F478186

General Info

Members Datasets Scaffolds Average Seq Length
735 261 720 396

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100154443|Ga0068862_1001544431
Length 440
Sequence MMQVFRALIAVILWQRMSAFPLGNSEWIHLAETVVSWQSKRMPVTTVAMLTAGGLAPCLSAAVGGLIGHYTQVAPDVRIIAYLNGYAGLLVGKSVEVTTEVRAAAGRLHAFGGSPIGNSRVRLTNVDDCLRRGLVQPGQDPLQMAAEQLRRDGVDVLHTIGGDDTNTTAADLAAYLSSHGYRLTVVGLPKTIDNDVVPIRQTLGAWSAAEQGALYARNIIAEHSSNPRMLIVHEVMGRNCGWLTAATALAHHQWVKDAQFAEWLENSAAEWDVHGVYVPERPINIAEEAKRLRKGMERHSNVNLFISEGAGAQEIVVAMEAAGEQVPRDPFGHVQLDKVNPGEWFAKQFAAALGAEKVLVQKSGYFARSAPANEADLALIRICTTYAVDAALRGESGVVGQDEERGDKLRVIEFERIAGGKSFDTSVSWFTDLLSDIGQV

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
4 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
5 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
6 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
7 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
8 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
9 2808606394 Promicromonospora sp. C35 Isolate Unclassified
10 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
11 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
12 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
13 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
14 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0.41
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 3.81
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000759 3300001904 Bacteria 5900
2 JGI24741J21665_1002347 3300001915 Bacteria 4957
3 JGI24740J21852_10003099 3300001979 Bacteria 7335
4 JGI24740J21852_10010512 3300001979 Bacteria 3558
5 JGI24740J21852_10018147 3300001979 Bacteria 2503
6 JGI24739J22299_10005409 3300001989 Bacteria 4853
7 JGI24737J22298_10000746 3300001990 Bacteria 11487
8 JGI24737J22298_10000786 3300001990 Bacteria 11230
9 JGI24737J22298_10003275 3300001990 Bacteria 5744
10 JGI24737J22298_10007606 3300001990 Bacteria 3651
11 JGI24737J22298_10028748 3300001990 Bacteria 1746
12 JGI24735J21928_10006139 3300002067 Bacteria 3966
13 JGI24735J21928_10007844 3300002067 Bacteria 3469
14 JGI24735J21928_10021176 3300002067 Bacteria 1987
15 JGI24745J21846_1001492 3300002073 Bacteria 2276
16 JGI24738J21930_10000194 3300002075 Bacteria 16008
17 JGI24738J21930_10005800 3300002075 Bacteria 2934
18 JGI24738J21930_10005848 3300002075 Bacteria 2923
19 Ga0070658_10000584 3300005327 Bacteria 31661
20 Ga0070658_10031162 3300005327 Bacteria 4281
21 Ga0070658_10033650 3300005327 Bacteria 4124
22 Ga0070658_10036735 3300005327 Bacteria 3948
23 Ga0070658_10182228 3300005327 Bacteria 1767
24 Ga0070676_10007325 3300005328 Bacteria 5920
25 Ga0070683_100013630 3300005329 Bacteria 7096
26 Ga0070683_100014137 3300005329 Bacteria 6972
27 Ga0070683_100032882 3300005329 Bacteria 4727
28 Ga0070683_100064747 3300005329 Bacteria 3403
29 Ga0070683_100081414 3300005329 Bacteria 3031
30 Ga0070690_100124468 3300005330 Bacteria 1734
31 Ga0070670_100021499 3300005331 Bacteria 5550
32 Ga0070670_100101434 3300005331 Bacteria 2478
33 Ga0068869_100006785 3300005334 Bacteria 7277
34 Ga0068869_100058106 3300005334 Bacteria 2827
35 Ga0068869_100256309 3300005334 Bacteria 1399
36 Ga0070666_10000216 3300005335 Bacteria 39574
37 Ga0070666_10006945 3300005335 Bacteria 6976
38 Ga0070666_10009580 3300005335 Bacteria 6044
39 Ga0070666_10031092 3300005335 Bacteria 3523
40 Ga0070680_100000734 3300005336 Bacteria 22858
41 Ga0070680_100006132 3300005336 Bacteria 9113
42 Ga0070680_100008040 3300005336 Bacteria 8055
43 Ga0070680_100017540 3300005336 Bacteria 5645
44 Ga0068868_100023459 3300005338 Bacteria 4670
45 Ga0068868_100036608 3300005338 Bacteria 3800
46 Ga0068868_100171643 3300005338 Bacteria 1795
47 Ga0070660_100000147 3300005339 Bacteria 45250
48 Ga0070660_100002954 3300005339 Bacteria 11693
49 Ga0070660_100016712 3300005339 Bacteria 5333
50 Ga0070660_100050525 3300005339 Bacteria 3200
51 Ga0070660_100089849 3300005339 Bacteria 2421
52 Ga0070660_100096062 3300005339 Bacteria 2343
53 Ga0070660_100110975 3300005339 Bacteria 2181
54 Ga0070691_10048210 3300005341 Bacteria 2027
55 Ga0070687_100058189 3300005343 Bacteria 2030
56 Ga0070661_100000213 3300005344 Bacteria 48218
57 Ga0070661_100028273 3300005344 Bacteria 4043
58 Ga0070661_100040241 3300005344 Bacteria 3409
59 Ga0070661_100046328 3300005344 Bacteria 3181
60 Ga0070669_100000629 3300005353 Bacteria 26123
61 Ga0070669_100044878 3300005353 Bacteria 3220
62 Ga0070675_100016949 3300005354 Bacteria 5787
63 Ga0070675_100089116 3300005354 Bacteria 2583
64 Ga0070671_100005290 3300005355 Bacteria 10297
65 Ga0070671_100008660 3300005355 Bacteria 8163
66 Ga0070671_100024818 3300005355 Bacteria 4912
67 Ga0070671_100068476 3300005355 Bacteria 2960
68 Ga0070671_100272166 3300005355 Bacteria 1440
69 Ga0070674_100024613 3300005356 Bacteria 3910
70 Ga0070674_100028858 3300005356 Bacteria 3647
71 Ga0070673_100005945 3300005364 Bacteria 7888
72 Ga0070673_100005956 3300005364 Bacteria 7881
73 Ga0070673_100016917 3300005364 Bacteria 5171
74 Ga0070673_100038146 3300005364 Bacteria 3667
75 Ga0070673_100044581 3300005364 Bacteria 3435
76 Ga0070673_100114877 3300005364 Bacteria 2238
77 Ga0070659_100000123 3300005366 Bacteria 58613
78 Ga0070659_100001223 3300005366 Bacteria 18648
79 Ga0070659_100004009 3300005366 Bacteria 10479
80 Ga0070659_100011730 3300005366 Bacteria 6487
81 Ga0070659_100016409 3300005366 Bacteria 5560
82 Ga0070659_100028316 3300005366 Bacteria 4325
83 Ga0070659_100143945 3300005366 Bacteria 1941
84 Ga0070667_100010025 3300005367 Bacteria 7850
85 Ga0070667_100021756 3300005367 Bacteria 5322
86 Ga0070667_100071000 3300005367 Bacteria 2965
87 Ga0070667_100108779 3300005367 Bacteria 2402
88 Ga0070714_100017357 3300005435 Bacteria 5829
89 Ga0070714_100017962 3300005435 Bacteria 5736
90 Ga0070714_100022690 3300005435 Bacteria 5148
91 Ga0070714_100042637 3300005435 Bacteria 3834
92 Ga0070713_100052229 3300005436 Bacteria 3383
93 Ga0070713_100052663 3300005436 Bacteria 3370
94 Ga0070713_100065431 3300005436 Bacteria 3054
95 Ga0070713_100086400 3300005436 Bacteria 2689
96 Ga0070694_100038141 3300005444 Bacteria 3191
97 Ga0070663_100001735 3300005455 Bacteria 12109
98 Ga0070663_100010076 3300005455 Bacteria 5878
99 Ga0070663_100017691 3300005455 Bacteria 4657
100 Ga0070678_100048390 3300005456 Bacteria 3061
101 Ga0070678_100057965 3300005456 Bacteria 2840
102 Ga0070678_100069917 3300005456 Bacteria 2622
103 Ga0070662_100000060 3300005457 Bacteria 59430
104 Ga0070662_100010709 3300005457 Bacteria 6036
105 Ga0070662_100012577 3300005457 Bacteria 5614
106 Ga0070662_100039968 3300005457 Bacteria 3338
107 Ga0070662_100077659 3300005457 Bacteria 2464
108 Ga0070681_10035173 3300005458 Bacteria 5032
109 Ga0070681_10231893 3300005458 Bacteria 1760
110 Ga0068867_100004321 3300005459 Bacteria 10002
111 Ga0068867_100042149 3300005459 Bacteria 3337
112 Ga0068867_100042601 3300005459 Bacteria 3321
113 Ga0068867_100045663 3300005459 Bacteria 3214
114 Ga0070684_100015937 3300005535 Bacteria 6137
115 Ga0070684_100016652 3300005535 Bacteria 6013
116 Ga0070684_100093635 3300005535 Bacteria 2675
117 Ga0068853_100000277 3300005539 Bacteria 36116
118 Ga0068853_100003199 3300005539 Bacteria 12510
119 Ga0068853_100028498 3300005539 Bacteria 4698
120 Ga0068853_100165335 3300005539 Bacteria 1999
121 Ga0070672_100003277 3300005543 Bacteria 10478
122 Ga0070672_100018309 3300005543 Bacteria 5060
123 Ga0070665_100003766 3300005548 Bacteria 16049
124 Ga0070665_100016998 3300005548 Bacteria 7294
125 Ga0070665_100024266 3300005548 Bacteria 6106
126 Ga0070665_100058493 3300005548 Bacteria 3864
127 Ga0068855_100000877 3300005563 Bacteria 37389
128 Ga0068855_100006911 3300005563 Bacteria 13762
129 Ga0068855_100019332 3300005563 Bacteria 8185
130 Ga0068855_100047947 3300005563 Bacteria 5044
131 Ga0070664_100000158 3300005564 Bacteria 46496
132 Ga0070664_100027076 3300005564 Bacteria 4763
133 Ga0068857_100001240 3300005577 Bacteria 19917
134 Ga0068857_100020601 3300005577 Bacteria 5803
135 Ga0068857_100041550 3300005577 Bacteria 4077
136 Ga0068857_100041928 3300005577 Bacteria 4058
137 Ga0068854_100021242 3300005578 Bacteria 4403
138 Ga0068854_100029865 3300005578 Bacteria 3777
139 Ga0068854_100030803 3300005578 Bacteria 3724
140 Ga0068854_100128662 3300005578 Bacteria 1931
141 Ga0068856_100000974 3300005614 Bacteria 30540
142 Ga0068856_100011435 3300005614 Bacteria 8610
143 Ga0068856_100200037 3300005614 Bacteria 2012
144 Ga0068856_100216315 3300005614 Bacteria 1931
145 Ga0068852_100001298 3300005616 Bacteria 16705
146 Ga0068852_100001354 3300005616 Bacteria 16438
147 Ga0068852_100006359 3300005616 Bacteria 8530
148 Ga0068852_100009317 3300005616 Bacteria 7284
149 Ga0068852_100011068 3300005616 Bacteria 6772
150 Ga0068852_100019422 3300005616 Bacteria 5379
151 Ga0068852_100067340 3300005616 Bacteria 3130
152 Ga0068859_100002593 3300005617 Bacteria 18395
153 Ga0068864_100012308 3300005618 Bacteria 7071
154 Ga0068864_100184371 3300005618 Bacteria 1910
155 Ga0068866_10040292 3300005718 Bacteria 2312
156 Ga0068866_10044137 3300005718 Bacteria 2229
157 Ga0068866_10093358 3300005718 Bacteria 1644
158 Ga0068851_10004197 3300005834 Bacteria 6492
159 Ga0068870_10080568 3300005840 Bacteria 1799
160 Ga0068863_100033211 3300005841 Bacteria 4916
161 Ga0068863_100054970 3300005841 Bacteria 3771
162 Ga0068863_100077472 3300005841 Bacteria 3146
163 Ga0068863_100254103 3300005841 Bacteria 1698
164 Ga0068858_100001220 3300005842 Bacteria 26659
165 Ga0068858_100001846 3300005842 Bacteria 21586
166 Ga0068858_100011265 3300005842 Bacteria 8450
167 Ga0068860_100036535 3300005843 Bacteria 4706
168 Ga0068860_100038335 3300005843 Bacteria 4584
169 Ga0068860_100058888 3300005843 Bacteria 3652
170 Ga0068862_100011722 3300005844 Bacteria 7235
171 Ga0068862_100154443 3300005844 Bacteria 2045
172 Ga0081540_1008084 3300005983 Bacteria 7389
173 Ga0070717_10007064 3300006028 Bacteria 8317
174 Ga0070712_100091074 3300006175 Bacteria 2234
175 Ga0097621_100005115 3300006237 Bacteria 9214
176 Ga0097621_100100581 3300006237 Bacteria 2432
177 Ga0068871_100007484 3300006358 Bacteria 7811
178 Ga0068871_100082726 3300006358 Bacteria 2662
179 Ga0075433_10062719 3300006852 Bacteria 3255
180 Ga0068865_100009283 3300006881 Bacteria 6094
181 Ga0068865_100016775 3300006881 Bacteria 4694
