F478183

General Info

Members Datasets Scaffolds Average Seq Length
735 255 1470 94

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101742256|Ga0070713_1017422562
Length 102
Sequence VFGPEGWAMLLDAVSEVELFVNVFFDVYILAILAYILTSWVQLPYSLRPVQRFLYDACEPYLRLWRRILPFRVGAFDLSPMVAVFALIAVEQILLTVLGRLH

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 3.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.07
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 18.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_101742256 3300005436 Bacteria 605
2 rootH1_10318263 3300003323 Bacteria 2307
3 Ga0058863_11596509 3300004799 Bacteria 622
4 Ga0058861_11831151 3300004800 Bacteria 732
5 Ga0058861_11878822 3300004800 Unclassified 605
6 Ga0058862_12611363 3300004803 Bacteria 666
7 Ga0058862_12661891 3300004803 Bacteria 1135
8 Ga0070658_10011654 3300005327 Bacteria 7051
9 Ga0070658_10296871 3300005327 Bacteria 1377
10 Ga0070658_10416077 3300005327 Unclassified 1156
11 Ga0070658_10944829 3300005327 Unclassified 750
12 Ga0070658_11150855 3300005327 Unclassified 675
13 Ga0070658_11243912 3300005327 Bacteria 647
14 Ga0070658_11588302 3300005327 Bacteria 567
15 Ga0070683_100014696 3300005329 Bacteria 6858
16 Ga0070683_100033750 3300005329 Bacteria 4668
17 Ga0070683_100310901 3300005329 Bacteria 1499
18 Ga0070683_100476407 3300005329 Bacteria 1192
19 Ga0070683_100491134 3300005329 Bacteria 1172
20 Ga0070683_100555635 3300005329 Unclassified 1098
21 Ga0070690_101061516 3300005330 Unclassified 641
22 Ga0070666_11119805 3300005335 Unclassified 585
23 Ga0070680_100020219 3300005336 Bacteria 5282
24 Ga0070680_100107422 3300005336 Bacteria 2321
25 Ga0070680_100147622 3300005336 Bacteria 1973
26 Ga0070680_100197229 3300005336 Bacteria 1697
27 Ga0070680_100463495 3300005336 Bacteria 1083
28 Ga0070680_100533901 3300005336 Bacteria 1005
29 Ga0070680_100788299 3300005336 Unclassified 819
30 Ga0070680_100834072 3300005336 Bacteria 795
31 Ga0070660_100003611 3300005339 Bacteria 10692
32 Ga0070660_100006608 3300005339 Bacteria 8047
33 Ga0070660_100051211 3300005339 Bacteria 3179
34 Ga0070660_100105017 3300005339 Bacteria 2241
35 Ga0070660_100214122 3300005339 Bacteria 1564
36 Ga0070660_100316888 3300005339 Bacteria 1280
37 Ga0070660_100636610 3300005339 Bacteria 893
38 Ga0070661_100020146 3300005344 Bacteria 4755
39 Ga0070661_100070569 3300005344 Bacteria 2569
40 Ga0070661_100151903 3300005344 Bacteria 1751
41 Ga0070661_100194475 3300005344 Bacteria 1548
42 Ga0070661_100655231 3300005344 Bacteria 852
43 Ga0070661_100792816 3300005344 Bacteria 777
44 Ga0070661_101045530 3300005344 Bacteria 679
45 Ga0070671_100016842 3300005355 Bacteria 5910
46 Ga0070671_101113840 3300005355 Bacteria 693
47 Ga0070673_100354771 3300005364 Bacteria 1302
48 Ga0070659_100068194 3300005366 Bacteria 2821
49 Ga0070659_100148416 3300005366 Bacteria 1911
50 Ga0070659_101852264 3300005366 Bacteria 541
51 Ga0070659_101852848 3300005366 Bacteria 541
52 Ga0070709_10207559 3300005434 Bacteria 1391
53 Ga0070714_100061015 3300005435 Bacteria 3237
54 Ga0070714_100128444 3300005435 Bacteria 2263
55 Ga0070714_100229411 3300005435 Bacteria 1710
56 Ga0070714_100376426 3300005435 Bacteria 1338
57 Ga0070714_100676054 3300005435 Bacteria 995
58 Ga0070714_100715282 3300005435 Bacteria 967
59 Ga0070714_100900617 3300005435 Bacteria 859
60 Ga0070714_101121314 3300005435 Unclassified 767
61 Ga0070714_101318007 3300005435 Bacteria 705
62 Ga0070714_101932282 3300005435 Unclassified 576
63 Ga0070713_100176256 3300005436 Bacteria 1919
64 Ga0070713_100618717 3300005436 Bacteria 1030
65 Ga0070713_102374955 3300005436 Bacteria 513
66 Ga0070710_10319995 3300005437 Bacteria 1018
67 Ga0070710_11497549 3300005437 Unclassified 507
68 Ga0070711_100119762 3300005439 Bacteria 1945
69 Ga0070708_100519482 3300005445 Bacteria 1123
70 Ga0070678_100420577 3300005456 Bacteria 1165
71 Ga0070678_102186213 3300005456 Unclassified 525
72 Ga0070681_10001213 3300005458 Bacteria 22417
73 Ga0070681_10065555 3300005458 Bacteria 3600
74 Ga0070681_10104999 3300005458 Bacteria 2767
75 Ga0070681_10270523 3300005458 Bacteria 1610
76 Ga0070681_10600876 3300005458 Bacteria 1014
77 Ga0070681_10665058 3300005458 Bacteria 957
78 Ga0070681_10795706 3300005458 Unclassified 863
79 Ga0070698_100912672 3300005471 Unclassified 824
80 Ga0070698_101439670 3300005471 Bacteria 640
81 Ga0070679_100004486 3300005530 Bacteria 12895
82 Ga0070679_100020574 3300005530 Bacteria 6435
83 Ga0070679_100058769 3300005530 Bacteria 3832
84 Ga0070679_100136865 3300005530 Bacteria 2430
85 Ga0070679_100292527 3300005530 Bacteria 1580
86 Ga0070679_100512764 3300005530 Bacteria 1143
87 Ga0070679_100549503 3300005530 Unclassified 1099
88 Ga0070679_100815110 3300005530 Unclassified 876
89 Ga0070684_100013758 3300005535 Bacteria 6531
90 Ga0070684_100034651 3300005535 Bacteria 4317
91 Ga0070684_100318025 3300005535 Bacteria 1430
92 Ga0070684_100330605 3300005535 Bacteria 1401
93 Ga0070684_100341558 3300005535 Bacteria 1376
94 Ga0070684_100360746 3300005535 Bacteria 1337
95 Ga0070684_101206585 3300005535 Bacteria 712
96 Ga0070697_100712728 3300005536 Unclassified 886
97 Ga0068853_100092663 3300005539 Bacteria 2658
98 Ga0068853_100306706 3300005539 Bacteria 1469
99 Ga0068853_100708198 3300005539 Bacteria 961
100 Ga0068853_100801253 3300005539 Bacteria 902
101 Ga0070696_100006574 3300005546 Bacteria 7761
102 Ga0070696_101883192 3300005546 Unclassified 518
103 Ga0070665_100281583 3300005548 Bacteria 1665
104 Ga0068855_100022769 3300005563 Bacteria 7508
105 Ga0068855_100063071 3300005563 Bacteria 4326
106 Ga0068855_100132958 3300005563 Bacteria 2840
107 Ga0068855_100163556 3300005563 Bacteria 2524
108 Ga0068855_100200959 3300005563 Bacteria 2243
109 Ga0068855_100510856 3300005563 Bacteria 1305
110 Ga0068855_100556072 3300005563 Bacteria 1242
111 Ga0070664_100988054 3300005564 Bacteria 791
112 Ga0068857_100044123 3300005577 Bacteria 3954
113 Ga0068857_100088246 3300005577 Bacteria 2774
114 Ga0068857_100292510 3300005577 Bacteria 1500
115 Ga0068857_100620593 3300005577 Bacteria 1023
116 Ga0068857_102003365 3300005577 Bacteria 568
117 Ga0068854_101811561 3300005578 Unclassified 560
118 Ga0068856_100218148 3300005614 Bacteria 1923
119 Ga0068856_100333179 3300005614 Bacteria 1535
120 Ga0068856_100784388 3300005614 Bacteria 973
121 Ga0068856_100824817 3300005614 Unclassified 947
122 Ga0068852_100027110 3300005616 Bacteria 4665
123 Ga0068852_100258189 3300005616 Bacteria 1672
124 Ga0068851_10608150 3300005834 Bacteria 666
125 Ga0070717_10064666 3300006028 Bacteria 3039
126 Ga0070717_10226281 3300006028 Bacteria 1646
127 Ga0070717_10286109 3300006028 Bacteria 1463
