGESGVVGQDEERGDKLRVIEFERIAGGKSFDTSVSWFTDLLSDIGQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 2 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 3 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 4 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 5 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 6 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 7 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 8 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 9 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 10 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 11 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 12 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 13 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 14 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 15 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 16 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 164 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 185 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 222 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 223 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 224 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 225 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 226 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 227 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 256 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 260 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 261 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.55 |
| Metatranscriptomes | 0.41 |
| Isolates | 2.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 3.81 |
| Rhizosphere | 92.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000759 | 3300001904 | Bacteria | 5900 |
| 2 | JGI24741J21665_1002347 | 3300001915 | Bacteria | 4957 |
| 3 | JGI24740J21852_10003099 | 3300001979 | Bacteria | 7335 |
| 4 | JGI24740J21852_10010512 | 3300001979 | Bacteria | 3558 |
| 5 | JGI24740J21852_10018147 | 3300001979 | Bacteria | 2503 |
| 6 | JGI24739J22299_10005409 | 3300001989 | Bacteria | 4853 |
| 7 | JGI24737J22298_10000746 | 3300001990 | Bacteria | 11487 |
| 8 | JGI24737J22298_10000786 | 3300001990 | Bacteria | 11230 |
| 9 | JGI24737J22298_10003275 | 3300001990 | Bacteria | 5744 |
| 10 | JGI24737J22298_10007606 | 3300001990 | Bacteria | 3651 |
| 11 | JGI24737J22298_10028748 | 3300001990 | Bacteria | 1746 |
| 12 | JGI24735J21928_10006139 | 3300002067 | Bacteria | 3966 |
| 13 | JGI24735J21928_10007844 | 3300002067 | Bacteria | 3469 |
| 14 | JGI24735J21928_10021176 | 3300002067 | Bacteria | 1987 |
| 15 | JGI24745J21846_1001492 | 3300002073 | Bacteria | 2276 |
| 16 | JGI24738J21930_10000194 | 3300002075 | Bacteria | 16008 |
| 17 | JGI24738J21930_10005800 | 3300002075 | Bacteria | 2934 |
| 18 | JGI24738J21930_10005848 | 3300002075 | Bacteria | 2923 |
| 19 | Ga0070658_10000584 | 3300005327 | Bacteria | 31661 |
| 20 | Ga0070658_10031162 | 3300005327 | Bacteria | 4281 |
| 21 | Ga0070658_10033650 | 3300005327 | Bacteria | 4124 |
| 22 | Ga0070658_10036735 | 3300005327 | Bacteria | 3948 |
| 23 | Ga0070658_10182228 | 3300005327 | Bacteria | 1767 |
| 24 | Ga0070676_10007325 | 3300005328 | Bacteria | 5920 |
| 25 | Ga0070683_100013630 | 3300005329 | Bacteria | 7096 |
| 26 | Ga0070683_100014137 | 3300005329 | Bacteria | 6972 |
| 27 | Ga0070683_100032882 | 3300005329 | Bacteria | 4727 |
| 28 | Ga0070683_100064747 | 3300005329 | Bacteria | 3403 |
| 29 | Ga0070683_100081414 | 3300005329 | Bacteria | 3031 |
| 30 | Ga0070690_100124468 | 3300005330 | Bacteria | 1734 |
| 31 | Ga0070670_100021499 | 3300005331 | Bacteria | 5550 |
| 32 | Ga0070670_100101434 | 3300005331 | Bacteria | 2478 |
| 33 | Ga0068869_100006785 | 3300005334 | Bacteria | 7277 |
| 34 | Ga0068869_100058106 | 3300005334 | Bacteria | 2827 |
| 35 | Ga0068869_100256309 | 3300005334 | Bacteria | 1399 |
| 36 | Ga0070666_10000216 | 3300005335 | Bacteria | 39574 |
| 37 | Ga0070666_10006945 | 3300005335 | Bacteria | 6976 |
| 38 | Ga0070666_10009580 | 3300005335 | Bacteria | 6044 |
| 39 | Ga0070666_10031092 | 3300005335 | Bacteria | 3523 |
| 40 | Ga0070680_100000734 | 3300005336 | Bacteria | 22858 |
| 41 | Ga0070680_100006132 | 3300005336 | Bacteria | 9113 |
| 42 | Ga0070680_100008040 | 3300005336 | Bacteria | 8055 |
| 43 | Ga0070680_100017540 | 3300005336 | Bacteria | 5645 |
| 44 | Ga0068868_100023459 | 3300005338 | Bacteria | 4670 |
| 45 | Ga0068868_100036608 | 3300005338 | Bacteria | 3800 |
| 46 | Ga0068868_100171643 | 3300005338 | Bacteria | 1795 |
| 47 | Ga0070660_100000147 | 3300005339 | Bacteria | 45250 |
| 48 | Ga0070660_100002954 | 3300005339 | Bacteria | 11693 |
| 49 | Ga0070660_100016712 | 3300005339 | Bacteria | 5333 |
| 50 | Ga0070660_100050525 | 3300005339 | Bacteria | 3200 |
| 51 | Ga0070660_100089849 | 3300005339 | Bacteria | 2421 |
| 52 | Ga0070660_100096062 | 3300005339 | Bacteria | 2343 |
| 53 | Ga0070660_100110975 | 3300005339 | Bacteria | 2181 |
| 54 | Ga0070691_10048210 | 3300005341 | Bacteria | 2027 |
| 55 | Ga0070687_100058189 | 3300005343 | Bacteria | 2030 |
| 56 | Ga0070661_100000213 | 3300005344 | Bacteria | 48218 |
| 57 | Ga0070661_100028273 | 3300005344 | Bacteria | 4043 |
| 58 | Ga0070661_100040241 | 3300005344 | Bacteria | 3409 |
| 59 | Ga0070661_100046328 | 3300005344 | Bacteria | 3181 |
| 60 | Ga0070669_100000629 | 3300005353 | Bacteria | 26123 |
| 61 | Ga0070669_100044878 | 3300005353 | Bacteria | 3220 |
| 62 | Ga0070675_100016949 | 3300005354 | Bacteria | 5787 |
| 63 | Ga0070675_100089116 | 3300005354 | Bacteria | 2583 |
| 64 | Ga0070671_100005290 | 3300005355 | Bacteria | 10297 |
| 65 | Ga0070671_100008660 | 3300005355 | Bacteria | 8163 |
| 66 | Ga0070671_100024818 | 3300005355 | Bacteria | 4912 |
| 67 | Ga0070671_100068476 | 3300005355 | Bacteria | 2960 |
| 68 | Ga0070671_100272166 | 3300005355 | Bacteria | 1440 |
| 69 | Ga0070674_100024613 | 3300005356 | Bacteria | 3910 |
| 70 | Ga0070674_100028858 | 3300005356 | Bacteria | 3647 |
| 71 | Ga0070673_100005945 | 3300005364 | Bacteria | 7888 |
| 72 | Ga0070673_100005956 | 3300005364 | Bacteria | 7881 |
| 73 | Ga0070673_100016917 | 3300005364 | Bacteria | 5171 |
| 74 | Ga0070673_100038146 | 3300005364 | Bacteria | 3667 |
| 75 | Ga0070673_100044581 | 3300005364 | Bacteria | 3435 |
| 76 | Ga0070673_100114877 | 3300005364 | Bacteria | 2238 |
| 77 | Ga0070659_100000123 | 3300005366 | Bacteria | 58613 |
| 78 | Ga0070659_100001223 | 3300005366 | Bacteria | 18648 |
| 79 | Ga0070659_100004009 | 3300005366 | Bacteria | 10479 |
| 80 | Ga0070659_100011730 | 3300005366 | Bacteria | 6487 |
| 81 | Ga0070659_100016409 | 3300005366 | Bacteria | 5560 |
| 82 | Ga0070659_100028316 | 3300005366 | Bacteria | 4325 |
| 83 | Ga0070659_100143945 | 3300005366 | Bacteria | 1941 |
| 84 | Ga0070667_100010025 | 3300005367 | Bacteria | 7850 |
| 85 | Ga0070667_100021756 | 3300005367 | Bacteria | 5322 |
| 86 | Ga0070667_100071000 | 3300005367 | Bacteria | 2965 |
| 87 | Ga0070667_100108779 | 3300005367 | Bacteria | 2402 |
| 88 | Ga0070714_100017357 | 3300005435 | Bacteria | 5829 |
| 89 | Ga0070714_100017962 | 3300005435 | Bacteria | 5736 |
| 90 | Ga0070714_100022690 | 3300005435 | Bacteria | 5148 |
| 91 | Ga0070714_100042637 | 3300005435 | Bacteria | 3834 |
| 92 | Ga0070713_100052229 | 3300005436 | Bacteria | 3383 |
| 93 | Ga0070713_100052663 | 3300005436 | Bacteria | 3370 |
| 94 | Ga0070713_100065431 | 3300005436 | Bacteria | 3054 |
| 95 | Ga0070713_100086400 | 3300005436 | Bacteria | 2689 |
| 96 | Ga0070694_100038141 | 3300005444 | Bacteria | 3191 |
| 97 | Ga0070663_100001735 | 3300005455 | Bacteria | 12109 |
| 98 | Ga0070663_100010076 | 3300005455 | Bacteria | 5878 |
| 99 | Ga0070663_100017691 | 3300005455 | Bacteria | 4657 |
| 100 | Ga0070678_100048390 | 3300005456 | Bacteria | 3061 |
| 101 | Ga0070678_100057965 | 3300005456 | Bacteria | 2840 |
| 102 | Ga0070678_100069917 | 3300005456 | Bacteria | 2622 |
| 103 | Ga0070662_100000060 | 3300005457 | Bacteria | 59430 |
| 104 | Ga0070662_100010709 | 3300005457 | Bacteria | 6036 |
| 105 | Ga0070662_100012577 | 3300005457 | Bacteria | 5614 |
| 106 | Ga0070662_100039968 | 3300005457 | Bacteria | 3338 |
| 107 | Ga0070662_100077659 | 3300005457 | Bacteria | 2464 |
| 108 | Ga0070681_10035173 | 3300005458 | Bacteria | 5032 |
| 109 | Ga0070681_10231893 | 3300005458 | Bacteria | 1760 |
| 110 | Ga0068867_100004321 | 3300005459 | Bacteria | 10002 |
| 111 | Ga0068867_100042149 | 3300005459 | Bacteria | 3337 |
| 112 | Ga0068867_100042601 | 3300005459 | Bacteria | 3321 |
| 113 | Ga0068867_100045663 | 3300005459 | Bacteria | 3214 |
| 114 | Ga0070684_100015937 | 3300005535 | Bacteria | 6137 |
| 115 | Ga0070684_100016652 | 3300005535 | Bacteria | 6013 |
| 116 | Ga0070684_100093635 | 3300005535 | Bacteria | 2675 |
| 117 | Ga0068853_100000277 | 3300005539 | Bacteria | 36116 |
| 118 | Ga0068853_100003199 | 3300005539 | Bacteria | 12510 |
| 119 | Ga0068853_100028498 | 3300005539 | Bacteria | 4698 |
| 120 | Ga0068853_100165335 | 3300005539 | Bacteria | 1999 |
| 121 | Ga0070672_100003277 | 3300005543 | Bacteria | 10478 |
| 122 | Ga0070672_100018309 | 3300005543 | Bacteria | 5060 |
| 123 | Ga0070665_100003766 | 3300005548 | Bacteria | 16049 |
| 124 | Ga0070665_100016998 | 3300005548 | Bacteria | 7294 |
| 125 | Ga0070665_100024266 | 3300005548 | Bacteria | 6106 |
| 126 | Ga0070665_100058493 | 3300005548 | Bacteria | 3864 |
| 127 | Ga0068855_100000877 | 3300005563 | Bacteria | 37389 |
| 128 | Ga0068855_100006911 | 3300005563 | Bacteria | 13762 |
| 129 | Ga0068855_100019332 | 3300005563 | Bacteria | 8185 |
| 130 | Ga0068855_100047947 | 3300005563 | Bacteria | 5044 |
| 131 | Ga0070664_100000158 | 3300005564 | Bacteria | 46496 |
| 132 | Ga0070664_100027076 | 3300005564 | Bacteria | 4763 |
| 133 | Ga0068857_100001240 | 3300005577 | Bacteria | 19917 |
| 134 | Ga0068857_100020601 | 3300005577 | Bacteria | 5803 |
| 135 | Ga0068857_100041550 | 3300005577 | Bacteria | 4077 |
| 136 | Ga0068857_100041928 | 3300005577 | Bacteria | 4058 |
| 137 | Ga0068854_100021242 | 3300005578 | Bacteria | 4403 |
| 138 | Ga0068854_100029865 | 3300005578 | Bacteria | 3777 |
| 139 | Ga0068854_100030803 | 3300005578 | Bacteria | 3724 |
| 140 | Ga0068854_100128662 | 3300005578 | Bacteria | 1931 |
| 141 | Ga0068856_100000974 | 3300005614 | Bacteria | 30540 |
| 142 | Ga0068856_100011435 | 3300005614 | Bacteria | 8610 |
| 143 | Ga0068856_100200037 | 3300005614 | Bacteria | 2012 |
| 144 | Ga0068856_100216315 | 3300005614 | Bacteria | 1931 |
| 145 | Ga0068852_100001298 | 3300005616 | Bacteria | 16705 |
| 146 | Ga0068852_100001354 | 3300005616 | Bacteria | 16438 |
| 147 | Ga0068852_100006359 | 3300005616 | Bacteria | 8530 |
| 148 | Ga0068852_100009317 | 3300005616 | Bacteria | 7284 |
| 149 | Ga0068852_100011068 | 3300005616 | Bacteria | 6772 |
| 150 | Ga0068852_100019422 | 3300005616 | Bacteria | 5379 |
| 151 | Ga0068852_100067340 | 3300005616 | Bacteria | 3130 |
| 152 | Ga0068859_100002593 | 3300005617 | Bacteria | 18395 |
| 153 | Ga0068864_100012308 | 3300005618 | Bacteria | 7071 |
| 154 | Ga0068864_100184371 | 3300005618 | Bacteria | 1910 |
| 155 | Ga0068866_10040292 | 3300005718 | Bacteria | 2312 |
| 156 | Ga0068866_10044137 | 3300005718 | Bacteria | 2229 |
| 157 | Ga0068866_10093358 | 3300005718 | Bacteria | 1644 |
| 158 | Ga0068851_10004197 | 3300005834 | Bacteria | 6492 |
| 159 | Ga0068870_10080568 | 3300005840 | Bacteria | 1799 |
| 160 | Ga0068863_100033211 | 3300005841 | Bacteria | 4916 |
| 161 | Ga0068863_100054970 | 3300005841 | Bacteria | 3771 |
| 162 | Ga0068863_100077472 | 3300005841 | Bacteria | 3146 |
| 163 | Ga0068863_100254103 | 3300005841 | Bacteria | 1698 |
| 164 | Ga0068858_100001220 | 3300005842 | Bacteria | 26659 |
| 165 | Ga0068858_100001846 | 3300005842 | Bacteria | 21586 |
| 166 | Ga0068858_100011265 | 3300005842 | Bacteria | 8450 |
| 167 | Ga0068860_100036535 | 3300005843 | Bacteria | 4706 |
| 168 | Ga0068860_100038335 | 3300005843 | Bacteria | 4584 |
| 169 | Ga0068860_100058888 | 3300005843 | Bacteria | 3652 |
| 170 | Ga0068862_100011722 | 3300005844 | Bacteria | 7235 |
| 171 | Ga0068862_100154443 | 3300005844 | Bacteria | 2045 |
| 172 | Ga0081540_1008084 | 3300005983 | Bacteria | 7389 |
| 173 | Ga0070717_10007064 | 3300006028 | Bacteria | 8317 |
| 174 | Ga0070712_100091074 | 3300006175 | Bacteria | 2234 |
| 175 | Ga0097621_100005115 | 3300006237 | Bacteria | 9214 |
| 176 | Ga0097621_100100581 | 3300006237 | Bacteria | 2432 |
| 177 | Ga0068871_100007484 | 3300006358 | Bacteria | 7811 |