182 Ga0097620_100002593 3300006931 Bacteria 18395
183 Ga0097620_100039763 3300006931 Bacteria 4719
184 Ga0105240_10010940 3300009093 Bacteria 12711
185 Ga0105240_10067029 3300009093 Bacteria 4451
186 Ga0105240_10145713 3300009093 Bacteria 2826
187 Ga0105240_10220990 3300009093 Bacteria 2207
188 Ga0111539_10215607 3300009094 Bacteria 2236
189 Ga0105245_10000345 3300009098 Bacteria 43597
190 Ga0105245_10007397 3300009098 Bacteria 9617
191 Ga0105245_10018295 3300009098 Bacteria 6127
192 Ga0105245_10064090 3300009098 Bacteria 3321
193 Ga0105245_10078381 3300009098 Bacteria 3015
194 Ga0105245_10289122 3300009098 Bacteria 1605
195 Ga0105243_10089923 3300009148 Bacteria 2526
196 Ga0105241_10025393 3300009174 Bacteria 4402
197 Ga0105242_10283216 3300009176 Bacteria 1506
198 Ga0105248_10000278 3300009177 Bacteria 60305
199 Ga0105248_10000575 3300009177 Bacteria 41822
200 Ga0105248_10003523 3300009177 Bacteria 17362
201 Ga0105248_10010229 3300009177 Bacteria 10329
202 Ga0105248_10019015 3300009177 Bacteria 7596
203 Ga0105248_10061483 3300009177 Bacteria 4217
204 Ga0105248_10102833 3300009177 Bacteria 3220
205 Ga0105248_10107994 3300009177 Bacteria 3138
206 Ga0105237_10043265 3300009545 Bacteria 4538
207 Ga0105238_10030680 3300009551 Bacteria 5471
208 Ga0105238_10054334 3300009551 Bacteria 4023
209 Ga0105238_10414962 3300009551 Bacteria 1340
210 Ga0105249_10171388 3300009553 Bacteria 2105
211 Ga0105239_10086897 3300010375 Bacteria 3447
212 Ga0105239_10165431 3300010375 Bacteria 2473
213 Ga0105246_10017944 3300011119 Bacteria 4505
214 Ga0157373_10008459 3300013100 Bacteria 7640
215 Ga0157373_10023675 3300013100 Bacteria 4451
216 Ga0157373_10027797 3300013100 Bacteria 4081
217 Ga0157373_10035835 3300013100 Bacteria 3561
218 Ga0157373_10047395 3300013100 Bacteria 3065
219 Ga0157371_10002505 3300013102 Bacteria 17454
220 Ga0157371_10010808 3300013102 Bacteria 7084
221 Ga0157371_10022940 3300013102 Bacteria 4565
222 Ga0157371_10043368 3300013102 Bacteria 3204
223 Ga0157371_10056697 3300013102 Bacteria 2779
224 Ga0157371_10192946 3300013102 Bacteria 1459
225 Ga0157371_10280185 3300013102 Bacteria 1204
226 Ga0157371_10280478 3300013102 Bacteria 1204
227 Ga0157370_10014807 3300013104 Bacteria 7959
228 Ga0157370_10053392 3300013104 Bacteria 3854
229 Ga0157370_10053862 3300013104 Bacteria 3835
230 Ga0157370_10057396 3300013104 Bacteria 3701
231 Ga0157370_10085415 3300013104 Bacteria 2965
232 Ga0157370_10096494 3300013104 Bacteria 2774
233 Ga0157370_10250709 3300013104 Bacteria 1637
234 Ga0157369_10000207 3300013105 Bacteria 81678
235 Ga0157369_10006939 3300013105 Bacteria 13071
236 Ga0157369_10021548 3300013105 Bacteria 7208
237 Ga0157369_10022923 3300013105 Bacteria 6962
238 Ga0157369_10046359 3300013105 Bacteria 4724
239 Ga0157369_10070536 3300013105 Bacteria 3754
240 Ga0157369_10074597 3300013105 Bacteria 3638
241 Ga0157369_10103474 3300013105 Bacteria 3033
242 Ga0157369_10140894 3300013105 Bacteria 2552
243 Ga0157369_10357506 3300013105 Bacteria 1516
244 Ga0157374_10004605 3300013296 Bacteria 11567
245 Ga0157374_10038900 3300013296 Bacteria 4374
246 Ga0157374_10165019 3300013296 Bacteria 2158
247 Ga0157378_10006791 3300013297 Bacteria 9988
248 Ga0157378_10079513 3300013297 Bacteria 2960
249 Ga0163162_10011540 3300013306 Bacteria 8618
250 Ga0163162_10036178 3300013306 Bacteria 4919
251 Ga0157372_10069404 3300013307 Bacteria 3963
252 Ga0157375_10028971 3300013308 Bacteria 5201
253 Ga0157375_10053602 3300013308 Bacteria 3969
254 Ga0157375_10056718 3300013308 Bacteria 3869
255 Ga0157375_10062099 3300013308 Bacteria 3712
256 Ga0157375_10268370 3300013308 Bacteria 1868
257 Ga0163163_10000843 3300014325 Bacteria 26070
258 Ga0163163_10274079 3300014325 Bacteria 1738
259 Ga0182008_10060270 3300014497 Bacteria 1871
260 Ga0157377_10055272 3300014745 Bacteria 2250
261 Ga0157377_10097495 3300014745 Bacteria 1746
262 Ga0157379_10020897 3300014968 Bacteria 5793
263 Ga0157379_10027414 3300014968 Bacteria 5072
264 Ga0157376_10008028 3300014969 Bacteria 7580
265 Ga0157376_10263474 3300014969 Bacteria 1616
266 Ga0206354_10354046 3300020081 Bacteria 1540
267 Ga0206353_10254860 3300020082 Bacteria 2115
268 Ga0206353_10519444 3300020082 Bacteria 4163
269 Ga0213875_10001660 3300021388 Bacteria 14018
270 Ga0207697_10006110 3300025315 Bacteria 5501
271 Ga0207697_10018985 3300025315 Bacteria 2817
272 Ga0207682_10006585 3300025893 Bacteria 4673
273 Ga0207682_10021911 3300025893 Bacteria 2515
274 Ga0207688_10007449 3300025901 Bacteria 5952
275 Ga0207688_10083943 3300025901 Bacteria 1823
276 Ga0207688_10084827 3300025901 Bacteria 1814
277 Ga0207680_10007504 3300025903 Bacteria 5324
278 Ga0207680_10014223 3300025903 Bacteria 4112
279 Ga0207680_10099023 3300025903 Bacteria 1870
280 Ga0207647_10000181 3300025904 Bacteria 50570
281 Ga0207647_10001259 3300025904 Bacteria 19477
282 Ga0207647_10001551 3300025904 Bacteria 17676
283 Ga0207647_10001581 3300025904 Bacteria 17475
284 Ga0207647_10005987 3300025904 Bacteria 8859
285 Ga0207647_10022146 3300025904 Bacteria 4226
286 Ga0207647_10025792 3300025904 Bacteria 3855
287 Ga0207647_10069608 3300025904 Bacteria 2127
288 Ga0207643_10046516 3300025908 Bacteria 2453
289 Ga0207643_10050233 3300025908 Bacteria 2364
290 Ga0207705_10000030 3300025909 Bacteria 239341
291 Ga0207705_10000295 3300025909 Bacteria 46532
292 Ga0207705_10004858 3300025909 Bacteria 10091
293 Ga0207705_10006350 3300025909 Bacteria 8769
294 Ga0207705_10009708 3300025909 Bacteria 6999
295 Ga0207705_10036102 3300025909 Bacteria 3537
296 Ga0207705_10068688 3300025909 Bacteria 2566
297 Ga0207705_10105896 3300025909 Bacteria 2073
298 Ga0207705_10175758 3300025909 Bacteria 1614
299 Ga0207654_10050031 3300025911 Bacteria 2400
300 Ga0207707_10015159 3300025912 Bacteria 6710
301 Ga0207707_10032046 3300025912 Bacteria 4601
302 Ga0207695_10003659 3300025913 Bacteria 21455
303 Ga0207695_10013923 3300025913 Bacteria 9561
304 Ga0207695_10027383 3300025913 Bacteria 6348
305 Ga0207695_10039298 3300025913 Bacteria 5087
306 Ga0207695_10150783 3300025913 Bacteria 2264
307 Ga0207671_10041044 3300025914 Bacteria 3424
308 Ga0207693_10086060 3300025915 Bacteria 2462
309 Ga0207660_10000750 3300025917 Bacteria 21593
310 Ga0207660_10004788 3300025917 Bacteria 8804
311 Ga0207660_10005631 3300025917 Bacteria 8134
312 Ga0207660_10031824 3300025917 Bacteria 3637
313 Ga0207660_10078366 3300025917 Bacteria 2421
314 Ga0207662_10066830 3300025918 Bacteria 2167
315 Ga0207657_10000334 3300025919 Bacteria 49890
316 Ga0207657_10003211 3300025919 Bacteria 17498
317 Ga0207657_10008718 3300025919 Bacteria 10265
318 Ga0207657_10019817 3300025919 Bacteria 6376
319 Ga0207657_10019896 3300025919 Bacteria 6360
320 Ga0207657_10023780 3300025919 Bacteria 5697
321 Ga0207657_10024553 3300025919 Bacteria 5575
322 Ga0207657_10024743 3300025919 Bacteria 5551
323 Ga0207657_10036764 3300025919 Bacteria 4380
324 Ga0207649_10000211 3300025920 Bacteria 48545
325 Ga0207649_10001913 3300025920 Bacteria 11889
326 Ga0207649_10023326 3300025920 Bacteria 3582
327 Ga0207649_10026735 3300025920 Bacteria 3378
328 Ga0207649_10033231 3300025920 Bacteria 3080
329 Ga0207649_10076045 3300025920 Bacteria 2159
330 Ga0207649_10081357 3300025920 Bacteria 2097
331 Ga0207652_10010359 3300025921 Bacteria 7507
332 Ga0207652_10172033 3300025921 Bacteria 1944
333 Ga0207681_10001272 3300025923 Bacteria 16283
334 Ga0207694_10091034 3300025924 Bacteria 2407
335 Ga0207694_10093165 3300025924 Bacteria 2379
336 Ga0207694_10153730 3300025924 Bacteria 1855
337 Ga0207694_10172900 3300025924 Bacteria 1750
338 Ga0207650_10010807 3300025925 Bacteria 6270
339 Ga0207650_10135121 3300025925 Bacteria 1934
340 Ga0207659_10092832 3300025926 Bacteria 2258
341 Ga0207659_10220392 3300025926 Bacteria 1525
342 Ga0207687_10020631 3300025927 Bacteria 4373
343 Ga0207687_10025261 3300025927 Bacteria 3974
344 Ga0207687_10124808 3300025927 Bacteria 1931
345 Ga0207700_10052290 3300025928 Bacteria 3054
346 Ga0207664_10066419 3300025929 Bacteria 2891
347 Ga0207644_10000244 3300025931 Bacteria 37269
348 Ga0207644_10019858 3300025931 Bacteria 4562
349 Ga0207644_10134429 3300025931 Bacteria 1897
350 Ga0207690_10000182 3300025932 Bacteria 48302
351 Ga0207690_10001681 3300025932 Bacteria 13631
352 Ga0207690_10004770 3300025932 Bacteria 7997
353 Ga0207690_10016048 3300025932 Bacteria 4553
354 Ga0207690_10016885 3300025932 Bacteria 4449
355 Ga0207690_10097353 3300025932 Bacteria 2093
356 Ga0207706_10001111 3300025933 Bacteria 27391
357 Ga0207706_10001196 3300025933 Bacteria 26205
358 Ga0207706_10007420 3300025933 Bacteria 10138
359 Ga0207706_10010496 3300025933 Bacteria 8465
360 Ga0207706_10020691 3300025933 Bacteria 5912
361 Ga0207706_10021761 3300025933 Bacteria 5755
362 Ga0207706_10029223 3300025933 Bacteria 4921
363 Ga0207706_10110292 3300025933 Bacteria 2421
364 Ga0207706_10133673 3300025933 Bacteria 2182
365 Ga0207706_10208005 3300025933 Bacteria 1715
366 Ga0207669_10009631 3300025937 Bacteria 4616
367 Ga0207669_10235228 3300025937 Bacteria 1354
368 Ga0207704_10020224 3300025938 Bacteria 3516
369 Ga0207704_10028082 3300025938 Bacteria 3116
370 Ga0207665_10019185 3300025939 Bacteria 4493
371 Ga0207665_10066567 3300025939 Bacteria 2452
372 Ga0207691_10001971 3300025940 Bacteria 20065
373 Ga0207691_10004474 3300025940 Bacteria 13539
374 Ga0207691_10006883 3300025940 Bacteria 10968
375 Ga0207691_10010219 3300025940 Bacteria 9003
376 Ga0207691_10043731 3300025940 Bacteria 4126
377 Ga0207691_10054083 3300025940 Bacteria 3663
378 Ga0207691_10058961 3300025940 Bacteria 3491
379 Ga0207711_10000496 3300025941 Bacteria 40666
380 Ga0207711_10003249 3300025941 Bacteria 14164
381 Ga0207711_10003482 3300025941 Bacteria 13619
382 Ga0207711_10014623 3300025941 Bacteria 6522
383 Ga0207711_10017473 3300025941 Bacteria 5959
384 Ga0207711_10017952 3300025941 Bacteria 5879
385 Ga0207711_10168801 3300025941 Bacteria 1984
386 Ga0207711_10229454 3300025941 Bacteria 1700
387 Ga0207689_10001430 3300025942 Bacteria 22793
388 Ga0207689_10037593 3300025942 Bacteria 4014
389 Ga0207689_10102929 3300025942 Bacteria 2346
390 Ga0207689_10211270 3300025942 Bacteria 1603
391 Ga0207661_10004896 3300025944 Bacteria 9381
392 Ga0207661_10006695 3300025944 Bacteria 8150
393 Ga0207661_10020069 3300025944 Bacteria 4991
394 Ga0207661_10052050 3300025944 Bacteria 3270