128 Ga0070717_10466886 3300006028 Bacteria 1139
129 Ga0070715_10403900 3300006163 Bacteria 760
130 Ga0070716_100779797 3300006173 Bacteria 738
131 Ga0070716_100990470 3300006173 Bacteria 664
132 Ga0070712_100061780 3300006175 Bacteria 2647
133 Ga0070712_100128214 3300006175 Unclassified 1919
134 Ga0070712_101378596 3300006175 Bacteria 615
135 Ga0070712_101817520 3300006175 Unclassified 533
136 Ga0097621_100347645 3300006237 Bacteria 1318
137 Ga0068871_100555044 3300006358 Bacteria 1041
138 Ga0068871_100653553 3300006358 Bacteria 960
139 Ga0068871_100863694 3300006358 Bacteria 837
140 Ga0068871_102230491 3300006358 Unclassified 522
141 Ga0075433_10038807 3300006852 Bacteria 4115
142 Ga0075434_100038125 3300006871 Bacteria 4760
143 Ga0068865_100687104 3300006881 Bacteria 873
144 Ga0075436_100842737 3300006914 Bacteria 684
145 Ga0075435_100073743 3300007076 Bacteria 2791
146 Ga0075435_102046186 3300007076 Unclassified 503
147 Ga0105240_10016420 3300009093 Bacteria 10024
148 Ga0105240_10238489 3300009093 Bacteria 2109
149 Ga0105240_10289254 3300009093 Bacteria 1879
150 Ga0105240_10466430 3300009093 Bacteria 1410
151 Ga0105240_10660834 3300009093 Bacteria 1144
152 Ga0105245_10144642 3300009098 Bacteria 2242
153 Ga0105245_11206405 3300009098 Unclassified 804
154 Ga0105245_11263114 3300009098 Bacteria 787
155 Ga0114129_11867614 3300009147 Bacteria 729
156 Ga0105243_10915197 3300009148 Unclassified 873
157 Ga0105241_10360025 3300009174 Unclassified 1266
158 Ga0105241_10699621 3300009174 Bacteria 925
159 Ga0105241_10847936 3300009174 Unclassified 845
160 Ga0105241_11159294 3300009174 Unclassified 730
161 Ga0105241_11800201 3300009174 Bacteria 598
162 Ga0105242_10050202 3300009176 Bacteria 3396
163 Ga0105242_10511307 3300009176 Bacteria 1144
164 Ga0105242_10874994 3300009176 Unclassified 896
165 Ga0105237_10039262 3300009545 Bacteria 4779
166 Ga0105237_11090377 3300009545 Unclassified 805
167 Ga0105237_11352527 3300009545 Bacteria 718
168 Ga0105237_11514314 3300009545 Bacteria 677
169 Ga0105238_10051504 3300009551 Bacteria 4141
170 Ga0105238_10123201 3300009551 Bacteria 2572
171 Ga0105238_10524196 3300009551 Bacteria 1188
172 Ga0105238_10743440 3300009551 Bacteria 994
173 Ga0105238_11635108 3300009551 Unclassified 674
174 Ga0105238_12347921 3300009551 Bacteria 569
175 Ga0105239_10237715 3300010375 Bacteria 2045
176 Ga0105239_10335437 3300010375 Bacteria 1706
177 Ga0105239_11976934 3300010375 Unclassified 677
178 Ga0105246_11601761 3300011119 Bacteria 615
179 Ga0105246_11867008 3300011119 Bacteria 576
180 Ga0157373_10753344 3300013100 Bacteria 716
181 Ga0157371_10210646 3300013102 Bacteria 1394
182 Ga0157371_10570819 3300013102 Unclassified 840
183 Ga0157370_10021632 3300013104 Bacteria 6408
184 Ga0157370_10064360 3300013104 Bacteria 3472
185 Ga0157370_10070570 3300013104 Bacteria 3297
186 Ga0157370_10388142 3300013104 Bacteria 1286
187 Ga0157370_10519965 3300013104 Bacteria 1092
188 Ga0157370_10973060 3300013104 Unclassified 769
189 Ga0157369_10155660 3300013105 Bacteria 2414
190 Ga0157369_10202624 3300013105 Bacteria 2082
191 Ga0157369_10515452 3300013105 Bacteria 1237
192 Ga0157369_10649099 3300013105 Bacteria 1088
193 Ga0157369_10794367 3300013105 Unclassified 972
194 Ga0157374_10116329 3300013296 Bacteria 2576
195 Ga0157374_11275962 3300013296 Bacteria 756
196 Ga0157374_11468015 3300013296 Unclassified 705
197 Ga0157378_10324391 3300013297 Bacteria 1497
198 Ga0157378_11059795 3300013297 Unclassified 847
199 Ga0157378_11252824 3300013297 Unclassified 782
200 Ga0157372_10081192 3300013307 Bacteria 3670
201 Ga0157372_10140995 3300013307 Bacteria 2777
202 Ga0157372_10142507 3300013307 Bacteria 2762
203 Ga0157372_10548720 3300013307 Bacteria 1347
204 Ga0157372_10683127 3300013307 Bacteria 1195
205 Ga0157372_10937920 3300013307 Bacteria 1003
206 Ga0157375_11126518 3300013308 Bacteria 919
207 Ga0182008_10152147 3300014497 Unclassified 1161
208 Ga0182008_10672405 3300014497 Bacteria 588
209 Ga0157376_10768776 3300014969 Bacteria 974
210 Ga0197907_10930522 3300020069 Bacteria 674
211 Ga0197907_11151862 3300020069 Unclassified 533
212 Ga0197907_11361063 3300020069 Bacteria 1362
213 Ga0206356_10428047 3300020070 Bacteria 1987
214 Ga0206356_10429965 3300020070 Bacteria 1116
215 Ga0206356_11685916 3300020070 Bacteria 3416
216 Ga0206349_1108614 3300020075 Bacteria 701
217 Ga0206355_1054366 3300020076 Unclassified 683
218 Ga0206355_1060814 3300020076 Unclassified 592
219 Ga0206355_1721177 3300020076 Bacteria 898
220 Ga0206351_10198018 3300020077 Bacteria 733
221 Ga0206352_11259618 3300020078 Bacteria 1253
222 Ga0206350_10116138 3300020080 Bacteria 858
223 Ga0206350_10949612 3300020080 Bacteria 1060
224 Ga0206354_10139567 3300020081 Bacteria 2247
225 Ga0206354_10899407 3300020081 Bacteria 1021
226 Ga0206353_10123035 3300020082 Bacteria 3294
227 Ga0206353_10721544 3300020082 Bacteria 1907
228 Ga0206353_12056592 3300020082 Bacteria 5106
229 Ga0206353_12068744 3300020082 Unclassified 578
230 Ga0154015_1053496 3300020610 Bacteria 624
231 Ga0154015_1316928 3300020610 Unclassified 628
232 Ga0213874_10120501 3300021377 Bacteria 891
233 Ga0213875_10237802 3300021388 Bacteria 858
234 Ga0224712_10018854 3300022467 Bacteria 2314
235 Ga0224712_10095789 3300022467 Bacteria 1250
236 Ga0207692_10138561 3300025898 Archaea 1382
237 Ga0207692_10491593 3300025898 Unclassified 777
238 Ga0207692_10504185 3300025898 Unclassified 768
239 Ga0207685_10011327 3300025905 Bacteria 2677
240 Ga0207685_10319871 3300025905 Bacteria 773
241 Ga0207699_10152627 3300025906 Bacteria 1530
242 Ga0207705_10021888 3300025909 Bacteria 4561
243 Ga0207705_10121403 3300025909 Bacteria 1939
244 Ga0207705_10136378 3300025909 Bacteria 1830
245 Ga0207705_10287374 3300025909 Bacteria 1260
246 Ga0207705_10512084 3300025909 Unclassified 932
247 Ga0207705_10653238 3300025909 Bacteria 818
248 Ga0207705_10933019 3300025909 Bacteria 672
249 Ga0207654_11390618 3300025911 Bacteria 512
250 Ga0207707_10002380 3300025912 Bacteria 16951
251 Ga0207707_10034890 3300025912 Bacteria 4400
252 Ga0207707_10053386 3300025912 Bacteria 3518
253 Ga0207707_10185569 3300025912 Bacteria 1815
254 Ga0207707_10185716 3300025912 Bacteria 1814
255 Ga0207707_10227797 3300025912 Bacteria 1622
256 Ga0207707_10497417 3300025912 Bacteria 1040
257 Ga0207695_10261844 3300025913 Bacteria 1627
258 Ga0207695_10360715 3300025913 Bacteria 1340
259 Ga0207671_10054864 3300025914 Bacteria 2952
260 Ga0207671_10490275 3300025914 Unclassified 980
261 Ga0207671_10993853 3300025914 Bacteria 661
262 Ga0207693_10026100 3300025915 Bacteria 4626
263 Ga0207693_10107272 3300025915 Unclassified 2191