| 178 | Ga0068871_100082726 | 3300006358 | Bacteria | 2662 |
| 179 | Ga0075433_10062719 | 3300006852 | Bacteria | 3255 |
| 180 | Ga0068865_100009283 | 3300006881 | Bacteria | 6094 |
| 181 | Ga0068865_100016775 | 3300006881 | Bacteria | 4694 |
| 182 | Ga0097620_100002593 | 3300006931 | Bacteria | 18395 |
| 183 | Ga0097620_100039763 | 3300006931 | Bacteria | 4719 |
| 184 | Ga0105240_10010940 | 3300009093 | Bacteria | 12711 |
| 185 | Ga0105240_10067029 | 3300009093 | Bacteria | 4451 |
| 186 | Ga0105240_10145713 | 3300009093 | Bacteria | 2826 |
| 187 | Ga0105240_10220990 | 3300009093 | Bacteria | 2207 |
| 188 | Ga0111539_10215607 | 3300009094 | Bacteria | 2236 |
| 189 | Ga0105245_10000345 | 3300009098 | Bacteria | 43597 |
| 190 | Ga0105245_10007397 | 3300009098 | Bacteria | 9617 |
| 191 | Ga0105245_10018295 | 3300009098 | Bacteria | 6127 |
| 192 | Ga0105245_10064090 | 3300009098 | Bacteria | 3321 |
| 193 | Ga0105245_10078381 | 3300009098 | Bacteria | 3015 |
| 194 | Ga0105245_10289122 | 3300009098 | Bacteria | 1605 |
| 195 | Ga0105243_10089923 | 3300009148 | Bacteria | 2526 |
| 196 | Ga0105241_10025393 | 3300009174 | Bacteria | 4402 |
| 197 | Ga0105242_10283216 | 3300009176 | Bacteria | 1506 |
| 198 | Ga0105248_10000278 | 3300009177 | Bacteria | 60305 |
| 199 | Ga0105248_10000575 | 3300009177 | Bacteria | 41822 |
| 200 | Ga0105248_10003523 | 3300009177 | Bacteria | 17362 |
| 201 | Ga0105248_10010229 | 3300009177 | Bacteria | 10329 |
| 202 | Ga0105248_10019015 | 3300009177 | Bacteria | 7596 |
| 203 | Ga0105248_10061483 | 3300009177 | Bacteria | 4217 |
| 204 | Ga0105248_10102833 | 3300009177 | Bacteria | 3220 |
| 205 | Ga0105248_10107994 | 3300009177 | Bacteria | 3138 |
| 206 | Ga0105237_10043265 | 3300009545 | Bacteria | 4538 |
| 207 | Ga0105238_10030680 | 3300009551 | Bacteria | 5471 |
| 208 | Ga0105238_10054334 | 3300009551 | Bacteria | 4023 |
| 209 | Ga0105238_10414962 | 3300009551 | Bacteria | 1340 |
| 210 | Ga0105249_10171388 | 3300009553 | Bacteria | 2105 |
| 211 | Ga0105239_10086897 | 3300010375 | Bacteria | 3447 |
| 212 | Ga0105239_10165431 | 3300010375 | Bacteria | 2473 |
| 213 | Ga0105246_10017944 | 3300011119 | Bacteria | 4505 |
| 214 | Ga0157373_10008459 | 3300013100 | Bacteria | 7640 |
| 215 | Ga0157373_10023675 | 3300013100 | Bacteria | 4451 |
| 216 | Ga0157373_10027797 | 3300013100 | Bacteria | 4081 |
| 217 | Ga0157373_10035835 | 3300013100 | Bacteria | 3561 |
| 218 | Ga0157373_10047395 | 3300013100 | Bacteria | 3065 |
| 219 | Ga0157371_10002505 | 3300013102 | Bacteria | 17454 |
| 220 | Ga0157371_10010808 | 3300013102 | Bacteria | 7084 |
| 221 | Ga0157371_10022940 | 3300013102 | Bacteria | 4565 |
| 222 | Ga0157371_10043368 | 3300013102 | Bacteria | 3204 |
| 223 | Ga0157371_10056697 | 3300013102 | Bacteria | 2779 |
| 224 | Ga0157371_10192946 | 3300013102 | Bacteria | 1459 |
| 225 | Ga0157371_10280185 | 3300013102 | Bacteria | 1204 |
| 226 | Ga0157371_10280478 | 3300013102 | Bacteria | 1204 |
| 227 | Ga0157370_10014807 | 3300013104 | Bacteria | 7959 |
| 228 | Ga0157370_10053392 | 3300013104 | Bacteria | 3854 |
| 229 | Ga0157370_10053862 | 3300013104 | Bacteria | 3835 |
| 230 | Ga0157370_10057396 | 3300013104 | Bacteria | 3701 |
| 231 | Ga0157370_10085415 | 3300013104 | Bacteria | 2965 |
| 232 | Ga0157370_10096494 | 3300013104 | Bacteria | 2774 |
| 233 | Ga0157370_10250709 | 3300013104 | Bacteria | 1637 |
| 234 | Ga0157369_10000207 | 3300013105 | Bacteria | 81678 |
| 235 | Ga0157369_10006939 | 3300013105 | Bacteria | 13071 |
| 236 | Ga0157369_10021548 | 3300013105 | Bacteria | 7208 |
| 237 | Ga0157369_10022923 | 3300013105 | Bacteria | 6962 |
| 238 | Ga0157369_10046359 | 3300013105 | Bacteria | 4724 |
| 239 | Ga0157369_10070536 | 3300013105 | Bacteria | 3754 |
| 240 | Ga0157369_10074597 | 3300013105 | Bacteria | 3638 |
| 241 | Ga0157369_10103474 | 3300013105 | Bacteria | 3033 |
| 242 | Ga0157369_10140894 | 3300013105 | Bacteria | 2552 |
| 243 | Ga0157369_10357506 | 3300013105 | Bacteria | 1516 |
| 244 | Ga0157374_10004605 | 3300013296 | Bacteria | 11567 |
| 245 | Ga0157374_10038900 | 3300013296 | Bacteria | 4374 |
| 246 | Ga0157374_10165019 | 3300013296 | Bacteria | 2158 |
| 247 | Ga0157378_10006791 | 3300013297 | Bacteria | 9988 |
| 248 | Ga0157378_10079513 | 3300013297 | Bacteria | 2960 |
| 249 | Ga0163162_10011540 | 3300013306 | Bacteria | 8618 |
| 250 | Ga0163162_10036178 | 3300013306 | Bacteria | 4919 |
| 251 | Ga0157372_10069404 | 3300013307 | Bacteria | 3963 |
| 252 | Ga0157375_10028971 | 3300013308 | Bacteria | 5201 |
| 253 | Ga0157375_10053602 | 3300013308 | Bacteria | 3969 |
| 254 | Ga0157375_10056718 | 3300013308 | Bacteria | 3869 |
| 255 | Ga0157375_10062099 | 3300013308 | Bacteria | 3712 |
| 256 | Ga0157375_10268370 | 3300013308 | Bacteria | 1868 |
| 257 | Ga0163163_10000843 | 3300014325 | Bacteria | 26070 |
| 258 | Ga0163163_10274079 | 3300014325 | Bacteria | 1738 |
| 259 | Ga0182008_10060270 | 3300014497 | Bacteria | 1871 |
| 260 | Ga0157377_10055272 | 3300014745 | Bacteria | 2250 |
| 261 | Ga0157377_10097495 | 3300014745 | Bacteria | 1746 |
| 262 | Ga0157379_10020897 | 3300014968 | Bacteria | 5793 |
| 263 | Ga0157379_10027414 | 3300014968 | Bacteria | 5072 |
| 264 | Ga0157376_10008028 | 3300014969 | Bacteria | 7580 |
| 265 | Ga0157376_10263474 | 3300014969 | Bacteria | 1616 |
| 266 | Ga0206354_10354046 | 3300020081 | Bacteria | 1540 |
| 267 | Ga0206353_10254860 | 3300020082 | Bacteria | 2115 |
| 268 | Ga0206353_10519444 | 3300020082 | Bacteria | 4163 |
| 269 | Ga0213875_10001660 | 3300021388 | Bacteria | 14018 |
| 270 | Ga0207697_10006110 | 3300025315 | Bacteria | 5501 |
| 271 | Ga0207697_10018985 | 3300025315 | Bacteria | 2817 |
| 272 | Ga0207682_10006585 | 3300025893 | Bacteria | 4673 |
| 273 | Ga0207682_10021911 | 3300025893 | Bacteria | 2515 |
| 274 | Ga0207688_10007449 | 3300025901 | Bacteria | 5952 |
| 275 | Ga0207688_10083943 | 3300025901 | Bacteria | 1823 |
| 276 | Ga0207688_10084827 | 3300025901 | Bacteria | 1814 |
| 277 | Ga0207680_10007504 | 3300025903 | Bacteria | 5324 |
| 278 | Ga0207680_10014223 | 3300025903 | Bacteria | 4112 |
| 279 | Ga0207680_10099023 | 3300025903 | Bacteria | 1870 |
| 280 | Ga0207647_10000181 | 3300025904 | Bacteria | 50570 |
| 281 | Ga0207647_10001259 | 3300025904 | Bacteria | 19477 |
| 282 | Ga0207647_10001551 | 3300025904 | Bacteria | 17676 |
| 283 | Ga0207647_10001581 | 3300025904 | Bacteria | 17475 |
| 284 | Ga0207647_10005987 | 3300025904 | Bacteria | 8859 |
| 285 | Ga0207647_10022146 | 3300025904 | Bacteria | 4226 |
| 286 | Ga0207647_10025792 | 3300025904 | Bacteria | 3855 |
| 287 | Ga0207647_10069608 | 3300025904 | Bacteria | 2127 |
| 288 | Ga0207643_10046516 | 3300025908 | Bacteria | 2453 |
| 289 | Ga0207643_10050233 | 3300025908 | Bacteria | 2364 |
| 290 | Ga0207705_10000030 | 3300025909 | Bacteria | 239341 |
| 291 | Ga0207705_10000295 | 3300025909 | Bacteria | 46532 |
| 292 | Ga0207705_10004858 | 3300025909 | Bacteria | 10091 |
| 293 | Ga0207705_10006350 | 3300025909 | Bacteria | 8769 |
| 294 | Ga0207705_10009708 | 3300025909 | Bacteria | 6999 |
| 295 | Ga0207705_10036102 | 3300025909 | Bacteria | 3537 |
| 296 | Ga0207705_10068688 | 3300025909 | Bacteria | 2566 |
| 297 | Ga0207705_10105896 | 3300025909 | Bacteria | 2073 |
| 298 | Ga0207705_10175758 | 3300025909 | Bacteria | 1614 |
| 299 | Ga0207654_10050031 | 3300025911 | Bacteria | 2400 |
| 300 | Ga0207707_10015159 | 3300025912 | Bacteria | 6710 |
| 301 | Ga0207707_10032046 | 3300025912 | Bacteria | 4601 |
| 302 | Ga0207695_10003659 | 3300025913 | Bacteria | 21455 |
| 303 | Ga0207695_10013923 | 3300025913 | Bacteria | 9561 |
| 304 | Ga0207695_10027383 | 3300025913 | Bacteria | 6348 |
| 305 | Ga0207695_10039298 | 3300025913 | Bacteria | 5087 |
| 306 | Ga0207695_10150783 | 3300025913 | Bacteria | 2264 |
| 307 | Ga0207671_10041044 | 3300025914 | Bacteria | 3424 |
| 308 | Ga0207693_10086060 | 3300025915 | Bacteria | 2462 |
| 309 | Ga0207660_10000750 | 3300025917 | Bacteria | 21593 |
| 310 | Ga0207660_10004788 | 3300025917 | Bacteria | 8804 |
| 311 | Ga0207660_10005631 | 3300025917 | Bacteria | 8134 |
| 312 | Ga0207660_10031824 | 3300025917 | Bacteria | 3637 |
| 313 | Ga0207660_10078366 | 3300025917 | Bacteria | 2421 |
| 314 | Ga0207662_10066830 | 3300025918 | Bacteria | 2167 |
| 315 | Ga0207657_10000334 | 3300025919 | Bacteria | 49890 |
| 316 | Ga0207657_10003211 | 3300025919 | Bacteria | 17498 |
| 317 | Ga0207657_10008718 | 3300025919 | Bacteria | 10265 |
| 318 | Ga0207657_10019817 | 3300025919 | Bacteria | 6376 |
| 319 | Ga0207657_10019896 | 3300025919 | Bacteria | 6360 |
| 320 | Ga0207657_10023780 | 3300025919 | Bacteria | 5697 |
| 321 | Ga0207657_10024553 | 3300025919 | Bacteria | 5575 |
| 322 | Ga0207657_10024743 | 3300025919 | Bacteria | 5551 |
| 323 | Ga0207657_10036764 | 3300025919 | Bacteria | 4380 |
| 324 | Ga0207649_10000211 | 3300025920 | Bacteria | 48545 |
| 325 | Ga0207649_10001913 | 3300025920 | Bacteria | 11889 |
| 326 | Ga0207649_10023326 | 3300025920 | Bacteria | 3582 |
| 327 | Ga0207649_10026735 | 3300025920 | Bacteria | 3378 |
| 328 | Ga0207649_10033231 | 3300025920 | Bacteria | 3080 |
| 329 | Ga0207649_10076045 | 3300025920 | Bacteria | 2159 |
| 330 | Ga0207649_10081357 | 3300025920 | Bacteria | 2097 |
| 331 | Ga0207652_10010359 | 3300025921 | Bacteria | 7507 |
| 332 | Ga0207652_10172033 | 3300025921 | Bacteria | 1944 |
| 333 | Ga0207681_10001272 | 3300025923 | Bacteria | 16283 |
| 334 | Ga0207694_10091034 | 3300025924 | Bacteria | 2407 |
| 335 | Ga0207694_10093165 | 3300025924 | Bacteria | 2379 |
| 336 | Ga0207694_10153730 | 3300025924 | Bacteria | 1855 |
| 337 | Ga0207694_10172900 | 3300025924 | Bacteria | 1750 |
| 338 | Ga0207650_10010807 | 3300025925 | Bacteria | 6270 |
| 339 | Ga0207650_10135121 | 3300025925 | Bacteria | 1934 |
| 340 | Ga0207659_10092832 | 3300025926 | Bacteria | 2258 |
| 341 | Ga0207659_10220392 | 3300025926 | Bacteria | 1525 |
| 342 | Ga0207687_10020631 | 3300025927 | Bacteria | 4373 |
| 343 | Ga0207687_10025261 | 3300025927 | Bacteria | 3974 |
| 344 | Ga0207687_10124808 | 3300025927 | Bacteria | 1931 |
| 345 | Ga0207700_10052290 | 3300025928 | Bacteria | 3054 |
| 346 | Ga0207664_10066419 | 3300025929 | Bacteria | 2891 |
| 347 | Ga0207644_10000244 | 3300025931 | Bacteria | 37269 |
| 348 | Ga0207644_10019858 | 3300025931 | Bacteria | 4562 |
| 349 | Ga0207644_10134429 | 3300025931 | Bacteria | 1897 |
| 350 | Ga0207690_10000182 | 3300025932 | Bacteria | 48302 |
| 351 | Ga0207690_10001681 | 3300025932 | Bacteria | 13631 |
| 352 | Ga0207690_10004770 | 3300025932 | Bacteria | 7997 |
| 353 | Ga0207690_10016048 | 3300025932 | Bacteria | 4553 |
| 354 | Ga0207690_10016885 | 3300025932 | Bacteria | 4449 |
| 355 | Ga0207690_10097353 | 3300025932 | Bacteria | 2093 |
| 356 | Ga0207706_10001111 | 3300025933 | Bacteria | 27391 |
| 357 | Ga0207706_10001196 | 3300025933 | Bacteria | 26205 |
| 358 | Ga0207706_10007420 | 3300025933 | Bacteria | 10138 |
| 359 | Ga0207706_10010496 | 3300025933 | Bacteria | 8465 |
| 360 | Ga0207706_10020691 | 3300025933 | Bacteria | 5912 |
| 361 | Ga0207706_10021761 | 3300025933 | Bacteria | 5755 |
| 362 | Ga0207706_10029223 | 3300025933 | Bacteria | 4921 |
| 363 | Ga0207706_10110292 | 3300025933 | Bacteria | 2421 |
| 364 | Ga0207706_10133673 | 3300025933 | Bacteria | 2182 |
| 365 | Ga0207706_10208005 | 3300025933 | Bacteria | 1715 |
| 366 | Ga0207669_10009631 | 3300025937 | Bacteria | 4616 |
| 367 | Ga0207669_10235228 | 3300025937 | Bacteria | 1354 |
| 368 | Ga0207704_10020224 | 3300025938 | Bacteria | 3516 |
| 369 | Ga0207704_10028082 | 3300025938 | Bacteria | 3116 |
| 370 | Ga0207665_10019185 | 3300025939 | Bacteria | 4493 |
| 371 | Ga0207665_10066567 | 3300025939 | Bacteria | 2452 |
| 372 | Ga0207691_10001971 | 3300025940 | Bacteria | 20065 |
| 373 | Ga0207691_10004474 | 3300025940 | Bacteria | 13539 |
| 374 | Ga0207691_10006883 | 3300025940 | Bacteria | 10968 |
| 375 | Ga0207691_10010219 | 3300025940 | Bacteria | 9003 |
| 376 | Ga0207691_10043731 | 3300025940 | Bacteria | 4126 |
| 377 | Ga0207691_10054083 | 3300025940 | Bacteria | 3663 |
| 378 | Ga0207691_10058961 | 3300025940 | Bacteria | 3491 |
| 379 | Ga0207711_10000496 | 3300025941 | Bacteria | 40666 |
| 380 | Ga0207711_10003249 | 3300025941 | Bacteria | 14164 |
| 381 | Ga0207711_10003482 | 3300025941 | Bacteria | 13619 |
| 382 | Ga0207711_10014623 | 3300025941 | Bacteria | 6522 |
| 383 | Ga0207711_10017473 | 3300025941 | Bacteria | 5959 |
| 384 | Ga0207711_10017952 | 3300025941 | Bacteria | 5879 |