395 Ga0207679_10000293 3300025945 Bacteria 37744
396 Ga0207679_10004229 3300025945 Bacteria 8921
397 Ga0207679_10007447 3300025945 Bacteria 6943
398 Ga0207679_10014639 3300025945 Bacteria 5161
399 Ga0207679_10072925 3300025945 Bacteria 2595
400 Ga0207667_10001632 3300025949 Bacteria 28244
401 Ga0207667_10003164 3300025949 Bacteria 20362
402 Ga0207667_10009303 3300025949 Bacteria 11589
403 Ga0207667_10021295 3300025949 Bacteria 7185
404 Ga0207667_10052663 3300025949 Bacteria 4285
405 Ga0207667_10078318 3300025949 Bacteria 3426
406 Ga0207667_10280306 3300025949 Bacteria 1703
407 Ga0207667_10303208 3300025949 Bacteria 1632
408 Ga0207651_10002607 3300025960 Bacteria 8617
409 Ga0207651_10003074 3300025960 Bacteria 8104
410 Ga0207651_10017404 3300025960 Bacteria 4247
411 Ga0207651_10042328 3300025960 Bacteria 3030
412 Ga0207651_10121421 3300025960 Bacteria 1982
413 Ga0207712_10004801 3300025961 Bacteria 8540
414 Ga0207668_10057300 3300025972 Bacteria 2717
415 Ga0207640_10003428 3300025981 Bacteria 8540
416 Ga0207640_10005127 3300025981 Bacteria 7125
417 Ga0207640_10016005 3300025981 Bacteria 4353
418 Ga0207640_10017230 3300025981 Bacteria 4222
419 Ga0207640_10109953 3300025981 Bacteria 1951
420 Ga0207640_10157337 3300025981 Bacteria 1677
421 Ga0207658_10005837 3300025986 Bacteria 8421
422 Ga0207658_10005856 3300025986 Bacteria 8407
423 Ga0207658_10017450 3300025986 Bacteria 4946
424 Ga0207658_10035255 3300025986 Bacteria 3582
425 Ga0207658_10092772 3300025986 Bacteria 2346
426 Ga0207677_10001914 3300026023 Bacteria 10997
427 Ga0207677_10002862 3300026023 Bacteria 9105
428 Ga0207677_10025226 3300026023 Bacteria 3705
429 Ga0207677_10033222 3300026023 Bacteria 3326
430 Ga0207703_10008253 3300026035 Bacteria 8227
431 Ga0207703_10009527 3300026035 Bacteria 7621
432 Ga0207703_10021916 3300026035 Bacteria 5003
433 Ga0207703_10064569 3300026035 Bacteria 3005
434 Ga0207639_10000154 3300026041 Bacteria 52098
435 Ga0207639_10126906 3300026041 Bacteria 2106
436 Ga0207639_10134323 3300026041 Bacteria 2052
437 Ga0207639_10172152 3300026041 Bacteria 1834
438 Ga0207678_10000989 3300026067 Bacteria 25886
439 Ga0207678_10004204 3300026067 Bacteria 12922
440 Ga0207678_10008382 3300026067 Bacteria 9119
441 Ga0207678_10024308 3300026067 Bacteria 5292
442 Ga0207678_10028452 3300026067 Bacteria 4879
443 Ga0207678_10032245 3300026067 Bacteria 4566
444 Ga0207678_10082277 3300026067 Bacteria 2755
445 Ga0207678_10091329 3300026067 Bacteria 2603
446 Ga0207678_10253160 3300026067 Bacteria 1508
447 Ga0207702_10000497 3300026078 Bacteria 44238
448 Ga0207702_10012814 3300026078 Bacteria 6975
449 Ga0207702_10014245 3300026078 Bacteria 6603
450 Ga0207702_10021180 3300026078 Bacteria 5380
451 Ga0207702_10161370 3300026078 Bacteria 2047
452 Ga0207641_10024132 3300026088 Bacteria 5012
453 Ga0207641_10043191 3300026088 Bacteria 3784
454 Ga0207641_10060781 3300026088 Bacteria 3221
455 Ga0207641_10135403 3300026088 Bacteria 2217
456 Ga0207641_10317630 3300026088 Bacteria 1476
457 Ga0207648_10000838 3300026089 Bacteria 34648
458 Ga0207648_10002771 3300026089 Bacteria 18597
459 Ga0207648_10005618 3300026089 Bacteria 12603
460 Ga0207648_10016546 3300026089 Bacteria 6736
461 Ga0207648_10027547 3300026089 Bacteria 5045
462 Ga0207676_10001828 3300026095 Bacteria 15589
463 Ga0207676_10253201 3300026095 Bacteria 1586
464 Ga0207674_10002837 3300026116 Bacteria 21549
465 Ga0207674_10006205 3300026116 Bacteria 14085
466 Ga0207674_10007245 3300026116 Bacteria 12935
467 Ga0207674_10012448 3300026116 Bacteria 9507
468 Ga0207674_10015575 3300026116 Bacteria 8350
469 Ga0207674_10020630 3300026116 Bacteria 7115
470 Ga0207674_10238491 3300026116 Bacteria 1765
471 Ga0207675_100078146 3300026118 Bacteria 3100
472 Ga0207683_10007726 3300026121 Bacteria 9210
473 Ga0207683_10039327 3300026121 Bacteria 4126
474 Ga0207683_10048875 3300026121 Bacteria 3701
475 Ga0207683_10284062 3300026121 Bacteria 1512
476 Ga0207698_10001214 3300026142 Bacteria 15048
477 Ga0207698_10001363 3300026142 Bacteria 14226
478 Ga0207698_10004239 3300026142 Bacteria 8724
479 Ga0207698_10004588 3300026142 Bacteria 8431
480 Ga0207698_10006440 3300026142 Bacteria 7331
481 Ga0207698_10020836 3300026142 Bacteria 4522
482 Ga0207698_10024126 3300026142 Bacteria 4263
483 Ga0207698_10117438 3300026142 Bacteria 2244
484 Ga0268266_10002631 3300028379 Bacteria 18965
485 Ga0268266_10007828 3300028379 Bacteria 9578
486 Ga0268266_10011861 3300028379 Bacteria 7551
487 Ga0268266_10023299 3300028379 Bacteria 5271
488 Ga0268266_10044312 3300028379 Bacteria 3803
489 Ga0268265_10038985 3300028380 Bacteria 3498
490 Ga0268264_10001404 3300028381 Bacteria 22509
491 Ga0268264_10015899 3300028381 Bacteria 6163
492 Ga0268264_10258882 3300028381 Bacteria 1620
493 Ga0314311_1220182 3300030733 Bacteria 4039
494 Ga0316179_1031902 3300030734 Bacteria 2785
495 Ga0307513_10102386 3300031456 Bacteria 2883
496 Ga0307514_10144997 3300031649 Bacteria 1606
497 Ga0307405_10002843 3300031731 Bacteria 7780
498 Ga0307413_10002762 3300031824 Bacteria 7224
499 Ga0307413_10007843 3300031824 Bacteria 4994
500 Ga0307410_10007955 3300031852 Bacteria 5845
501 Ga0307410_10010005 3300031852 Bacteria 5351
502 Ga0307410_10037231 3300031852 Bacteria 3175
503 Ga0307410_10070248 3300031852 Bacteria 2425
504 Ga0307407_10001660 3300031903 Bacteria 8234
505 Ga0307412_10056998 3300031911 Bacteria 2606
506 Ga0307409_100005087 3300031995 Bacteria 7501
507 Ga0307409_100015831 3300031995 Bacteria 4966
508 Ga0307409_100036419 3300031995 Bacteria 3616
509 Ga0307416_100027796 3300032002 Bacteria 4195
510 Ga0307416_100063293 3300032002 Bacteria 3029
511 Ga0307416_100080985 3300032002 Bacteria 2743
512 Ga0307416_100093410 3300032002 Bacteria 2591
513 Ga0307416_100210848 3300032002 Bacteria 1853
514 Ga0307414_10018114 3300032004 Bacteria 4325
515 Ga0307414_10127463 3300032004 Bacteria 1969
516 Ga0307411_10004993 3300032005 Bacteria 6451
517 Ga0373935_0009488 3300035692 Bacteria 5823
518 Ga0373935_0016542 3300035692 Bacteria 4462
519 Ga0373947_0004557 3300035725 Bacteria 8124
520 Ga0395899_0012460 3300037312 Bacteria 6515
521 Ga0395899_0016795 3300037312 Bacteria 5579
522 Ga0395899_0029232 3300037312 Bacteria 4145
523 Ga0395899_0057539 3300037312 Bacteria 2870
524 Ga0395899_0115100 3300037312 Bacteria 1930
525 Ga0395899_0116084 3300037312 Bacteria 1921
526 Ga0395899_0121756 3300037312 Bacteria 1868
527 Ga0395900_0003925 3300037418 Bacteria 15869
528 Ga0395900_0005369 3300037418 Bacteria 13430
529 Ga0395900_0005577 3300037418 Bacteria 13172
530 Ga0395900_0010077 3300037418 Bacteria 9666
531 Ga0395900_0042369 3300037418 Bacteria 4691
532 Ga0395900_0043799 3300037418 Bacteria 4613
533 Ga0395900_0046569 3300037418 Bacteria 4466
534 Ga0395900_0079761 3300037418 Bacteria 3364
535 Ga0395900_0106522 3300037418 Bacteria 2879
536 Ga0395900_0111863 3300037418 Bacteria 2804
537 Ga0395900_0143661 3300037418 Bacteria 2442
538 Ga0395900_0153630 3300037418 Bacteria 2351
539 Ga0395900_0287071 3300037418 Bacteria 1635
540 Ga0395900_0339712 3300037418 Bacteria 1477
541 Ga0395898_0008780 3300037466 Bacteria 10649
542 Ga0395898_0012167 3300037466 Bacteria 8902
543 Ga0395898_0026941 3300037466 Bacteria 5776
544 Ga0395898_0075074 3300037466 Bacteria 3265
545 Ga0395898_0083941 3300037466 Bacteria 3070
546 Ga0395898_0113227 3300037466 Bacteria 2600
547 Ga0395898_0126794 3300037466 Bacteria 2445
548 Ga0395898_0173903 3300037466 Bacteria 2058
549 Ga0395898_0316331 3300037466 Bacteria 1489
550 Ga0395898_0376715 3300037466 Bacteria 1353
551 Ga0395898_0451579 3300037466 Bacteria 1224
552 Ga0395905_0001141 3300037471 Bacteria 33234
553 Ga0395905_0004658 3300037471 Bacteria 14180
554 Ga0395905_0006676 3300037471 Bacteria 11564
555 Ga0395905_0007482 3300037471 Bacteria 10865
556 Ga0395905_0007657 3300037471 Bacteria 10718
557 Ga0395905_0011136 3300037471 Bacteria 8698
558 Ga0395905_0017826 3300037471 Bacteria 6746
559 Ga0395905_0033420 3300037471 Bacteria 4831
560 Ga0395905_0037823 3300037471 Bacteria 4528
561 Ga0395905_0045363 3300037471 Bacteria 4122
562 Ga0395905_0053977 3300037471 Bacteria 3761
563 Ga0395905_0067409 3300037471 Bacteria 3352
564 Ga0395905_0090401 3300037471 Bacteria 2870
565 Ga0395905_0092845 3300037471 Bacteria 2830
566 Ga0395905_0098512 3300037471 Bacteria 2745
567 Ga0395905_0116291 3300037471 Bacteria 2514
568 Ga0395905_0185180 3300037471 Bacteria 1954
569 Ga0395905_0191440 3300037471 Bacteria 1918
570 Ga0395905_0191716 3300037471 Bacteria 1917
571 Ga0395905_0213058 3300037471 Bacteria 1809
572 Ga0395905_0263036 3300037471 Bacteria 1610
573 Ga0436364_0269013 3300037853 Bacteria 16037
574 Ga0395901_0000041 3300038443 Bacteria 202314
575 Ga0395901_0004104 3300038443 Bacteria 14684
576 Ga0395901_0007396 3300038443 Bacteria 11079
577 Ga0395901_0007445 3300038443 Bacteria 11046
578 Ga0395901_0017386 3300038443 Bacteria 7341
579 Ga0395901_0023857 3300038443 Bacteria 6274
580 Ga0395901_0029478 3300038443 Bacteria 5651
581 Ga0395901_0035520 3300038443 Bacteria 5150
582 Ga0395901_0040317 3300038443 Bacteria 4836
583 Ga0395901_0048364 3300038443 Bacteria 4416
584 Ga0395901_0079818 3300038443 Bacteria 3416
585 Ga0395901_0133341 3300038443 Bacteria 2610
586 Ga0395901_0136651 3300038443 Bacteria 2576
587 Ga0395901_0147291 3300038443 Bacteria 2474
588 Ga0395901_0197500 3300038443 Bacteria 2109
589 Ga0395901_0241185 3300038443 Bacteria 1885
590 Ga0395901_0297875 3300038443 Bacteria 1672
591 Ga0395901_0301703 3300038443 Bacteria 1660
592 Ga0395901_0317415 3300038443 Bacteria 1612
593 Ga0395901_0401553 3300038443 Bacteria 1408
594 Ga0439445_0007961 3300042004 Bacteria 2472
595 Ga0439462_0002422 3300042015 Bacteria 4329
596 Ga0439458_0003050 3300042157 Bacteria 3993
597 Ga0466969_0019153 3300044656 Bacteria 3562
598 Ga0466972_0060624 3300044658 Bacteria 1815
599 Ga0466972_0085902 3300044658 Bacteria 1495
600 Ga0466965_0119087 3300044683 Bacteria 1362
601 Ga0466966_0000041 3300044684 Bacteria 97092
602 Ga0466966_0012337 3300044684 Bacteria 5662
603 Ga0466966_0015306 3300044684 Bacteria 5073
604 Ga0466966_0016074 3300044684 Bacteria 4948
605 Ga0466961_0007333 3300044693 Bacteria 7017
606 Ga0466961_0050312 3300044693 Bacteria 2661
607 Ga0466961_0065378 3300044693 Bacteria 2311
608 Ga0466961_0089372 3300044693 Bacteria 1945