264 Ga0207693_10429445 3300025915 Bacteria 1033
265 Ga0207693_11144320 3300025915 Bacteria 589
266 Ga0207663_10016856 3300025916 Bacteria 4062
267 Ga0207663_10069621 3300025916 Bacteria 2264
268 Ga0207663_10079452 3300025916 Unclassified 2142
269 Ga0207663_11170464 3300025916 Unclassified 619
270 Ga0207660_10012183 3300025917 Bacteria 5620
271 Ga0207660_10093840 3300025917 Bacteria 2230
272 Ga0207660_10136020 3300025917 Bacteria 1875
273 Ga0207660_10155159 3300025917 Bacteria 1762
274 Ga0207660_10498913 3300025917 Bacteria 987
275 Ga0207660_10634303 3300025917 Bacteria 871
276 Ga0207660_10848435 3300025917 Unclassified 745
277 Ga0207660_10892777 3300025917 Unclassified 725
278 Ga0207657_10000054 3300025919 Bacteria 106767
279 Ga0207657_10001075 3300025919 Bacteria 28931
280 Ga0207657_10004160 3300025919 Bacteria 15336
281 Ga0207657_10033290 3300025919 Bacteria 4647
282 Ga0207657_10197179 3300025919 Bacteria 1622
283 Ga0207657_10337525 3300025919 Bacteria 1190
284 Ga0207657_10969627 3300025919 Bacteria 653
285 Ga0207649_10058016 3300025920 Bacteria 2423
286 Ga0207649_10327546 3300025920 Bacteria 1127
287 Ga0207649_10350243 3300025920 Bacteria 1093
288 Ga0207649_10358166 3300025920 Bacteria 1082
289 Ga0207649_10695383 3300025920 Unclassified 788
290 Ga0207649_10766771 3300025920 Unclassified 751
291 Ga0207649_11073449 3300025920 Bacteria 635
292 Ga0207652_10147522 3300025921 Bacteria 2106
293 Ga0207652_10160480 3300025921 Bacteria 2015
294 Ga0207652_10160688 3300025921 Bacteria 2014
295 Ga0207652_10166388 3300025921 Bacteria 1977
296 Ga0207652_10201891 3300025921 Bacteria 1789
297 Ga0207652_10952591 3300025921 Bacteria 756
298 Ga0207652_11196502 3300025921 Unclassified 662
299 Ga0207652_11229674 3300025921 Unclassified 651
300 Ga0207652_11852294 3300025921 Unclassified 509
301 Ga0207646_10317404 3300025922 Bacteria 1408
302 Ga0207646_10323367 3300025922 Bacteria 1394
303 Ga0207694_10534356 3300025924 Bacteria 983
304 Ga0207687_10205832 3300025927 Bacteria 1541
305 Ga0207700_10390438 3300025928 Bacteria 1218
306 Ga0207700_10652256 3300025928 Bacteria 938
307 Ga0207664_10156674 3300025929 Bacteria 1939
308 Ga0207664_10231381 3300025929 Bacteria 1607
309 Ga0207664_10337959 3300025929 Bacteria 1331
310 Ga0207664_10377808 3300025929 Bacteria 1258
311 Ga0207664_10590707 3300025929 Unclassified 997
312 Ga0207690_10043519 3300025932 Bacteria 2955
313 Ga0207690_10451550 3300025932 Bacteria 1033
314 Ga0207686_10992522 3300025934 Bacteria 681
315 Ga0207709_10654215 3300025935 Unclassified 837
316 Ga0207665_10111072 3300025939 Bacteria 1926
317 Ga0207665_10237768 3300025939 Bacteria 1341
318 Ga0207665_10997836 3300025939 Bacteria 666
319 Ga0207661_10026264 3300025944 Bacteria 4434
320 Ga0207661_10218085 3300025944 Bacteria 1685
321 Ga0207661_10418043 3300025944 Bacteria 1217
322 Ga0207661_10652825 3300025944 Bacteria 967
323 Ga0207661_11825387 3300025944 Unclassified 553
324 Ga0207679_10147944 3300025945 Bacteria 1908
325 Ga0207679_11387893 3300025945 Bacteria 645
326 Ga0207667_10040671 3300025949 Bacteria 4950
327 Ga0207667_10096249 3300025949 Bacteria 3055
328 Ga0207667_10175124 3300025949 Bacteria 2204
329 Ga0207667_10310584 3300025949 Bacteria 1610
330 Ga0207667_10330871 3300025949 Unclassified 1555
331 Ga0207667_10415856 3300025949 Bacteria 1368
332 Ga0207667_11119018 3300025949 Bacteria 770
333 Ga0207640_10522246 3300025981 Bacteria 993
334 Ga0207640_11581895 3300025981 Unclassified 590
335 Ga0207658_10130663 3300025986 Bacteria 2017
336 Ga0207677_10115980 3300026023 Bacteria 2004
337 Ga0207639_10056492 3300026041 Bacteria 3009
338 Ga0207639_10269163 3300026041 Bacteria 1494
339 Ga0207639_10682248 3300026041 Bacteria 952
340 Ga0207639_12202683 3300026041 Bacteria 512
341 Ga0207678_11135068 3300026067 Unclassified 692
342 Ga0207702_10032479 3300026078 Unclassified 4356
343 Ga0207702_10143631 3300026078 Bacteria 2163
344 Ga0207702_10688072 3300026078 Bacteria 1007
345 Ga0207702_11591926 3300026078 Bacteria 647
346 Ga0207674_10056847 3300026116 Bacteria 3969
347 Ga0207674_10066998 3300026116 Bacteria 3615
348 Ga0207674_10358692 3300026116 Bacteria 1409
349 Ga0207683_10447707 3300026121 Bacteria 1190
350 Ga0207698_10095007 3300026142 Bacteria 2453
351 Ga0207698_10218876 3300026142 Bacteria 1719
352 Ga0207698_10685427 3300026142 Bacteria 1018
353 Ga0268266_10253992 3300028379 Unclassified 1627
354 Ga0265319_1036087 3300028563 Bacteria 1693
355 Ga0265334_10013764 3300028573 Bacteria 3382
356 Ga0265318_10048967 3300028577 Bacteria 1591
357 Ga0265322_10040434 3300028654 Bacteria 1327
358 Ga0265336_10268026 3300028666 Unclassified 507
359 Ga0265324_10230764 3300029957 Unclassified 628
360 Ga0265330_10064920 3300031235 Bacteria 1585
361 Ga0265320_10046447 3300031240 Bacteria 2128
362 Ga0265325_10074032 3300031241 Bacteria 1704
363 Ga0265329_10155352 3300031242 Bacteria 742
364 Ga0265340_10063816 3300031247 Bacteria 1757
365 Ga0265339_10441662 3300031249 Unclassified 604
366 Ga0265327_10016624 3300031251 Bacteria 4661
367 Ga0265316_10031777 3300031344 Bacteria 4313
368 Ga0265313_10030460 3300031595 Bacteria 2778
369 Ga0265314_10214934 3300031711 Bacteria 1126
370 Ga0265314_10235694 3300031711 Bacteria 1059
371 Ga0265342_10079201 3300031712 Bacteria 1900
372 Ga0373926_0198757 3300035083 Bacteria 771
373 Ga0373926_0298366 3300035083 Unclassified 629
374 Ga0373936_0009649 3300035113 Bacteria 3638
375 Ga0373936_0090715 3300035113 Unclassified 1281
376 Ga0373945_0023282 3300035116 Bacteria 2139
377 Ga0373945_0194304 3300035116 Unclassified 840
378 Ga0373956_0522272 3300035119 Unclassified 567
379 Ga0373943_0000101 3300035170 Bacteria 31609
380 Ga0373943_0001881 3300035170 Bacteria 9492
381 Ga0373943_0021015 3300035170 Bacteria 3014
382 Ga0373946_0006107 3300035171 Bacteria 4362
383 Ga0373946_0079806 3300035171 Bacteria 1430
384 Ga0373946_0193601 3300035171 Bacteria 971
385 Ga0373955_0247281 3300035172 Bacteria 1069
386 Ga0373931_1300492 3300035691 Bacteria 500
387 Ga0373935_0026073 3300035692 Bacteria 3605
388 Ga0373935_0052840 3300035692 Unclassified 2584
389 Ga0373935_0295829 3300035692 Bacteria 1143
390 Ga0373927_0053528 3300035695 Bacteria 2611
391 Ga0373927_0093584 3300035695 Bacteria 1953
392 Ga0373927_0429770 3300035695 Unclassified 872
393 Ga0373933_0192407 3300035724 Unclassified 1303
394 Ga0373947_0004085 3300035725 Bacteria 8591
395 Ga0373947_0005625 3300035725 Bacteria 7308
396 Ga0373947_0039963 3300035725 Bacteria 2793
397 Ga0373937_0283207 3300036401 Unclassified 1565
398 Ga0373937_0471658 3300036401 Bacteria 1192
399 Ga0373925_0001828 3300037068 Bacteria 17755
400 Ga0373925_0148942 3300037068 Bacteria 1836