| 385 | Ga0207711_10168801 | 3300025941 | Bacteria | 1984 |
| 386 | Ga0207711_10229454 | 3300025941 | Bacteria | 1700 |
| 387 | Ga0207689_10001430 | 3300025942 | Bacteria | 22793 |
| 388 | Ga0207689_10037593 | 3300025942 | Bacteria | 4014 |
| 389 | Ga0207689_10102929 | 3300025942 | Bacteria | 2346 |
| 390 | Ga0207689_10211270 | 3300025942 | Bacteria | 1603 |
| 391 | Ga0207661_10004896 | 3300025944 | Bacteria | 9381 |
| 392 | Ga0207661_10006695 | 3300025944 | Bacteria | 8150 |
| 393 | Ga0207661_10020069 | 3300025944 | Bacteria | 4991 |
| 394 | Ga0207661_10052050 | 3300025944 | Bacteria | 3270 |
| 395 | Ga0207679_10000293 | 3300025945 | Bacteria | 37744 |
| 396 | Ga0207679_10004229 | 3300025945 | Bacteria | 8921 |
| 397 | Ga0207679_10007447 | 3300025945 | Bacteria | 6943 |
| 398 | Ga0207679_10014639 | 3300025945 | Bacteria | 5161 |
| 399 | Ga0207679_10072925 | 3300025945 | Bacteria | 2595 |
| 400 | Ga0207667_10001632 | 3300025949 | Bacteria | 28244 |
| 401 | Ga0207667_10003164 | 3300025949 | Bacteria | 20362 |
| 402 | Ga0207667_10009303 | 3300025949 | Bacteria | 11589 |
| 403 | Ga0207667_10021295 | 3300025949 | Bacteria | 7185 |
| 404 | Ga0207667_10052663 | 3300025949 | Bacteria | 4285 |
| 405 | Ga0207667_10078318 | 3300025949 | Bacteria | 3426 |
| 406 | Ga0207667_10280306 | 3300025949 | Bacteria | 1703 |
| 407 | Ga0207667_10303208 | 3300025949 | Bacteria | 1632 |
| 408 | Ga0207651_10002607 | 3300025960 | Bacteria | 8617 |
| 409 | Ga0207651_10003074 | 3300025960 | Bacteria | 8104 |
| 410 | Ga0207651_10017404 | 3300025960 | Bacteria | 4247 |
| 411 | Ga0207651_10042328 | 3300025960 | Bacteria | 3030 |
| 412 | Ga0207651_10121421 | 3300025960 | Bacteria | 1982 |
| 413 | Ga0207712_10004801 | 3300025961 | Bacteria | 8540 |
| 414 | Ga0207668_10057300 | 3300025972 | Bacteria | 2717 |
| 415 | Ga0207640_10003428 | 3300025981 | Bacteria | 8540 |
| 416 | Ga0207640_10005127 | 3300025981 | Bacteria | 7125 |
| 417 | Ga0207640_10016005 | 3300025981 | Bacteria | 4353 |
| 418 | Ga0207640_10017230 | 3300025981 | Bacteria | 4222 |
| 419 | Ga0207640_10109953 | 3300025981 | Bacteria | 1951 |
| 420 | Ga0207640_10157337 | 3300025981 | Bacteria | 1677 |
| 421 | Ga0207658_10005837 | 3300025986 | Bacteria | 8421 |
| 422 | Ga0207658_10005856 | 3300025986 | Bacteria | 8407 |
| 423 | Ga0207658_10017450 | 3300025986 | Bacteria | 4946 |
| 424 | Ga0207658_10035255 | 3300025986 | Bacteria | 3582 |
| 425 | Ga0207658_10092772 | 3300025986 | Bacteria | 2346 |
| 426 | Ga0207677_10001914 | 3300026023 | Bacteria | 10997 |
| 427 | Ga0207677_10002862 | 3300026023 | Bacteria | 9105 |
| 428 | Ga0207677_10025226 | 3300026023 | Bacteria | 3705 |
| 429 | Ga0207677_10033222 | 3300026023 | Bacteria | 3326 |
| 430 | Ga0207703_10008253 | 3300026035 | Bacteria | 8227 |
| 431 | Ga0207703_10009527 | 3300026035 | Bacteria | 7621 |
| 432 | Ga0207703_10021916 | 3300026035 | Bacteria | 5003 |
| 433 | Ga0207703_10064569 | 3300026035 | Bacteria | 3005 |
| 434 | Ga0207639_10000154 | 3300026041 | Bacteria | 52098 |
| 435 | Ga0207639_10126906 | 3300026041 | Bacteria | 2106 |
| 436 | Ga0207639_10134323 | 3300026041 | Bacteria | 2052 |
| 437 | Ga0207639_10172152 | 3300026041 | Bacteria | 1834 |
| 438 | Ga0207678_10000989 | 3300026067 | Bacteria | 25886 |
| 439 | Ga0207678_10004204 | 3300026067 | Bacteria | 12922 |
| 440 | Ga0207678_10008382 | 3300026067 | Bacteria | 9119 |
| 441 | Ga0207678_10024308 | 3300026067 | Bacteria | 5292 |
| 442 | Ga0207678_10028452 | 3300026067 | Bacteria | 4879 |
| 443 | Ga0207678_10032245 | 3300026067 | Bacteria | 4566 |
| 444 | Ga0207678_10082277 | 3300026067 | Bacteria | 2755 |
| 445 | Ga0207678_10091329 | 3300026067 | Bacteria | 2603 |
| 446 | Ga0207678_10253160 | 3300026067 | Bacteria | 1508 |
| 447 | Ga0207702_10000497 | 3300026078 | Bacteria | 44238 |
| 448 | Ga0207702_10012814 | 3300026078 | Bacteria | 6975 |
| 449 | Ga0207702_10014245 | 3300026078 | Bacteria | 6603 |
| 450 | Ga0207702_10021180 | 3300026078 | Bacteria | 5380 |
| 451 | Ga0207702_10161370 | 3300026078 | Bacteria | 2047 |
| 452 | Ga0207641_10024132 | 3300026088 | Bacteria | 5012 |
| 453 | Ga0207641_10043191 | 3300026088 | Bacteria | 3784 |
| 454 | Ga0207641_10060781 | 3300026088 | Bacteria | 3221 |
| 455 | Ga0207641_10135403 | 3300026088 | Bacteria | 2217 |
| 456 | Ga0207641_10317630 | 3300026088 | Bacteria | 1476 |
| 457 | Ga0207648_10000838 | 3300026089 | Bacteria | 34648 |
| 458 | Ga0207648_10002771 | 3300026089 | Bacteria | 18597 |
| 459 | Ga0207648_10005618 | 3300026089 | Bacteria | 12603 |
| 460 | Ga0207648_10016546 | 3300026089 | Bacteria | 6736 |
| 461 | Ga0207648_10027547 | 3300026089 | Bacteria | 5045 |
| 462 | Ga0207676_10001828 | 3300026095 | Bacteria | 15589 |
| 463 | Ga0207676_10253201 | 3300026095 | Bacteria | 1586 |
| 464 | Ga0207674_10002837 | 3300026116 | Bacteria | 21549 |
| 465 | Ga0207674_10006205 | 3300026116 | Bacteria | 14085 |
| 466 | Ga0207674_10007245 | 3300026116 | Bacteria | 12935 |
| 467 | Ga0207674_10012448 | 3300026116 | Bacteria | 9507 |
| 468 | Ga0207674_10015575 | 3300026116 | Bacteria | 8350 |
| 469 | Ga0207674_10020630 | 3300026116 | Bacteria | 7115 |
| 470 | Ga0207674_10238491 | 3300026116 | Bacteria | 1765 |
| 471 | Ga0207675_100078146 | 3300026118 | Bacteria | 3100 |
| 472 | Ga0207683_10007726 | 3300026121 | Bacteria | 9210 |
| 473 | Ga0207683_10039327 | 3300026121 | Bacteria | 4126 |
| 474 | Ga0207683_10048875 | 3300026121 | Bacteria | 3701 |
| 475 | Ga0207683_10284062 | 3300026121 | Bacteria | 1512 |
| 476 | Ga0207698_10001214 | 3300026142 | Bacteria | 15048 |
| 477 | Ga0207698_10001363 | 3300026142 | Bacteria | 14226 |
| 478 | Ga0207698_10004239 | 3300026142 | Bacteria | 8724 |
| 479 | Ga0207698_10004588 | 3300026142 | Bacteria | 8431 |
| 480 | Ga0207698_10006440 | 3300026142 | Bacteria | 7331 |
| 481 | Ga0207698_10020836 | 3300026142 | Bacteria | 4522 |
| 482 | Ga0207698_10024126 | 3300026142 | Bacteria | 4263 |
| 483 | Ga0207698_10117438 | 3300026142 | Bacteria | 2244 |
| 484 | Ga0268266_10002631 | 3300028379 | Bacteria | 18965 |
| 485 | Ga0268266_10007828 | 3300028379 | Bacteria | 9578 |
| 486 | Ga0268266_10011861 | 3300028379 | Bacteria | 7551 |
| 487 | Ga0268266_10023299 | 3300028379 | Bacteria | 5271 |
| 488 | Ga0268266_10044312 | 3300028379 | Bacteria | 3803 |
| 489 | Ga0268265_10038985 | 3300028380 | Bacteria | 3498 |
| 490 | Ga0268264_10001404 | 3300028381 | Bacteria | 22509 |
| 491 | Ga0268264_10015899 | 3300028381 | Bacteria | 6163 |
| 492 | Ga0268264_10258882 | 3300028381 | Bacteria | 1620 |
| 493 | Ga0314311_1220182 | 3300030733 | Bacteria | 4039 |
| 494 | Ga0316179_1031902 | 3300030734 | Bacteria | 2785 |
| 495 | Ga0307513_10102386 | 3300031456 | Bacteria | 2883 |
| 496 | Ga0307514_10144997 | 3300031649 | Bacteria | 1606 |
| 497 | Ga0307405_10002843 | 3300031731 | Bacteria | 7780 |
| 498 | Ga0307413_10002762 | 3300031824 | Bacteria | 7224 |
| 499 | Ga0307413_10007843 | 3300031824 | Bacteria | 4994 |
| 500 | Ga0307410_10007955 | 3300031852 | Bacteria | 5845 |
| 501 | Ga0307410_10010005 | 3300031852 | Bacteria | 5351 |
| 502 | Ga0307410_10037231 | 3300031852 | Bacteria | 3175 |
| 503 | Ga0307410_10070248 | 3300031852 | Bacteria | 2425 |
| 504 | Ga0307407_10001660 | 3300031903 | Bacteria | 8234 |
| 505 | Ga0307412_10056998 | 3300031911 | Bacteria | 2606 |
| 506 | Ga0307409_100005087 | 3300031995 | Bacteria | 7501 |
| 507 | Ga0307409_100015831 | 3300031995 | Bacteria | 4966 |
| 508 | Ga0307409_100036419 | 3300031995 | Bacteria | 3616 |
| 509 | Ga0307416_100027796 | 3300032002 | Bacteria | 4195 |
| 510 | Ga0307416_100063293 | 3300032002 | Bacteria | 3029 |
| 511 | Ga0307416_100080985 | 3300032002 | Bacteria | 2743 |
| 512 | Ga0307416_100093410 | 3300032002 | Bacteria | 2591 |
| 513 | Ga0307416_100210848 | 3300032002 | Bacteria | 1853 |
| 514 | Ga0307414_10018114 | 3300032004 | Bacteria | 4325 |
| 515 | Ga0307414_10127463 | 3300032004 | Bacteria | 1969 |
| 516 | Ga0307411_10004993 | 3300032005 | Bacteria | 6451 |
| 517 | Ga0373935_0009488 | 3300035692 | Bacteria | 5823 |
| 518 | Ga0373935_0016542 | 3300035692 | Bacteria | 4462 |
| 519 | Ga0373947_0004557 | 3300035725 | Bacteria | 8124 |
| 520 | Ga0395899_0012460 | 3300037312 | Bacteria | 6515 |
| 521 | Ga0395899_0016795 | 3300037312 | Bacteria | 5579 |
| 522 | Ga0395899_0029232 | 3300037312 | Bacteria | 4145 |
| 523 | Ga0395899_0057539 | 3300037312 | Bacteria | 2870 |
| 524 | Ga0395899_0115100 | 3300037312 | Bacteria | 1930 |
| 525 | Ga0395899_0116084 | 3300037312 | Bacteria | 1921 |
| 526 | Ga0395899_0121756 | 3300037312 | Bacteria | 1868 |
| 527 | Ga0395900_0003925 | 3300037418 | Bacteria | 15869 |
| 528 | Ga0395900_0005369 | 3300037418 | Bacteria | 13430 |
| 529 | Ga0395900_0005577 | 3300037418 | Bacteria | 13172 |
| 530 | Ga0395900_0010077 | 3300037418 | Bacteria | 9666 |
| 531 | Ga0395900_0042369 | 3300037418 | Bacteria | 4691 |
| 532 | Ga0395900_0043799 | 3300037418 | Bacteria | 4613 |
| 533 | Ga0395900_0046569 | 3300037418 | Bacteria | 4466 |
| 534 | Ga0395900_0079761 | 3300037418 | Bacteria | 3364 |
| 535 | Ga0395900_0106522 | 3300037418 | Bacteria | 2879 |
| 536 | Ga0395900_0111863 | 3300037418 | Bacteria | 2804 |
| 537 | Ga0395900_0143661 | 3300037418 | Bacteria | 2442 |
| 538 | Ga0395900_0153630 | 3300037418 | Bacteria | 2351 |
| 539 | Ga0395900_0287071 | 3300037418 | Bacteria | 1635 |
| 540 | Ga0395900_0339712 | 3300037418 | Bacteria | 1477 |
| 541 | Ga0395898_0008780 | 3300037466 | Bacteria | 10649 |
| 542 | Ga0395898_0012167 | 3300037466 | Bacteria | 8902 |
| 543 | Ga0395898_0026941 | 3300037466 | Bacteria | 5776 |
| 544 | Ga0395898_0075074 | 3300037466 | Bacteria | 3265 |
| 545 | Ga0395898_0083941 | 3300037466 | Bacteria | 3070 |
| 546 | Ga0395898_0113227 | 3300037466 | Bacteria | 2600 |
| 547 | Ga0395898_0126794 | 3300037466 | Bacteria | 2445 |
| 548 | Ga0395898_0173903 | 3300037466 | Bacteria | 2058 |
| 549 | Ga0395898_0316331 | 3300037466 | Bacteria | 1489 |
| 550 | Ga0395898_0376715 | 3300037466 | Bacteria | 1353 |
| 551 | Ga0395898_0451579 | 3300037466 | Bacteria | 1224 |
| 552 | Ga0395905_0001141 | 3300037471 | Bacteria | 33234 |
| 553 | Ga0395905_0004658 | 3300037471 | Bacteria | 14180 |
| 554 | Ga0395905_0006676 | 3300037471 | Bacteria | 11564 |
| 555 | Ga0395905_0007482 | 3300037471 | Bacteria | 10865 |
| 556 | Ga0395905_0007657 | 3300037471 | Bacteria | 10718 |
| 557 | Ga0395905_0011136 | 3300037471 | Bacteria | 8698 |
| 558 | Ga0395905_0017826 | 3300037471 | Bacteria | 6746 |
| 559 | Ga0395905_0033420 | 3300037471 | Bacteria | 4831 |
| 560 | Ga0395905_0037823 | 3300037471 | Bacteria | 4528 |
| 561 | Ga0395905_0045363 | 3300037471 | Bacteria | 4122 |
| 562 | Ga0395905_0053977 | 3300037471 | Bacteria | 3761 |
| 563 | Ga0395905_0067409 | 3300037471 | Bacteria | 3352 |
| 564 | Ga0395905_0090401 | 3300037471 | Bacteria | 2870 |
| 565 | Ga0395905_0092845 | 3300037471 | Bacteria | 2830 |
| 566 | Ga0395905_0098512 | 3300037471 | Bacteria | 2745 |
| 567 | Ga0395905_0116291 | 3300037471 | Bacteria | 2514 |
| 568 | Ga0395905_0185180 | 3300037471 | Bacteria | 1954 |
| 569 | Ga0395905_0191440 | 3300037471 | Bacteria | 1918 |
| 570 | Ga0395905_0191716 | 3300037471 | Bacteria | 1917 |
| 571 | Ga0395905_0213058 | 3300037471 | Bacteria | 1809 |
| 572 | Ga0395905_0263036 | 3300037471 | Bacteria | 1610 |
| 573 | Ga0436364_0269013 | 3300037853 | Bacteria | 16037 |
| 574 | Ga0395901_0000041 | 3300038443 | Bacteria | 202314 |
| 575 | Ga0395901_0004104 | 3300038443 | Bacteria | 14684 |
| 576 | Ga0395901_0007396 | 3300038443 | Bacteria | 11079 |
| 577 | Ga0395901_0007445 | 3300038443 | Bacteria | 11046 |
| 578 | Ga0395901_0017386 | 3300038443 | Bacteria | 7341 |
| 579 | Ga0395901_0023857 | 3300038443 | Bacteria | 6274 |
| 580 | Ga0395901_0029478 | 3300038443 | Bacteria | 5651 |
| 581 | Ga0395901_0035520 | 3300038443 | Bacteria | 5150 |
| 582 | Ga0395901_0040317 | 3300038443 | Bacteria | 4836 |
| 583 | Ga0395901_0048364 | 3300038443 | Bacteria | 4416 |
| 584 | Ga0395901_0079818 | 3300038443 | Bacteria | 3416 |
| 585 | Ga0395901_0133341 | 3300038443 | Bacteria | 2610 |
| 586 | Ga0395901_0136651 | 3300038443 | Bacteria | 2576 |
| 587 | Ga0395901_0147291 | 3300038443 | Bacteria | 2474 |
| 588 | Ga0395901_0197500 | 3300038443 | Bacteria | 2109 |
| 589 | Ga0395901_0241185 | 3300038443 | Bacteria | 1885 |
| 590 | Ga0395901_0297875 | 3300038443 | Bacteria | 1672 |
| 591 | Ga0395901_0301703 | 3300038443 | Bacteria | 1660 |
| 592 | Ga0395901_0317415 | 3300038443 | Bacteria | 1612 |