609 Ga0466963_0003494 3300044694 Bacteria 9016
610 Ga0466963_0005728 3300044694 Bacteria 7306
611 Ga0466963_0108219 3300044694 Bacteria 1906
612 Ga0466963_0175422 3300044694 Bacteria 1495
613 Ga0466971_0003474 3300044719 Bacteria 6732
614 Ga0466971_0003766 3300044719 Bacteria 6492
615 Ga0466971_0087620 3300044719 Bacteria 1423
616 Ga0466970_0014280 3300044765 Bacteria 4074
617 Ga0466970_0034221 3300044765 Bacteria 2689
618 Ga0466957_0003087 3300044842 Bacteria 9067
619 Ga0466957_0004452 3300044842 Bacteria 7807
620 Ga0466959_0155917 3300045049 Bacteria 1607
621 Ga0466958_0005228 3300045836 Bacteria 6955
622 Ga0466958_0006088 3300045836 Bacteria 6541
623 Ga0466958_0109616 3300045836 Bacteria 1723
624 Ga0466967_0002106 3300045976 Bacteria 12203
625 Ga0466967_0044740 3300045976 Bacteria 3842
626 Ga0466967_0191274 3300045976 Bacteria 1934
627 Ga0495627_004139 3300046453 Bacteria 6156
628 Ga0495663_0018317 3300046525 Bacteria 1994
629 Ga0495598_0017285 3300046537 Bacteria 1857
630 Ga0495621_0000088 3300046539 Bacteria 18635
631 Ga0495668_0023406 3300046616 Bacteria 3523
632 Ga0495669_0000417 3300046684 Bacteria 20552
633 Ga0495669_0014265 3300046684 Bacteria 3398
634 Ga0495669_0019165 3300046684 Bacteria 2951
635 Ga0495670_0000192 3300046691 Bacteria 27204
636 Ga0495670_0037787 3300046691 Bacteria 2407
637 Ga0496100_0001321 3300048903 Bacteria 12119
638 Ga0496100_0064199 3300048903 Bacteria 2429
639 Ga0496101_0000325 3300048904 Bacteria 32628
640 Ga0496101_0035792 3300048904 Bacteria 3513
641 Ga0496102_0034774 3300048905 Bacteria 4534
642 Ga0496102_0090651 3300048905 Bacteria 2829
643 Ga0496102_0107255 3300048905 Bacteria 2601
644 Ga0496103_0033965 3300048906 Bacteria 3118
645 Ga0496104_0087287 3300048907 Bacteria 2979
646 Ga0496106_0004454 3300048909 Bacteria 10386
647 Ga0496106_0035887 3300048909 Bacteria 3708
648 Ga0496107_0002192 3300048910 Bacteria 12552
649 Ga0496107_0031870 3300048910 Bacteria 3764
650 Ga0496107_0044820 3300048910 Bacteria 3180
651 Ga0496108_0012352 3300048911 Bacteria 6950
652 Ga0496109_0008023 3300048912 Bacteria 8950
653 Ga0496109_0049587 3300048912 Bacteria 3822
654 Ga0496110_0013114 3300048913 Bacteria 6841
655 Ga0496111_0000090 3300048914 Bacteria 38333
656 Ga0496111_0001247 3300048914 Bacteria 14238
657 Ga0496112_0002770 3300048915 Bacteria 14218
658 Ga0496112_0013002 3300048915 Bacteria 7675
659 Ga0496112_0077190 3300048915 Bacteria 3294
660 Ga0496112_0151816 3300048915 Bacteria 2283
661 Ga0496113_0003942 3300048916 Bacteria 9005
662 Ga0496114_0000006 3300048917 Bacteria 472921
663 Ga0496114_0015065 3300048917 Bacteria 6217
664 Ga0496115_0116987 3300048918 Bacteria 2193
665 Ga0496117_0049378 3300048920 Bacteria 2993
666 Ga0496118_0042557 3300048921 Bacteria 3581
667 Ga0496122_0001921 3300048925 Bacteria 31403
668 Ga0496122_0003416 3300048925 Bacteria 20896
669 Ga0496123_0000634 3300048926 Bacteria 58737
670 Ga0496124_0002403 3300048927 Bacteria 24565
671 Ga0496125_0015561 3300048928 Bacteria 7347
672 Ga0496126_0017351 3300048929 Bacteria 7174
673 Ga0501031_0000074 3300049568 Bacteria 52791
674 Ga0501031_0012677 3300049568 Bacteria 5505
675 Ga0501032_0002979 3300049569 Bacteria 13150
676 Ga0501033_0000637 3300049570 Bacteria 32382
677 Ga0501033_0006706 3300049570 Bacteria 8994
678 Ga0501034_0000877 3300049571 Bacteria 44229
679 Ga0501036_0013355 3300049572 Bacteria 6822
680 Ga0501036_0018516 3300049572 Bacteria 5837
681 Ga0501037_0000235 3300049573 Bacteria 47804
682 Ga0501037_0078229 3300049573 Bacteria 2400
683 Ga0501038_0000196 3300049574 Bacteria 52394
684 Ga0501038_0003100 3300049574 Bacteria 15500
685 Ga0501039_0000124 3300049575 Bacteria 53373
686 Ga0501039_0006099 3300049575 Bacteria 9150
687 Ga0501040_0009495 3300049576 Bacteria 6343
688 Ga0501042_0115557 3300049578 Bacteria 1932
689 Ga0501046_0000844 3300049580 Bacteria 29854
690 Ga0501047_0000378 3300049581 Bacteria 50236
691 Ga0501048_0000096 3300049582 Bacteria 47896
692 Ga0501048_0045254 3300049582 Bacteria 3144
693 Ga0501067_0008008 3300049583 Bacteria 5869
694 Ga0501069_0000680 3300049585 Bacteria 15814
695 Ga0501070_0000216 3300049586 Bacteria 54638
696 Ga0501073_0005497 3300049589 Bacteria 9494
697 Ga0501074_0005172 3300049590 Bacteria 9375
698 Ga0501079_0017665 3300049741 Bacteria 5449
699 Ga0501080_0000177 3300049742 Bacteria 46889
700 Ga0501080_0026855 3300049742 Bacteria 5353
701 Ga0501081_0031784 3300049743 Bacteria 3578
702 Ga0501083_0005982 3300049744 Bacteria 8615
703 Ga0501035_0000648 3300049822 Bacteria 38367
704 Ga0501035_0210176 3300049822 Bacteria 1665
705 Ga0501044_0000585 3300049823 Bacteria 44237
706 Ga0501044_0336223 3300049823 Bacteria 1432
707 Ga0501045_0025750 3300049824 Bacteria 4229
708 Ga0501045_0045512 3300049824 Bacteria 3195
709 Ga0501045_0107332 3300049824 Bacteria 2069
710 nmdc:mga08y16_316687_c1 3300050511 Bacteria 1606
711 nmdc:mga0a205_4753_c1 3300050515 Bacteria 12204
712 Ga0500593_000149 3300053117 Bacteria 27933
713 Ga0500658_0000115 3300053134 Bacteria 38090
714 Ga0501084_0001653 3300054114 Bacteria 17738
715 Ga0501084_0005383 3300054114 Bacteria 10492
716 Ga0501082_0231928 3300060353 Bacteria 1606
717 Ga0466962_0006923 3300061719 Bacteria 5435
718 Ga0466962_0029238 3300061719 Bacteria 2637
719 Ga0466962_0032090 3300061719 Bacteria 2515
720 Ga0530510_0045537 3300061734 Bacteria 3169

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100165335 Ga0068853_1001653351 356
2 3300005578 Ga0068854_100029865 Ga0068854_1000298654 357
3 3300005616 Ga0068852_100001298 Ga0068852_1000012987 357
4 3300013104 Ga0157370_10096494 Ga0157370_100964943 357
5 3300026142 Ga0207698_10001363 Ga0207698_1000136313 357
6 3300013105 Ga0157369_10006939 Ga0157369_100069397 358
7 3300002067 JGI24735J21928_10007844 JGI24735J21928_100078445 364
8 3300025909 Ga0207705_10068688 Ga0207705_100686883 364
9 3300037312 Ga0395899_0012460 Ga0395899_0012460_5161_6360 365
10 3300037466 Ga0395898_0008780 Ga0395898_0008780_896_2095 365
11 3300037471 Ga0395905_0007657 Ga0395905_0007657_566_1765 365
12 3300038443 Ga0395901_0007396 Ga0395901_0007396_929_2128 365
13 3300005327 Ga0070658_10182228 Ga0070658_101822282 369
14 3300037471 Ga0395905_0116291 Ga0395905_0116291_774_1973 369
15 3300025909 Ga0207705_10175758 Ga0207705_101757582 374
16 3300005366 Ga0070659_100011730 Ga0070659_1000117303 375
17 3300005435 Ga0070714_100017962 Ga0070714_1000179625 375
18 3300005436 Ga0070713_100065431 Ga0070713_1000654312 375
19 3300009093 Ga0105240_10067029 Ga0105240_100670294 375
20 3300010375 Ga0105239_10165431 Ga0105239_101654312 375
21 3300013102 Ga0157371_10192946 Ga0157371_101929462 375
22 3300013102 Ga0157371_10280185 Ga0157371_102801851 375
23 3300013102 Ga0157371_10280478 Ga0157371_102804781 375
24 3300037418 Ga0395900_0043799 Ga0395900_0043799_1132_2310 375
25 3300037466 Ga0395898_0451579 Ga0395898_0451579_81_1208 375
26 3300038443 Ga0395901_0000041 Ga0395901_0000041_16137_17315 375
27 3300046684 Ga0495669_0000417 Ga0495669_0000417_17267_18394 375
28 3300046684 Ga0495669_0014265 Ga0495669_0014265_1295_2422 375
29 3300037471 Ga0395905_0033420 Ga0395905_0033420_2387_3523 378
30 3300038443 Ga0395901_0079818 Ga0395901_0079818_1708_2844 378
31 3300005577 Ga0068857_100041928 Ga0068857_1000419282 379
32 3300026088 Ga0207641_10317630 Ga0207641_103176302 379
33 3300026116 Ga0207674_10006205 Ga0207674_100062054 379
34 3300038443 Ga0395901_0401553 Ga0395901_0401553_194_1393 379
35 3300037466 Ga0395898_0113227 Ga0395898_0113227_591_1790 380
36 3300001915 JGI24741J21665_1002347 JGI24741J21665_10023472 381
37 3300002067 JGI24735J21928_10006139 JGI24735J21928_100061393 381
38 3300005329 Ga0070683_100064747 Ga0070683_1000647473 381
39 3300005455 Ga0070663_100010076 Ga0070663_1000100762 381
40 3300005577 Ga0068857_100020601 Ga0068857_1000206016 381
41 3300025909 Ga0207705_10006350 Ga0207705_100063506 381
42 3300025912 Ga0207707_10015159 Ga0207707_100151596 381
43 3300025917 Ga0207660_10031824 Ga0207660_100318244 381
44 3300025921 Ga0207652_10010359 Ga0207652_100103597 381
45 3300025945 Ga0207679_10004229 Ga0207679_100042297 381
46 3300025981 Ga0207640_10017230 Ga0207640_100172302 381
47 3300025986 Ga0207658_10017450 Ga0207658_100174504 381
48 3300026067 Ga0207678_10008382 Ga0207678_100083824 381
49 3300037471 Ga0395905_0006676 Ga0395905_0006676_9949_11148 381
50 3300038443 Ga0395901_0297875 Ga0395901_0297875_422_1621 381
51 3300038443 Ga0395901_0241185 Ga0395901_0241185_503_1702 382
52 3300013104 Ga0157370_10014807 Ga0157370_100148072 383
53 3300026142 Ga0207698_10117438 Ga0207698_101174382 384
54 3300001979 JGI24740J21852_10018147 JGI24740J21852_100181472 390
55 3300005983 Ga0081540_1008084 Ga0081540_10080844 391
56 3300001904 JGI24736J21556_1000759 JGI24736J21556_10007593 392
57 3300001979 JGI24740J21852_10003099 JGI24740J21852_100030992 392
58 3300001979 JGI24740J21852_10010512 JGI24740J21852_100105121 392
59 3300001989 JGI24739J22299_10005409 JGI24739J22299_100054094 392
60 3300001990 JGI24737J22298_10000746 JGI24737J22298_1000074611 392
61 3300001990 JGI24737J22298_10000786 JGI24737J22298_100007863 392
62 3300001990 JGI24737J22298_10003275 JGI24737J22298_100032752 392
63 3300001990 JGI24737J22298_10007606 JGI24737J22298_100076065 392
64 3300001990 JGI24737J22298_10028748 JGI24737J22298_100287482 392
65 3300002067 JGI24735J21928_10021176 JGI24735J21928_100211762 392
66 3300002073 JGI24745J21846_1001492 JGI24745J21846_10014923 392
67 3300002075 JGI24738J21930_10000194 JGI24738J21930_1000019416 392
68 3300002075 JGI24738J21930_10005800 JGI24738J21930_100058002 392
69 3300002075 JGI24738J21930_10005848 JGI24738J21930_100058483 392
70 3300005327 Ga0070658_10000584 Ga0070658_1000058415 392
71 3300005327 Ga0070658_10031162 Ga0070658_100311623 392
72 3300005327 Ga0070658_10033650 Ga0070658_100336502 392
73 3300005327 Ga0070658_10036735 Ga0070658_100367355 392
74 3300005328 Ga0070676_10007325 Ga0070676_100073253 392
75 3300005329 Ga0070683_100013630 Ga0070683_1000136301 392
76 3300005329 Ga0070683_100014137 Ga0070683_1000141377 392
77 3300005329 Ga0070683_100032882 Ga0070683_1000328823 392
78 3300005329 Ga0070683_100081414 Ga0070683_1000814142 392
79 3300005330 Ga0070690_100124468 Ga0070690_1001244682 392
80 3300005331 Ga0070670_100021499 Ga0070670_1000214996 392
81 3300005331 Ga0070670_100101434 Ga0070670_1001014342 392