401 Ga0395899_0023795 3300037312 Bacteria 4635
402 Ga0395899_0085357 3300037312 Bacteria 2293
403 Ga0395900_0021884 3300037418 Bacteria 6537
404 Ga0395900_0114172 3300037418 Bacteria 2772
405 Ga0395900_0183662 3300037418 Bacteria 2124
406 Ga0395900_0266290 3300037418 Bacteria 1710
407 Ga0395900_0937121 3300037418 Bacteria 788
408 Ga0395900_1211859 3300037418 Bacteria 670
409 Ga0395898_0001509 3300037466 Bacteria 32076
410 Ga0395898_0004411 3300037466 Bacteria 15397
411 Ga0395898_0091755 3300037466 Bacteria 2922
412 Ga0395898_0153557 3300037466 Bacteria 2203
413 Ga0395898_0442076 3300037466 Bacteria 1239
414 Ga0395905_0045512 3300037471 Bacteria 4115
415 Ga0395905_0265388 3300037471 Bacteria 1602
416 Ga0395905_1292120 3300037471 Bacteria 633
417 Ga0436364_0244893 3300037853 Bacteria 1243
418 Ga0395901_0009334 3300038443 Bacteria 9945
419 Ga0395901_0276606 3300038443 Bacteria 1745
420 Ga0395901_0301484 3300038443 Bacteria 1661
421 Ga0395901_0772371 3300038443 Bacteria 952
422 Ga0436365_0007111 3300039437 Bacteria 973
423 Ga0436365_0008576 3300039437 Bacteria 1109
424 Ga0436365_0644646 3300039437 Bacteria 623
425 Ga0436363_0783829 3300039450 Bacteria 927
426 Ga0436363_0811044 3300039450 Bacteria 721
427 Ga0436363_0979416 3300039450 Unclassified 630
428 Ga0436363_1065067 3300039450 Bacteria 1104
429 Ga0436362_0326961 3300039453 Bacteria 724
430 Ga0451789_0989819 3300041443 Unclassified 687
431 Ga0451802_0769261 3300041460 Bacteria 535
432 Ga0451853_1672016 3300041512 Bacteria 759
433 Ga0466972_0480817 3300044658 Bacteria 584
434 Ga0466965_0162990 3300044683 Bacteria 1170
435 Ga0466965_0746125 3300044683 Unclassified 564
436 Ga0466966_0008410 3300044684 Bacteria 6827
437 Ga0466966_0125538 3300044684 Bacteria 1574
438 Ga0466966_0199752 3300044684 Bacteria 1210
439 Ga0466961_0019467 3300044693 Bacteria 4366
440 Ga0466961_0026671 3300044693 Bacteria 3714
441 Ga0466961_0080613 3300044693 Bacteria 2060
442 Ga0466963_0003862 3300044694 Bacteria 8649
443 Ga0466963_0004394 3300044694 Bacteria 8190
444 Ga0466963_0011736 3300044694 Bacteria 5342
445 Ga0466963_0022077 3300044694 Bacteria 4026
446 Ga0466963_0034324 3300044694 Bacteria 3300
447 Ga0466963_0489629 3300044694 Bacteria 868
448 Ga0466963_0751444 3300044694 Bacteria 688
449 Ga0466963_0935951 3300044694 Bacteria 610
450 Ga0466964_0002916 3300044706 Bacteria 6178
451 Ga0466964_0002988 3300044706 Bacteria 6122
452 Ga0466964_0009352 3300044706 Bacteria 3689
453 Ga0466964_0017077 3300044706 Bacteria 2776
454 Ga0466964_0649753 3300044706 Bacteria 583
455 Ga0466971_0000282 3300044719 Bacteria 19481
456 Ga0466971_0151659 3300044719 Bacteria 1082
457 Ga0466971_0539798 3300044719 Unclassified 578
458 Ga0466968_0421634 3300044735 Bacteria 656
459 Ga0466970_0633817 3300044765 Bacteria 621
460 Ga0466957_0002174 3300044842 Bacteria 10505
461 Ga0466957_0047874 3300044842 Bacteria 2598
462 Ga0466957_0119300 3300044842 Bacteria 1680
463 Ga0466957_0321553 3300044842 Unclassified 1044
464 Ga0466957_0914483 3300044842 Bacteria 627
465 Ga0466957_1117824 3300044842 Bacteria 568
466 Ga0466960_0192719 3300044901 Bacteria 1110
467 Ga0466959_0007644 3300045049 Bacteria 7601
468 Ga0466959_0033459 3300045049 Bacteria 3801
469 Ga0466959_0034408 3300045049 Bacteria 3747
470 Ga0466959_0113114 3300045049 Bacteria 1935
471 Ga0466959_0651726 3300045049 Bacteria 707
472 Ga0466958_0004124 3300045836 Bacteria 7626
473 Ga0466958_0012056 3300045836 Bacteria 4885
474 Ga0466958_0288138 3300045836 Bacteria 1053
475 Ga0466958_0323307 3300045836 Bacteria 991
476 Ga0466967_0010340 3300045976 Bacteria 6994
477 Ga0466967_0015053 3300045976 Bacteria 6052
478 Ga0466967_0022022 3300045976 Bacteria 5190
479 Ga0466967_0026965 3300045976 Bacteria 4770
480 Ga0466967_0047524 3300045976 Bacteria 3741
481 Ga0466967_0051218 3300045976 Bacteria 3617
482 Ga0466967_0114041 3300045976 Bacteria 2487
483 Ga0466967_0120211 3300045976 Bacteria 2426
484 Ga0466967_0125131 3300045976 Bacteria 2380
485 Ga0466967_0201452 3300045976 Bacteria 1885
486 Ga0466967_0374137 3300045976 Bacteria 1382
487 Ga0466967_0449371 3300045976 Unclassified 1259
488 Ga0466967_0473827 3300045976 Bacteria 1226
489 Ga0466967_0542474 3300045976 Bacteria 1144
490 Ga0466967_0701550 3300045976 Bacteria 1002
491 Ga0466967_0793879 3300045976 Bacteria 940
492 Ga0466967_1331551 3300045976 Unclassified 715
493 Ga0466967_2366019 3300045976 Unclassified 527
494 Ga0495592_0352349 3300046454 Bacteria 943
495 Ga0495629_0159054 3300046459 Bacteria 1569
496 Ga0495629_0359342 3300046459 Unclassified 993
497 Ga0495641_0000374 3300046461 Bacteria 37120
498 Ga0495641_0028226 3300046461 Bacteria 2718
499 Ga0495641_0092247 3300046461 Unclassified 1353
500 Ga0495641_0191687 3300046461 Bacteria 916
501 Ga0495641_0236485 3300046461 Unclassified 820
502 Ga0495641_0250725 3300046461 Bacteria 796
503 Ga0495651_0018440 3300046462 Bacteria 5405
504 Ga0495651_0028003 3300046462 Unclassified 4392
505 Ga0495651_0071904 3300046462 Bacteria 2629
506 Ga0495651_0860151 3300046462 Bacteria 556
507 Ga0495653_0015646 3300046463 Bacteria 6183
508 Ga0495653_0123619 3300046463 Bacteria 1840
509 Ga0495653_0213398 3300046463 Bacteria 1302
510 Ga0495653_0308685 3300046463 Bacteria 1029
511 Ga0495653_0392811 3300046463 Unclassified 883
512 Ga0495582_0000124 3300046473 Bacteria 41197
513 Ga0495582_0058377 3300046473 Bacteria 2128
514 Ga0495582_0314568 3300046473 Bacteria 901
515 Ga0495582_0403060 3300046473 Bacteria 789
516 Ga0495582_0873677 3300046473 Bacteria 520
517 Ga0495605_0054425 3300046474 Bacteria 1938
518 Ga0495639_0000786 3300046475 Bacteria 14467
519 Ga0495639_0322699 3300046475 Bacteria 772
520 Ga0495662_0000898 3300046476 Bacteria 14537
521 Ga0495664_0018607 3300046477 Bacteria 3984
522 Ga0495664_0035313 3300046477 Bacteria 2943
523 Ga0495664_0097484 3300046477 Bacteria 1770
524 Ga0495664_0655644 3300046477 Unclassified 622
525 Ga0495594_0085096 3300046499 Unclassified 1769
526 Ga0495608_0010122 3300046511 Bacteria 6580
527 Ga0495608_0029476 3300046511 Bacteria 3721
528 Ga0495608_0127601 3300046511 Bacteria 1629
529 Ga0495608_0283204 3300046511 Unclassified 1028
530 Ga0495618_0218690 3300046514 Unclassified 1202
531 Ga0495618_0579624 3300046514 Bacteria 669
532 Ga0495628_0026156 3300046516 Bacteria 4764
533 Ga0495628_0079309 3300046516 Unclassified 2553
534 Ga0495628_0105848 3300046516 Bacteria 2167
535 Ga0495628_0291974 3300046516 Unclassified 1208
536 Ga0495630_0029084 3300046517 Bacteria 4107
537 Ga0495630_0110340 3300046517 Bacteria 2084
538 Ga0495666_0166133 3300046526 Bacteria 1022
539 Ga0495652_0311192 3300046529 Bacteria 1141
540 Ga0495652_0314960 3300046529 Bacteria 1132