| 593 | Ga0395901_0401553 | 3300038443 | Bacteria | 1408 |
| 594 | Ga0439445_0007961 | 3300042004 | Bacteria | 2472 |
| 595 | Ga0439462_0002422 | 3300042015 | Bacteria | 4329 |
| 596 | Ga0439458_0003050 | 3300042157 | Bacteria | 3993 |
| 597 | Ga0466969_0019153 | 3300044656 | Bacteria | 3562 |
| 598 | Ga0466972_0060624 | 3300044658 | Bacteria | 1815 |
| 599 | Ga0466972_0085902 | 3300044658 | Bacteria | 1495 |
| 600 | Ga0466965_0119087 | 3300044683 | Bacteria | 1362 |
| 601 | Ga0466966_0000041 | 3300044684 | Bacteria | 97092 |
| 602 | Ga0466966_0012337 | 3300044684 | Bacteria | 5662 |
| 603 | Ga0466966_0015306 | 3300044684 | Bacteria | 5073 |
| 604 | Ga0466966_0016074 | 3300044684 | Bacteria | 4948 |
| 605 | Ga0466961_0007333 | 3300044693 | Bacteria | 7017 |
| 606 | Ga0466961_0050312 | 3300044693 | Bacteria | 2661 |
| 607 | Ga0466961_0065378 | 3300044693 | Bacteria | 2311 |
| 608 | Ga0466961_0089372 | 3300044693 | Bacteria | 1945 |
| 609 | Ga0466963_0003494 | 3300044694 | Bacteria | 9016 |
| 610 | Ga0466963_0005728 | 3300044694 | Bacteria | 7306 |
| 611 | Ga0466963_0108219 | 3300044694 | Bacteria | 1906 |
| 612 | Ga0466963_0175422 | 3300044694 | Bacteria | 1495 |
| 613 | Ga0466971_0003474 | 3300044719 | Bacteria | 6732 |
| 614 | Ga0466971_0003766 | 3300044719 | Bacteria | 6492 |
| 615 | Ga0466971_0087620 | 3300044719 | Bacteria | 1423 |
| 616 | Ga0466970_0014280 | 3300044765 | Bacteria | 4074 |
| 617 | Ga0466970_0034221 | 3300044765 | Bacteria | 2689 |
| 618 | Ga0466957_0003087 | 3300044842 | Bacteria | 9067 |
| 619 | Ga0466957_0004452 | 3300044842 | Bacteria | 7807 |
| 620 | Ga0466959_0155917 | 3300045049 | Bacteria | 1607 |
| 621 | Ga0466958_0005228 | 3300045836 | Bacteria | 6955 |
| 622 | Ga0466958_0006088 | 3300045836 | Bacteria | 6541 |
| 623 | Ga0466958_0109616 | 3300045836 | Bacteria | 1723 |
| 624 | Ga0466967_0002106 | 3300045976 | Bacteria | 12203 |
| 625 | Ga0466967_0044740 | 3300045976 | Bacteria | 3842 |
| 626 | Ga0466967_0191274 | 3300045976 | Bacteria | 1934 |
| 627 | Ga0495627_004139 | 3300046453 | Bacteria | 6156 |
| 628 | Ga0495663_0018317 | 3300046525 | Bacteria | 1994 |
| 629 | Ga0495598_0017285 | 3300046537 | Bacteria | 1857 |
| 630 | Ga0495621_0000088 | 3300046539 | Bacteria | 18635 |
| 631 | Ga0495668_0023406 | 3300046616 | Bacteria | 3523 |
| 632 | Ga0495669_0000417 | 3300046684 | Bacteria | 20552 |
| 633 | Ga0495669_0014265 | 3300046684 | Bacteria | 3398 |
| 634 | Ga0495669_0019165 | 3300046684 | Bacteria | 2951 |
| 635 | Ga0495670_0000192 | 3300046691 | Bacteria | 27204 |
| 636 | Ga0495670_0037787 | 3300046691 | Bacteria | 2407 |
| 637 | Ga0496100_0001321 | 3300048903 | Bacteria | 12119 |
| 638 | Ga0496100_0064199 | 3300048903 | Bacteria | 2429 |
| 639 | Ga0496101_0000325 | 3300048904 | Bacteria | 32628 |
| 640 | Ga0496101_0035792 | 3300048904 | Bacteria | 3513 |
| 641 | Ga0496102_0034774 | 3300048905 | Bacteria | 4534 |
| 642 | Ga0496102_0090651 | 3300048905 | Bacteria | 2829 |
| 643 | Ga0496102_0107255 | 3300048905 | Bacteria | 2601 |
| 644 | Ga0496103_0033965 | 3300048906 | Bacteria | 3118 |
| 645 | Ga0496104_0087287 | 3300048907 | Bacteria | 2979 |
| 646 | Ga0496106_0004454 | 3300048909 | Bacteria | 10386 |
| 647 | Ga0496106_0035887 | 3300048909 | Bacteria | 3708 |
| 648 | Ga0496107_0002192 | 3300048910 | Bacteria | 12552 |
| 649 | Ga0496107_0031870 | 3300048910 | Bacteria | 3764 |
| 650 | Ga0496107_0044820 | 3300048910 | Bacteria | 3180 |
| 651 | Ga0496108_0012352 | 3300048911 | Bacteria | 6950 |
| 652 | Ga0496109_0008023 | 3300048912 | Bacteria | 8950 |
| 653 | Ga0496109_0049587 | 3300048912 | Bacteria | 3822 |
| 654 | Ga0496110_0013114 | 3300048913 | Bacteria | 6841 |
| 655 | Ga0496111_0000090 | 3300048914 | Bacteria | 38333 |
| 656 | Ga0496111_0001247 | 3300048914 | Bacteria | 14238 |
| 657 | Ga0496112_0002770 | 3300048915 | Bacteria | 14218 |
| 658 | Ga0496112_0013002 | 3300048915 | Bacteria | 7675 |
| 659 | Ga0496112_0077190 | 3300048915 | Bacteria | 3294 |
| 660 | Ga0496112_0151816 | 3300048915 | Bacteria | 2283 |
| 661 | Ga0496113_0003942 | 3300048916 | Bacteria | 9005 |
| 662 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 663 | Ga0496114_0015065 | 3300048917 | Bacteria | 6217 |
| 664 | Ga0496115_0116987 | 3300048918 | Bacteria | 2193 |
| 665 | Ga0496117_0049378 | 3300048920 | Bacteria | 2993 |
| 666 | Ga0496118_0042557 | 3300048921 | Bacteria | 3581 |
| 667 | Ga0496122_0001921 | 3300048925 | Bacteria | 31403 |
| 668 | Ga0496122_0003416 | 3300048925 | Bacteria | 20896 |
| 669 | Ga0496123_0000634 | 3300048926 | Bacteria | 58737 |
| 670 | Ga0496124_0002403 | 3300048927 | Bacteria | 24565 |
| 671 | Ga0496125_0015561 | 3300048928 | Bacteria | 7347 |
| 672 | Ga0496126_0017351 | 3300048929 | Bacteria | 7174 |
| 673 | Ga0501031_0000074 | 3300049568 | Bacteria | 52791 |
| 674 | Ga0501031_0012677 | 3300049568 | Bacteria | 5505 |
| 675 | Ga0501032_0002979 | 3300049569 | Bacteria | 13150 |
| 676 | Ga0501033_0000637 | 3300049570 | Bacteria | 32382 |
| 677 | Ga0501033_0006706 | 3300049570 | Bacteria | 8994 |
| 678 | Ga0501034_0000877 | 3300049571 | Bacteria | 44229 |
| 679 | Ga0501036_0013355 | 3300049572 | Bacteria | 6822 |
| 680 | Ga0501036_0018516 | 3300049572 | Bacteria | 5837 |
| 681 | Ga0501037_0000235 | 3300049573 | Bacteria | 47804 |
| 682 | Ga0501037_0078229 | 3300049573 | Bacteria | 2400 |
| 683 | Ga0501038_0000196 | 3300049574 | Bacteria | 52394 |
| 684 | Ga0501038_0003100 | 3300049574 | Bacteria | 15500 |
| 685 | Ga0501039_0000124 | 3300049575 | Bacteria | 53373 |
| 686 | Ga0501039_0006099 | 3300049575 | Bacteria | 9150 |
| 687 | Ga0501040_0009495 | 3300049576 | Bacteria | 6343 |
| 688 | Ga0501042_0115557 | 3300049578 | Bacteria | 1932 |
| 689 | Ga0501046_0000844 | 3300049580 | Bacteria | 29854 |
| 690 | Ga0501047_0000378 | 3300049581 | Bacteria | 50236 |
| 691 | Ga0501048_0000096 | 3300049582 | Bacteria | 47896 |
| 692 | Ga0501048_0045254 | 3300049582 | Bacteria | 3144 |
| 693 | Ga0501067_0008008 | 3300049583 | Bacteria | 5869 |
| 694 | Ga0501069_0000680 | 3300049585 | Bacteria | 15814 |
| 695 | Ga0501070_0000216 | 3300049586 | Bacteria | 54638 |
| 696 | Ga0501073_0005497 | 3300049589 | Bacteria | 9494 |
| 697 | Ga0501074_0005172 | 3300049590 | Bacteria | 9375 |
| 698 | Ga0501079_0017665 | 3300049741 | Bacteria | 5449 |
| 699 | Ga0501080_0000177 | 3300049742 | Bacteria | 46889 |
| 700 | Ga0501080_0026855 | 3300049742 | Bacteria | 5353 |
| 701 | Ga0501081_0031784 | 3300049743 | Bacteria | 3578 |
| 702 | Ga0501083_0005982 | 3300049744 | Bacteria | 8615 |
| 703 | Ga0501035_0000648 | 3300049822 | Bacteria | 38367 |
| 704 | Ga0501035_0210176 | 3300049822 | Bacteria | 1665 |
| 705 | Ga0501044_0000585 | 3300049823 | Bacteria | 44237 |
| 706 | Ga0501044_0336223 | 3300049823 | Bacteria | 1432 |
| 707 | Ga0501045_0025750 | 3300049824 | Bacteria | 4229 |
| 708 | Ga0501045_0045512 | 3300049824 | Bacteria | 3195 |
| 709 | Ga0501045_0107332 | 3300049824 | Bacteria | 2069 |
| 710 | nmdc:mga08y16_316687_c1 | 3300050511 | Bacteria | 1606 |
| 711 | nmdc:mga0a205_4753_c1 | 3300050515 | Bacteria | 12204 |
| 712 | Ga0500593_000149 | 3300053117 | Bacteria | 27933 |
| 713 | Ga0500658_0000115 | 3300053134 | Bacteria | 38090 |
| 714 | Ga0501084_0001653 | 3300054114 | Bacteria | 17738 |
| 715 | Ga0501084_0005383 | 3300054114 | Bacteria | 10492 |
| 716 | Ga0501082_0231928 | 3300060353 | Bacteria | 1606 |
| 717 | Ga0466962_0006923 | 3300061719 | Bacteria | 5435 |
| 718 | Ga0466962_0029238 | 3300061719 | Bacteria | 2637 |
| 719 | Ga0466962_0032090 | 3300061719 | Bacteria | 2515 |
| 720 | Ga0530510_0045537 | 3300061734 | Bacteria | 3169 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100165335 | Ga0068853_1001653351 | 356 |
| 2 | 3300005578 | Ga0068854_100029865 | Ga0068854_1000298654 | 357 |
| 3 | 3300005616 | Ga0068852_100001298 | Ga0068852_1000012987 | 357 |
| 4 | 3300013104 | Ga0157370_10096494 | Ga0157370_100964943 | 357 |
| 5 | 3300026142 | Ga0207698_10001363 | Ga0207698_1000136313 | 357 |
| 6 | 3300013105 | Ga0157369_10006939 | Ga0157369_100069397 | 358 |
| 7 | 3300002067 | JGI24735J21928_10007844 | JGI24735J21928_100078445 | 364 |
| 8 | 3300025909 | Ga0207705_10068688 | Ga0207705_100686883 | 364 |
| 9 | 3300037312 | Ga0395899_0012460 | Ga0395899_0012460_5161_6360 | 365 |
| 10 | 3300037466 | Ga0395898_0008780 | Ga0395898_0008780_896_2095 | 365 |
| 11 | 3300037471 | Ga0395905_0007657 | Ga0395905_0007657_566_1765 | 365 |
| 12 | 3300038443 | Ga0395901_0007396 | Ga0395901_0007396_929_2128 | 365 |
| 13 | 3300005327 | Ga0070658_10182228 | Ga0070658_101822282 | 369 |
| 14 | 3300037471 | Ga0395905_0116291 | Ga0395905_0116291_774_1973 | 369 |
| 15 | 3300025909 | Ga0207705_10175758 | Ga0207705_101757582 | 374 |
| 16 | 3300005366 | Ga0070659_100011730 | Ga0070659_1000117303 | 375 |
| 17 | 3300005435 | Ga0070714_100017962 | Ga0070714_1000179625 | 375 |
| 18 | 3300005436 | Ga0070713_100065431 | Ga0070713_1000654312 | 375 |
| 19 | 3300009093 | Ga0105240_10067029 | Ga0105240_100670294 | 375 |
| 20 | 3300010375 | Ga0105239_10165431 | Ga0105239_101654312 | 375 |
| 21 | 3300013102 | Ga0157371_10192946 | Ga0157371_101929462 | 375 |
| 22 | 3300013102 | Ga0157371_10280185 | Ga0157371_102801851 | 375 |
| 23 | 3300013102 | Ga0157371_10280478 | Ga0157371_102804781 | 375 |
| 24 | 3300037418 | Ga0395900_0043799 | Ga0395900_0043799_1132_2310 | 375 |
| 25 | 3300037466 | Ga0395898_0451579 | Ga0395898_0451579_81_1208 | 375 |
| 26 | 3300038443 | Ga0395901_0000041 | Ga0395901_0000041_16137_17315 | 375 |
| 27 | 3300046684 | Ga0495669_0000417 | Ga0495669_0000417_17267_18394 | 375 |
| 28 | 3300046684 | Ga0495669_0014265 | Ga0495669_0014265_1295_2422 | 375 |
| 29 | 3300037471 | Ga0395905_0033420 | Ga0395905_0033420_2387_3523 | 378 |
| 30 | 3300038443 | Ga0395901_0079818 | Ga0395901_0079818_1708_2844 | 378 |
| 31 | 3300005577 | Ga0068857_100041928 | Ga0068857_1000419282 | 379 |
| 32 | 3300026088 | Ga0207641_10317630 | Ga0207641_103176302 | 379 |
| 33 | 3300026116 | Ga0207674_10006205 | Ga0207674_100062054 | 379 |
| 34 | 3300038443 | Ga0395901_0401553 | Ga0395901_0401553_194_1393 | 379 |
| 35 | 3300037466 | Ga0395898_0113227 | Ga0395898_0113227_591_1790 | 380 |
| 36 | 3300001915 | JGI24741J21665_1002347 | JGI24741J21665_10023472 | 381 |
| 37 | 3300002067 | JGI24735J21928_10006139 | JGI24735J21928_100061393 | 381 |
| 38 | 3300005329 | Ga0070683_100064747 | Ga0070683_1000647473 | 381 |
| 39 | 3300005455 | Ga0070663_100010076 | Ga0070663_1000100762 | 381 |
| 40 | 3300005577 | Ga0068857_100020601 | Ga0068857_1000206016 | 381 |
| 41 | 3300025909 | Ga0207705_10006350 | Ga0207705_100063506 | 381 |
| 42 | 3300025912 | Ga0207707_10015159 | Ga0207707_100151596 | 381 |
| 43 | 3300025917 | Ga0207660_10031824 | Ga0207660_100318244 | 381 |
| 44 | 3300025921 | Ga0207652_10010359 | Ga0207652_100103597 | 381 |
| 45 | 3300025945 | Ga0207679_10004229 | Ga0207679_100042297 | 381 |
| 46 | 3300025981 | Ga0207640_10017230 | Ga0207640_100172302 | 381 |
| 47 | 3300025986 | Ga0207658_10017450 | Ga0207658_100174504 | 381 |
| 48 | 3300026067 | Ga0207678_10008382 | Ga0207678_100083824 | 381 |
| 49 | 3300037471 | Ga0395905_0006676 | Ga0395905_0006676_9949_11148 | 381 |
| 50 | 3300038443 | Ga0395901_0297875 | Ga0395901_0297875_422_1621 | 381 |
| 51 | 3300038443 | Ga0395901_0241185 | Ga0395901_0241185_503_1702 | 382 |
| 52 | 3300013104 | Ga0157370_10014807 | Ga0157370_100148072 | 383 |
| 53 | 3300026142 | Ga0207698_10117438 | Ga0207698_101174382 | 384 |
| 54 | 3300001979 | JGI24740J21852_10018147 | JGI24740J21852_100181472 | 390 |
| 55 | 3300005983 | Ga0081540_1008084 | Ga0081540_10080844 | 391 |
| 56 | 3300001904 | JGI24736J21556_1000759 | JGI24736J21556_10007593 | 392 |
| 57 | 3300001979 | JGI24740J21852_10003099 | JGI24740J21852_100030992 | 392 |
| 58 | 3300001979 | JGI24740J21852_10010512 | JGI24740J21852_100105121 | 392 |
| 59 | 3300001989 | JGI24739J22299_10005409 | JGI24739J22299_100054094 | 392 |
| 60 | 3300001990 | JGI24737J22298_10000746 | JGI24737J22298_1000074611 | 392 |
| 61 | 3300001990 | JGI24737J22298_10000786 | JGI24737J22298_100007863 | 392 |
| 62 | 3300001990 | JGI24737J22298_10003275 | JGI24737J22298_100032752 | 392 |
| 63 | 3300001990 | JGI24737J22298_10007606 | JGI24737J22298_100076065 | 392 |
| 64 | 3300001990 | JGI24737J22298_10028748 | JGI24737J22298_100287482 | 392 |
| 65 | 3300002067 | JGI24735J21928_10021176 | JGI24735J21928_100211762 | 392 |
| 66 | 3300002073 | JGI24745J21846_1001492 | JGI24745J21846_10014923 | 392 |
| 67 | 3300002075 | JGI24738J21930_10000194 | JGI24738J21930_1000019416 | 392 |