82 3300005334 Ga0068869_100006785 Ga0068869_1000067853 392
83 3300005334 Ga0068869_100058106 Ga0068869_1000581063 392
84 3300005334 Ga0068869_100256309 Ga0068869_1002563092 392
85 3300005335 Ga0070666_10000216 Ga0070666_1000021611 392
86 3300005335 Ga0070666_10006945 Ga0070666_100069455 392
87 3300005335 Ga0070666_10009580 Ga0070666_100095803 392
88 3300005335 Ga0070666_10031092 Ga0070666_100310922 392
89 3300005336 Ga0070680_100000734 Ga0070680_1000007346 392
90 3300005336 Ga0070680_100006132 Ga0070680_1000061324 392
91 3300005336 Ga0070680_100008040 Ga0070680_1000080403 392
92 3300005336 Ga0070680_100017540 Ga0070680_1000175405 392
93 3300005338 Ga0068868_100023459 Ga0068868_1000234592 392
94 3300005338 Ga0068868_100036608 Ga0068868_1000366082 392
95 3300005338 Ga0068868_100171643 Ga0068868_1001716431 392
96 3300005339 Ga0070660_100000147 Ga0070660_10000014729 392
97 3300005339 Ga0070660_100002954 Ga0070660_10000295416 392
98 3300005339 Ga0070660_100016712 Ga0070660_1000167122 392
99 3300005339 Ga0070660_100050525 Ga0070660_1000505252 392
100 3300005339 Ga0070660_100089849 Ga0070660_1000898492 392
101 3300005339 Ga0070660_100096062 Ga0070660_1000960622 392
102 3300005339 Ga0070660_100110975 Ga0070660_1001109752 392
103 3300005341 Ga0070691_10048210 Ga0070691_100482102 392
104 3300005343 Ga0070687_100058189 Ga0070687_1000581893 392
105 3300005344 Ga0070661_100000213 Ga0070661_10000021334 392
106 3300005344 Ga0070661_100028273 Ga0070661_1000282732 392
107 3300005344 Ga0070661_100040241 Ga0070661_1000402412 392
108 3300005344 Ga0070661_100046328 Ga0070661_1000463284 392
109 3300005353 Ga0070669_100000629 Ga0070669_10000062938 392
110 3300005353 Ga0070669_100044878 Ga0070669_1000448782 392
111 3300005354 Ga0070675_100016949 Ga0070675_1000169493 392
112 3300005354 Ga0070675_100089116 Ga0070675_1000891162 392
113 3300005355 Ga0070671_100005290 Ga0070671_1000052907 392
114 3300005355 Ga0070671_100008660 Ga0070671_1000086609 392
115 3300005355 Ga0070671_100024818 Ga0070671_1000248182 392
116 3300005355 Ga0070671_100068476 Ga0070671_1000684763 392
117 3300005355 Ga0070671_100272166 Ga0070671_1002721662 392
118 3300005356 Ga0070674_100024613 Ga0070674_1000246133 392
119 3300005356 Ga0070674_100028858 Ga0070674_1000288583 392
120 3300005364 Ga0070673_100005945 Ga0070673_1000059452 392
121 3300005364 Ga0070673_100005956 Ga0070673_1000059565 392
122 3300005364 Ga0070673_100016917 Ga0070673_1000169175 392
123 3300005364 Ga0070673_100038146 Ga0070673_1000381463 392
124 3300005364 Ga0070673_100044581 Ga0070673_1000445812 392
125 3300005364 Ga0070673_100114877 Ga0070673_1001148772 392
126 3300005366 Ga0070659_100000123 Ga0070659_10000012329 392
127 3300005366 Ga0070659_100001223 Ga0070659_1000012233 392
128 3300005366 Ga0070659_100004009 Ga0070659_1000040097 392
129 3300005366 Ga0070659_100016409 Ga0070659_1000164092 392
130 3300005366 Ga0070659_100028316 Ga0070659_1000283163 392
131 3300005366 Ga0070659_100143945 Ga0070659_1001439452 392
132 3300005367 Ga0070667_100010025 Ga0070667_1000100259 392
133 3300005367 Ga0070667_100021756 Ga0070667_1000217564 392
134 3300005367 Ga0070667_100071000 Ga0070667_1000710002 392
135 3300005367 Ga0070667_100108779 Ga0070667_1001087792 392
136 3300005435 Ga0070714_100017357 Ga0070714_1000173575 392
137 3300005435 Ga0070714_100022690 Ga0070714_1000226904 392
138 3300005435 Ga0070714_100042637 Ga0070714_1000426373 392
139 3300005436 Ga0070713_100052229 Ga0070713_1000522294 392
140 3300005436 Ga0070713_100052663 Ga0070713_1000526631 392
141 3300005436 Ga0070713_100086400 Ga0070713_1000864002 392
142 3300005444 Ga0070694_100038141 Ga0070694_1000381414 392
143 3300005455 Ga0070663_100001735 Ga0070663_1000017353 392
144 3300005455 Ga0070663_100017691 Ga0070663_1000176917 392
145 3300005456 Ga0070678_100048390 Ga0070678_1000483903 392
146 3300005456 Ga0070678_100057965 Ga0070678_1000579652 392
147 3300005456 Ga0070678_100069917 Ga0070678_1000699173 392
148 3300005457 Ga0070662_100000060 Ga0070662_10000006029 392
149 3300005457 Ga0070662_100010709 Ga0070662_1000107094 392
150 3300005457 Ga0070662_100012577 Ga0070662_1000125772 392
151 3300005457 Ga0070662_100039968 Ga0070662_1000399683 392
152 3300005457 Ga0070662_100077659 Ga0070662_1000776591 392
153 3300005458 Ga0070681_10035173 Ga0070681_100351736 392
154 3300005458 Ga0070681_10231893 Ga0070681_102318931 392
155 3300005459 Ga0068867_100004321 Ga0068867_1000043219 392
156 3300005459 Ga0068867_100042149 Ga0068867_1000421493 392
157 3300005459 Ga0068867_100042601 Ga0068867_1000426012 392
158 3300005459 Ga0068867_100045663 Ga0068867_1000456633 392
159 3300005535 Ga0070684_100015937 Ga0070684_1000159373 392
160 3300005535 Ga0070684_100016652 Ga0070684_1000166523 392
161 3300005535 Ga0070684_100093635 Ga0070684_1000936352 392
162 3300005539 Ga0068853_100000277 Ga0068853_10000027711 392
163 3300005539 Ga0068853_100003199 Ga0068853_1000031997 392
164 3300005539 Ga0068853_100028498 Ga0068853_1000284984 392
165 3300005543 Ga0070672_100003277 Ga0070672_1000032779 392
166 3300005543 Ga0070672_100018309 Ga0070672_1000183095 392
167 3300005548 Ga0070665_100003766 Ga0070665_1000037669 392
168 3300005548 Ga0070665_100016998 Ga0070665_1000169982 392
169 3300005548 Ga0070665_100024266 Ga0070665_1000242662 392
170 3300005548 Ga0070665_100058493 Ga0070665_1000584931 392
171 3300005563 Ga0068855_100000877 Ga0068855_10000087719 392
172 3300005563 Ga0068855_100006911 Ga0068855_1000069119 392
173 3300005563 Ga0068855_100019332 Ga0068855_1000193323 392
174 3300005563 Ga0068855_100047947 Ga0068855_1000479472 392
175 3300005564 Ga0070664_100000158 Ga0070664_10000015829 392
176 3300005564 Ga0070664_100027076 Ga0070664_1000270762 392
177 3300005577 Ga0068857_100001240 Ga0068857_1000012404 392
178 3300005577 Ga0068857_100041550 Ga0068857_1000415504 392
179 3300005578 Ga0068854_100021242 Ga0068854_1000212424 392
180 3300005578 Ga0068854_100030803 Ga0068854_1000308033 392
181 3300005578 Ga0068854_100128662 Ga0068854_1001286622 392
182 3300005614 Ga0068856_100000974 Ga0068856_10000097421 392
183 3300005614 Ga0068856_100011435 Ga0068856_1000114357 392
184 3300005614 Ga0068856_100200037 Ga0068856_1002000373 392
185 3300005614 Ga0068856_100216315 Ga0068856_1002163152 392
186 3300005616 Ga0068852_100001354 Ga0068852_1000013544 392
187 3300005616 Ga0068852_100006359 Ga0068852_1000063596 392
188 3300005616 Ga0068852_100009317 Ga0068852_1000093177 392
189 3300005616 Ga0068852_100011068 Ga0068852_1000110687 392
190 3300005616 Ga0068852_100019422 Ga0068852_1000194222 392
191 3300005616 Ga0068852_100067340 Ga0068852_1000673402 392
192 3300005617 Ga0068859_100002593 Ga0068859_1000025934 392
193 3300005618 Ga0068864_100012308 Ga0068864_10001230810 392
194 3300005618 Ga0068864_100184371 Ga0068864_1001843712 392
195 3300005718 Ga0068866_10040292 Ga0068866_100402923 392
196 3300005718 Ga0068866_10044137 Ga0068866_100441372 392
197 3300005718 Ga0068866_10093358 Ga0068866_100933582 392
198 3300005834 Ga0068851_10004197 Ga0068851_100041977 392
199 3300005840 Ga0068870_10080568 Ga0068870_100805682 392
200 3300005841 Ga0068863_100033211 Ga0068863_1000332112 392
201 3300005841 Ga0068863_100054970 Ga0068863_1000549702 392
202 3300005841 Ga0068863_100077472 Ga0068863_1000774724 392
203 3300005841 Ga0068863_100254103 Ga0068863_1002541032 392
204 3300005842 Ga0068858_100001220 Ga0068858_10000122020 392
205 3300005842 Ga0068858_100001846 Ga0068858_1000018464 392
206 3300005842 Ga0068858_100011265 Ga0068858_1000112654 392
207 3300005843 Ga0068860_100036535 Ga0068860_1000365352 392
208 3300005843 Ga0068860_100038335 Ga0068860_1000383353 392
209 3300005843 Ga0068860_100058888 Ga0068860_1000588884 392
210 3300005844 Ga0068862_100011722 Ga0068862_1000117224 392
211 3300005844 Ga0068862_100154443 Ga0068862_1001544431 392
212 3300006028 Ga0070717_10007064 Ga0070717_100070647 392
213 3300006175 Ga0070712_100091074 Ga0070712_1000910743 392
214 3300006237 Ga0097621_100005115 Ga0097621_1000051159 392
215 3300006237 Ga0097621_100100581 Ga0097621_1001005811 392
216 3300006358 Ga0068871_100007484 Ga0068871_1000074845 392
217 3300006358 Ga0068871_100082726 Ga0068871_1000827262 392
218 3300006852 Ga0075433_10062719 Ga0075433_100627192 392
219 3300006881 Ga0068865_100009283 Ga0068865_1000092836 392
220 3300006881 Ga0068865_100016775 Ga0068865_1000167752 392
221 3300006931 Ga0097620_100002593 Ga0097620_10000259317 392
222 3300006931 Ga0097620_100039763 Ga0097620_1000397632 392
223 3300009093 Ga0105240_10010940 Ga0105240_100109406 392
224 3300009093 Ga0105240_10145713 Ga0105240_101457132 392
225 3300009093 Ga0105240_10220990 Ga0105240_102209901 392
226 3300009094 Ga0111539_10215607 Ga0111539_102156073 392
227 3300009098 Ga0105245_10000345 Ga0105245_1000034511 392
228 3300009098 Ga0105245_10007397 Ga0105245_1000739710 392
229 3300009098 Ga0105245_10018295 Ga0105245_100182955 392
230 3300009098 Ga0105245_10064090 Ga0105245_100640902 392
231 3300009098 Ga0105245_10078381 Ga0105245_100783812 392
232 3300009098 Ga0105245_10289122 Ga0105245_102891221 392
233 3300009148 Ga0105243_10089923 Ga0105243_100899231 392
234 3300009174 Ga0105241_10025393 Ga0105241_100253932 392
235 3300009176 Ga0105242_10283216 Ga0105242_102832161 392
236 3300009177 Ga0105248_10000278 Ga0105248_1000027834 392
237 3300009177 Ga0105248_10000575 Ga0105248_1000057511 392
238 3300009177 Ga0105248_10003523 Ga0105248_1000352317 392
239 3300009177 Ga0105248_10010229 Ga0105248_1001022912 392
240 3300009177 Ga0105248_10019015 Ga0105248_100190153 392
241 3300009177 Ga0105248_10061483 Ga0105248_100614834 392
242 3300009177 Ga0105248_10102833 Ga0105248_101028332 392
243 3300009177 Ga0105248_10107994 Ga0105248_101079942 392
244 3300009545 Ga0105237_10043265 Ga0105237_100432652 392
245 3300009551 Ga0105238_10030680 Ga0105238_100306802 392
246 3300009551 Ga0105238_10054334 Ga0105238_100543345 392
247 3300009551 Ga0105238_10414962 Ga0105238_104149621 392
248 3300009553 Ga0105249_10171388 Ga0105249_101713882 392
249 3300010375 Ga0105239_10086897 Ga0105239_100868972 392
250 3300011119 Ga0105246_10017944 Ga0105246_100179443 392
251 3300013100 Ga0157373_10008459 Ga0157373_100084592 392
252 3300013100 Ga0157373_10023675 Ga0157373_100236752 392
253 3300013100 Ga0157373_10027797 Ga0157373_100277973 392