541 Ga0495665_0086584 3300046531 Unclassified 1646
542 Ga0495665_0086623 3300046531 Bacteria 1646
543 Ga0495665_0631266 3300046531 Unclassified 534
544 Ga0495640_0019423 3300046533 Bacteria 5015
545 Ga0495640_0090361 3300046533 Bacteria 2022
546 Ga0495586_0369894 3300046535 Bacteria 824
547 Ga0495586_0902520 3300046535 Bacteria 509
548 Ga0495587_0098432 3300046536 Bacteria 1686
549 Ga0495587_0113705 3300046536 Unclassified 1553
550 Ga0495587_0347101 3300046536 Unclassified 827
551 Ga0495645_0178400 3300046543 Bacteria 1457
552 Ga0495645_0221156 3300046543 Unclassified 1273
553 Ga0495622_0219251 3300046557 Bacteria 843
554 Ga0495667_0002397 3300046559 Bacteria 12532
555 Ga0495667_0020012 3300046559 Bacteria 4513
556 Ga0495667_0032795 3300046559 Bacteria 3477
557 Ga0495667_0045214 3300046559 Bacteria 2916
558 Ga0495634_0075065 3300046642 Bacteria 2221
559 Ga0495634_0457328 3300046642 Unclassified 752
560 Ga0495635_0030531 3300046663 Bacteria 3745
561 Ga0495635_0036436 3300046663 Bacteria 3410
562 Ga0495635_0118691 3300046663 Bacteria 1805
563 Ga0495588_0734388 3300046674 Bacteria 516
564 Ga0495657_0027919 3300046675 Bacteria 3974
565 Ga0495657_0028795 3300046675 Bacteria 3902
566 Ga0495657_0199563 3300046675 Bacteria 1220
567 Ga0495657_0340598 3300046675 Bacteria 889
568 Ga0495657_0370545 3300046675 Bacteria 845
569 Ga0495599_0092733 3300046678 Unclassified 1884
570 Ga0495599_0194893 3300046678 Unclassified 1245
571 Ga0495599_0373445 3300046678 Bacteria 852
572 Ga0495623_0040204 3300046679 Bacteria 2986
573 Ga0495646_0035388 3300046680 Bacteria 3098
574 Ga0495646_0078933 3300046680 Bacteria 1923
575 Ga0495646_0082304 3300046680 Bacteria 1873
576 Ga0495647_0004080 3300046681 Bacteria 4720
577 Ga0495647_0601875 3300046681 Bacteria 516
578 Ga0495647_0616179 3300046681 Bacteria 510
579 Ga0495658_0000247 3300046683 Bacteria 30977
580 Ga0495658_0032563 3300046683 Bacteria 2848
581 Ga0495658_0070745 3300046683 Bacteria 2025
582 Ga0495613_0013675 3300046689 Bacteria 6021
583 Ga0495613_0032931 3300046689 Bacteria 3851
584 Ga0495613_0693818 3300046689 Unclassified 671
585 Ga0495624_0010741 3300046690 Bacteria 6310
586 Ga0495624_0109848 3300046690 Unclassified 1696
587 Ga0495624_0498767 3300046690 Unclassified 728
588 Ga0495624_0551431 3300046690 Bacteria 688
589 Ga0495624_0680530 3300046690 Bacteria 611
590 Ga0495600_0017559 3300046809 Bacteria 4553
591 Ga0495600_0059533 3300046809 Bacteria 2495
592 Ga0495600_0504629 3300046809 Bacteria 743
593 Ga0495581_0003701 3300047315 Bacteria 8805
594 Ga0495581_0116740 3300047315 Bacteria 1552
595 Ga0495581_0402584 3300047315 Bacteria 798
596 Ga0495604_0016420 3300047317 Bacteria 5918
597 Ga0495604_0033832 3300047317 Bacteria 4045
598 Ga0495604_0083229 3300047317 Bacteria 2392
599 Ga0495604_0259618 3300047317 Bacteria 1181
600 Ga0495674_0003941 3300047319 Bacteria 14400
601 Ga0495674_0019510 3300047319 Bacteria 6289
602 Ga0495674_0129472 3300047319 Bacteria 2127
603 Ga0495674_0257792 3300047319 Bacteria 1433
604 Ga0495676_0001077 3300047321 Bacteria 23118
605 Ga0495680_0006023 3300047322 Bacteria 11341
606 Ga0495680_0011046 3300047322 Bacteria 8022
607 Ga0495680_0036742 3300047322 Unclassified 3929
608 Ga0495680_0555427 3300047322 Bacteria 773
609 Ga0495675_0290391 3300047444 Unclassified 973
610 Ga0495675_0357632 3300047444 Bacteria 858
611 Ga0495675_0628620 3300047444 Bacteria 607
612 Ga0495684_0001855 3300047471 Bacteria 16919
613 Ga0495684_0018726 3300047471 Bacteria 5333
614 Ga0495684_0283913 3300047471 Unclassified 1193
615 Ga0495593_0012759 3300047673 Bacteria 4798
616 Ga0495593_0129579 3300047673 Bacteria 1281
617 Ga0495602_0122289 3300048088 Bacteria 2092
618 Ga0495602_0150988 3300048088 Bacteria 1826
619 Ga0495602_0193124 3300048088 Bacteria 1559
620 Ga0495602_0577756 3300048088 Unclassified 775
621 Ga0495614_0013434 3300048089 Bacteria 3592
622 Ga0495614_0074716 3300048089 Unclassified 1464
623 Ga0495614_0331388 3300048089 Bacteria 707
624 Ga0496100_0001575 3300048903 Bacteria 11237
625 Ga0496100_0010229 3300048903 Bacteria 5306
626 Ga0496100_0071371 3300048903 Bacteria 2318
627 Ga0496100_0402453 3300048903 Unclassified 1043
628 Ga0496101_0012134 3300048904 Bacteria 5743
629 Ga0496101_0012361 3300048904 Bacteria 5696
630 Ga0496101_0045876 3300048904 Bacteria 3132
631 Ga0496101_0058115 3300048904 Bacteria 2799
632 Ga0496101_0193072 3300048904 Bacteria 1572
633 Ga0496102_0062684 3300048905 Bacteria 3405
634 Ga0496102_0219062 3300048905 Bacteria 1794
635 Ga0496102_0340261 3300048905 Bacteria 1413
636 Ga0496102_0633389 3300048905 Unclassified 992
637 Ga0496103_0071012 3300048906 Bacteria 2179
638 Ga0496103_0095128 3300048906 Bacteria 1882
639 Ga0496103_0232184 3300048906 Bacteria 1187
640 Ga0496103_0745970 3300048906 Bacteria 619
641 Ga0496103_0787844 3300048906 Unclassified 600
642 Ga0496103_0924022 3300048906 Bacteria 546
643 Ga0496103_0959002 3300048906 Unclassified 534
644 Ga0496104_0089440 3300048907 Bacteria 2941
645 Ga0496104_0136449 3300048907 Bacteria 2357
646 Ga0496104_0860390 3300048907 Bacteria 812
647 Ga0496105_0028970 3300048908 Bacteria 4530
648 Ga0496105_0034310 3300048908 Bacteria 4172
649 Ga0496105_0460266 3300048908 Unclassified 1003
650 Ga0496105_0463314 3300048908 Bacteria 999
651 Ga0496106_0017922 3300048909 Bacteria 5237
652 Ga0496106_0060221 3300048909 Bacteria 2877
653 Ga0496106_0176793 3300048909 Bacteria 1693
654 Ga0496107_0045134 3300048910 Bacteria 3169
655 Ga0496107_0063540 3300048910 Bacteria 2675
656 Ga0496107_0207827 3300048910 Bacteria 1455
657 Ga0496107_1065703 3300048910 Unclassified 585
658 Ga0496108_0028066 3300048911 Bacteria 4656
659 Ga0496108_0181259 3300048911 Bacteria 1824
660 Ga0496108_1619868 3300048911 Bacteria 535
661 Ga0496109_0017699 3300048912 Bacteria 6251
662 Ga0496109_0409127 3300048912 Unclassified 1282
663 Ga0496109_0410478 3300048912 Bacteria 1279
664 Ga0496110_0119476 3300048913 Bacteria 2374
665 Ga0496110_1067199 3300048913 Unclassified 716
666 Ga0496110_1160701 3300048913 Bacteria 681
667 Ga0496111_0028408 3300048914 Bacteria 3964
668 Ga0496111_0400626 3300048914 Bacteria 1014
669 Ga0496111_0800764 3300048914 Bacteria 682
670 Ga0496111_1301213 3300048914 Unclassified 512
671 Ga0496112_0021620 3300048915 Bacteria 6119
672 Ga0496112_0069713 3300048915 Bacteria 3473
673 Ga0496112_0081215 3300048915 Bacteria 3206
674 Ga0496112_0098797 3300048915 Bacteria 2888
675 Ga0496112_0102149 3300048915 Bacteria 2837
676 Ga0496112_0163385 3300048915 Bacteria 2193
677 Ga0496112_0442222 3300048915 Unclassified 1238
678 Ga0496112_0469710 3300048915 Bacteria 1195
679 Ga0496112_0760301 3300048915 Bacteria 895
680 Ga0496112_1172625 3300048915 Bacteria 685