| 68 | 3300002075 | JGI24738J21930_10005800 | JGI24738J21930_100058002 | 392 |
| 69 | 3300002075 | JGI24738J21930_10005848 | JGI24738J21930_100058483 | 392 |
| 70 | 3300005327 | Ga0070658_10000584 | Ga0070658_1000058415 | 392 |
| 71 | 3300005327 | Ga0070658_10031162 | Ga0070658_100311623 | 392 |
| 72 | 3300005327 | Ga0070658_10033650 | Ga0070658_100336502 | 392 |
| 73 | 3300005327 | Ga0070658_10036735 | Ga0070658_100367355 | 392 |
| 74 | 3300005328 | Ga0070676_10007325 | Ga0070676_100073253 | 392 |
| 75 | 3300005329 | Ga0070683_100013630 | Ga0070683_1000136301 | 392 |
| 76 | 3300005329 | Ga0070683_100014137 | Ga0070683_1000141377 | 392 |
| 77 | 3300005329 | Ga0070683_100032882 | Ga0070683_1000328823 | 392 |
| 78 | 3300005329 | Ga0070683_100081414 | Ga0070683_1000814142 | 392 |
| 79 | 3300005330 | Ga0070690_100124468 | Ga0070690_1001244682 | 392 |
| 80 | 3300005331 | Ga0070670_100021499 | Ga0070670_1000214996 | 392 |
| 81 | 3300005331 | Ga0070670_100101434 | Ga0070670_1001014342 | 392 |
| 82 | 3300005334 | Ga0068869_100006785 | Ga0068869_1000067853 | 392 |
| 83 | 3300005334 | Ga0068869_100058106 | Ga0068869_1000581063 | 392 |
| 84 | 3300005334 | Ga0068869_100256309 | Ga0068869_1002563092 | 392 |
| 85 | 3300005335 | Ga0070666_10000216 | Ga0070666_1000021611 | 392 |
| 86 | 3300005335 | Ga0070666_10006945 | Ga0070666_100069455 | 392 |
| 87 | 3300005335 | Ga0070666_10009580 | Ga0070666_100095803 | 392 |
| 88 | 3300005335 | Ga0070666_10031092 | Ga0070666_100310922 | 392 |
| 89 | 3300005336 | Ga0070680_100000734 | Ga0070680_1000007346 | 392 |
| 90 | 3300005336 | Ga0070680_100006132 | Ga0070680_1000061324 | 392 |
| 91 | 3300005336 | Ga0070680_100008040 | Ga0070680_1000080403 | 392 |
| 92 | 3300005336 | Ga0070680_100017540 | Ga0070680_1000175405 | 392 |
| 93 | 3300005338 | Ga0068868_100023459 | Ga0068868_1000234592 | 392 |
| 94 | 3300005338 | Ga0068868_100036608 | Ga0068868_1000366082 | 392 |
| 95 | 3300005338 | Ga0068868_100171643 | Ga0068868_1001716431 | 392 |
| 96 | 3300005339 | Ga0070660_100000147 | Ga0070660_10000014729 | 392 |
| 97 | 3300005339 | Ga0070660_100002954 | Ga0070660_10000295416 | 392 |
| 98 | 3300005339 | Ga0070660_100016712 | Ga0070660_1000167122 | 392 |
| 99 | 3300005339 | Ga0070660_100050525 | Ga0070660_1000505252 | 392 |
| 100 | 3300005339 | Ga0070660_100089849 | Ga0070660_1000898492 | 392 |
| 101 | 3300005339 | Ga0070660_100096062 | Ga0070660_1000960622 | 392 |
| 102 | 3300005339 | Ga0070660_100110975 | Ga0070660_1001109752 | 392 |
| 103 | 3300005341 | Ga0070691_10048210 | Ga0070691_100482102 | 392 |
| 104 | 3300005343 | Ga0070687_100058189 | Ga0070687_1000581893 | 392 |
| 105 | 3300005344 | Ga0070661_100000213 | Ga0070661_10000021334 | 392 |
| 106 | 3300005344 | Ga0070661_100028273 | Ga0070661_1000282732 | 392 |
| 107 | 3300005344 | Ga0070661_100040241 | Ga0070661_1000402412 | 392 |
| 108 | 3300005344 | Ga0070661_100046328 | Ga0070661_1000463284 | 392 |
| 109 | 3300005353 | Ga0070669_100000629 | Ga0070669_10000062938 | 392 |
| 110 | 3300005353 | Ga0070669_100044878 | Ga0070669_1000448782 | 392 |
| 111 | 3300005354 | Ga0070675_100016949 | Ga0070675_1000169493 | 392 |
| 112 | 3300005354 | Ga0070675_100089116 | Ga0070675_1000891162 | 392 |
| 113 | 3300005355 | Ga0070671_100005290 | Ga0070671_1000052907 | 392 |
| 114 | 3300005355 | Ga0070671_100008660 | Ga0070671_1000086609 | 392 |
| 115 | 3300005355 | Ga0070671_100024818 | Ga0070671_1000248182 | 392 |
| 116 | 3300005355 | Ga0070671_100068476 | Ga0070671_1000684763 | 392 |
| 117 | 3300005355 | Ga0070671_100272166 | Ga0070671_1002721662 | 392 |
| 118 | 3300005356 | Ga0070674_100024613 | Ga0070674_1000246133 | 392 |
| 119 | 3300005356 | Ga0070674_100028858 | Ga0070674_1000288583 | 392 |
| 120 | 3300005364 | Ga0070673_100005945 | Ga0070673_1000059452 | 392 |
| 121 | 3300005364 | Ga0070673_100005956 | Ga0070673_1000059565 | 392 |
| 122 | 3300005364 | Ga0070673_100016917 | Ga0070673_1000169175 | 392 |
| 123 | 3300005364 | Ga0070673_100038146 | Ga0070673_1000381463 | 392 |
| 124 | 3300005364 | Ga0070673_100044581 | Ga0070673_1000445812 | 392 |
| 125 | 3300005364 | Ga0070673_100114877 | Ga0070673_1001148772 | 392 |
| 126 | 3300005366 | Ga0070659_100000123 | Ga0070659_10000012329 | 392 |
| 127 | 3300005366 | Ga0070659_100001223 | Ga0070659_1000012233 | 392 |
| 128 | 3300005366 | Ga0070659_100004009 | Ga0070659_1000040097 | 392 |
| 129 | 3300005366 | Ga0070659_100016409 | Ga0070659_1000164092 | 392 |
| 130 | 3300005366 | Ga0070659_100028316 | Ga0070659_1000283163 | 392 |
| 131 | 3300005366 | Ga0070659_100143945 | Ga0070659_1001439452 | 392 |
| 132 | 3300005367 | Ga0070667_100010025 | Ga0070667_1000100259 | 392 |
| 133 | 3300005367 | Ga0070667_100021756 | Ga0070667_1000217564 | 392 |
| 134 | 3300005367 | Ga0070667_100071000 | Ga0070667_1000710002 | 392 |
| 135 | 3300005367 | Ga0070667_100108779 | Ga0070667_1001087792 | 392 |
| 136 | 3300005435 | Ga0070714_100017357 | Ga0070714_1000173575 | 392 |
| 137 | 3300005435 | Ga0070714_100022690 | Ga0070714_1000226904 | 392 |
| 138 | 3300005435 | Ga0070714_100042637 | Ga0070714_1000426373 | 392 |
| 139 | 3300005436 | Ga0070713_100052229 | Ga0070713_1000522294 | 392 |
| 140 | 3300005436 | Ga0070713_100052663 | Ga0070713_1000526631 | 392 |
| 141 | 3300005436 | Ga0070713_100086400 | Ga0070713_1000864002 | 392 |
| 142 | 3300005444 | Ga0070694_100038141 | Ga0070694_1000381414 | 392 |
| 143 | 3300005455 | Ga0070663_100001735 | Ga0070663_1000017353 | 392 |
| 144 | 3300005455 | Ga0070663_100017691 | Ga0070663_1000176917 | 392 |
| 145 | 3300005456 | Ga0070678_100048390 | Ga0070678_1000483903 | 392 |
| 146 | 3300005456 | Ga0070678_100057965 | Ga0070678_1000579652 | 392 |
| 147 | 3300005456 | Ga0070678_100069917 | Ga0070678_1000699173 | 392 |
| 148 | 3300005457 | Ga0070662_100000060 | Ga0070662_10000006029 | 392 |
| 149 | 3300005457 | Ga0070662_100010709 | Ga0070662_1000107094 | 392 |
| 150 | 3300005457 | Ga0070662_100012577 | Ga0070662_1000125772 | 392 |
| 151 | 3300005457 | Ga0070662_100039968 | Ga0070662_1000399683 | 392 |
| 152 | 3300005457 | Ga0070662_100077659 | Ga0070662_1000776591 | 392 |
| 153 | 3300005458 | Ga0070681_10035173 | Ga0070681_100351736 | 392 |
| 154 | 3300005458 | Ga0070681_10231893 | Ga0070681_102318931 | 392 |
| 155 | 3300005459 | Ga0068867_100004321 | Ga0068867_1000043219 | 392 |
| 156 | 3300005459 | Ga0068867_100042149 | Ga0068867_1000421493 | 392 |
| 157 | 3300005459 | Ga0068867_100042601 | Ga0068867_1000426012 | 392 |
| 158 | 3300005459 | Ga0068867_100045663 | Ga0068867_1000456633 | 392 |
| 159 | 3300005535 | Ga0070684_100015937 | Ga0070684_1000159373 | 392 |
| 160 | 3300005535 | Ga0070684_100016652 | Ga0070684_1000166523 | 392 |
| 161 | 3300005535 | Ga0070684_100093635 | Ga0070684_1000936352 | 392 |
| 162 | 3300005539 | Ga0068853_100000277 | Ga0068853_10000027711 | 392 |
| 163 | 3300005539 | Ga0068853_100003199 | Ga0068853_1000031997 | 392 |
| 164 | 3300005539 | Ga0068853_100028498 | Ga0068853_1000284984 | 392 |
| 165 | 3300005543 | Ga0070672_100003277 | Ga0070672_1000032779 | 392 |
| 166 | 3300005543 | Ga0070672_100018309 | Ga0070672_1000183095 | 392 |
| 167 | 3300005548 | Ga0070665_100003766 | Ga0070665_1000037669 | 392 |
| 168 | 3300005548 | Ga0070665_100016998 | Ga0070665_1000169982 | 392 |
| 169 | 3300005548 | Ga0070665_100024266 | Ga0070665_1000242662 | 392 |
| 170 | 3300005548 | Ga0070665_100058493 | Ga0070665_1000584931 | 392 |
| 171 | 3300005563 | Ga0068855_100000877 | Ga0068855_10000087719 | 392 |
| 172 | 3300005563 | Ga0068855_100006911 | Ga0068855_1000069119 | 392 |
| 173 | 3300005563 | Ga0068855_100019332 | Ga0068855_1000193323 | 392 |
| 174 | 3300005563 | Ga0068855_100047947 | Ga0068855_1000479472 | 392 |
| 175 | 3300005564 | Ga0070664_100000158 | Ga0070664_10000015829 | 392 |
| 176 | 3300005564 | Ga0070664_100027076 | Ga0070664_1000270762 | 392 |
| 177 | 3300005577 | Ga0068857_100001240 | Ga0068857_1000012404 | 392 |
| 178 | 3300005577 | Ga0068857_100041550 | Ga0068857_1000415504 | 392 |
| 179 | 3300005578 | Ga0068854_100021242 | Ga0068854_1000212424 | 392 |
| 180 | 3300005578 | Ga0068854_100030803 | Ga0068854_1000308033 | 392 |
| 181 | 3300005578 | Ga0068854_100128662 | Ga0068854_1001286622 | 392 |
| 182 | 3300005614 | Ga0068856_100000974 | Ga0068856_10000097421 | 392 |
| 183 | 3300005614 | Ga0068856_100011435 | Ga0068856_1000114357 | 392 |
| 184 | 3300005614 | Ga0068856_100200037 | Ga0068856_1002000373 | 392 |
| 185 | 3300005614 | Ga0068856_100216315 | Ga0068856_1002163152 | 392 |
| 186 | 3300005616 | Ga0068852_100001354 | Ga0068852_1000013544 | 392 |
| 187 | 3300005616 | Ga0068852_100006359 | Ga0068852_1000063596 | 392 |
| 188 | 3300005616 | Ga0068852_100009317 | Ga0068852_1000093177 | 392 |
| 189 | 3300005616 | Ga0068852_100011068 | Ga0068852_1000110687 | 392 |
| 190 | 3300005616 | Ga0068852_100019422 | Ga0068852_1000194222 | 392 |
| 191 | 3300005616 | Ga0068852_100067340 | Ga0068852_1000673402 | 392 |
| 192 | 3300005617 | Ga0068859_100002593 | Ga0068859_1000025934 | 392 |
| 193 | 3300005618 | Ga0068864_100012308 | Ga0068864_10001230810 | 392 |
| 194 | 3300005618 | Ga0068864_100184371 | Ga0068864_1001843712 | 392 |
| 195 | 3300005718 | Ga0068866_10040292 | Ga0068866_100402923 | 392 |
| 196 | 3300005718 | Ga0068866_10044137 | Ga0068866_100441372 | 392 |
| 197 | 3300005718 | Ga0068866_10093358 | Ga0068866_100933582 | 392 |
| 198 | 3300005834 | Ga0068851_10004197 | Ga0068851_100041977 | 392 |
| 199 | 3300005840 | Ga0068870_10080568 | Ga0068870_100805682 | 392 |
| 200 | 3300005841 | Ga0068863_100033211 | Ga0068863_1000332112 | 392 |
| 201 | 3300005841 | Ga0068863_100054970 | Ga0068863_1000549702 | 392 |
| 202 | 3300005841 | Ga0068863_100077472 | Ga0068863_1000774724 | 392 |
| 203 | 3300005841 | Ga0068863_100254103 | Ga0068863_1002541032 | 392 |
| 204 | 3300005842 | Ga0068858_100001220 | Ga0068858_10000122020 | 392 |
| 205 | 3300005842 | Ga0068858_100001846 | Ga0068858_1000018464 | 392 |
| 206 | 3300005842 | Ga0068858_100011265 | Ga0068858_1000112654 | 392 |
| 207 | 3300005843 | Ga0068860_100036535 | Ga0068860_1000365352 | 392 |
| 208 | 3300005843 | Ga0068860_100038335 | Ga0068860_1000383353 | 392 |
| 209 | 3300005843 | Ga0068860_100058888 | Ga0068860_1000588884 | 392 |
| 210 | 3300005844 | Ga0068862_100011722 | Ga0068862_1000117224 | 392 |
| 211 | 3300005844 | Ga0068862_100154443 | Ga0068862_1001544431 | 392 |
| 212 | 3300006028 | Ga0070717_10007064 | Ga0070717_100070647 | 392 |
| 213 | 3300006175 | Ga0070712_100091074 | Ga0070712_1000910743 | 392 |
| 214 | 3300006237 | Ga0097621_100005115 | Ga0097621_1000051159 | 392 |
| 215 | 3300006237 | Ga0097621_100100581 | Ga0097621_1001005811 | 392 |
| 216 | 3300006358 | Ga0068871_100007484 | Ga0068871_1000074845 | 392 |
| 217 | 3300006358 | Ga0068871_100082726 | Ga0068871_1000827262 | 392 |
| 218 | 3300006852 | Ga0075433_10062719 | Ga0075433_100627192 | 392 |
| 219 | 3300006881 | Ga0068865_100009283 | Ga0068865_1000092836 | 392 |
| 220 | 3300006881 | Ga0068865_100016775 | Ga0068865_1000167752 | 392 |
| 221 | 3300006931 | Ga0097620_100002593 | Ga0097620_10000259317 | 392 |
| 222 | 3300006931 | Ga0097620_100039763 | Ga0097620_1000397632 | 392 |
| 223 | 3300009093 | Ga0105240_10010940 | Ga0105240_100109406 | 392 |
| 224 | 3300009093 | Ga0105240_10145713 | Ga0105240_101457132 | 392 |
| 225 | 3300009093 | Ga0105240_10220990 | Ga0105240_102209901 | 392 |
| 226 | 3300009094 | Ga0111539_10215607 | Ga0111539_102156073 | 392 |
| 227 | 3300009098 | Ga0105245_10000345 | Ga0105245_1000034511 | 392 |
| 228 | 3300009098 | Ga0105245_10007397 | Ga0105245_1000739710 | 392 |
| 229 | 3300009098 | Ga0105245_10018295 | Ga0105245_100182955 | 392 |
| 230 | 3300009098 | Ga0105245_10064090 | Ga0105245_100640902 | 392 |
| 231 | 3300009098 | Ga0105245_10078381 | Ga0105245_100783812 | 392 |
| 232 | 3300009098 | Ga0105245_10289122 | Ga0105245_102891221 | 392 |
| 233 | 3300009148 | Ga0105243_10089923 | Ga0105243_100899231 | 392 |
| 234 | 3300009174 | Ga0105241_10025393 | Ga0105241_100253932 | 392 |
| 235 | 3300009176 | Ga0105242_10283216 | Ga0105242_102832161 | 392 |
| 236 | 3300009177 | Ga0105248_10000278 | Ga0105248_1000027834 | 392 |
| 237 | 3300009177 | Ga0105248_10000575 | Ga0105248_1000057511 | 392 |
| 238 | 3300009177 | Ga0105248_10003523 | Ga0105248_1000352317 | 392 |
| 239 | 3300009177 | Ga0105248_10010229 | Ga0105248_1001022912 | 392 |
| 240 | 3300009177 | Ga0105248_10019015 | Ga0105248_100190153 | 392 |
| 241 | 3300009177 | Ga0105248_10061483 | Ga0105248_100614834 | 392 |