254 3300013100 Ga0157373_10035835 Ga0157373_100358352 392
255 3300013100 Ga0157373_10047395 Ga0157373_100473952 392
256 3300013102 Ga0157371_10002505 Ga0157371_100025052 392
257 3300013102 Ga0157371_10010808 Ga0157371_100108087 392
258 3300013102 Ga0157371_10022940 Ga0157371_100229406 392
259 3300013102 Ga0157371_10043368 Ga0157371_100433682 392
260 3300013102 Ga0157371_10056697 Ga0157371_100566972 392
261 3300013104 Ga0157370_10053392 Ga0157370_100533923 392
262 3300013104 Ga0157370_10053862 Ga0157370_100538625 392
263 3300013104 Ga0157370_10057396 Ga0157370_100573962 392
264 3300013104 Ga0157370_10085415 Ga0157370_100854153 392
265 3300013104 Ga0157370_10250709 Ga0157370_102507092 392
266 3300013105 Ga0157369_10000207 Ga0157369_100002076 392
267 3300013105 Ga0157369_10021548 Ga0157369_100215483 392
268 3300013105 Ga0157369_10022923 Ga0157369_100229232 392
269 3300013105 Ga0157369_10046359 Ga0157369_100463595 392
270 3300013105 Ga0157369_10070536 Ga0157369_100705363 392
271 3300013105 Ga0157369_10074597 Ga0157369_100745975 392
272 3300013105 Ga0157369_10103474 Ga0157369_101034743 392
273 3300013105 Ga0157369_10140894 Ga0157369_101408942 392
274 3300013105 Ga0157369_10357506 Ga0157369_103575062 392
275 3300013296 Ga0157374_10004605 Ga0157374_1000460513 392
276 3300013296 Ga0157374_10038900 Ga0157374_100389006 392
277 3300013296 Ga0157374_10165019 Ga0157374_101650192 392
278 3300013297 Ga0157378_10006791 Ga0157378_100067911 392
279 3300013297 Ga0157378_10079513 Ga0157378_100795133 392
280 3300013306 Ga0163162_10011540 Ga0163162_100115408 392
281 3300013306 Ga0163162_10036178 Ga0163162_100361785 392
282 3300013307 Ga0157372_10069404 Ga0157372_100694043 392
283 3300013308 Ga0157375_10028971 Ga0157375_100289711 392
284 3300013308 Ga0157375_10053602 Ga0157375_100536022 392
285 3300013308 Ga0157375_10056718 Ga0157375_100567182 392
286 3300013308 Ga0157375_10062099 Ga0157375_100620995 392
287 3300013308 Ga0157375_10268370 Ga0157375_102683701 392
288 3300014325 Ga0163163_10000843 Ga0163163_1000084324 392
289 3300014325 Ga0163163_10274079 Ga0163163_102740792 392
290 3300014497 Ga0182008_10060270 Ga0182008_100602702 392
291 3300014745 Ga0157377_10055272 Ga0157377_100552722 392
292 3300014745 Ga0157377_10097495 Ga0157377_100974951 392
293 3300014968 Ga0157379_10020897 Ga0157379_100208972 392
294 3300014968 Ga0157379_10027414 Ga0157379_100274142 392
295 3300014969 Ga0157376_10008028 Ga0157376_100080289 392
296 3300014969 Ga0157376_10263474 Ga0157376_102634741 392
297 3300020081 Ga0206354_10354046 Ga0206354_103540462 392
298 3300020082 Ga0206353_10254860 Ga0206353_102548602 392
299 3300020082 Ga0206353_10519444 Ga0206353_105194442 392
300 3300021388 Ga0213875_10001660 Ga0213875_1000166012 392
301 3300025315 Ga0207697_10006110 Ga0207697_100061106 392
302 3300025315 Ga0207697_10018985 Ga0207697_100189853 392
303 3300025893 Ga0207682_10006585 Ga0207682_100065852 392
304 3300025893 Ga0207682_10021911 Ga0207682_100219112 392
305 3300025901 Ga0207688_10007449 Ga0207688_100074493 392
306 3300025901 Ga0207688_10083943 Ga0207688_100839433 392
307 3300025901 Ga0207688_10084827 Ga0207688_100848272 392
308 3300025903 Ga0207680_10007504 Ga0207680_100075045 392
309 3300025903 Ga0207680_10014223 Ga0207680_100142234 392
310 3300025903 Ga0207680_10099023 Ga0207680_100990232 392
311 3300025904 Ga0207647_10000181 Ga0207647_1000018140 392
312 3300025904 Ga0207647_10001259 Ga0207647_1000125914 392
313 3300025904 Ga0207647_10001551 Ga0207647_1000155119 392
314 3300025904 Ga0207647_10001581 Ga0207647_1000158120 392
315 3300025904 Ga0207647_10005987 Ga0207647_100059879 392
316 3300025904 Ga0207647_10022146 Ga0207647_100221465 392
317 3300025904 Ga0207647_10025792 Ga0207647_100257923 392
318 3300025904 Ga0207647_10069608 Ga0207647_100696083 392
319 3300025908 Ga0207643_10046516 Ga0207643_100465162 392
320 3300025908 Ga0207643_10050233 Ga0207643_100502333 392
321 3300025909 Ga0207705_10000030 Ga0207705_10000030106 392
322 3300025909 Ga0207705_10000295 Ga0207705_1000029529 392
323 3300025909 Ga0207705_10004858 Ga0207705_100048585 392
324 3300025909 Ga0207705_10009708 Ga0207705_100097083 392
325 3300025909 Ga0207705_10036102 Ga0207705_100361022 392
326 3300025909 Ga0207705_10105896 Ga0207705_101058962 392
327 3300025911 Ga0207654_10050031 Ga0207654_100500312 392
328 3300025912 Ga0207707_10032046 Ga0207707_100320462 392
329 3300025913 Ga0207695_10003659 Ga0207695_100036596 392
330 3300025913 Ga0207695_10013923 Ga0207695_100139236 392
331 3300025913 Ga0207695_10027383 Ga0207695_100273832 392
332 3300025913 Ga0207695_10039298 Ga0207695_100392986 392
333 3300025913 Ga0207695_10150783 Ga0207695_101507831 392
334 3300025914 Ga0207671_10041044 Ga0207671_100410441 392
335 3300025915 Ga0207693_10086060 Ga0207693_100860603 392
336 3300025917 Ga0207660_10000750 Ga0207660_100007509 392
337 3300025917 Ga0207660_10004788 Ga0207660_100047883 392
338 3300025917 Ga0207660_10005631 Ga0207660_100056315 392
339 3300025917 Ga0207660_10078366 Ga0207660_100783661 392
340 3300025918 Ga0207662_10066830 Ga0207662_100668301 392
341 3300025919 Ga0207657_10000334 Ga0207657_1000033429 392
342 3300025919 Ga0207657_10003211 Ga0207657_1000321120 392
343 3300025919 Ga0207657_10008718 Ga0207657_100087186 392
344 3300025919 Ga0207657_10019817 Ga0207657_100198173 392
345 3300025919 Ga0207657_10019896 Ga0207657_100198968 392
346 3300025919 Ga0207657_10023780 Ga0207657_100237806 392
347 3300025919 Ga0207657_10024553 Ga0207657_100245532 392
348 3300025919 Ga0207657_10024743 Ga0207657_100247432 392
349 3300025919 Ga0207657_10036764 Ga0207657_100367642 392
350 3300025920 Ga0207649_10000211 Ga0207649_1000021133 392
351 3300025920 Ga0207649_10001913 Ga0207649_100019134 392
352 3300025920 Ga0207649_10023326 Ga0207649_100233262 392
353 3300025920 Ga0207649_10026735 Ga0207649_100267352 392
354 3300025920 Ga0207649_10033231 Ga0207649_100332312 392
355 3300025920 Ga0207649_10076045 Ga0207649_100760452 392
356 3300025920 Ga0207649_10081357 Ga0207649_100813572 392
357 3300025921 Ga0207652_10172033 Ga0207652_101720331 392
358 3300025923 Ga0207681_10001272 Ga0207681_1000127214 392
359 3300025924 Ga0207694_10091034 Ga0207694_100910342 392
360 3300025924 Ga0207694_10093165 Ga0207694_100931652 392
361 3300025924 Ga0207694_10153730 Ga0207694_101537301 392
362 3300025924 Ga0207694_10172900 Ga0207694_101729002 392
363 3300025925 Ga0207650_10010807 Ga0207650_100108071 392
364 3300025925 Ga0207650_10135121 Ga0207650_101351212 392
365 3300025926 Ga0207659_10092832 Ga0207659_100928321 392
366 3300025926 Ga0207659_10220392 Ga0207659_102203921 392
367 3300025927 Ga0207687_10020631 Ga0207687_100206313 392
368 3300025927 Ga0207687_10025261 Ga0207687_100252612 392
369 3300025927 Ga0207687_10124808 Ga0207687_101248082 392
370 3300025928 Ga0207700_10052290 Ga0207700_100522902 392
371 3300025929 Ga0207664_10066419 Ga0207664_100664192 392
372 3300025931 Ga0207644_10000244 Ga0207644_1000024415 392
373 3300025931 Ga0207644_10019858 Ga0207644_100198583 392
374 3300025931 Ga0207644_10134429 Ga0207644_101344292 392
375 3300025932 Ga0207690_10000182 Ga0207690_1000018219 392
376 3300025932 Ga0207690_10001681 Ga0207690_100016817 392
377 3300025932 Ga0207690_10004770 Ga0207690_100047702 392
378 3300025932 Ga0207690_10016048 Ga0207690_100160484 392
379 3300025932 Ga0207690_10016885 Ga0207690_100168856 392
380 3300025932 Ga0207690_10097353 Ga0207690_100973532 392
381 3300025933 Ga0207706_10001111 Ga0207706_100011112 392
382 3300025933 Ga0207706_10001196 Ga0207706_1000119624 392
383 3300025933 Ga0207706_10007420 Ga0207706_100074202 392
384 3300025933 Ga0207706_10010496 Ga0207706_100104968 392
385 3300025933 Ga0207706_10020691 Ga0207706_100206916 392
386 3300025933 Ga0207706_10021761 Ga0207706_100217614 392
387 3300025933 Ga0207706_10029223 Ga0207706_100292235 392
388 3300025933 Ga0207706_10110292 Ga0207706_101102922 392
389 3300025933 Ga0207706_10133673 Ga0207706_101336732 392
390 3300025933 Ga0207706_10208005 Ga0207706_102080052 392
391 3300025937 Ga0207669_10009631 Ga0207669_100096315 392
392 3300025937 Ga0207669_10235228 Ga0207669_102352281 392
393 3300025938 Ga0207704_10020224 Ga0207704_100202243 392
394 3300025938 Ga0207704_10028082 Ga0207704_100280823 392
395 3300025939 Ga0207665_10019185 Ga0207665_100191855 392
396 3300025939 Ga0207665_10066567 Ga0207665_100665672 392
397 3300025940 Ga0207691_10001971 Ga0207691_1000197124 392
398 3300025940 Ga0207691_10004474 Ga0207691_100044743 392
399 3300025940 Ga0207691_10006883 Ga0207691_100068832 392
400 3300025940 Ga0207691_10010219 Ga0207691_100102192 392
401 3300025940 Ga0207691_10043731 Ga0207691_100437312 392
402 3300025940 Ga0207691_10054083 Ga0207691_100540833 392
403 3300025940 Ga0207691_10058961 Ga0207691_100589613 392
404 3300025941 Ga0207711_10000496 Ga0207711_1000049629 392
405 3300025941 Ga0207711_10003249 Ga0207711_100032494 392
406 3300025941 Ga0207711_10003482 Ga0207711_100034824 392
407 3300025941 Ga0207711_10014623 Ga0207711_100146235 392
408 3300025941 Ga0207711_10017473 Ga0207711_100174738 392
409 3300025941 Ga0207711_10017952 Ga0207711_100179525 392
410 3300025941 Ga0207711_10168801 Ga0207711_101688011 392
411 3300025941 Ga0207711_10229454 Ga0207711_102294542 392
412 3300025942 Ga0207689_10001430 Ga0207689_100014302 392
413 3300025942 Ga0207689_10037593 Ga0207689_100375932 392
414 3300025942 Ga0207689_10102929 Ga0207689_101029292 392
415 3300025942 Ga0207689_10211270 Ga0207689_102112702 392
416 3300025944 Ga0207661_10004896 Ga0207661_100048968 392
417 3300025944 Ga0207661_10006695 Ga0207661_100066958 392
418 3300025944 Ga0207661_10020069 Ga0207661_100200693 392
419 3300025944 Ga0207661_10052050 Ga0207661_100520502 392
420 3300025945 Ga0207679_10000293 Ga0207679_1000029334 392
421 3300025945 Ga0207679_10007447 Ga0207679_100074478 392
422 3300025945 Ga0207679_10014639 Ga0207679_100146393 392
423 3300025945 Ga0207679_10072925 Ga0207679_100729253 392
424 3300025949 Ga0207667_10001632 Ga0207667_100016329 392
425 3300025949 Ga0207667_10003164 Ga0207667_1000316420 392
426 3300025949 Ga0207667_10009303 Ga0207667_100093039 392
427 3300025949 Ga0207667_10021295 Ga0207667_100212955 392
428 3300025949 Ga0207667_10052663 Ga0207667_100526634 392
429 3300025949 Ga0207667_10078318 Ga0207667_100783183 392
430 3300025949 Ga0207667_10280306 Ga0207667_102803062 392