681 Ga0496113_0452541 3300048916 Bacteria 1032
682 Ga0496113_1518759 3300048916 Unclassified 517
683 Ga0496114_0001536 3300048917 Bacteria 17490
684 Ga0496114_0012463 3300048917 Bacteria 6806
685 Ga0496114_0044736 3300048917 Bacteria 3675
686 Ga0496114_0165087 3300048917 Bacteria 1927
687 Ga0496114_0301577 3300048917 Bacteria 1414
688 Ga0496114_0468153 3300048917 Bacteria 1115
689 Ga0496115_0006958 3300048918 Bacteria 8308
690 Ga0496115_0007667 3300048918 Bacteria 7953
691 Ga0496115_0016034 3300048918 Bacteria 5698
692 Ga0496115_0079832 3300048918 Bacteria 2663
693 Ga0496115_0092031 3300048918 Bacteria 2479
694 Ga0496115_0489336 3300048918 Bacteria 990
695 Ga0496115_0848060 3300048918 Unclassified 708
696 Ga0501038_1035824 3300049574 Bacteria 601
697 Ga0501047_0036325 3300049581 Bacteria 4762
698 Ga0501067_0000684 3300049583 Bacteria 18236
699 Ga0501067_0040552 3300049583 Bacteria 2585
700 Ga0501067_0404865 3300049583 Bacteria 761
701 Ga0501067_0480507 3300049583 Unclassified 695
702 Ga0501069_0085031 3300049585 Bacteria 1785
703 Ga0501069_0116351 3300049585 Bacteria 1525
704 Ga0501069_0546615 3300049585 Bacteria 693
705 Ga0501070_0059846 3300049586 Bacteria 3157
706 Ga0501070_0535568 3300049586 Bacteria 938
707 Ga0501070_1470355 3300049586 Bacteria 516
708 Ga0501073_0262784 3300049589 Bacteria 1191
709 Ga0501074_0060768 3300049590 Bacteria 2722
710 Ga0501074_0809281 3300049590 Bacteria 660
711 Ga0501079_0304870 3300049741 Unclassified 1246
712 Ga0501080_0596119 3300049742 Bacteria 981
713 Ga0501044_0377656 3300049823 Bacteria 1333
714 nmdc:mga05p37_1332511_c1 3300050507 Bacteria 729
715 nmdc:mga0n895_6128_c1 3300050512 Bacteria 10157
716 nmdc:mga0rr50_519562_c1 3300050513 Unclassified 514
717 nmdc:mga0rr50_65197_c1 3300050513 Bacteria 2758
718 nmdc:mga0a205_113505_c1 3300050515 Bacteria 2608
719 nmdc:mga0a205_13182_c2 3300050515 Bacteria 4726
720 Ga0495601_0140522 3300053077 Bacteria 1575
721 Ga0495601_0349453 3300053077 Unclassified 961
722 Ga0495601_0591430 3300053077 Unclassified 712
723 Ga0495612_0059843 3300053078 Bacteria 1576
724 Ga0495612_0115817 3300053078 Bacteria 1150
725 Ga0495612_0119035 3300053078 Unclassified 1135
726 Ga0495655_0012607 3300053083 Bacteria 1727
727 Ga0495595_0018976 3300053084 Unclassified 2978
728 Ga0495595_0039102 3300053084 Bacteria 2164
729 Ga0495595_0095196 3300053084 Bacteria 1432
730 Ga0495595_0153361 3300053084 Bacteria 1134
731 Ga0495619_0025945 3300053085 Bacteria 3767
732 Ga0466962_0006119 3300061719 Bacteria 5785
733 Ga0466962_0017977 3300061719 Bacteria 3402
734 Ga0466962_0165499 3300061719 Unclassified 1076
735 Ga0466962_0541639 3300061719 Bacteria 591
736 Ga0070713_101742256
737 rootH1_10318263
738 Ga0058863_11596509
739 Ga0058861_11831151
740 Ga0058861_11878822
741 Ga0058862_12611363
742 Ga0058862_12661891
743 Ga0070658_10011654
744 Ga0070658_10296871
745 Ga0070658_10416077
746 Ga0070658_10944829
747 Ga0070658_11150855
748 Ga0070658_11243912
749 Ga0070658_11588302
750 Ga0070683_100014696
751 Ga0070683_100033750
752 Ga0070683_100310901
753 Ga0070683_100476407
754 Ga0070683_100491134
755 Ga0070683_100555635
756 Ga0070690_101061516
757 Ga0070666_11119805
758 Ga0070680_100020219
759 Ga0070680_100107422
760 Ga0070680_100147622
761 Ga0070680_100197229
762 Ga0070680_100463495
763 Ga0070680_100533901
764 Ga0070680_100788299
765 Ga0070680_100834072
766 Ga0070660_100003611
767 Ga0070660_100006608
768 Ga0070660_100051211
769 Ga0070660_100105017
770 Ga0070660_100214122
771 Ga0070660_100316888
772 Ga0070660_100636610
773 Ga0070661_100020146
774 Ga0070661_100070569
775 Ga0070661_100151903
776 Ga0070661_100194475
777 Ga0070661_100655231
778 Ga0070661_100792816
779 Ga0070661_101045530
780 Ga0070671_100016842
781 Ga0070671_101113840
782 Ga0070673_100354771
783 Ga0070659_100068194
784 Ga0070659_100148416
785 Ga0070659_101852264
786 Ga0070659_101852848
787 Ga0070709_10207559
788 Ga0070714_100061015
789 Ga0070714_100128444
790 Ga0070714_100229411
791 Ga0070714_100376426
792 Ga0070714_100676054
793 Ga0070714_100715282
794 Ga0070714_100900617
795 Ga0070714_101121314
796 Ga0070714_101318007
797 Ga0070714_101932282
798 Ga0070713_100176256
799 Ga0070713_100618717
800 Ga0070713_102374955
801 Ga0070710_10319995
802 Ga0070710_11497549
803 Ga0070711_100119762
804 Ga0070708_100519482
805 Ga0070678_100420577
806 Ga0070678_102186213
807 Ga0070681_10001213
808 Ga0070681_10065555
809 Ga0070681_10104999
810 Ga0070681_10270523
811 Ga0070681_10600876
812 Ga0070681_10665058
813 Ga0070681_10795706
814 Ga0070698_100912672
815 Ga0070698_101439670
816 Ga0070679_100004486
817 Ga0070679_100020574
818 Ga0070679_100058769
819 Ga0070679_100136865
820 Ga0070679_100292527
821 Ga0070679_100512764
822 Ga0070679_100549503
823 Ga0070679_100815110
824 Ga0070684_100013758
825 Ga0070684_100034651
826 Ga0070684_100318025
827 Ga0070684_100330605
828 Ga0070684_100341558
829 Ga0070684_100360746
830 Ga0070684_101206585
831 Ga0070697_100712728
832 Ga0068853_100092663
833 Ga0068853_100306706
834 Ga0068853_100708198
835 Ga0068853_100801253
836 Ga0070696_100006574
837 Ga0070696_101883192
838 Ga0070665_100281583
839 Ga0068855_100022769
840 Ga0068855_100063071
841 Ga0068855_100132958
842 Ga0068855_100163556
843 Ga0068855_100200959
844 Ga0068855_100510856
845 Ga0068855_100556072
846 Ga0070664_100988054
847 Ga0068857_100044123
848 Ga0068857_100088246
849 Ga0068857_100292510
850 Ga0068857_100620593
851 Ga0068857_102003365
852 Ga0068854_101811561
853 Ga0068856_100218148
854 Ga0068856_100333179
855 Ga0068856_100784388
856 Ga0068856_100824817
857 Ga0068852_100027110
858 Ga0068852_100258189
859 Ga0068851_10608150
860 Ga0070717_10064666
861 Ga0070717_10226281
862 Ga0070717_10286109
863 Ga0070717_10466886
864 Ga0070715_10403900
865 Ga0070716_100779797
866 Ga0070716_100990470
867 Ga0070712_100061780
868 Ga0070712_100128214
869 Ga0070712_101378596
870 Ga0070712_101817520
871 Ga0097621_100347645
872 Ga0068871_100555044
873 Ga0068871_100653553
874 Ga0068871_100863694
875 Ga0068871_102230491
876 Ga0075433_10038807
877 Ga0075434_100038125
878 Ga0068865_100687104
879 Ga0075436_100842737
880 Ga0075435_100073743
881 Ga0075435_102046186
882 Ga0105240_10016420
883 Ga0105240_10238489
884 Ga0105240_10289254
885 Ga0105240_10466430
886 Ga0105240_10660834
887 Ga0105245_10144642
888 Ga0105245_11206405
889 Ga0105245_11263114
890 Ga0114129_11867614
891 Ga0105243_10915197
892 Ga0105241_10360025
893 Ga0105241_10699621
894 Ga0105241_10847936
895 Ga0105241_11159294
896 Ga0105241_11800201
897 Ga0105242_10050202
898 Ga0105242_10511307
899 Ga0105242_10874994
900 Ga0105237_10039262
901 Ga0105237_11090377
902 Ga0105237_11352527
903 Ga0105237_11514314