| 242 | 3300009177 | Ga0105248_10102833 | Ga0105248_101028332 | 392 |
| 243 | 3300009177 | Ga0105248_10107994 | Ga0105248_101079942 | 392 |
| 244 | 3300009545 | Ga0105237_10043265 | Ga0105237_100432652 | 392 |
| 245 | 3300009551 | Ga0105238_10030680 | Ga0105238_100306802 | 392 |
| 246 | 3300009551 | Ga0105238_10054334 | Ga0105238_100543345 | 392 |
| 247 | 3300009551 | Ga0105238_10414962 | Ga0105238_104149621 | 392 |
| 248 | 3300009553 | Ga0105249_10171388 | Ga0105249_101713882 | 392 |
| 249 | 3300010375 | Ga0105239_10086897 | Ga0105239_100868972 | 392 |
| 250 | 3300011119 | Ga0105246_10017944 | Ga0105246_100179443 | 392 |
| 251 | 3300013100 | Ga0157373_10008459 | Ga0157373_100084592 | 392 |
| 252 | 3300013100 | Ga0157373_10023675 | Ga0157373_100236752 | 392 |
| 253 | 3300013100 | Ga0157373_10027797 | Ga0157373_100277973 | 392 |
| 254 | 3300013100 | Ga0157373_10035835 | Ga0157373_100358352 | 392 |
| 255 | 3300013100 | Ga0157373_10047395 | Ga0157373_100473952 | 392 |
| 256 | 3300013102 | Ga0157371_10002505 | Ga0157371_100025052 | 392 |
| 257 | 3300013102 | Ga0157371_10010808 | Ga0157371_100108087 | 392 |
| 258 | 3300013102 | Ga0157371_10022940 | Ga0157371_100229406 | 392 |
| 259 | 3300013102 | Ga0157371_10043368 | Ga0157371_100433682 | 392 |
| 260 | 3300013102 | Ga0157371_10056697 | Ga0157371_100566972 | 392 |
| 261 | 3300013104 | Ga0157370_10053392 | Ga0157370_100533923 | 392 |
| 262 | 3300013104 | Ga0157370_10053862 | Ga0157370_100538625 | 392 |
| 263 | 3300013104 | Ga0157370_10057396 | Ga0157370_100573962 | 392 |
| 264 | 3300013104 | Ga0157370_10085415 | Ga0157370_100854153 | 392 |
| 265 | 3300013104 | Ga0157370_10250709 | Ga0157370_102507092 | 392 |
| 266 | 3300013105 | Ga0157369_10000207 | Ga0157369_100002076 | 392 |
| 267 | 3300013105 | Ga0157369_10021548 | Ga0157369_100215483 | 392 |
| 268 | 3300013105 | Ga0157369_10022923 | Ga0157369_100229232 | 392 |
| 269 | 3300013105 | Ga0157369_10046359 | Ga0157369_100463595 | 392 |
| 270 | 3300013105 | Ga0157369_10070536 | Ga0157369_100705363 | 392 |
| 271 | 3300013105 | Ga0157369_10074597 | Ga0157369_100745975 | 392 |
| 272 | 3300013105 | Ga0157369_10103474 | Ga0157369_101034743 | 392 |
| 273 | 3300013105 | Ga0157369_10140894 | Ga0157369_101408942 | 392 |
| 274 | 3300013105 | Ga0157369_10357506 | Ga0157369_103575062 | 392 |
| 275 | 3300013296 | Ga0157374_10004605 | Ga0157374_1000460513 | 392 |
| 276 | 3300013296 | Ga0157374_10038900 | Ga0157374_100389006 | 392 |
| 277 | 3300013296 | Ga0157374_10165019 | Ga0157374_101650192 | 392 |
| 278 | 3300013297 | Ga0157378_10006791 | Ga0157378_100067911 | 392 |
| 279 | 3300013297 | Ga0157378_10079513 | Ga0157378_100795133 | 392 |
| 280 | 3300013306 | Ga0163162_10011540 | Ga0163162_100115408 | 392 |
| 281 | 3300013306 | Ga0163162_10036178 | Ga0163162_100361785 | 392 |
| 282 | 3300013307 | Ga0157372_10069404 | Ga0157372_100694043 | 392 |
| 283 | 3300013308 | Ga0157375_10028971 | Ga0157375_100289711 | 392 |
| 284 | 3300013308 | Ga0157375_10053602 | Ga0157375_100536022 | 392 |
| 285 | 3300013308 | Ga0157375_10056718 | Ga0157375_100567182 | 392 |
| 286 | 3300013308 | Ga0157375_10062099 | Ga0157375_100620995 | 392 |
| 287 | 3300013308 | Ga0157375_10268370 | Ga0157375_102683701 | 392 |
| 288 | 3300014325 | Ga0163163_10000843 | Ga0163163_1000084324 | 392 |
| 289 | 3300014325 | Ga0163163_10274079 | Ga0163163_102740792 | 392 |
| 290 | 3300014497 | Ga0182008_10060270 | Ga0182008_100602702 | 392 |
| 291 | 3300014745 | Ga0157377_10055272 | Ga0157377_100552722 | 392 |
| 292 | 3300014745 | Ga0157377_10097495 | Ga0157377_100974951 | 392 |
| 293 | 3300014968 | Ga0157379_10020897 | Ga0157379_100208972 | 392 |
| 294 | 3300014968 | Ga0157379_10027414 | Ga0157379_100274142 | 392 |
| 295 | 3300014969 | Ga0157376_10008028 | Ga0157376_100080289 | 392 |
| 296 | 3300014969 | Ga0157376_10263474 | Ga0157376_102634741 | 392 |
| 297 | 3300020081 | Ga0206354_10354046 | Ga0206354_103540462 | 392 |
| 298 | 3300020082 | Ga0206353_10254860 | Ga0206353_102548602 | 392 |
| 299 | 3300020082 | Ga0206353_10519444 | Ga0206353_105194442 | 392 |
| 300 | 3300021388 | Ga0213875_10001660 | Ga0213875_1000166012 | 392 |
| 301 | 3300025315 | Ga0207697_10006110 | Ga0207697_100061106 | 392 |
| 302 | 3300025315 | Ga0207697_10018985 | Ga0207697_100189853 | 392 |
| 303 | 3300025893 | Ga0207682_10006585 | Ga0207682_100065852 | 392 |
| 304 | 3300025893 | Ga0207682_10021911 | Ga0207682_100219112 | 392 |
| 305 | 3300025901 | Ga0207688_10007449 | Ga0207688_100074493 | 392 |
| 306 | 3300025901 | Ga0207688_10083943 | Ga0207688_100839433 | 392 |
| 307 | 3300025901 | Ga0207688_10084827 | Ga0207688_100848272 | 392 |
| 308 | 3300025903 | Ga0207680_10007504 | Ga0207680_100075045 | 392 |
| 309 | 3300025903 | Ga0207680_10014223 | Ga0207680_100142234 | 392 |
| 310 | 3300025903 | Ga0207680_10099023 | Ga0207680_100990232 | 392 |
| 311 | 3300025904 | Ga0207647_10000181 | Ga0207647_1000018140 | 392 |
| 312 | 3300025904 | Ga0207647_10001259 | Ga0207647_1000125914 | 392 |
| 313 | 3300025904 | Ga0207647_10001551 | Ga0207647_1000155119 | 392 |
| 314 | 3300025904 | Ga0207647_10001581 | Ga0207647_1000158120 | 392 |
| 315 | 3300025904 | Ga0207647_10005987 | Ga0207647_100059879 | 392 |
| 316 | 3300025904 | Ga0207647_10022146 | Ga0207647_100221465 | 392 |
| 317 | 3300025904 | Ga0207647_10025792 | Ga0207647_100257923 | 392 |
| 318 | 3300025904 | Ga0207647_10069608 | Ga0207647_100696083 | 392 |
| 319 | 3300025908 | Ga0207643_10046516 | Ga0207643_100465162 | 392 |
| 320 | 3300025908 | Ga0207643_10050233 | Ga0207643_100502333 | 392 |
| 321 | 3300025909 | Ga0207705_10000030 | Ga0207705_10000030106 | 392 |
| 322 | 3300025909 | Ga0207705_10000295 | Ga0207705_1000029529 | 392 |
| 323 | 3300025909 | Ga0207705_10004858 | Ga0207705_100048585 | 392 |
| 324 | 3300025909 | Ga0207705_10009708 | Ga0207705_100097083 | 392 |
| 325 | 3300025909 | Ga0207705_10036102 | Ga0207705_100361022 | 392 |
| 326 | 3300025909 | Ga0207705_10105896 | Ga0207705_101058962 | 392 |
| 327 | 3300025911 | Ga0207654_10050031 | Ga0207654_100500312 | 392 |
| 328 | 3300025912 | Ga0207707_10032046 | Ga0207707_100320462 | 392 |
| 329 | 3300025913 | Ga0207695_10003659 | Ga0207695_100036596 | 392 |
| 330 | 3300025913 | Ga0207695_10013923 | Ga0207695_100139236 | 392 |
| 331 | 3300025913 | Ga0207695_10027383 | Ga0207695_100273832 | 392 |
| 332 | 3300025913 | Ga0207695_10039298 | Ga0207695_100392986 | 392 |
| 333 | 3300025913 | Ga0207695_10150783 | Ga0207695_101507831 | 392 |
| 334 | 3300025914 | Ga0207671_10041044 | Ga0207671_100410441 | 392 |
| 335 | 3300025915 | Ga0207693_10086060 | Ga0207693_100860603 | 392 |
| 336 | 3300025917 | Ga0207660_10000750 | Ga0207660_100007509 | 392 |
| 337 | 3300025917 | Ga0207660_10004788 | Ga0207660_100047883 | 392 |
| 338 | 3300025917 | Ga0207660_10005631 | Ga0207660_100056315 | 392 |
| 339 | 3300025917 | Ga0207660_10078366 | Ga0207660_100783661 | 392 |
| 340 | 3300025918 | Ga0207662_10066830 | Ga0207662_100668301 | 392 |
| 341 | 3300025919 | Ga0207657_10000334 | Ga0207657_1000033429 | 392 |
| 342 | 3300025919 | Ga0207657_10003211 | Ga0207657_1000321120 | 392 |
| 343 | 3300025919 | Ga0207657_10008718 | Ga0207657_100087186 | 392 |
| 344 | 3300025919 | Ga0207657_10019817 | Ga0207657_100198173 | 392 |
| 345 | 3300025919 | Ga0207657_10019896 | Ga0207657_100198968 | 392 |
| 346 | 3300025919 | Ga0207657_10023780 | Ga0207657_100237806 | 392 |
| 347 | 3300025919 | Ga0207657_10024553 | Ga0207657_100245532 | 392 |
| 348 | 3300025919 | Ga0207657_10024743 | Ga0207657_100247432 | 392 |
| 349 | 3300025919 | Ga0207657_10036764 | Ga0207657_100367642 | 392 |
| 350 | 3300025920 | Ga0207649_10000211 | Ga0207649_1000021133 | 392 |
| 351 | 3300025920 | Ga0207649_10001913 | Ga0207649_100019134 | 392 |
| 352 | 3300025920 | Ga0207649_10023326 | Ga0207649_100233262 | 392 |
| 353 | 3300025920 | Ga0207649_10026735 | Ga0207649_100267352 | 392 |
| 354 | 3300025920 | Ga0207649_10033231 | Ga0207649_100332312 | 392 |
| 355 | 3300025920 | Ga0207649_10076045 | Ga0207649_100760452 | 392 |
| 356 | 3300025920 | Ga0207649_10081357 | Ga0207649_100813572 | 392 |
| 357 | 3300025921 | Ga0207652_10172033 | Ga0207652_101720331 | 392 |
| 358 | 3300025923 | Ga0207681_10001272 | Ga0207681_1000127214 | 392 |
| 359 | 3300025924 | Ga0207694_10091034 | Ga0207694_100910342 | 392 |
| 360 | 3300025924 | Ga0207694_10093165 | Ga0207694_100931652 | 392 |
| 361 | 3300025924 | Ga0207694_10153730 | Ga0207694_101537301 | 392 |
| 362 | 3300025924 | Ga0207694_10172900 | Ga0207694_101729002 | 392 |
| 363 | 3300025925 | Ga0207650_10010807 | Ga0207650_100108071 | 392 |
| 364 | 3300025925 | Ga0207650_10135121 | Ga0207650_101351212 | 392 |
| 365 | 3300025926 | Ga0207659_10092832 | Ga0207659_100928321 | 392 |
| 366 | 3300025926 | Ga0207659_10220392 | Ga0207659_102203921 | 392 |
| 367 | 3300025927 | Ga0207687_10020631 | Ga0207687_100206313 | 392 |
| 368 | 3300025927 | Ga0207687_10025261 | Ga0207687_100252612 | 392 |
| 369 | 3300025927 | Ga0207687_10124808 | Ga0207687_101248082 | 392 |
| 370 | 3300025928 | Ga0207700_10052290 | Ga0207700_100522902 | 392 |
| 371 | 3300025929 | Ga0207664_10066419 | Ga0207664_100664192 | 392 |
| 372 | 3300025931 | Ga0207644_10000244 | Ga0207644_1000024415 | 392 |
| 373 | 3300025931 | Ga0207644_10019858 | Ga0207644_100198583 | 392 |
| 374 | 3300025931 | Ga0207644_10134429 | Ga0207644_101344292 | 392 |
| 375 | 3300025932 | Ga0207690_10000182 | Ga0207690_1000018219 | 392 |
| 376 | 3300025932 | Ga0207690_10001681 | Ga0207690_100016817 | 392 |
| 377 | 3300025932 | Ga0207690_10004770 | Ga0207690_100047702 | 392 |
| 378 | 3300025932 | Ga0207690_10016048 | Ga0207690_100160484 | 392 |
| 379 | 3300025932 | Ga0207690_10016885 | Ga0207690_100168856 | 392 |
| 380 | 3300025932 | Ga0207690_10097353 | Ga0207690_100973532 | 392 |
| 381 | 3300025933 | Ga0207706_10001111 | Ga0207706_100011112 | 392 |
| 382 | 3300025933 | Ga0207706_10001196 | Ga0207706_1000119624 | 392 |
| 383 | 3300025933 | Ga0207706_10007420 | Ga0207706_100074202 | 392 |
| 384 | 3300025933 | Ga0207706_10010496 | Ga0207706_100104968 | 392 |
| 385 | 3300025933 | Ga0207706_10020691 | Ga0207706_100206916 | 392 |
| 386 | 3300025933 | Ga0207706_10021761 | Ga0207706_100217614 | 392 |
| 387 | 3300025933 | Ga0207706_10029223 | Ga0207706_100292235 | 392 |
| 388 | 3300025933 | Ga0207706_10110292 | Ga0207706_101102922 | 392 |
| 389 | 3300025933 | Ga0207706_10133673 | Ga0207706_101336732 | 392 |
| 390 | 3300025933 | Ga0207706_10208005 | Ga0207706_102080052 | 392 |
| 391 | 3300025937 | Ga0207669_10009631 | Ga0207669_100096315 | 392 |
| 392 | 3300025937 | Ga0207669_10235228 | Ga0207669_102352281 | 392 |
| 393 | 3300025938 | Ga0207704_10020224 | Ga0207704_100202243 | 392 |
| 394 | 3300025938 | Ga0207704_10028082 | Ga0207704_100280823 | 392 |
| 395 | 3300025939 | Ga0207665_10019185 | Ga0207665_100191855 | 392 |
| 396 | 3300025939 | Ga0207665_10066567 | Ga0207665_100665672 | 392 |
| 397 | 3300025940 | Ga0207691_10001971 | Ga0207691_1000197124 | 392 |
| 398 | 3300025940 | Ga0207691_10004474 | Ga0207691_100044743 | 392 |
| 399 | 3300025940 | Ga0207691_10006883 | Ga0207691_100068832 | 392 |
| 400 | 3300025940 | Ga0207691_10010219 | Ga0207691_100102192 | 392 |
| 401 | 3300025940 | Ga0207691_10043731 | Ga0207691_100437312 | 392 |
| 402 | 3300025940 | Ga0207691_10054083 | Ga0207691_100540833 | 392 |
| 403 | 3300025940 | Ga0207691_10058961 | Ga0207691_100589613 | 392 |
| 404 | 3300025941 | Ga0207711_10000496 | Ga0207711_1000049629 | 392 |
| 405 | 3300025941 | Ga0207711_10003249 | Ga0207711_100032494 | 392 |
| 406 | 3300025941 | Ga0207711_10003482 | Ga0207711_100034824 | 392 |
| 407 | 3300025941 | Ga0207711_10014623 | Ga0207711_100146235 | 392 |
| 408 | 3300025941 | Ga0207711_10017473 | Ga0207711_100174738 | 392 |
| 409 | 3300025941 | Ga0207711_10017952 | Ga0207711_100179525 | 392 |
| 410 | 3300025941 | Ga0207711_10168801 | Ga0207711_101688011 | 392 |
| 411 | 3300025941 | Ga0207711_10229454 | Ga0207711_102294542 | 392 |
| 412 | 3300025942 | Ga0207689_10001430 | Ga0207689_100014302 | 392 |
| 413 | 3300025942 | Ga0207689_10037593 | Ga0207689_100375932 | 392 |
| 414 | 3300025942 | Ga0207689_10102929 | Ga0207689_101029292 | 392 |
| 415 | 3300025942 | Ga0207689_10211270 | Ga0207689_102112702 | 392 |
| 416 | 3300025944 | Ga0207661_10004896 | Ga0207661_100048968 | 392 |
| 417 | 3300025944 | Ga0207661_10006695 | Ga0207661_100066958 | 392 |
| 418 | 3300025944 | Ga0207661_10020069 | Ga0207661_100200693 | 392 |
| 419 | 3300025944 | Ga0207661_10052050 | Ga0207661_100520502 | 392 |