431 3300025949 Ga0207667_10303208 Ga0207667_103032081 392
432 3300025960 Ga0207651_10002607 Ga0207651_100026077 392
433 3300025960 Ga0207651_10003074 Ga0207651_100030743 392
434 3300025960 Ga0207651_10017404 Ga0207651_100174043 392
435 3300025960 Ga0207651_10042328 Ga0207651_100423284 392
436 3300025960 Ga0207651_10121421 Ga0207651_101214212 392
437 3300025961 Ga0207712_10004801 Ga0207712_100048012 392
438 3300025972 Ga0207668_10057300 Ga0207668_100573003 392
439 3300025981 Ga0207640_10003428 Ga0207640_100034284 392
440 3300025981 Ga0207640_10005127 Ga0207640_100051275 392
441 3300025981 Ga0207640_10016005 Ga0207640_100160052 392
442 3300025981 Ga0207640_10109953 Ga0207640_101099532 392
443 3300025981 Ga0207640_10157337 Ga0207640_101573372 392
444 3300025986 Ga0207658_10005837 Ga0207658_100058378 392
445 3300025986 Ga0207658_10005856 Ga0207658_100058567 392
446 3300025986 Ga0207658_10035255 Ga0207658_100352552 392
447 3300025986 Ga0207658_10092772 Ga0207658_100927722 392
448 3300026023 Ga0207677_10001914 Ga0207677_1000191411 392
449 3300026023 Ga0207677_10002862 Ga0207677_100028622 392
450 3300026023 Ga0207677_10025226 Ga0207677_100252264 392
451 3300026023 Ga0207677_10033222 Ga0207677_100332223 392
452 3300026035 Ga0207703_10008253 Ga0207703_100082534 392
453 3300026035 Ga0207703_10009527 Ga0207703_100095276 392
454 3300026035 Ga0207703_10021916 Ga0207703_100219163 392
455 3300026035 Ga0207703_10064569 Ga0207703_100645692 392
456 3300026041 Ga0207639_10000154 Ga0207639_1000015426 392
457 3300026041 Ga0207639_10126906 Ga0207639_101269063 392
458 3300026041 Ga0207639_10134323 Ga0207639_101343232 392
459 3300026041 Ga0207639_10172152 Ga0207639_101721522 392
460 3300026067 Ga0207678_10000989 Ga0207678_100009895 392
461 3300026067 Ga0207678_10004204 Ga0207678_100042043 392
462 3300026067 Ga0207678_10024308 Ga0207678_100243082 392
463 3300026067 Ga0207678_10028452 Ga0207678_100284521 392
464 3300026067 Ga0207678_10032245 Ga0207678_100322455 392
465 3300026067 Ga0207678_10082277 Ga0207678_100822774 392
466 3300026067 Ga0207678_10091329 Ga0207678_100913292 392
467 3300026067 Ga0207678_10253160 Ga0207678_102531601 392
468 3300026078 Ga0207702_10000497 Ga0207702_1000049729 392
469 3300026078 Ga0207702_10012814 Ga0207702_100128147 392
470 3300026078 Ga0207702_10014245 Ga0207702_100142455 392
471 3300026078 Ga0207702_10021180 Ga0207702_100211803 392
472 3300026078 Ga0207702_10161370 Ga0207702_101613702 392
473 3300026088 Ga0207641_10024132 Ga0207641_100241322 392
474 3300026088 Ga0207641_10043191 Ga0207641_100431912 392
475 3300026088 Ga0207641_10060781 Ga0207641_100607812 392
476 3300026088 Ga0207641_10135403 Ga0207641_101354032 392
477 3300026089 Ga0207648_10000838 Ga0207648_100008385 392
478 3300026089 Ga0207648_10002771 Ga0207648_100027717 392
479 3300026089 Ga0207648_10005618 Ga0207648_100056187 392
480 3300026089 Ga0207648_10016546 Ga0207648_100165467 392
481 3300026089 Ga0207648_10027547 Ga0207648_100275476 392
482 3300026095 Ga0207676_10001828 Ga0207676_1000182815 392
483 3300026095 Ga0207676_10253201 Ga0207676_102532012 392
484 3300026116 Ga0207674_10002837 Ga0207674_100028377 392
485 3300026116 Ga0207674_10007245 Ga0207674_100072457 392
486 3300026116 Ga0207674_10012448 Ga0207674_100124483 392
487 3300026116 Ga0207674_10015575 Ga0207674_100155753 392
488 3300026116 Ga0207674_10020630 Ga0207674_100206306 392
489 3300026116 Ga0207674_10238491 Ga0207674_102384911 392
490 3300026118 Ga0207675_100078146 Ga0207675_1000781462 392
491 3300026121 Ga0207683_10007726 Ga0207683_100077262 392
492 3300026121 Ga0207683_10039327 Ga0207683_100393272 392
493 3300026121 Ga0207683_10048875 Ga0207683_100488753 392
494 3300026121 Ga0207683_10284062 Ga0207683_102840621 392
495 3300026142 Ga0207698_10001214 Ga0207698_100012142 392
496 3300026142 Ga0207698_10004239 Ga0207698_100042397 392
497 3300026142 Ga0207698_10004588 Ga0207698_100045882 392
498 3300026142 Ga0207698_10006440 Ga0207698_100064408 392
499 3300026142 Ga0207698_10020836 Ga0207698_100208362 392
500 3300026142 Ga0207698_10024126 Ga0207698_100241263 392
501 3300028379 Ga0268266_10002631 Ga0268266_1000263119 392
502 3300028379 Ga0268266_10007828 Ga0268266_100078286 392
503 3300028379 Ga0268266_10011861 Ga0268266_100118617 392
504 3300028379 Ga0268266_10023299 Ga0268266_100232994 392
505 3300028379 Ga0268266_10044312 Ga0268266_100443123 392
506 3300028380 Ga0268265_10038985 Ga0268265_100389853 392
507 3300028381 Ga0268264_10001404 Ga0268264_100014045 392
508 3300028381 Ga0268264_10015899 Ga0268264_100158996 392
509 3300028381 Ga0268264_10258882 Ga0268264_102588822 392
510 3300030733 Ga0314311_1220182 Ga0314311_12201823 392
511 3300030734 Ga0316179_1031902 Ga0316179_10319022 392
512 3300031456 Ga0307513_10102386 Ga0307513_101023861 392
513 3300031649 Ga0307514_10144997 Ga0307514_101449972 392
514 3300031731 Ga0307405_10002843 Ga0307405_1000284312 392
515 3300031824 Ga0307413_10002762 Ga0307413_100027628 392
516 3300031824 Ga0307413_10007843 Ga0307413_100078434 392
517 3300031852 Ga0307410_10007955 Ga0307410_100079552 392
518 3300031852 Ga0307410_10010005 Ga0307410_100100055 392
519 3300031852 Ga0307410_10037231 Ga0307410_100372313 392
520 3300031852 Ga0307410_10070248 Ga0307410_100702481 392
521 3300031903 Ga0307407_10001660 Ga0307407_100016602 392
522 3300031911 Ga0307412_10056998 Ga0307412_100569982 392
523 3300031995 Ga0307409_100005087 Ga0307409_1000050877 392
524 3300031995 Ga0307409_100015831 Ga0307409_1000158312 392
525 3300031995 Ga0307409_100036419 Ga0307409_1000364193 392
526 3300032002 Ga0307416_100027796 Ga0307416_1000277965 392
527 3300032002 Ga0307416_100063293 Ga0307416_1000632933 392
528 3300032002 Ga0307416_100080985 Ga0307416_1000809853 392
529 3300032002 Ga0307416_100093410 Ga0307416_1000934104 392
530 3300032002 Ga0307416_100210848 Ga0307416_1002108482 392
531 3300032004 Ga0307414_10018114 Ga0307414_100181144 392
532 3300032004 Ga0307414_10127463 Ga0307414_101274632 392
533 3300032005 Ga0307411_10004993 Ga0307411_100049936 392
534 3300035692 Ga0373935_0009488 Ga0373935_0009488_4342_5520 392
535 3300035692 Ga0373935_0016542 Ga0373935_0016542_1472_2650 392
536 3300035725 Ga0373947_0004557 Ga0373947_0004557_3545_4723 392
537 3300037312 Ga0395899_0016795 Ga0395899_0016795_2458_3636 392
538 3300037312 Ga0395899_0029232 Ga0395899_0029232_872_2071 392
539 3300037312 Ga0395899_0057539 Ga0395899_0057539_1415_2593 392
540 3300037312 Ga0395899_0115100 Ga0395899_0115100_693_1892 392
541 3300037312 Ga0395899_0116084 Ga0395899_0116084_88_1287 392
542 3300037312 Ga0395899_0121756 Ga0395899_0121756_449_1627 392
543 3300037418 Ga0395900_0003925 Ga0395900_0003925_10170_11369 392
544 3300037418 Ga0395900_0005369 Ga0395900_0005369_3241_4440 392
545 3300037418 Ga0395900_0005577 Ga0395900_0005577_9841_11040 392
546 3300037418 Ga0395900_0010077 Ga0395900_0010077_13_1191 392
547 3300037418 Ga0395900_0042369 Ga0395900_0042369_3001_4200 392
548 3300037418 Ga0395900_0046569 Ga0395900_0046569_192_1391 392
549 3300037418 Ga0395900_0079761 Ga0395900_0079761_858_2036 392
550 3300037418 Ga0395900_0106522 Ga0395900_0106522_26_1204 392
551 3300037418 Ga0395900_0111863 Ga0395900_0111863_415_1614 392
552 3300037418 Ga0395900_0143661 Ga0395900_0143661_394_1593 392
553 3300037418 Ga0395900_0153630 Ga0395900_0153630_863_2062 392
554 3300037418 Ga0395900_0287071 Ga0395900_0287071_129_1328 392
555 3300037418 Ga0395900_0339712 Ga0395900_0339712_288_1466 392
556 3300037466 Ga0395898_0012167 Ga0395898_0012167_2554_3732 392
557 3300037466 Ga0395898_0026941 Ga0395898_0026941_3377_4555 392
558 3300037466 Ga0395898_0075074 Ga0395898_0075074_90_1268 392
559 3300037466 Ga0395898_0083941 Ga0395898_0083941_1153_2331 392
560 3300037466 Ga0395898_0126794 Ga0395898_0126794_74_1252 392
561 3300037466 Ga0395898_0173903 Ga0395898_0173903_230_1429 392
562 3300037466 Ga0395898_0316331 Ga0395898_0316331_202_1380 392
563 3300037466 Ga0395898_0376715 Ga0395898_0376715_121_1320 392
564 3300037471 Ga0395905_0001141 Ga0395905_0001141_12035_13234 392
565 3300037471 Ga0395905_0004658 Ga0395905_0004658_12187_13386 392
566 3300037471 Ga0395905_0007482 Ga0395905_0007482_3011_4210 392
567 3300037471 Ga0395905_0011136 Ga0395905_0011136_7391_8569 392
568 3300037471 Ga0395905_0017826 Ga0395905_0017826_2778_3956 392
569 3300037471 Ga0395905_0037823 Ga0395905_0037823_2393_3592 392
570 3300037471 Ga0395905_0045363 Ga0395905_0045363_1639_2817 392
571 3300037471 Ga0395905_0053977 Ga0395905_0053977_879_2057 392
572 3300037471 Ga0395905_0067409 Ga0395905_0067409_1013_2212 392
573 3300037471 Ga0395905_0090401 Ga0395905_0090401_1206_2405 392
574 3300037471 Ga0395905_0092845 Ga0395905_0092845_202_1380 392
575 3300037471 Ga0395905_0098512 Ga0395905_0098512_280_1524 392
576 3300037471 Ga0395905_0185180 Ga0395905_0185180_613_1812 392
577 3300037471 Ga0395905_0191440 Ga0395905_0191440_651_1829 392
578 3300037471 Ga0395905_0191716 Ga0395905_0191716_539_1717 392
579 3300037471 Ga0395905_0213058 Ga0395905_0213058_237_1436 392
580 3300037471 Ga0395905_0263036 Ga0395905_0263036_114_1313 392
581 3300037853 Ga0436364_0269013 Ga0436364_0269013_5321_6499 392
582 3300038443 Ga0395901_0004104 Ga0395901_0004104_10428_11627 392
583 3300038443 Ga0395901_0007445 Ga0395901_0007445_1292_2491 392
584 3300038443 Ga0395901_0017386 Ga0395901_0017386_288_1466 392
585 3300038443 Ga0395901_0023857 Ga0395901_0023857_401_1600 392
586 3300038443 Ga0395901_0029478 Ga0395901_0029478_44_1222 392
587 3300038443 Ga0395901_0035520 Ga0395901_0035520_1397_2596 392
588 3300038443 Ga0395901_0040317 Ga0395901_0040317_3054_4253 392
589 3300038443 Ga0395901_0048364 Ga0395901_0048364_2596_3795 392
590 3300038443 Ga0395901_0133341 Ga0395901_0133341_878_2077 392
591 3300038443 Ga0395901_0136651 Ga0395901_0136651_1107_2306 392
592 3300038443 Ga0395901_0147291 Ga0395901_0147291_289_1488 392
593 3300038443 Ga0395901_0197500 Ga0395901_0197500_921_2099 392
594 3300038443 Ga0395901_0301703 Ga0395901_0301703_34_1233 392
595 3300038443 Ga0395901_0317415 Ga0395901_0317415_130_1329 392
596 3300042004 Ga0439445_0007961 Ga0439445_0007961_505_1683 392
597 3300042015 Ga0439462_0002422 Ga0439462_0002422_2614_3813 392
598 3300042157 Ga0439458_0003050 Ga0439458_0003050_899_2098 392
599 3300044656 Ga0466969_0019153 Ga0466969_0019153_1736_2914 392