904 Ga0105238_10051504
905 Ga0105238_10123201
906 Ga0105238_10524196
907 Ga0105238_10743440
908 Ga0105238_11635108
909 Ga0105238_12347921
910 Ga0105239_10237715
911 Ga0105239_10335437
912 Ga0105239_11976934
913 Ga0105246_11601761
914 Ga0105246_11867008
915 Ga0157373_10753344
916 Ga0157371_10210646
917 Ga0157371_10570819
918 Ga0157370_10021632
919 Ga0157370_10064360
920 Ga0157370_10070570
921 Ga0157370_10388142
922 Ga0157370_10519965
923 Ga0157370_10973060
924 Ga0157369_10155660
925 Ga0157369_10202624
926 Ga0157369_10515452
927 Ga0157369_10649099
928 Ga0157369_10794367
929 Ga0157374_10116329
930 Ga0157374_11275962
931 Ga0157374_11468015
932 Ga0157378_10324391
933 Ga0157378_11059795
934 Ga0157378_11252824
935 Ga0157372_10081192
936 Ga0157372_10140995
937 Ga0157372_10142507
938 Ga0157372_10548720
939 Ga0157372_10683127
940 Ga0157372_10937920
941 Ga0157375_11126518
942 Ga0182008_10152147
943 Ga0182008_10672405
944 Ga0157376_10768776
945 Ga0197907_10930522
946 Ga0197907_11151862
947 Ga0197907_11361063
948 Ga0206356_10428047
949 Ga0206356_10429965
950 Ga0206356_11685916
951 Ga0206349_1108614
952 Ga0206355_1054366
953 Ga0206355_1060814
954 Ga0206355_1721177
955 Ga0206351_10198018
956 Ga0206352_11259618
957 Ga0206350_10116138
958 Ga0206350_10949612
959 Ga0206354_10139567
960 Ga0206354_10899407
961 Ga0206353_10123035
962 Ga0206353_10721544
963 Ga0206353_12056592
964 Ga0206353_12068744
965 Ga0154015_1053496
966 Ga0154015_1316928
967 Ga0213874_10120501
968 Ga0213875_10237802
969 Ga0224712_10018854
970 Ga0224712_10095789
971 Ga0207692_10138561
972 Ga0207692_10491593
973 Ga0207692_10504185
974 Ga0207685_10011327
975 Ga0207685_10319871
976 Ga0207699_10152627
977 Ga0207705_10021888
978 Ga0207705_10121403
979 Ga0207705_10136378
980 Ga0207705_10287374
981 Ga0207705_10512084
982 Ga0207705_10653238
983 Ga0207705_10933019
984 Ga0207654_11390618
985 Ga0207707_10002380
986 Ga0207707_10034890
987 Ga0207707_10053386
988 Ga0207707_10185569
989 Ga0207707_10185716
990 Ga0207707_10227797
991 Ga0207707_10497417
992 Ga0207695_10261844
993 Ga0207695_10360715
994 Ga0207671_10054864
995 Ga0207671_10490275
996 Ga0207671_10993853
997 Ga0207693_10026100
998 Ga0207693_10107272
999 Ga0207693_10429445
1000 Ga0207693_11144320
1001 Ga0207663_10016856
1002 Ga0207663_10069621
1003 Ga0207663_10079452
1004 Ga0207663_11170464
1005 Ga0207660_10012183
1006 Ga0207660_10093840
1007 Ga0207660_10136020
1008 Ga0207660_10155159
1009 Ga0207660_10498913
1010 Ga0207660_10634303
1011 Ga0207660_10848435
1012 Ga0207660_10892777
1013 Ga0207657_10000054
1014 Ga0207657_10001075
1015 Ga0207657_10004160
1016 Ga0207657_10033290
1017 Ga0207657_10197179
1018 Ga0207657_10337525
1019 Ga0207657_10969627
1020 Ga0207649_10058016
1021 Ga0207649_10327546
1022 Ga0207649_10350243
1023 Ga0207649_10358166
1024 Ga0207649_10695383
1025 Ga0207649_10766771
1026 Ga0207649_11073449
1027 Ga0207652_10147522
1028 Ga0207652_10160480
1029 Ga0207652_10160688
1030 Ga0207652_10166388
1031 Ga0207652_10201891
1032 Ga0207652_10952591
1033 Ga0207652_11196502
1034 Ga0207652_11229674
1035 Ga0207652_11852294
1036 Ga0207646_10317404
1037 Ga0207646_10323367
1038 Ga0207694_10534356
1039 Ga0207687_10205832
1040 Ga0207700_10390438
1041 Ga0207700_10652256
1042 Ga0207664_10156674
1043 Ga0207664_10231381
1044 Ga0207664_10337959
1045 Ga0207664_10377808
1046 Ga0207664_10590707
1047 Ga0207690_10043519
1048 Ga0207690_10451550
1049 Ga0207686_10992522
1050 Ga0207709_10654215
1051 Ga0207665_10111072
1052 Ga0207665_10237768
1053 Ga0207665_10997836
1054 Ga0207661_10026264
1055 Ga0207661_10218085
1056 Ga0207661_10418043
1057 Ga0207661_10652825
1058 Ga0207661_11825387
1059 Ga0207679_10147944
1060 Ga0207679_11387893
1061 Ga0207667_10040671
1062 Ga0207667_10096249
1063 Ga0207667_10175124
1064 Ga0207667_10310584
1065 Ga0207667_10330871
1066 Ga0207667_10415856
1067 Ga0207667_11119018
1068 Ga0207640_10522246
1069 Ga0207640_11581895
1070 Ga0207658_10130663
1071 Ga0207677_10115980
1072 Ga0207639_10056492
1073 Ga0207639_10269163
1074 Ga0207639_10682248
1075 Ga0207639_12202683
1076 Ga0207678_11135068
1077 Ga0207702_10032479
1078 Ga0207702_10143631
1079 Ga0207702_10688072
1080 Ga0207702_11591926
1081 Ga0207674_10056847
1082 Ga0207674_10066998
1083 Ga0207674_10358692
1084 Ga0207683_10447707
1085 Ga0207698_10095007
1086 Ga0207698_10218876
1087 Ga0207698_10685427
1088 Ga0268266_10253992
1089 Ga0265319_1036087
1090 Ga0265334_10013764
1091 Ga0265318_10048967
1092 Ga0265322_10040434
1093 Ga0265336_10268026
1094 Ga0265324_10230764
1095 Ga0265330_10064920
1096 Ga0265320_10046447
1097 Ga0265325_10074032
1098 Ga0265329_10155352
1099 Ga0265340_10063816
1100 Ga0265339_10441662
1101 Ga0265327_10016624
1102 Ga0265316_10031777
1103 Ga0265313_10030460
1104 Ga0265314_10214934
1105 Ga0265314_10235694
1106 Ga0265342_10079201
1107 Ga0373926_0198757
1108 Ga0373926_0298366
1109 Ga0373936_0009649
1110 Ga0373936_0090715
1111 Ga0373945_0023282
1112 Ga0373945_0194304
1113 Ga0373956_0522272
1114 Ga0373943_0000101
1115 Ga0373943_0001881
1116 Ga0373943_0021015
1117 Ga0373946_0006107
1118 Ga0373946_0079806
1119 Ga0373946_0193601
1120 Ga0373955_0247281
1121 Ga0373931_1300492
1122 Ga0373935_0026073
1123 Ga0373935_0052840
1124 Ga0373935_0295829
1125 Ga0373927_0053528
1126 Ga0373927_0093584
1127 Ga0373927_0429770
1128 Ga0373933_0192407
1129 Ga0373947_0004085
1130 Ga0373947_0005625
1131 Ga0373947_0039963
1132 Ga0373937_0283207
1133 Ga0373937_0471658
1134 Ga0373925_0001828
1135 Ga0373925_0148942
1136 Ga0395899_0023795
1137 Ga0395899_0085357
1138 Ga0395900_0021884
1139 Ga0395900_0114172
1140 Ga0395900_0183662
1141 Ga0395900_0266290
1142 Ga0395900_0937121
1143 Ga0395900_1211859
1144 Ga0395898_0001509
1145 Ga0395898_0004411
1146 Ga0395898_0091755
1147 Ga0395898_0153557
1148 Ga0395898_0442076
1149 Ga0395905_0045512
1150 Ga0395905_0265388
1151 Ga0395905_1292120
1152 Ga0436364_0244893
1153 Ga0395901_0009334
1154 Ga0395901_0276606
1155 Ga0395901_0301484
1156 Ga0395901_0772371
1157 Ga0436365_0007111
1158 Ga0436365_0008576
1159 Ga0436365_0644646
1160 Ga0436363_0783829
1161 Ga0436363_0811044
1162 Ga0436363_0979416
1163 Ga0436363_1065067
1164 Ga0436362_0326961
1165 Ga0451789_0989819
1166 Ga0451802_0769261
1167 Ga0451853_1672016
1168 Ga0466972_0480817
1169 Ga0466965_0162990
1170 Ga0466965_0746125
1171 Ga0466966_0008410
1172 Ga0466966_0125538
1173 Ga0466966_0199752
1174 Ga0466961_0019467
1175 Ga0466961_0026671
1176 Ga0466961_0080613
1177 Ga0466963_0003862
1178 Ga0466963_0004394
1179 Ga0466963_0011736
1180 Ga0466963_0022077
1181 Ga0466963_0034324
1182 Ga0466963_0489629
1183 Ga0466963_0751444
1184 Ga0466963_0935951
1185 Ga0466964_0002916
1186 Ga0466964_0002988
1187 Ga0466964_0009352