| 420 | 3300025945 | Ga0207679_10000293 | Ga0207679_1000029334 | 392 |
| 421 | 3300025945 | Ga0207679_10007447 | Ga0207679_100074478 | 392 |
| 422 | 3300025945 | Ga0207679_10014639 | Ga0207679_100146393 | 392 |
| 423 | 3300025945 | Ga0207679_10072925 | Ga0207679_100729253 | 392 |
| 424 | 3300025949 | Ga0207667_10001632 | Ga0207667_100016329 | 392 |
| 425 | 3300025949 | Ga0207667_10003164 | Ga0207667_1000316420 | 392 |
| 426 | 3300025949 | Ga0207667_10009303 | Ga0207667_100093039 | 392 |
| 427 | 3300025949 | Ga0207667_10021295 | Ga0207667_100212955 | 392 |
| 428 | 3300025949 | Ga0207667_10052663 | Ga0207667_100526634 | 392 |
| 429 | 3300025949 | Ga0207667_10078318 | Ga0207667_100783183 | 392 |
| 430 | 3300025949 | Ga0207667_10280306 | Ga0207667_102803062 | 392 |
| 431 | 3300025949 | Ga0207667_10303208 | Ga0207667_103032081 | 392 |
| 432 | 3300025960 | Ga0207651_10002607 | Ga0207651_100026077 | 392 |
| 433 | 3300025960 | Ga0207651_10003074 | Ga0207651_100030743 | 392 |
| 434 | 3300025960 | Ga0207651_10017404 | Ga0207651_100174043 | 392 |
| 435 | 3300025960 | Ga0207651_10042328 | Ga0207651_100423284 | 392 |
| 436 | 3300025960 | Ga0207651_10121421 | Ga0207651_101214212 | 392 |
| 437 | 3300025961 | Ga0207712_10004801 | Ga0207712_100048012 | 392 |
| 438 | 3300025972 | Ga0207668_10057300 | Ga0207668_100573003 | 392 |
| 439 | 3300025981 | Ga0207640_10003428 | Ga0207640_100034284 | 392 |
| 440 | 3300025981 | Ga0207640_10005127 | Ga0207640_100051275 | 392 |
| 441 | 3300025981 | Ga0207640_10016005 | Ga0207640_100160052 | 392 |
| 442 | 3300025981 | Ga0207640_10109953 | Ga0207640_101099532 | 392 |
| 443 | 3300025981 | Ga0207640_10157337 | Ga0207640_101573372 | 392 |
| 444 | 3300025986 | Ga0207658_10005837 | Ga0207658_100058378 | 392 |
| 445 | 3300025986 | Ga0207658_10005856 | Ga0207658_100058567 | 392 |
| 446 | 3300025986 | Ga0207658_10035255 | Ga0207658_100352552 | 392 |
| 447 | 3300025986 | Ga0207658_10092772 | Ga0207658_100927722 | 392 |
| 448 | 3300026023 | Ga0207677_10001914 | Ga0207677_1000191411 | 392 |
| 449 | 3300026023 | Ga0207677_10002862 | Ga0207677_100028622 | 392 |
| 450 | 3300026023 | Ga0207677_10025226 | Ga0207677_100252264 | 392 |
| 451 | 3300026023 | Ga0207677_10033222 | Ga0207677_100332223 | 392 |
| 452 | 3300026035 | Ga0207703_10008253 | Ga0207703_100082534 | 392 |
| 453 | 3300026035 | Ga0207703_10009527 | Ga0207703_100095276 | 392 |
| 454 | 3300026035 | Ga0207703_10021916 | Ga0207703_100219163 | 392 |
| 455 | 3300026035 | Ga0207703_10064569 | Ga0207703_100645692 | 392 |
| 456 | 3300026041 | Ga0207639_10000154 | Ga0207639_1000015426 | 392 |
| 457 | 3300026041 | Ga0207639_10126906 | Ga0207639_101269063 | 392 |
| 458 | 3300026041 | Ga0207639_10134323 | Ga0207639_101343232 | 392 |
| 459 | 3300026041 | Ga0207639_10172152 | Ga0207639_101721522 | 392 |
| 460 | 3300026067 | Ga0207678_10000989 | Ga0207678_100009895 | 392 |
| 461 | 3300026067 | Ga0207678_10004204 | Ga0207678_100042043 | 392 |
| 462 | 3300026067 | Ga0207678_10024308 | Ga0207678_100243082 | 392 |
| 463 | 3300026067 | Ga0207678_10028452 | Ga0207678_100284521 | 392 |
| 464 | 3300026067 | Ga0207678_10032245 | Ga0207678_100322455 | 392 |
| 465 | 3300026067 | Ga0207678_10082277 | Ga0207678_100822774 | 392 |
| 466 | 3300026067 | Ga0207678_10091329 | Ga0207678_100913292 | 392 |
| 467 | 3300026067 | Ga0207678_10253160 | Ga0207678_102531601 | 392 |
| 468 | 3300026078 | Ga0207702_10000497 | Ga0207702_1000049729 | 392 |
| 469 | 3300026078 | Ga0207702_10012814 | Ga0207702_100128147 | 392 |
| 470 | 3300026078 | Ga0207702_10014245 | Ga0207702_100142455 | 392 |
| 471 | 3300026078 | Ga0207702_10021180 | Ga0207702_100211803 | 392 |
| 472 | 3300026078 | Ga0207702_10161370 | Ga0207702_101613702 | 392 |
| 473 | 3300026088 | Ga0207641_10024132 | Ga0207641_100241322 | 392 |
| 474 | 3300026088 | Ga0207641_10043191 | Ga0207641_100431912 | 392 |
| 475 | 3300026088 | Ga0207641_10060781 | Ga0207641_100607812 | 392 |
| 476 | 3300026088 | Ga0207641_10135403 | Ga0207641_101354032 | 392 |
| 477 | 3300026089 | Ga0207648_10000838 | Ga0207648_100008385 | 392 |
| 478 | 3300026089 | Ga0207648_10002771 | Ga0207648_100027717 | 392 |
| 479 | 3300026089 | Ga0207648_10005618 | Ga0207648_100056187 | 392 |
| 480 | 3300026089 | Ga0207648_10016546 | Ga0207648_100165467 | 392 |
| 481 | 3300026089 | Ga0207648_10027547 | Ga0207648_100275476 | 392 |
| 482 | 3300026095 | Ga0207676_10001828 | Ga0207676_1000182815 | 392 |
| 483 | 3300026095 | Ga0207676_10253201 | Ga0207676_102532012 | 392 |
| 484 | 3300026116 | Ga0207674_10002837 | Ga0207674_100028377 | 392 |
| 485 | 3300026116 | Ga0207674_10007245 | Ga0207674_100072457 | 392 |
| 486 | 3300026116 | Ga0207674_10012448 | Ga0207674_100124483 | 392 |
| 487 | 3300026116 | Ga0207674_10015575 | Ga0207674_100155753 | 392 |
| 488 | 3300026116 | Ga0207674_10020630 | Ga0207674_100206306 | 392 |
| 489 | 3300026116 | Ga0207674_10238491 | Ga0207674_102384911 | 392 |
| 490 | 3300026118 | Ga0207675_100078146 | Ga0207675_1000781462 | 392 |
| 491 | 3300026121 | Ga0207683_10007726 | Ga0207683_100077262 | 392 |
| 492 | 3300026121 | Ga0207683_10039327 | Ga0207683_100393272 | 392 |
| 493 | 3300026121 | Ga0207683_10048875 | Ga0207683_100488753 | 392 |
| 494 | 3300026121 | Ga0207683_10284062 | Ga0207683_102840621 | 392 |
| 495 | 3300026142 | Ga0207698_10001214 | Ga0207698_100012142 | 392 |
| 496 | 3300026142 | Ga0207698_10004239 | Ga0207698_100042397 | 392 |
| 497 | 3300026142 | Ga0207698_10004588 | Ga0207698_100045882 | 392 |
| 498 | 3300026142 | Ga0207698_10006440 | Ga0207698_100064408 | 392 |
| 499 | 3300026142 | Ga0207698_10020836 | Ga0207698_100208362 | 392 |
| 500 | 3300026142 | Ga0207698_10024126 | Ga0207698_100241263 | 392 |
| 501 | 3300028379 | Ga0268266_10002631 | Ga0268266_1000263119 | 392 |
| 502 | 3300028379 | Ga0268266_10007828 | Ga0268266_100078286 | 392 |
| 503 | 3300028379 | Ga0268266_10011861 | Ga0268266_100118617 | 392 |
| 504 | 3300028379 | Ga0268266_10023299 | Ga0268266_100232994 | 392 |
| 505 | 3300028379 | Ga0268266_10044312 | Ga0268266_100443123 | 392 |
| 506 | 3300028380 | Ga0268265_10038985 | Ga0268265_100389853 | 392 |
| 507 | 3300028381 | Ga0268264_10001404 | Ga0268264_100014045 | 392 |
| 508 | 3300028381 | Ga0268264_10015899 | Ga0268264_100158996 | 392 |
| 509 | 3300028381 | Ga0268264_10258882 | Ga0268264_102588822 | 392 |
| 510 | 3300030733 | Ga0314311_1220182 | Ga0314311_12201823 | 392 |
| 511 | 3300030734 | Ga0316179_1031902 | Ga0316179_10319022 | 392 |
| 512 | 3300031456 | Ga0307513_10102386 | Ga0307513_101023861 | 392 |
| 513 | 3300031649 | Ga0307514_10144997 | Ga0307514_101449972 | 392 |
| 514 | 3300031731 | Ga0307405_10002843 | Ga0307405_1000284312 | 392 |
| 515 | 3300031824 | Ga0307413_10002762 | Ga0307413_100027628 | 392 |
| 516 | 3300031824 | Ga0307413_10007843 | Ga0307413_100078434 | 392 |
| 517 | 3300031852 | Ga0307410_10007955 | Ga0307410_100079552 | 392 |
| 518 | 3300031852 | Ga0307410_10010005 | Ga0307410_100100055 | 392 |
| 519 | 3300031852 | Ga0307410_10037231 | Ga0307410_100372313 | 392 |
| 520 | 3300031852 | Ga0307410_10070248 | Ga0307410_100702481 | 392 |
| 521 | 3300031903 | Ga0307407_10001660 | Ga0307407_100016602 | 392 |
| 522 | 3300031911 | Ga0307412_10056998 | Ga0307412_100569982 | 392 |
| 523 | 3300031995 | Ga0307409_100005087 | Ga0307409_1000050877 | 392 |
| 524 | 3300031995 | Ga0307409_100015831 | Ga0307409_1000158312 | 392 |
| 525 | 3300031995 | Ga0307409_100036419 | Ga0307409_1000364193 | 392 |
| 526 | 3300032002 | Ga0307416_100027796 | Ga0307416_1000277965 | 392 |
| 527 | 3300032002 | Ga0307416_100063293 | Ga0307416_1000632933 | 392 |
| 528 | 3300032002 | Ga0307416_100080985 | Ga0307416_1000809853 | 392 |
| 529 | 3300032002 | Ga0307416_100093410 | Ga0307416_1000934104 | 392 |
| 530 | 3300032002 | Ga0307416_100210848 | Ga0307416_1002108482 | 392 |
| 531 | 3300032004 | Ga0307414_10018114 | Ga0307414_100181144 | 392 |
| 532 | 3300032004 | Ga0307414_10127463 | Ga0307414_101274632 | 392 |
| 533 | 3300032005 | Ga0307411_10004993 | Ga0307411_100049936 | 392 |
| 534 | 3300035692 | Ga0373935_0009488 | Ga0373935_0009488_4342_5520 | 392 |
| 535 | 3300035692 | Ga0373935_0016542 | Ga0373935_0016542_1472_2650 | 392 |
| 536 | 3300035725 | Ga0373947_0004557 | Ga0373947_0004557_3545_4723 | 392 |
| 537 | 3300037312 | Ga0395899_0016795 | Ga0395899_0016795_2458_3636 | 392 |
| 538 | 3300037312 | Ga0395899_0029232 | Ga0395899_0029232_872_2071 | 392 |
| 539 | 3300037312 | Ga0395899_0057539 | Ga0395899_0057539_1415_2593 | 392 |
| 540 | 3300037312 | Ga0395899_0115100 | Ga0395899_0115100_693_1892 | 392 |
| 541 | 3300037312 | Ga0395899_0116084 | Ga0395899_0116084_88_1287 | 392 |
| 542 | 3300037312 | Ga0395899_0121756 | Ga0395899_0121756_449_1627 | 392 |
| 543 | 3300037418 | Ga0395900_0003925 | Ga0395900_0003925_10170_11369 | 392 |
| 544 | 3300037418 | Ga0395900_0005369 | Ga0395900_0005369_3241_4440 | 392 |
| 545 | 3300037418 | Ga0395900_0005577 | Ga0395900_0005577_9841_11040 | 392 |
| 546 | 3300037418 | Ga0395900_0010077 | Ga0395900_0010077_13_1191 | 392 |
| 547 | 3300037418 | Ga0395900_0042369 | Ga0395900_0042369_3001_4200 | 392 |
| 548 | 3300037418 | Ga0395900_0046569 | Ga0395900_0046569_192_1391 | 392 |
| 549 | 3300037418 | Ga0395900_0079761 | Ga0395900_0079761_858_2036 | 392 |
| 550 | 3300037418 | Ga0395900_0106522 | Ga0395900_0106522_26_1204 | 392 |
| 551 | 3300037418 | Ga0395900_0111863 | Ga0395900_0111863_415_1614 | 392 |
| 552 | 3300037418 | Ga0395900_0143661 | Ga0395900_0143661_394_1593 | 392 |
| 553 | 3300037418 | Ga0395900_0153630 | Ga0395900_0153630_863_2062 | 392 |
| 554 | 3300037418 | Ga0395900_0287071 | Ga0395900_0287071_129_1328 | 392 |
| 555 | 3300037418 | Ga0395900_0339712 | Ga0395900_0339712_288_1466 | 392 |
| 556 | 3300037466 | Ga0395898_0012167 | Ga0395898_0012167_2554_3732 | 392 |
| 557 | 3300037466 | Ga0395898_0026941 | Ga0395898_0026941_3377_4555 | 392 |
| 558 | 3300037466 | Ga0395898_0075074 | Ga0395898_0075074_90_1268 | 392 |
| 559 | 3300037466 | Ga0395898_0083941 | Ga0395898_0083941_1153_2331 | 392 |
| 560 | 3300037466 | Ga0395898_0126794 | Ga0395898_0126794_74_1252 | 392 |
| 561 | 3300037466 | Ga0395898_0173903 | Ga0395898_0173903_230_1429 | 392 |
| 562 | 3300037466 | Ga0395898_0316331 | Ga0395898_0316331_202_1380 | 392 |
| 563 | 3300037466 | Ga0395898_0376715 | Ga0395898_0376715_121_1320 | 392 |
| 564 | 3300037471 | Ga0395905_0001141 | Ga0395905_0001141_12035_13234 | 392 |
| 565 | 3300037471 | Ga0395905_0004658 | Ga0395905_0004658_12187_13386 | 392 |
| 566 | 3300037471 | Ga0395905_0007482 | Ga0395905_0007482_3011_4210 | 392 |
| 567 | 3300037471 | Ga0395905_0011136 | Ga0395905_0011136_7391_8569 | 392 |
| 568 | 3300037471 | Ga0395905_0017826 | Ga0395905_0017826_2778_3956 | 392 |
| 569 | 3300037471 | Ga0395905_0037823 | Ga0395905_0037823_2393_3592 | 392 |
| 570 | 3300037471 | Ga0395905_0045363 | Ga0395905_0045363_1639_2817 | 392 |
| 571 | 3300037471 | Ga0395905_0053977 | Ga0395905_0053977_879_2057 | 392 |
| 572 | 3300037471 | Ga0395905_0067409 | Ga0395905_0067409_1013_2212 | 392 |
| 573 | 3300037471 | Ga0395905_0090401 | Ga0395905_0090401_1206_2405 | 392 |
| 574 | 3300037471 | Ga0395905_0092845 | Ga0395905_0092845_202_1380 | 392 |
| 575 | 3300037471 | Ga0395905_0098512 | Ga0395905_0098512_280_1524 | 392 |
| 576 | 3300037471 | Ga0395905_0185180 | Ga0395905_0185180_613_1812 | 392 |
| 577 | 3300037471 | Ga0395905_0191440 | Ga0395905_0191440_651_1829 | 392 |
| 578 | 3300037471 | Ga0395905_0191716 | Ga0395905_0191716_539_1717 | 392 |
| 579 | 3300037471 | Ga0395905_0213058 | Ga0395905_0213058_237_1436 | 392 |
| 580 | 3300037471 | Ga0395905_0263036 | Ga0395905_0263036_114_1313 | 392 |
| 581 | 3300037853 | Ga0436364_0269013 | Ga0436364_0269013_5321_6499 | 392 |
| 582 | 3300038443 | Ga0395901_0004104 | Ga0395901_0004104_10428_11627 | 392 |
| 583 | 3300038443 | Ga0395901_0007445 | Ga0395901_0007445_1292_2491 | 392 |
| 584 | 3300038443 | Ga0395901_0017386 | Ga0395901_0017386_288_1466 | 392 |
| 585 | 3300038443 | Ga0395901_0023857 | Ga0395901_0023857_401_1600 | 392 |
| 586 | 3300038443 | Ga0395901_0029478 | Ga0395901_0029478_44_1222 | 392 |
| 587 | 3300038443 | Ga0395901_0035520 | Ga0395901_0035520_1397_2596 | 392 |
| 588 | 3300038443 | Ga0395901_0040317 | Ga0395901_0040317_3054_4253 | 392 |
| 589 | 3300038443 | Ga0395901_0048364 | Ga0395901_0048364_2596_3795 | 392 |
| 590 | 3300038443 | Ga0395901_0133341 | Ga0395901_0133341_878_2077 | 392 |
| 591 | 3300038443 | Ga0395901_0136651 | Ga0395901_0136651_1107_2306 | 392 |
| 592 | 3300038443 | Ga0395901_0147291 | Ga0395901_0147291_289_1488 | 392 |