600 3300044658 Ga0466972_0060624 Ga0466972_0060624_398_1594 392
601 3300044658 Ga0466972_0085902 Ga0466972_0085902_52_1251 392
602 3300044683 Ga0466965_0119087 Ga0466965_0119087_97_1317 392
603 3300044684 Ga0466966_0000041 Ga0466966_0000041_21934_23112 392
604 3300044684 Ga0466966_0012337 Ga0466966_0012337_2600_3799 392
605 3300044684 Ga0466966_0015306 Ga0466966_0015306_487_1665 392
606 3300044684 Ga0466966_0016074 Ga0466966_0016074_393_1571 392
607 3300044693 Ga0466961_0007333 Ga0466961_0007333_2542_3720 392
608 3300044693 Ga0466961_0050312 Ga0466961_0050312_1071_2249 392
609 3300044693 Ga0466961_0065378 Ga0466961_0065378_685_1863 392
610 3300044693 Ga0466961_0089372 Ga0466961_0089372_461_1660 392
611 3300044694 Ga0466963_0003494 Ga0466963_0003494_283_1482 392
612 3300044694 Ga0466963_0005728 Ga0466963_0005728_2998_4176 392
613 3300044694 Ga0466963_0108219 Ga0466963_0108219_138_1316 392
614 3300044694 Ga0466963_0175422 Ga0466963_0175422_12_1190 392
615 3300044719 Ga0466971_0003474 Ga0466971_0003474_4640_5839 392
616 3300044719 Ga0466971_0003766 Ga0466971_0003766_769_1947 392
617 3300044719 Ga0466971_0087620 Ga0466971_0087620_216_1394 392
618 3300044765 Ga0466970_0014280 Ga0466970_0014280_1496_2731 392
619 3300044765 Ga0466970_0034221 Ga0466970_0034221_1142_2341 392
620 3300044842 Ga0466957_0003087 Ga0466957_0003087_4148_5326 392
621 3300044842 Ga0466957_0004452 Ga0466957_0004452_3137_4315 392
622 3300045049 Ga0466959_0155917 Ga0466959_0155917_326_1525 392
623 3300045836 Ga0466958_0005228 Ga0466958_0005228_3155_4333 392
624 3300045836 Ga0466958_0006088 Ga0466958_0006088_3484_4662 392
625 3300045836 Ga0466958_0109616 Ga0466958_0109616_240_1418 392
626 3300045976 Ga0466967_0002106 Ga0466967_0002106_6932_8131 392
627 3300045976 Ga0466967_0044740 Ga0466967_0044740_2573_3751 392
628 3300045976 Ga0466967_0191274 Ga0466967_0191274_14_1192 392
629 3300046453 Ga0495627_004139 Ga0495627_004139_4005_5231 392
630 3300046525 Ga0495663_0018317 Ga0495663_0018317_193_1392 392
631 3300046537 Ga0495598_0017285 Ga0495598_0017285_605_1804 392
632 3300046539 Ga0495621_0000088 Ga0495621_0000088_16939_18138 392
633 3300046616 Ga0495668_0023406 Ga0495668_0023406_1037_2236 392
634 3300046684 Ga0495669_0019165 Ga0495669_0019165_1012_2190 392
635 3300046691 Ga0495670_0000192 Ga0495670_0000192_6084_7283 392
636 3300046691 Ga0495670_0037787 Ga0495670_0037787_440_1660 392
637 3300048903 Ga0496100_0001321 Ga0496100_0001321_3685_4884 392
638 3300048903 Ga0496100_0064199 Ga0496100_0064199_66_1265 392
639 3300048904 Ga0496101_0000325 Ga0496101_0000325_12203_13402 392
640 3300048904 Ga0496101_0035792 Ga0496101_0035792_2237_3436 392
641 3300048905 Ga0496102_0034774 Ga0496102_0034774_1770_2969 392
642 3300048905 Ga0496102_0090651 Ga0496102_0090651_1506_2705 392
643 3300048905 Ga0496102_0107255 Ga0496102_0107255_896_2092 392
644 3300048906 Ga0496103_0033965 Ga0496103_0033965_1281_2480 392
645 3300048907 Ga0496104_0087287 Ga0496104_0087287_760_1959 392
646 3300048909 Ga0496106_0004454 Ga0496106_0004454_2227_3426 392
647 3300048909 Ga0496106_0035887 Ga0496106_0035887_1621_2820 392
648 3300048910 Ga0496107_0002192 Ga0496107_0002192_5417_6616 392
649 3300048910 Ga0496107_0031870 Ga0496107_0031870_2149_3348 392
650 3300048910 Ga0496107_0044820 Ga0496107_0044820_1906_3105 392
651 3300048911 Ga0496108_0012352 Ga0496108_0012352_4688_5887 392
652 3300048912 Ga0496109_0008023 Ga0496109_0008023_6810_8009 392
653 3300048912 Ga0496109_0049587 Ga0496109_0049587_544_1743 392
654 3300048913 Ga0496110_0013114 Ga0496110_0013114_2699_3898 392
655 3300048914 Ga0496111_0000090 Ga0496111_0000090_17717_18916 392
656 3300048914 Ga0496111_0001247 Ga0496111_0001247_10131_11330 392
657 3300048915 Ga0496112_0002770 Ga0496112_0002770_7177_8376 392
658 3300048915 Ga0496112_0013002 Ga0496112_0013002_6104_7303 392
659 3300048915 Ga0496112_0077190 Ga0496112_0077190_383_1579 392
660 3300048915 Ga0496112_0151816 Ga0496112_0151816_770_1969 392
661 3300048916 Ga0496113_0003942 Ga0496113_0003942_2734_3933 392
662 3300048917 Ga0496114_0000006 Ga0496114_0000006_420473_421672 392
663 3300048917 Ga0496114_0015065 Ga0496114_0015065_4793_5992 392
664 3300048918 Ga0496115_0116987 Ga0496115_0116987_461_1660 392
665 3300048920 Ga0496117_0049378 Ga0496117_0049378_1211_2428 392
666 3300048921 Ga0496118_0042557 Ga0496118_0042557_1211_2428 392
667 3300048925 Ga0496122_0001921 Ga0496122_0001921_25388_26605 392
668 3300048925 Ga0496122_0003416 Ga0496122_0003416_11228_12448 392
669 3300048926 Ga0496123_0000634 Ga0496123_0000634_46310_47530 392
670 3300048927 Ga0496124_0002403 Ga0496124_0002403_11328_12548 392
671 3300048928 Ga0496125_0015561 Ga0496125_0015561_1346_2566 392
672 3300048929 Ga0496126_0017351 Ga0496126_0017351_3816_5042 392
673 3300049568 Ga0501031_0000074 Ga0501031_0000074_28015_29208 392
674 3300049568 Ga0501031_0012677 Ga0501031_0012677_2391_3569 392
675 3300049569 Ga0501032_0002979 Ga0501032_0002979_4029_5222 392
676 3300049570 Ga0501033_0000637 Ga0501033_0000637_2963_4156 392
677 3300049570 Ga0501033_0006706 Ga0501033_0006706_3308_4486 392
678 3300049571 Ga0501034_0000877 Ga0501034_0000877_23317_24510 392
679 3300049572 Ga0501036_0013355 Ga0501036_0013355_4028_5221 392
680 3300049572 Ga0501036_0018516 Ga0501036_0018516_4367_5545 392
681 3300049573 Ga0501037_0000235 Ga0501037_0000235_29384_30577 392
682 3300049573 Ga0501037_0078229 Ga0501037_0078229_1162_2340 392
683 3300049574 Ga0501038_0000196 Ga0501038_0000196_29770_30963 392
684 3300049574 Ga0501038_0003100 Ga0501038_0003100_9356_10534 392
685 3300049575 Ga0501039_0000124 Ga0501039_0000124_23792_24985 392
686 3300049575 Ga0501039_0006099 Ga0501039_0006099_1174_2352 392
687 3300049576 Ga0501040_0009495 Ga0501040_0009495_2924_4102 392
688 3300049578 Ga0501042_0115557 Ga0501042_0115557_707_1900 392
689 3300049580 Ga0501046_0000844 Ga0501046_0000844_21843_23036 392
690 3300049581 Ga0501047_0000378 Ga0501047_0000378_29196_30389 392
691 3300049582 Ga0501048_0000096 Ga0501048_0000096_17608_18801 392
692 3300049582 Ga0501048_0045254 Ga0501048_0045254_1941_3119 392
693 3300049583 Ga0501067_0008008 Ga0501067_0008008_3222_4415 392
694 3300049585 Ga0501069_0000680 Ga0501069_0000680_9782_10975 392
695 3300049586 Ga0501070_0000216 Ga0501070_0000216_24374_25567 392
696 3300049589 Ga0501073_0005497 Ga0501073_0005497_235_1428 392
697 3300049590 Ga0501074_0005172 Ga0501074_0005172_5994_7187 392
698 3300049741 Ga0501079_0017665 Ga0501079_0017665_2111_3289 392
699 3300049742 Ga0501080_0000177 Ga0501080_0000177_28579_29772 392
700 3300049742 Ga0501080_0026855 Ga0501080_0026855_1901_3079 392
701 3300049743 Ga0501081_0031784 Ga0501081_0031784_2271_3449 392
702 3300049744 Ga0501083_0005982 Ga0501083_0005982_4009_5202 392
703 3300049822 Ga0501035_0000648 Ga0501035_0000648_9546_10739 392
704 3300049822 Ga0501035_0210176 Ga0501035_0210176_159_1337 392
705 3300049823 Ga0501044_0000585 Ga0501044_0000585_26812_28005 392
706 3300049823 Ga0501044_0336223 Ga0501044_0336223_23_1201 392
707 3300049824 Ga0501045_0025750 Ga0501045_0025750_2069_3247 392
708 3300049824 Ga0501045_0045512 Ga0501045_0045512_722_1921 392
709 3300049824 Ga0501045_0107332 Ga0501045_0107332_803_1996 392
710 3300050511 nmdc:mga08y16_316687_c1 nmdc:mga08y16_316687_c1_68_1267 392
711 3300050515 nmdc:mga0a205_4753_c1 nmdc:mga0a205_4753_c1_7946_9145 392
712 3300053117 Ga0500593_000149 Ga0500593_000149_16248_17453 392
713 3300053134 Ga0500658_0000115 Ga0500658_0000115_10853_12052 392
714 3300054114 Ga0501084_0001653 Ga0501084_0001653_12689_13882 392
715 3300054114 Ga0501084_0005383 Ga0501084_0005383_7607_8785 392
716 3300060353 Ga0501082_0231928 Ga0501082_0231928_398_1576 392
717 3300061719 Ga0466962_0006923 Ga0466962_0006923_2732_3910 392
718 3300061719 Ga0466962_0029238 Ga0466962_0029238_470_1669 392
719 3300061719 Ga0466962_0032090 Ga0466962_0032090_905_2104 392
720 3300061734 Ga0530510_0045537 Ga0530510_0045537_157_1335 392
721 iso_pu_bacteria 2643221615 2644089627 392
722 iso_pu_bacteria 2643221657 2644319472 392
723 iso_pu_bacteria 2738541272 2738697340 392
724 iso_pu_bacteria 2738543027 2739326767 392
725 iso_pu_bacteria 2739367654 2739606042 392
726 iso_pu_bacteria 2758568522 2760307131 392
727 iso_pu_bacteria 2758568621 2760624405 392
728 iso_pu_bacteria 2808606365 2808872606 392
729 iso_pu_bacteria 2808606394 2809029274 392
730 iso_pu_bacteria 2811994880 2812364941 392
731 iso_pu_bacteria 2835188231 2835188614 392
732 iso_pu_bacteria 2848551377 2848552824 392
733 iso_pu_bacteria 2883821847 2883824524 392
734 iso_pu_bacteria 2896429255 2896430981 392
735 iso_pu_bacteria 8056579771 8056583740 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00365

PFK

Phosphofructokinase

46

391

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xza-assembly1.cif.gz_A crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp 0.8824 2 389
3pfk-assembly1.cif.gz_A phosphofructokinase. structure and control 0.8799 2 388
4i7e-assembly1.cif.gz_D crystal structure of the bacillus stearothermophilus phosphofructokinase mutant d12a in complex with pep 0.8766 2 389
4i4i-assembly1.cif.gz_D crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep 0.8644 2 389
5xza-assembly1.cif.gz_A crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp 0.8619 2 389
ID Description Score Start End Superfamily
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8946 2 369 3.40.50.450
4wl0D03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8825 2 157 3.40.50.450
2f48B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8821 2 150 3.40.50.450
3f5mA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.873 2 148 3.40.50.450
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8697 2 369 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A7S2JYI8-F1-model_v4 Phosphofructokinase domain-containing protein 0.9905 2 117 GO:0003872
GO:0046872
AF-A0A382YSG6-F1-model_v4 Phosphofructokinase domain-containing protein 0.9851 2 120 GO:0003872
GO:0046872
AF-A0A7S1AYN6-F1-model_v4 Phosphofructokinase domain-containing protein 0.9768 2 139 GO:0003872
GO:0005829
GO:0009749
GO:0046872
AF-A0A2E2BIC8-F1-model_v4 deleted 0.9727 1 106
AF-A0A850CZ18-F1-model_v4 deleted 0.9719 1 92

Feature Viewer

pLDDT pTM Quality
91.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map