1188 Ga0466964_0017077
1189 Ga0466964_0649753
1190 Ga0466971_0000282
1191 Ga0466971_0151659
1192 Ga0466971_0539798
1193 Ga0466968_0421634
1194 Ga0466970_0633817
1195 Ga0466957_0002174
1196 Ga0466957_0047874
1197 Ga0466957_0119300
1198 Ga0466957_0321553
1199 Ga0466957_0914483
1200 Ga0466957_1117824
1201 Ga0466960_0192719
1202 Ga0466959_0007644
1203 Ga0466959_0033459
1204 Ga0466959_0034408
1205 Ga0466959_0113114
1206 Ga0466959_0651726
1207 Ga0466958_0004124
1208 Ga0466958_0012056
1209 Ga0466958_0288138
1210 Ga0466958_0323307
1211 Ga0466967_0010340
1212 Ga0466967_0015053
1213 Ga0466967_0022022
1214 Ga0466967_0026965
1215 Ga0466967_0047524
1216 Ga0466967_0051218
1217 Ga0466967_0114041
1218 Ga0466967_0120211
1219 Ga0466967_0125131
1220 Ga0466967_0201452
1221 Ga0466967_0374137
1222 Ga0466967_0449371
1223 Ga0466967_0473827
1224 Ga0466967_0542474
1225 Ga0466967_0701550
1226 Ga0466967_0793879
1227 Ga0466967_1331551
1228 Ga0466967_2366019
1229 Ga0495592_0352349
1230 Ga0495629_0159054
1231 Ga0495629_0359342
1232 Ga0495641_0000374
1233 Ga0495641_0028226
1234 Ga0495641_0092247
1235 Ga0495641_0191687
1236 Ga0495641_0236485
1237 Ga0495641_0250725
1238 Ga0495651_0018440
1239 Ga0495651_0028003
1240 Ga0495651_0071904
1241 Ga0495651_0860151
1242 Ga0495653_0015646
1243 Ga0495653_0123619
1244 Ga0495653_0213398
1245 Ga0495653_0308685
1246 Ga0495653_0392811
1247 Ga0495582_0000124
1248 Ga0495582_0058377
1249 Ga0495582_0314568
1250 Ga0495582_0403060
1251 Ga0495582_0873677
1252 Ga0495605_0054425
1253 Ga0495639_0000786
1254 Ga0495639_0322699
1255 Ga0495662_0000898
1256 Ga0495664_0018607
1257 Ga0495664_0035313
1258 Ga0495664_0097484
1259 Ga0495664_0655644
1260 Ga0495594_0085096
1261 Ga0495608_0010122
1262 Ga0495608_0029476
1263 Ga0495608_0127601
1264 Ga0495608_0283204
1265 Ga0495618_0218690
1266 Ga0495618_0579624
1267 Ga0495628_0026156
1268 Ga0495628_0079309
1269 Ga0495628_0105848
1270 Ga0495628_0291974
1271 Ga0495630_0029084
1272 Ga0495630_0110340
1273 Ga0495666_0166133
1274 Ga0495652_0311192
1275 Ga0495652_0314960
1276 Ga0495665_0086584
1277 Ga0495665_0086623
1278 Ga0495665_0631266
1279 Ga0495640_0019423
1280 Ga0495640_0090361
1281 Ga0495586_0369894
1282 Ga0495586_0902520
1283 Ga0495587_0098432
1284 Ga0495587_0113705
1285 Ga0495587_0347101
1286 Ga0495645_0178400
1287 Ga0495645_0221156
1288 Ga0495622_0219251
1289 Ga0495667_0002397
1290 Ga0495667_0020012
1291 Ga0495667_0032795
1292 Ga0495667_0045214
1293 Ga0495634_0075065
1294 Ga0495634_0457328
1295 Ga0495635_0030531
1296 Ga0495635_0036436
1297 Ga0495635_0118691
1298 Ga0495588_0734388
1299 Ga0495657_0027919
1300 Ga0495657_0028795
1301 Ga0495657_0199563
1302 Ga0495657_0340598
1303 Ga0495657_0370545
1304 Ga0495599_0092733
1305 Ga0495599_0194893
1306 Ga0495599_0373445
1307 Ga0495623_0040204
1308 Ga0495646_0035388
1309 Ga0495646_0078933
1310 Ga0495646_0082304
1311 Ga0495647_0004080
1312 Ga0495647_0601875
1313 Ga0495647_0616179
1314 Ga0495658_0000247
1315 Ga0495658_0032563
1316 Ga0495658_0070745
1317 Ga0495613_0013675
1318 Ga0495613_0032931
1319 Ga0495613_0693818
1320 Ga0495624_0010741
1321 Ga0495624_0109848
1322 Ga0495624_0498767
1323 Ga0495624_0551431
1324 Ga0495624_0680530
1325 Ga0495600_0017559
1326 Ga0495600_0059533
1327 Ga0495600_0504629
1328 Ga0495581_0003701
1329 Ga0495581_0116740
1330 Ga0495581_0402584
1331 Ga0495604_0016420
1332 Ga0495604_0033832
1333 Ga0495604_0083229
1334 Ga0495604_0259618
1335 Ga0495674_0003941
1336 Ga0495674_0019510
1337 Ga0495674_0129472
1338 Ga0495674_0257792
1339 Ga0495676_0001077
1340 Ga0495680_0006023
1341 Ga0495680_0011046
1342 Ga0495680_0036742
1343 Ga0495680_0555427
1344 Ga0495675_0290391
1345 Ga0495675_0357632
1346 Ga0495675_0628620
1347 Ga0495684_0001855
1348 Ga0495684_0018726
1349 Ga0495684_0283913
1350 Ga0495593_0012759
1351 Ga0495593_0129579
1352 Ga0495602_0122289
1353 Ga0495602_0150988
1354 Ga0495602_0193124
1355 Ga0495602_0577756
1356 Ga0495614_0013434
1357 Ga0495614_0074716
1358 Ga0495614_0331388
1359 Ga0496100_0001575
1360 Ga0496100_0010229
1361 Ga0496100_0071371
1362 Ga0496100_0402453
1363 Ga0496101_0012134
1364 Ga0496101_0012361
1365 Ga0496101_0045876
1366 Ga0496101_0058115
1367 Ga0496101_0193072
1368 Ga0496102_0062684
1369 Ga0496102_0219062
1370 Ga0496102_0340261
1371 Ga0496102_0633389
1372 Ga0496103_0071012
1373 Ga0496103_0095128
1374 Ga0496103_0232184
1375 Ga0496103_0745970
1376 Ga0496103_0787844
1377 Ga0496103_0924022
1378 Ga0496103_0959002
1379 Ga0496104_0089440
1380 Ga0496104_0136449
1381 Ga0496104_0860390
1382 Ga0496105_0028970
1383 Ga0496105_0034310
1384 Ga0496105_0460266
1385 Ga0496105_0463314
1386 Ga0496106_0017922
1387 Ga0496106_0060221
1388 Ga0496106_0176793
1389 Ga0496107_0045134
1390 Ga0496107_0063540
1391 Ga0496107_0207827
1392 Ga0496107_1065703
1393 Ga0496108_0028066
1394 Ga0496108_0181259
1395 Ga0496108_1619868
1396 Ga0496109_0017699
1397 Ga0496109_0409127
1398 Ga0496109_0410478
1399 Ga0496110_0119476
1400 Ga0496110_1067199
1401 Ga0496110_1160701
1402 Ga0496111_0028408
1403 Ga0496111_0400626
1404 Ga0496111_0800764
1405 Ga0496111_1301213
1406 Ga0496112_0021620
1407 Ga0496112_0069713
1408 Ga0496112_0081215
1409 Ga0496112_0098797
1410 Ga0496112_0102149
1411 Ga0496112_0163385
1412 Ga0496112_0442222
1413 Ga0496112_0469710
1414 Ga0496112_0760301
1415 Ga0496112_1172625
1416 Ga0496113_0452541
1417 Ga0496113_1518759
1418 Ga0496114_0001536
1419 Ga0496114_0012463
1420 Ga0496114_0044736
1421 Ga0496114_0165087
1422 Ga0496114_0301577
1423 Ga0496114_0468153
1424 Ga0496115_0006958
1425 Ga0496115_0007667
1426 Ga0496115_0016034
1427 Ga0496115_0079832
1428 Ga0496115_0092031
1429 Ga0496115_0489336
1430 Ga0496115_0848060
1431 Ga0501038_1035824
1432 Ga0501047_0036325
1433 Ga0501067_0000684
1434 Ga0501067_0040552
1435 Ga0501067_0404865
1436 Ga0501067_0480507
1437 Ga0501069_0085031
1438 Ga0501069_0116351
1439 Ga0501069_0546615
1440 Ga0501070_0059846
1441 Ga0501070_0535568
1442 Ga0501070_1470355
1443 Ga0501073_0262784
1444 Ga0501074_0060768
1445 Ga0501074_0809281
1446 Ga0501079_0304870
1447 Ga0501080_0596119
1448 Ga0501044_0377656
1449 nmdc:mga05p37_1332511_c1
1450 nmdc:mga0n895_6128_c1
1451 nmdc:mga0rr50_519562_c1
1452 nmdc:mga0rr50_65197_c1
1453 nmdc:mga0a205_113505_c1
1454 nmdc:mga0a205_13182_c2
1455 Ga0495601_0140522
1456 Ga0495601_0349453
1457 Ga0495601_0591430
1458 Ga0495612_0059843
1459 Ga0495612_0115817
1460 Ga0495612_0119035
1461 Ga0495655_0012607
1462 Ga0495595_0018976
1463 Ga0495595_0039102
1464 Ga0495595_0095196
1465 Ga0495595_0153361
1466 Ga0495619_0025945
1467 Ga0466962_0006119
1468 Ga0466962_0017977
1469 Ga0466962_0165499
1470 Ga0466962_0541639

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

22

95

0.88

Map