| 593 | 3300038443 | Ga0395901_0197500 | Ga0395901_0197500_921_2099 | 392 |
| 594 | 3300038443 | Ga0395901_0301703 | Ga0395901_0301703_34_1233 | 392 |
| 595 | 3300038443 | Ga0395901_0317415 | Ga0395901_0317415_130_1329 | 392 |
| 596 | 3300042004 | Ga0439445_0007961 | Ga0439445_0007961_505_1683 | 392 |
| 597 | 3300042015 | Ga0439462_0002422 | Ga0439462_0002422_2614_3813 | 392 |
| 598 | 3300042157 | Ga0439458_0003050 | Ga0439458_0003050_899_2098 | 392 |
| 599 | 3300044656 | Ga0466969_0019153 | Ga0466969_0019153_1736_2914 | 392 |
| 600 | 3300044658 | Ga0466972_0060624 | Ga0466972_0060624_398_1594 | 392 |
| 601 | 3300044658 | Ga0466972_0085902 | Ga0466972_0085902_52_1251 | 392 |
| 602 | 3300044683 | Ga0466965_0119087 | Ga0466965_0119087_97_1317 | 392 |
| 603 | 3300044684 | Ga0466966_0000041 | Ga0466966_0000041_21934_23112 | 392 |
| 604 | 3300044684 | Ga0466966_0012337 | Ga0466966_0012337_2600_3799 | 392 |
| 605 | 3300044684 | Ga0466966_0015306 | Ga0466966_0015306_487_1665 | 392 |
| 606 | 3300044684 | Ga0466966_0016074 | Ga0466966_0016074_393_1571 | 392 |
| 607 | 3300044693 | Ga0466961_0007333 | Ga0466961_0007333_2542_3720 | 392 |
| 608 | 3300044693 | Ga0466961_0050312 | Ga0466961_0050312_1071_2249 | 392 |
| 609 | 3300044693 | Ga0466961_0065378 | Ga0466961_0065378_685_1863 | 392 |
| 610 | 3300044693 | Ga0466961_0089372 | Ga0466961_0089372_461_1660 | 392 |
| 611 | 3300044694 | Ga0466963_0003494 | Ga0466963_0003494_283_1482 | 392 |
| 612 | 3300044694 | Ga0466963_0005728 | Ga0466963_0005728_2998_4176 | 392 |
| 613 | 3300044694 | Ga0466963_0108219 | Ga0466963_0108219_138_1316 | 392 |
| 614 | 3300044694 | Ga0466963_0175422 | Ga0466963_0175422_12_1190 | 392 |
| 615 | 3300044719 | Ga0466971_0003474 | Ga0466971_0003474_4640_5839 | 392 |
| 616 | 3300044719 | Ga0466971_0003766 | Ga0466971_0003766_769_1947 | 392 |
| 617 | 3300044719 | Ga0466971_0087620 | Ga0466971_0087620_216_1394 | 392 |
| 618 | 3300044765 | Ga0466970_0014280 | Ga0466970_0014280_1496_2731 | 392 |
| 619 | 3300044765 | Ga0466970_0034221 | Ga0466970_0034221_1142_2341 | 392 |
| 620 | 3300044842 | Ga0466957_0003087 | Ga0466957_0003087_4148_5326 | 392 |
| 621 | 3300044842 | Ga0466957_0004452 | Ga0466957_0004452_3137_4315 | 392 |
| 622 | 3300045049 | Ga0466959_0155917 | Ga0466959_0155917_326_1525 | 392 |
| 623 | 3300045836 | Ga0466958_0005228 | Ga0466958_0005228_3155_4333 | 392 |
| 624 | 3300045836 | Ga0466958_0006088 | Ga0466958_0006088_3484_4662 | 392 |
| 625 | 3300045836 | Ga0466958_0109616 | Ga0466958_0109616_240_1418 | 392 |
| 626 | 3300045976 | Ga0466967_0002106 | Ga0466967_0002106_6932_8131 | 392 |
| 627 | 3300045976 | Ga0466967_0044740 | Ga0466967_0044740_2573_3751 | 392 |
| 628 | 3300045976 | Ga0466967_0191274 | Ga0466967_0191274_14_1192 | 392 |
| 629 | 3300046453 | Ga0495627_004139 | Ga0495627_004139_4005_5231 | 392 |
| 630 | 3300046525 | Ga0495663_0018317 | Ga0495663_0018317_193_1392 | 392 |
| 631 | 3300046537 | Ga0495598_0017285 | Ga0495598_0017285_605_1804 | 392 |
| 632 | 3300046539 | Ga0495621_0000088 | Ga0495621_0000088_16939_18138 | 392 |
| 633 | 3300046616 | Ga0495668_0023406 | Ga0495668_0023406_1037_2236 | 392 |
| 634 | 3300046684 | Ga0495669_0019165 | Ga0495669_0019165_1012_2190 | 392 |
| 635 | 3300046691 | Ga0495670_0000192 | Ga0495670_0000192_6084_7283 | 392 |
| 636 | 3300046691 | Ga0495670_0037787 | Ga0495670_0037787_440_1660 | 392 |
| 637 | 3300048903 | Ga0496100_0001321 | Ga0496100_0001321_3685_4884 | 392 |
| 638 | 3300048903 | Ga0496100_0064199 | Ga0496100_0064199_66_1265 | 392 |
| 639 | 3300048904 | Ga0496101_0000325 | Ga0496101_0000325_12203_13402 | 392 |
| 640 | 3300048904 | Ga0496101_0035792 | Ga0496101_0035792_2237_3436 | 392 |
| 641 | 3300048905 | Ga0496102_0034774 | Ga0496102_0034774_1770_2969 | 392 |
| 642 | 3300048905 | Ga0496102_0090651 | Ga0496102_0090651_1506_2705 | 392 |
| 643 | 3300048905 | Ga0496102_0107255 | Ga0496102_0107255_896_2092 | 392 |
| 644 | 3300048906 | Ga0496103_0033965 | Ga0496103_0033965_1281_2480 | 392 |
| 645 | 3300048907 | Ga0496104_0087287 | Ga0496104_0087287_760_1959 | 392 |
| 646 | 3300048909 | Ga0496106_0004454 | Ga0496106_0004454_2227_3426 | 392 |
| 647 | 3300048909 | Ga0496106_0035887 | Ga0496106_0035887_1621_2820 | 392 |
| 648 | 3300048910 | Ga0496107_0002192 | Ga0496107_0002192_5417_6616 | 392 |
| 649 | 3300048910 | Ga0496107_0031870 | Ga0496107_0031870_2149_3348 | 392 |
| 650 | 3300048910 | Ga0496107_0044820 | Ga0496107_0044820_1906_3105 | 392 |
| 651 | 3300048911 | Ga0496108_0012352 | Ga0496108_0012352_4688_5887 | 392 |
| 652 | 3300048912 | Ga0496109_0008023 | Ga0496109_0008023_6810_8009 | 392 |
| 653 | 3300048912 | Ga0496109_0049587 | Ga0496109_0049587_544_1743 | 392 |
| 654 | 3300048913 | Ga0496110_0013114 | Ga0496110_0013114_2699_3898 | 392 |
| 655 | 3300048914 | Ga0496111_0000090 | Ga0496111_0000090_17717_18916 | 392 |
| 656 | 3300048914 | Ga0496111_0001247 | Ga0496111_0001247_10131_11330 | 392 |
| 657 | 3300048915 | Ga0496112_0002770 | Ga0496112_0002770_7177_8376 | 392 |
| 658 | 3300048915 | Ga0496112_0013002 | Ga0496112_0013002_6104_7303 | 392 |
| 659 | 3300048915 | Ga0496112_0077190 | Ga0496112_0077190_383_1579 | 392 |
| 660 | 3300048915 | Ga0496112_0151816 | Ga0496112_0151816_770_1969 | 392 |
| 661 | 3300048916 | Ga0496113_0003942 | Ga0496113_0003942_2734_3933 | 392 |
| 662 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_420473_421672 | 392 |
| 663 | 3300048917 | Ga0496114_0015065 | Ga0496114_0015065_4793_5992 | 392 |
| 664 | 3300048918 | Ga0496115_0116987 | Ga0496115_0116987_461_1660 | 392 |
| 665 | 3300048920 | Ga0496117_0049378 | Ga0496117_0049378_1211_2428 | 392 |
| 666 | 3300048921 | Ga0496118_0042557 | Ga0496118_0042557_1211_2428 | 392 |
| 667 | 3300048925 | Ga0496122_0001921 | Ga0496122_0001921_25388_26605 | 392 |
| 668 | 3300048925 | Ga0496122_0003416 | Ga0496122_0003416_11228_12448 | 392 |
| 669 | 3300048926 | Ga0496123_0000634 | Ga0496123_0000634_46310_47530 | 392 |
| 670 | 3300048927 | Ga0496124_0002403 | Ga0496124_0002403_11328_12548 | 392 |
| 671 | 3300048928 | Ga0496125_0015561 | Ga0496125_0015561_1346_2566 | 392 |
| 672 | 3300048929 | Ga0496126_0017351 | Ga0496126_0017351_3816_5042 | 392 |
| 673 | 3300049568 | Ga0501031_0000074 | Ga0501031_0000074_28015_29208 | 392 |
| 674 | 3300049568 | Ga0501031_0012677 | Ga0501031_0012677_2391_3569 | 392 |
| 675 | 3300049569 | Ga0501032_0002979 | Ga0501032_0002979_4029_5222 | 392 |
| 676 | 3300049570 | Ga0501033_0000637 | Ga0501033_0000637_2963_4156 | 392 |
| 677 | 3300049570 | Ga0501033_0006706 | Ga0501033_0006706_3308_4486 | 392 |
| 678 | 3300049571 | Ga0501034_0000877 | Ga0501034_0000877_23317_24510 | 392 |
| 679 | 3300049572 | Ga0501036_0013355 | Ga0501036_0013355_4028_5221 | 392 |
| 680 | 3300049572 | Ga0501036_0018516 | Ga0501036_0018516_4367_5545 | 392 |
| 681 | 3300049573 | Ga0501037_0000235 | Ga0501037_0000235_29384_30577 | 392 |
| 682 | 3300049573 | Ga0501037_0078229 | Ga0501037_0078229_1162_2340 | 392 |
| 683 | 3300049574 | Ga0501038_0000196 | Ga0501038_0000196_29770_30963 | 392 |
| 684 | 3300049574 | Ga0501038_0003100 | Ga0501038_0003100_9356_10534 | 392 |
| 685 | 3300049575 | Ga0501039_0000124 | Ga0501039_0000124_23792_24985 | 392 |
| 686 | 3300049575 | Ga0501039_0006099 | Ga0501039_0006099_1174_2352 | 392 |
| 687 | 3300049576 | Ga0501040_0009495 | Ga0501040_0009495_2924_4102 | 392 |
| 688 | 3300049578 | Ga0501042_0115557 | Ga0501042_0115557_707_1900 | 392 |
| 689 | 3300049580 | Ga0501046_0000844 | Ga0501046_0000844_21843_23036 | 392 |
| 690 | 3300049581 | Ga0501047_0000378 | Ga0501047_0000378_29196_30389 | 392 |
| 691 | 3300049582 | Ga0501048_0000096 | Ga0501048_0000096_17608_18801 | 392 |
| 692 | 3300049582 | Ga0501048_0045254 | Ga0501048_0045254_1941_3119 | 392 |
| 693 | 3300049583 | Ga0501067_0008008 | Ga0501067_0008008_3222_4415 | 392 |
| 694 | 3300049585 | Ga0501069_0000680 | Ga0501069_0000680_9782_10975 | 392 |
| 695 | 3300049586 | Ga0501070_0000216 | Ga0501070_0000216_24374_25567 | 392 |
| 696 | 3300049589 | Ga0501073_0005497 | Ga0501073_0005497_235_1428 | 392 |
| 697 | 3300049590 | Ga0501074_0005172 | Ga0501074_0005172_5994_7187 | 392 |
| 698 | 3300049741 | Ga0501079_0017665 | Ga0501079_0017665_2111_3289 | 392 |
| 699 | 3300049742 | Ga0501080_0000177 | Ga0501080_0000177_28579_29772 | 392 |
| 700 | 3300049742 | Ga0501080_0026855 | Ga0501080_0026855_1901_3079 | 392 |
| 701 | 3300049743 | Ga0501081_0031784 | Ga0501081_0031784_2271_3449 | 392 |
| 702 | 3300049744 | Ga0501083_0005982 | Ga0501083_0005982_4009_5202 | 392 |
| 703 | 3300049822 | Ga0501035_0000648 | Ga0501035_0000648_9546_10739 | 392 |
| 704 | 3300049822 | Ga0501035_0210176 | Ga0501035_0210176_159_1337 | 392 |
| 705 | 3300049823 | Ga0501044_0000585 | Ga0501044_0000585_26812_28005 | 392 |
| 706 | 3300049823 | Ga0501044_0336223 | Ga0501044_0336223_23_1201 | 392 |
| 707 | 3300049824 | Ga0501045_0025750 | Ga0501045_0025750_2069_3247 | 392 |
| 708 | 3300049824 | Ga0501045_0045512 | Ga0501045_0045512_722_1921 | 392 |
| 709 | 3300049824 | Ga0501045_0107332 | Ga0501045_0107332_803_1996 | 392 |
| 710 | 3300050511 | nmdc:mga08y16_316687_c1 | nmdc:mga08y16_316687_c1_68_1267 | 392 |
| 711 | 3300050515 | nmdc:mga0a205_4753_c1 | nmdc:mga0a205_4753_c1_7946_9145 | 392 |
| 712 | 3300053117 | Ga0500593_000149 | Ga0500593_000149_16248_17453 | 392 |
| 713 | 3300053134 | Ga0500658_0000115 | Ga0500658_0000115_10853_12052 | 392 |
| 714 | 3300054114 | Ga0501084_0001653 | Ga0501084_0001653_12689_13882 | 392 |
| 715 | 3300054114 | Ga0501084_0005383 | Ga0501084_0005383_7607_8785 | 392 |
| 716 | 3300060353 | Ga0501082_0231928 | Ga0501082_0231928_398_1576 | 392 |
| 717 | 3300061719 | Ga0466962_0006923 | Ga0466962_0006923_2732_3910 | 392 |
| 718 | 3300061719 | Ga0466962_0029238 | Ga0466962_0029238_470_1669 | 392 |
| 719 | 3300061719 | Ga0466962_0032090 | Ga0466962_0032090_905_2104 | 392 |
| 720 | 3300061734 | Ga0530510_0045537 | Ga0530510_0045537_157_1335 | 392 |
| 721 | iso_pu_bacteria | 2643221615 | 2644089627 | 392 |
| 722 | iso_pu_bacteria | 2643221657 | 2644319472 | 392 |
| 723 | iso_pu_bacteria | 2738541272 | 2738697340 | 392 |
| 724 | iso_pu_bacteria | 2738543027 | 2739326767 | 392 |
| 725 | iso_pu_bacteria | 2739367654 | 2739606042 | 392 |
| 726 | iso_pu_bacteria | 2758568522 | 2760307131 | 392 |
| 727 | iso_pu_bacteria | 2758568621 | 2760624405 | 392 |
| 728 | iso_pu_bacteria | 2808606365 | 2808872606 | 392 |
| 729 | iso_pu_bacteria | 2808606394 | 2809029274 | 392 |
| 730 | iso_pu_bacteria | 2811994880 | 2812364941 | 392 |
| 731 | iso_pu_bacteria | 2835188231 | 2835188614 | 392 |
| 732 | iso_pu_bacteria | 2848551377 | 2848552824 | 392 |
| 733 | iso_pu_bacteria | 2883821847 | 2883824524 | 392 |
| 734 | iso_pu_bacteria | 2896429255 | 2896430981 | 392 |
| 735 | iso_pu_bacteria | 8056579771 | 8056583740 | 392 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xza-assembly1.cif.gz_A | crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp | 0.8824 | 2 | 389 |
| 3pfk-assembly1.cif.gz_A | phosphofructokinase. structure and control | 0.8799 | 2 | 388 |
| 4i7e-assembly1.cif.gz_D | crystal structure of the bacillus stearothermophilus phosphofructokinase mutant d12a in complex with pep | 0.8766 | 2 | 389 |
| 4i4i-assembly1.cif.gz_D | crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep | 0.8644 | 2 | 389 |
| 5xza-assembly1.cif.gz_A | crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp | 0.8619 | 2 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM8_1_303_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8946 | 2 | 369 | 3.40.50.450 |
| 4wl0D03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8825 | 2 | 157 | 3.40.50.450 |
| 2f48B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8821 | 2 | 150 | 3.40.50.450 |
| 3f5mA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.873 | 2 | 148 | 3.40.50.450 |
| af_Q2FXM8_1_303_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8697 | 2 | 369 | 3.40.50.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S2JYI8-F1-model_v4 | Phosphofructokinase domain-containing protein | 0.9905 | 2 | 117 |
GO:0003872
GO:0046872 |
| AF-A0A382YSG6-F1-model_v4 | Phosphofructokinase domain-containing protein | 0.9851 | 2 | 120 |
GO:0003872
GO:0046872 |
| AF-A0A7S1AYN6-F1-model_v4 | Phosphofructokinase domain-containing protein | 0.9768 | 2 | 139 |
GO:0003872
GO:0005829 GO:0009749 GO:0046872 |
| AF-A0A2E2BIC8-F1-model_v4 | deleted | 0.9727 | 1 | 106 |
|
| AF-A0A850CZ18-F1-model_v4 | deleted | 0.9719 | 1 | 92 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar