F478183
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 255 | 1470 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_101742256|Ga0070713_1017422562 |
| Length | 102 |
| Sequence | VFGPEGWAMLLDAVSEVELFVNVFFDVYILAILAYILTSWVQLPYSLRPVQRFLYDACEPYLRLWRRILPFRVGAFDLSPMVAVFALIAVEQILLTVLGRLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 72 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 144 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 156 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 157 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 160 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 161 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 166 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 167 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 168 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 171 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 172 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.05 |
| Metatranscriptomes | 3.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.07 |
| Rhizosphere | 88.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_101742256 | 3300005436 | Bacteria | 605 |
| 2 | rootH1_10318263 | 3300003323 | Bacteria | 2307 |
| 3 | Ga0058863_11596509 | 3300004799 | Bacteria | 622 |
| 4 | Ga0058861_11831151 | 3300004800 | Bacteria | 732 |
| 5 | Ga0058861_11878822 | 3300004800 | Unclassified | 605 |
| 6 | Ga0058862_12611363 | 3300004803 | Bacteria | 666 |
| 7 | Ga0058862_12661891 | 3300004803 | Bacteria | 1135 |
| 8 | Ga0070658_10011654 | 3300005327 | Bacteria | 7051 |
| 9 | Ga0070658_10296871 | 3300005327 | Bacteria | 1377 |
| 10 | Ga0070658_10416077 | 3300005327 | Unclassified | 1156 |
| 11 | Ga0070658_10944829 | 3300005327 | Unclassified | 750 |
| 12 | Ga0070658_11150855 | 3300005327 | Unclassified | 675 |
| 13 | Ga0070658_11243912 | 3300005327 | Bacteria | 647 |
| 14 | Ga0070658_11588302 | 3300005327 | Bacteria | 567 |
| 15 | Ga0070683_100014696 | 3300005329 | Bacteria | 6858 |
| 16 | Ga0070683_100033750 | 3300005329 | Bacteria | 4668 |
| 17 | Ga0070683_100310901 | 3300005329 | Bacteria | 1499 |
| 18 | Ga0070683_100476407 | 3300005329 | Bacteria | 1192 |
| 19 | Ga0070683_100491134 | 3300005329 | Bacteria | 1172 |
| 20 | Ga0070683_100555635 | 3300005329 | Unclassified | 1098 |
| 21 | Ga0070690_101061516 | 3300005330 | Unclassified | 641 |
| 22 | Ga0070666_11119805 | 3300005335 | Unclassified | 585 |
| 23 | Ga0070680_100020219 | 3300005336 | Bacteria | 5282 |
| 24 | Ga0070680_100107422 | 3300005336 | Bacteria | 2321 |
| 25 | Ga0070680_100147622 | 3300005336 | Bacteria | 1973 |
| 26 | Ga0070680_100197229 | 3300005336 | Bacteria | 1697 |
| 27 | Ga0070680_100463495 | 3300005336 | Bacteria | 1083 |
| 28 | Ga0070680_100533901 | 3300005336 | Bacteria | 1005 |
| 29 | Ga0070680_100788299 | 3300005336 | Unclassified | 819 |
| 30 | Ga0070680_100834072 | 3300005336 | Bacteria | 795 |
| 31 | Ga0070660_100003611 | 3300005339 | Bacteria | 10692 |
| 32 | Ga0070660_100006608 | 3300005339 | Bacteria | 8047 |
| 33 | Ga0070660_100051211 | 3300005339 | Bacteria | 3179 |
| 34 | Ga0070660_100105017 | 3300005339 | Bacteria | 2241 |
| 35 | Ga0070660_100214122 | 3300005339 | Bacteria | 1564 |
| 36 | Ga0070660_100316888 | 3300005339 | Bacteria | 1280 |
| 37 | Ga0070660_100636610 | 3300005339 | Bacteria | 893 |
| 38 | Ga0070661_100020146 | 3300005344 | Bacteria | 4755 |
| 39 | Ga0070661_100070569 | 3300005344 | Bacteria | 2569 |
| 40 | Ga0070661_100151903 | 3300005344 | Bacteria | 1751 |
| 41 | Ga0070661_100194475 | 3300005344 | Bacteria | 1548 |
| 42 | Ga0070661_100655231 | 3300005344 | Bacteria | 852 |
| 43 | Ga0070661_100792816 | 3300005344 | Bacteria | 777 |
| 44 | Ga0070661_101045530 | 3300005344 | Bacteria | 679 |
| 45 | Ga0070671_100016842 | 3300005355 | Bacteria | 5910 |
| 46 | Ga0070671_101113840 | 3300005355 | Bacteria | 693 |
| 47 | Ga0070673_100354771 | 3300005364 | Bacteria | 1302 |
| 48 | Ga0070659_100068194 | 3300005366 | Bacteria | 2821 |
| 49 | Ga0070659_100148416 | 3300005366 | Bacteria | 1911 |
| 50 | Ga0070659_101852264 | 3300005366 | Bacteria | 541 |
| 51 | Ga0070659_101852848 | 3300005366 | Bacteria | 541 |
| 52 | Ga0070709_10207559 | 3300005434 | Bacteria | 1391 |
| 53 | Ga0070714_100061015 | 3300005435 | Bacteria | 3237 |
| 54 | Ga0070714_100128444 | 3300005435 | Bacteria | 2263 |
| 55 | Ga0070714_100229411 | 3300005435 | Bacteria | 1710 |
| 56 | Ga0070714_100376426 | 3300005435 | Bacteria | 1338 |
| 57 | Ga0070714_100676054 | 3300005435 | Bacteria | 995 |
| 58 | Ga0070714_100715282 | 3300005435 | Bacteria | 967 |
| 59 | Ga0070714_100900617 | 3300005435 | Bacteria | 859 |
| 60 | Ga0070714_101121314 | 3300005435 | Unclassified | 767 |
| 61 | Ga0070714_101318007 | 3300005435 | Bacteria | 705 |
| 62 | Ga0070714_101932282 | 3300005435 | Unclassified | 576 |
| 63 | Ga0070713_100176256 | 3300005436 | Bacteria | 1919 |
| 64 | Ga0070713_100618717 | 3300005436 | Bacteria | 1030 |
| 65 | Ga0070713_102374955 | 3300005436 | Bacteria | 513 |
| 66 | Ga0070710_10319995 | 3300005437 | Bacteria | 1018 |
| 67 | Ga0070710_11497549 | 3300005437 | Unclassified | 507 |
| 68 | Ga0070711_100119762 | 3300005439 | Bacteria | 1945 |
| 69 | Ga0070708_100519482 | 3300005445 | Bacteria | 1123 |
| 70 | Ga0070678_100420577 | 3300005456 | Bacteria | 1165 |
| 71 | Ga0070678_102186213 | 3300005456 | Unclassified | 525 |
| 72 | Ga0070681_10001213 | 3300005458 | Bacteria | 22417 |
| 73 | Ga0070681_10065555 | 3300005458 | Bacteria | 3600 |
| 74 | Ga0070681_10104999 | 3300005458 | Bacteria | 2767 |
| 75 | Ga0070681_10270523 | 3300005458 | Bacteria | 1610 |
| 76 | Ga0070681_10600876 | 3300005458 | Bacteria | 1014 |
| 77 | Ga0070681_10665058 | 3300005458 | Bacteria | 957 |
| 78 | Ga0070681_10795706 | 3300005458 | Unclassified | 863 |
| 79 | Ga0070698_100912672 | 3300005471 | Unclassified | 824 |
| 80 | Ga0070698_101439670 | 3300005471 | Bacteria | 640 |
| 81 | Ga0070679_100004486 | 3300005530 | Bacteria | 12895 |
| 82 | Ga0070679_100020574 | 3300005530 | Bacteria | 6435 |
| 83 | Ga0070679_100058769 | 3300005530 | Bacteria | 3832 |
| 84 | Ga0070679_100136865 | 3300005530 | Bacteria | 2430 |
| 85 | Ga0070679_100292527 | 3300005530 | Bacteria | 1580 |
| 86 | Ga0070679_100512764 | 3300005530 | Bacteria | 1143 |
| 87 | Ga0070679_100549503 | 3300005530 | Unclassified | 1099 |
| 88 | Ga0070679_100815110 | 3300005530 | Unclassified | 876 |
| 89 | Ga0070684_100013758 | 3300005535 | Bacteria | 6531 |
| 90 | Ga0070684_100034651 | 3300005535 | Bacteria | 4317 |
| 91 | Ga0070684_100318025 | 3300005535 | Bacteria | 1430 |
| 92 | Ga0070684_100330605 | 3300005535 | Bacteria | 1401 |
| 93 | Ga0070684_100341558 | 3300005535 | Bacteria | 1376 |
| 94 | Ga0070684_100360746 | 3300005535 | Bacteria | 1337 |
| 95 | Ga0070684_101206585 | 3300005535 | Bacteria | 712 |
| 96 | Ga0070697_100712728 | 3300005536 | Unclassified | 886 |
| 97 | Ga0068853_100092663 | 3300005539 | Bacteria | 2658 |
| 98 | Ga0068853_100306706 | 3300005539 | Bacteria | 1469 |
| 99 | Ga0068853_100708198 | 3300005539 | Bacteria | 961 |
| 100 | Ga0068853_100801253 | 3300005539 | Bacteria | 902 |
| 101 | Ga0070696_100006574 | 3300005546 | Bacteria | 7761 |
| 102 | Ga0070696_101883192 | 3300005546 | Unclassified | 518 |
| 103 | Ga0070665_100281583 | 3300005548 | Bacteria | 1665 |
| 104 | Ga0068855_100022769 | 3300005563 | Bacteria | 7508 |
| 105 | Ga0068855_100063071 | 3300005563 | Bacteria | 4326 |
| 106 | Ga0068855_100132958 | 3300005563 | Bacteria | 2840 |
| 107 | Ga0068855_100163556 | 3300005563 | Bacteria | 2524 |
| 108 | Ga0068855_100200959 | 3300005563 | Bacteria | 2243 |
| 109 | Ga0068855_100510856 | 3300005563 | Bacteria | 1305 |
| 110 | Ga0068855_100556072 | 3300005563 | Bacteria | 1242 |
| 111 | Ga0070664_100988054 | 3300005564 | Bacteria | 791 |
| 112 | Ga0068857_100044123 | 3300005577 | Bacteria | 3954 |
| 113 | Ga0068857_100088246 | 3300005577 | Bacteria | 2774 |
| 114 | Ga0068857_100292510 | 3300005577 | Bacteria | 1500 |
| 115 | Ga0068857_100620593 | 3300005577 | Bacteria | 1023 |
| 116 | Ga0068857_102003365 | 3300005577 | Bacteria | 568 |
| 117 | Ga0068854_101811561 | 3300005578 | Unclassified | 560 |
| 118 | Ga0068856_100218148 | 3300005614 | Bacteria | 1923 |
| 119 | Ga0068856_100333179 | 3300005614 | Bacteria | 1535 |
| 120 | Ga0068856_100784388 | 3300005614 | Bacteria | 973 |
| 121 | Ga0068856_100824817 | 3300005614 | Unclassified | 947 |
| 122 | Ga0068852_100027110 | 3300005616 | Bacteria | 4665 |
| 123 | Ga0068852_100258189 | 3300005616 | Bacteria | 1672 |
| 124 | Ga0068851_10608150 | 3300005834 | Bacteria | 666 |
| 125 | Ga0070717_10064666 | 3300006028 | Bacteria | 3039 |
| 126 | Ga0070717_10226281 | 3300006028 | Bacteria | 1646 |
| 127 | Ga0070717_10286109 | 3300006028 | Bacteria | 1463 |
| 128 | Ga0070717_10466886 | 3300006028 | Bacteria | 1139 |
| 129 | Ga0070715_10403900 | 3300006163 | Bacteria | 760 |
| 130 | Ga0070716_100779797 | 3300006173 | Bacteria | 738 |
| 131 | Ga0070716_100990470 | 3300006173 | Bacteria | 664 |
| 132 | Ga0070712_100061780 | 3300006175 | Bacteria | 2647 |
| 133 | Ga0070712_100128214 | 3300006175 | Unclassified | 1919 |
| 134 | Ga0070712_101378596 | 3300006175 | Bacteria | 615 |
| 135 | Ga0070712_101817520 | 3300006175 | Unclassified | 533 |
| 136 | Ga0097621_100347645 | 3300006237 | Bacteria | 1318 |
| 137 | Ga0068871_100555044 | 3300006358 | Bacteria | 1041 |
| 138 | Ga0068871_100653553 | 3300006358 | Bacteria | 960 |
| 139 | Ga0068871_100863694 | 3300006358 | Bacteria | 837 |
| 140 | Ga0068871_102230491 | 3300006358 | Unclassified | 522 |
| 141 | Ga0075433_10038807 | 3300006852 | Bacteria | 4115 |
| 142 | Ga0075434_100038125 | 3300006871 | Bacteria | 4760 |
| 143 | Ga0068865_100687104 | 3300006881 | Bacteria | 873 |
| 144 | Ga0075436_100842737 | 3300006914 | Bacteria | 684 |
| 145 | Ga0075435_100073743 | 3300007076 | Bacteria | 2791 |
| 146 | Ga0075435_102046186 | 3300007076 | Unclassified | 503 |
| 147 | Ga0105240_10016420 | 3300009093 | Bacteria | 10024 |
| 148 | Ga0105240_10238489 | 3300009093 | Bacteria | 2109 |
| 149 | Ga0105240_10289254 | 3300009093 | Bacteria | 1879 |
| 150 | Ga0105240_10466430 | 3300009093 | Bacteria | 1410 |
| 151 | Ga0105240_10660834 | 3300009093 | Bacteria | 1144 |
| 152 | Ga0105245_10144642 | 3300009098 | Bacteria | 2242 |
| 153 | Ga0105245_11206405 | 3300009098 | Unclassified | 804 |
| 154 | Ga0105245_11263114 | 3300009098 | Bacteria | 787 |
| 155 | Ga0114129_11867614 | 3300009147 | Bacteria | 729 |
| 156 | Ga0105243_10915197 | 3300009148 | Unclassified | 873 |
| 157 | Ga0105241_10360025 | 3300009174 | Unclassified | 1266 |
| 158 | Ga0105241_10699621 | 3300009174 | Bacteria | 925 |
| 159 | Ga0105241_10847936 | 3300009174 | Unclassified | 845 |
| 160 | Ga0105241_11159294 | 3300009174 | Unclassified | 730 |
| 161 | Ga0105241_11800201 | 3300009174 | Bacteria | 598 |
| 162 | Ga0105242_10050202 | 3300009176 | Bacteria | 3396 |
| 163 | Ga0105242_10511307 | 3300009176 | Bacteria | 1144 |
| 164 | Ga0105242_10874994 | 3300009176 | Unclassified | 896 |
| 165 | Ga0105237_10039262 | 3300009545 | Bacteria | 4779 |
| 166 | Ga0105237_11090377 | 3300009545 | Unclassified | 805 |
| 167 | Ga0105237_11352527 | 3300009545 | Bacteria | 718 |
| 168 | Ga0105237_11514314 | 3300009545 | Bacteria | 677 |
| 169 | Ga0105238_10051504 | 3300009551 | Bacteria | 4141 |
| 170 | Ga0105238_10123201 | 3300009551 | Bacteria | 2572 |
| 171 | Ga0105238_10524196 | 3300009551 | Bacteria | 1188 |
| 172 | Ga0105238_10743440 | 3300009551 | Bacteria | 994 |
| 173 | Ga0105238_11635108 | 3300009551 | Unclassified | 674 |
| 174 | Ga0105238_12347921 | 3300009551 | Bacteria | 569 |
| 175 | Ga0105239_10237715 | 3300010375 | Bacteria | 2045 |
| 176 | Ga0105239_10335437 | 3300010375 | Bacteria | 1706 |
| 177 | Ga0105239_11976934 | 3300010375 | Unclassified | 677 |
| 178 | Ga0105246_11601761 | 3300011119 | Bacteria | 615 |
| 179 | Ga0105246_11867008 | 3300011119 | Bacteria | 576 |
| 180 | Ga0157373_10753344 | 3300013100 | Bacteria | 716 |
| 181 | Ga0157371_10210646 | 3300013102 | Bacteria | 1394 |
| 182 | Ga0157371_10570819 | 3300013102 | Unclassified | 840 |
| 183 | Ga0157370_10021632 | 3300013104 | Bacteria | 6408 |
| 184 | Ga0157370_10064360 | 3300013104 | Bacteria | 3472 |
| 185 | Ga0157370_10070570 | 3300013104 | Bacteria | 3297 |
| 186 | Ga0157370_10388142 | 3300013104 | Bacteria | 1286 |
| 187 | Ga0157370_10519965 | 3300013104 | Bacteria | 1092 |
| 188 | Ga0157370_10973060 | 3300013104 | Unclassified | 769 |
| 189 | Ga0157369_10155660 | 3300013105 | Bacteria | 2414 |
| 190 | Ga0157369_10202624 | 3300013105 | Bacteria | 2082 |
| 191 | Ga0157369_10515452 | 3300013105 | Bacteria | 1237 |
| 192 | Ga0157369_10649099 | 3300013105 | Bacteria | 1088 |
| 193 | Ga0157369_10794367 | 3300013105 | Unclassified | 972 |
| 194 | Ga0157374_10116329 | 3300013296 | Bacteria | 2576 |
| 195 | Ga0157374_11275962 | 3300013296 | Bacteria | 756 |
| 196 | Ga0157374_11468015 | 3300013296 | Unclassified | 705 |
| 197 | Ga0157378_10324391 | 3300013297 | Bacteria | 1497 |
| 198 | Ga0157378_11059795 | 3300013297 | Unclassified | 847 |
| 199 | Ga0157378_11252824 | 3300013297 | Unclassified | 782 |
| 200 | Ga0157372_10081192 | 3300013307 | Bacteria | 3670 |
| 201 | Ga0157372_10140995 | 3300013307 | Bacteria | 2777 |
| 202 | Ga0157372_10142507 | 3300013307 | Bacteria | 2762 |
| 203 | Ga0157372_10548720 | 3300013307 | Bacteria | 1347 |
| 204 | Ga0157372_10683127 | 3300013307 | Bacteria | 1195 |
| 205 | Ga0157372_10937920 | 3300013307 | Bacteria | 1003 |
| 206 | Ga0157375_11126518 | 3300013308 | Bacteria | 919 |
| 207 | Ga0182008_10152147 | 3300014497 | Unclassified | 1161 |
| 208 | Ga0182008_10672405 | 3300014497 | Bacteria | 588 |
| 209 | Ga0157376_10768776 | 3300014969 | Bacteria | 974 |
| 210 | Ga0197907_10930522 | 3300020069 | Bacteria | 674 |
| 211 | Ga0197907_11151862 | 3300020069 | Unclassified | 533 |
| 212 | Ga0197907_11361063 | 3300020069 | Bacteria | 1362 |
| 213 | Ga0206356_10428047 | 3300020070 | Bacteria | 1987 |
| 214 | Ga0206356_10429965 | 3300020070 | Bacteria | 1116 |
| 215 | Ga0206356_11685916 | 3300020070 | Bacteria | 3416 |
| 216 | Ga0206349_1108614 | 3300020075 | Bacteria | 701 |
| 217 | Ga0206355_1054366 | 3300020076 | Unclassified | 683 |
| 218 | Ga0206355_1060814 | 3300020076 | Unclassified | 592 |
| 219 | Ga0206355_1721177 | 3300020076 | Bacteria | 898 |
| 220 | Ga0206351_10198018 | 3300020077 | Bacteria | 733 |
| 221 | Ga0206352_11259618 | 3300020078 | Bacteria | 1253 |
| 222 | Ga0206350_10116138 | 3300020080 | Bacteria | 858 |
| 223 | Ga0206350_10949612 | 3300020080 | Bacteria | 1060 |
| 224 | Ga0206354_10139567 | 3300020081 | Bacteria | 2247 |
| 225 | Ga0206354_10899407 | 3300020081 | Bacteria | 1021 |
| 226 | Ga0206353_10123035 | 3300020082 | Bacteria | 3294 |
| 227 | Ga0206353_10721544 | 3300020082 | Bacteria | 1907 |
| 228 | Ga0206353_12056592 | 3300020082 | Bacteria | 5106 |
| 229 | Ga0206353_12068744 | 3300020082 | Unclassified | 578 |
| 230 | Ga0154015_1053496 | 3300020610 | Bacteria | 624 |
| 231 | Ga0154015_1316928 | 3300020610 | Unclassified | 628 |
| 232 | Ga0213874_10120501 | 3300021377 | Bacteria | 891 |
| 233 | Ga0213875_10237802 | 3300021388 | Bacteria | 858 |
| 234 | Ga0224712_10018854 | 3300022467 | Bacteria | 2314 |
| 235 | Ga0224712_10095789 | 3300022467 | Bacteria | 1250 |
| 236 | Ga0207692_10138561 | 3300025898 | Archaea | 1382 |
| 237 | Ga0207692_10491593 | 3300025898 | Unclassified | 777 |
| 238 | Ga0207692_10504185 | 3300025898 | Unclassified | 768 |
| 239 | Ga0207685_10011327 | 3300025905 | Bacteria | 2677 |
| 240 | Ga0207685_10319871 | 3300025905 | Bacteria | 773 |
| 241 | Ga0207699_10152627 | 3300025906 | Bacteria | 1530 |
| 242 | Ga0207705_10021888 | 3300025909 | Bacteria | 4561 |
| 243 | Ga0207705_10121403 | 3300025909 | Bacteria | 1939 |
| 244 | Ga0207705_10136378 | 3300025909 | Bacteria | 1830 |
| 245 | Ga0207705_10287374 | 3300025909 | Bacteria | 1260 |
| 246 | Ga0207705_10512084 | 3300025909 | Unclassified | 932 |
| 247 | Ga0207705_10653238 | 3300025909 | Bacteria | 818 |
| 248 | Ga0207705_10933019 | 3300025909 | Bacteria | 672 |
| 249 | Ga0207654_11390618 | 3300025911 | Bacteria | 512 |
| 250 | Ga0207707_10002380 | 3300025912 | Bacteria | 16951 |
| 251 | Ga0207707_10034890 | 3300025912 | Bacteria | 4400 |
| 252 | Ga0207707_10053386 | 3300025912 | Bacteria | 3518 |
| 253 | Ga0207707_10185569 | 3300025912 | Bacteria | 1815 |
| 254 | Ga0207707_10185716 | 3300025912 | Bacteria | 1814 |
| 255 | Ga0207707_10227797 | 3300025912 | Bacteria | 1622 |
| 256 | Ga0207707_10497417 | 3300025912 | Bacteria | 1040 |
| 257 | Ga0207695_10261844 | 3300025913 | Bacteria | 1627 |
| 258 | Ga0207695_10360715 | 3300025913 | Bacteria | 1340 |
| 259 | Ga0207671_10054864 | 3300025914 | Bacteria | 2952 |
| 260 | Ga0207671_10490275 | 3300025914 | Unclassified | 980 |
| 261 | Ga0207671_10993853 | 3300025914 | Bacteria | 661 |
| 262 | Ga0207693_10026100 | 3300025915 | Bacteria | 4626 |
| 263 | Ga0207693_10107272 | 3300025915 | Unclassified | 2191 |
| 264 | Ga0207693_10429445 | 3300025915 | Bacteria | 1033 |
| 265 | Ga0207693_11144320 | 3300025915 | Bacteria | 589 |
| 266 | Ga0207663_10016856 | 3300025916 | Bacteria | 4062 |
| 267 | Ga0207663_10069621 | 3300025916 | Bacteria | 2264 |
| 268 | Ga0207663_10079452 | 3300025916 | Unclassified | 2142 |
| 269 | Ga0207663_11170464 | 3300025916 | Unclassified | 619 |
| 270 | Ga0207660_10012183 | 3300025917 | Bacteria | 5620 |
| 271 | Ga0207660_10093840 | 3300025917 | Bacteria | 2230 |
| 272 | Ga0207660_10136020 | 3300025917 | Bacteria | 1875 |
| 273 | Ga0207660_10155159 | 3300025917 | Bacteria | 1762 |
| 274 | Ga0207660_10498913 | 3300025917 | Bacteria | 987 |
| 275 | Ga0207660_10634303 | 3300025917 | Bacteria | 871 |
| 276 | Ga0207660_10848435 | 3300025917 | Unclassified | 745 |
| 277 | Ga0207660_10892777 | 3300025917 | Unclassified | 725 |
| 278 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 279 | Ga0207657_10001075 | 3300025919 | Bacteria | 28931 |
| 280 | Ga0207657_10004160 | 3300025919 | Bacteria | 15336 |
| 281 | Ga0207657_10033290 | 3300025919 | Bacteria | 4647 |
| 282 | Ga0207657_10197179 | 3300025919 | Bacteria | 1622 |
| 283 | Ga0207657_10337525 | 3300025919 | Bacteria | 1190 |
| 284 | Ga0207657_10969627 | 3300025919 | Bacteria | 653 |
| 285 | Ga0207649_10058016 | 3300025920 | Bacteria | 2423 |
| 286 | Ga0207649_10327546 | 3300025920 | Bacteria | 1127 |
| 287 | Ga0207649_10350243 | 3300025920 | Bacteria | 1093 |
| 288 | Ga0207649_10358166 | 3300025920 | Bacteria | 1082 |
| 289 | Ga0207649_10695383 | 3300025920 | Unclassified | 788 |
| 290 | Ga0207649_10766771 | 3300025920 | Unclassified | 751 |
| 291 | Ga0207649_11073449 | 3300025920 | Bacteria | 635 |
| 292 | Ga0207652_10147522 | 3300025921 | Bacteria | 2106 |
| 293 | Ga0207652_10160480 | 3300025921 | Bacteria | 2015 |
| 294 | Ga0207652_10160688 | 3300025921 | Bacteria | 2014 |
| 295 | Ga0207652_10166388 | 3300025921 | Bacteria | 1977 |
| 296 | Ga0207652_10201891 | 3300025921 | Bacteria | 1789 |
| 297 | Ga0207652_10952591 | 3300025921 | Bacteria | 756 |
| 298 | Ga0207652_11196502 | 3300025921 | Unclassified | 662 |
| 299 | Ga0207652_11229674 | 3300025921 | Unclassified | 651 |
| 300 | Ga0207652_11852294 | 3300025921 | Unclassified | 509 |
| 301 | Ga0207646_10317404 | 3300025922 | Bacteria | 1408 |
| 302 | Ga0207646_10323367 | 3300025922 | Bacteria | 1394 |
| 303 | Ga0207694_10534356 | 3300025924 | Bacteria | 983 |
| 304 | Ga0207687_10205832 | 3300025927 | Bacteria | 1541 |
| 305 | Ga0207700_10390438 | 3300025928 | Bacteria | 1218 |
| 306 | Ga0207700_10652256 | 3300025928 | Bacteria | 938 |
| 307 | Ga0207664_10156674 | 3300025929 | Bacteria | 1939 |
| 308 | Ga0207664_10231381 | 3300025929 | Bacteria | 1607 |
| 309 | Ga0207664_10337959 | 3300025929 | Bacteria | 1331 |
| 310 | Ga0207664_10377808 | 3300025929 | Bacteria | 1258 |
| 311 | Ga0207664_10590707 | 3300025929 | Unclassified | 997 |
| 312 | Ga0207690_10043519 | 3300025932 | Bacteria | 2955 |
| 313 | Ga0207690_10451550 | 3300025932 | Bacteria | 1033 |
| 314 | Ga0207686_10992522 | 3300025934 | Bacteria | 681 |
| 315 | Ga0207709_10654215 | 3300025935 | Unclassified | 837 |
| 316 | Ga0207665_10111072 | 3300025939 | Bacteria | 1926 |
| 317 | Ga0207665_10237768 | 3300025939 | Bacteria | 1341 |
| 318 | Ga0207665_10997836 | 3300025939 | Bacteria | 666 |
| 319 | Ga0207661_10026264 | 3300025944 | Bacteria | 4434 |
| 320 | Ga0207661_10218085 | 3300025944 | Bacteria | 1685 |
| 321 | Ga0207661_10418043 | 3300025944 | Bacteria | 1217 |
| 322 | Ga0207661_10652825 | 3300025944 | Bacteria | 967 |
| 323 | Ga0207661_11825387 | 3300025944 | Unclassified | 553 |
| 324 | Ga0207679_10147944 | 3300025945 | Bacteria | 1908 |
| 325 | Ga0207679_11387893 | 3300025945 | Bacteria | 645 |
| 326 | Ga0207667_10040671 | 3300025949 | Bacteria | 4950 |
| 327 | Ga0207667_10096249 | 3300025949 | Bacteria | 3055 |
| 328 | Ga0207667_10175124 | 3300025949 | Bacteria | 2204 |
| 329 | Ga0207667_10310584 | 3300025949 | Bacteria | 1610 |
| 330 | Ga0207667_10330871 | 3300025949 | Unclassified | 1555 |
| 331 | Ga0207667_10415856 | 3300025949 | Bacteria | 1368 |
| 332 | Ga0207667_11119018 | 3300025949 | Bacteria | 770 |
| 333 | Ga0207640_10522246 | 3300025981 | Bacteria | 993 |
| 334 | Ga0207640_11581895 | 3300025981 | Unclassified | 590 |
| 335 | Ga0207658_10130663 | 3300025986 | Bacteria | 2017 |
| 336 | Ga0207677_10115980 | 3300026023 | Bacteria | 2004 |
| 337 | Ga0207639_10056492 | 3300026041 | Bacteria | 3009 |
| 338 | Ga0207639_10269163 | 3300026041 | Bacteria | 1494 |
| 339 | Ga0207639_10682248 | 3300026041 | Bacteria | 952 |
| 340 | Ga0207639_12202683 | 3300026041 | Bacteria | 512 |
| 341 | Ga0207678_11135068 | 3300026067 | Unclassified | 692 |
| 342 | Ga0207702_10032479 | 3300026078 | Unclassified | 4356 |
| 343 | Ga0207702_10143631 | 3300026078 | Bacteria | 2163 |
| 344 | Ga0207702_10688072 | 3300026078 | Bacteria | 1007 |
| 345 | Ga0207702_11591926 | 3300026078 | Bacteria | 647 |
| 346 | Ga0207674_10056847 | 3300026116 | Bacteria | 3969 |
| 347 | Ga0207674_10066998 | 3300026116 | Bacteria | 3615 |
| 348 | Ga0207674_10358692 | 3300026116 | Bacteria | 1409 |
| 349 | Ga0207683_10447707 | 3300026121 | Bacteria | 1190 |
| 350 | Ga0207698_10095007 | 3300026142 | Bacteria | 2453 |
| 351 | Ga0207698_10218876 | 3300026142 | Bacteria | 1719 |
| 352 | Ga0207698_10685427 | 3300026142 | Bacteria | 1018 |
| 353 | Ga0268266_10253992 | 3300028379 | Unclassified | 1627 |
| 354 | Ga0265319_1036087 | 3300028563 | Bacteria | 1693 |
| 355 | Ga0265334_10013764 | 3300028573 | Bacteria | 3382 |
| 356 | Ga0265318_10048967 | 3300028577 | Bacteria | 1591 |
| 357 | Ga0265322_10040434 | 3300028654 | Bacteria | 1327 |
| 358 | Ga0265336_10268026 | 3300028666 | Unclassified | 507 |
| 359 | Ga0265324_10230764 | 3300029957 | Unclassified | 628 |
| 360 | Ga0265330_10064920 | 3300031235 | Bacteria | 1585 |
| 361 | Ga0265320_10046447 | 3300031240 | Bacteria | 2128 |
| 362 | Ga0265325_10074032 | 3300031241 | Bacteria | 1704 |
| 363 | Ga0265329_10155352 | 3300031242 | Bacteria | 742 |
| 364 | Ga0265340_10063816 | 3300031247 | Bacteria | 1757 |
| 365 | Ga0265339_10441662 | 3300031249 | Unclassified | 604 |
| 366 | Ga0265327_10016624 | 3300031251 | Bacteria | 4661 |
| 367 | Ga0265316_10031777 | 3300031344 | Bacteria | 4313 |
| 368 | Ga0265313_10030460 | 3300031595 | Bacteria | 2778 |
| 369 | Ga0265314_10214934 | 3300031711 | Bacteria | 1126 |
| 370 | Ga0265314_10235694 | 3300031711 | Bacteria | 1059 |
| 371 | Ga0265342_10079201 | 3300031712 | Bacteria | 1900 |
| 372 | Ga0373926_0198757 | 3300035083 | Bacteria | 771 |
| 373 | Ga0373926_0298366 | 3300035083 | Unclassified | 629 |
| 374 | Ga0373936_0009649 | 3300035113 | Bacteria | 3638 |
| 375 | Ga0373936_0090715 | 3300035113 | Unclassified | 1281 |
| 376 | Ga0373945_0023282 | 3300035116 | Bacteria | 2139 |
| 377 | Ga0373945_0194304 | 3300035116 | Unclassified | 840 |
| 378 | Ga0373956_0522272 | 3300035119 | Unclassified | 567 |
| 379 | Ga0373943_0000101 | 3300035170 | Bacteria | 31609 |
| 380 | Ga0373943_0001881 | 3300035170 | Bacteria | 9492 |
| 381 | Ga0373943_0021015 | 3300035170 | Bacteria | 3014 |
| 382 | Ga0373946_0006107 | 3300035171 | Bacteria | 4362 |
| 383 | Ga0373946_0079806 | 3300035171 | Bacteria | 1430 |
| 384 | Ga0373946_0193601 | 3300035171 | Bacteria | 971 |
| 385 | Ga0373955_0247281 | 3300035172 | Bacteria | 1069 |
| 386 | Ga0373931_1300492 | 3300035691 | Bacteria | 500 |
| 387 | Ga0373935_0026073 | 3300035692 | Bacteria | 3605 |
| 388 | Ga0373935_0052840 | 3300035692 | Unclassified | 2584 |
| 389 | Ga0373935_0295829 | 3300035692 | Bacteria | 1143 |
| 390 | Ga0373927_0053528 | 3300035695 | Bacteria | 2611 |
| 391 | Ga0373927_0093584 | 3300035695 | Bacteria | 1953 |
| 392 | Ga0373927_0429770 | 3300035695 | Unclassified | 872 |
| 393 | Ga0373933_0192407 | 3300035724 | Unclassified | 1303 |
| 394 | Ga0373947_0004085 | 3300035725 | Bacteria | 8591 |
| 395 | Ga0373947_0005625 | 3300035725 | Bacteria | 7308 |
| 396 | Ga0373947_0039963 | 3300035725 | Bacteria | 2793 |
| 397 | Ga0373937_0283207 | 3300036401 | Unclassified | 1565 |
| 398 | Ga0373937_0471658 | 3300036401 | Bacteria | 1192 |
| 399 | Ga0373925_0001828 | 3300037068 | Bacteria | 17755 |
| 400 | Ga0373925_0148942 | 3300037068 | Bacteria | 1836 |
| 401 | Ga0395899_0023795 | 3300037312 | Bacteria | 4635 |
| 402 | Ga0395899_0085357 | 3300037312 | Bacteria | 2293 |
| 403 | Ga0395900_0021884 | 3300037418 | Bacteria | 6537 |
| 404 | Ga0395900_0114172 | 3300037418 | Bacteria | 2772 |
| 405 | Ga0395900_0183662 | 3300037418 | Bacteria | 2124 |
| 406 | Ga0395900_0266290 | 3300037418 | Bacteria | 1710 |
| 407 | Ga0395900_0937121 | 3300037418 | Bacteria | 788 |
| 408 | Ga0395900_1211859 | 3300037418 | Bacteria | 670 |
| 409 | Ga0395898_0001509 | 3300037466 | Bacteria | 32076 |
| 410 | Ga0395898_0004411 | 3300037466 | Bacteria | 15397 |
| 411 | Ga0395898_0091755 | 3300037466 | Bacteria | 2922 |
| 412 | Ga0395898_0153557 | 3300037466 | Bacteria | 2203 |
| 413 | Ga0395898_0442076 | 3300037466 | Bacteria | 1239 |
| 414 | Ga0395905_0045512 | 3300037471 | Bacteria | 4115 |
| 415 | Ga0395905_0265388 | 3300037471 | Bacteria | 1602 |
| 416 | Ga0395905_1292120 | 3300037471 | Bacteria | 633 |
| 417 | Ga0436364_0244893 | 3300037853 | Bacteria | 1243 |
| 418 | Ga0395901_0009334 | 3300038443 | Bacteria | 9945 |
| 419 | Ga0395901_0276606 | 3300038443 | Bacteria | 1745 |
| 420 | Ga0395901_0301484 | 3300038443 | Bacteria | 1661 |
| 421 | Ga0395901_0772371 | 3300038443 | Bacteria | 952 |
| 422 | Ga0436365_0007111 | 3300039437 | Bacteria | 973 |
| 423 | Ga0436365_0008576 | 3300039437 | Bacteria | 1109 |
| 424 | Ga0436365_0644646 | 3300039437 | Bacteria | 623 |
| 425 | Ga0436363_0783829 | 3300039450 | Bacteria | 927 |
| 426 | Ga0436363_0811044 | 3300039450 | Bacteria | 721 |
| 427 | Ga0436363_0979416 | 3300039450 | Unclassified | 630 |
| 428 | Ga0436363_1065067 | 3300039450 | Bacteria | 1104 |
| 429 | Ga0436362_0326961 | 3300039453 | Bacteria | 724 |
| 430 | Ga0451789_0989819 | 3300041443 | Unclassified | 687 |
| 431 | Ga0451802_0769261 | 3300041460 | Bacteria | 535 |
| 432 | Ga0451853_1672016 | 3300041512 | Bacteria | 759 |
| 433 | Ga0466972_0480817 | 3300044658 | Bacteria | 584 |
| 434 | Ga0466965_0162990 | 3300044683 | Bacteria | 1170 |
| 435 | Ga0466965_0746125 | 3300044683 | Unclassified | 564 |
| 436 | Ga0466966_0008410 | 3300044684 | Bacteria | 6827 |
| 437 | Ga0466966_0125538 | 3300044684 | Bacteria | 1574 |
| 438 | Ga0466966_0199752 | 3300044684 | Bacteria | 1210 |
| 439 | Ga0466961_0019467 | 3300044693 | Bacteria | 4366 |
| 440 | Ga0466961_0026671 | 3300044693 | Bacteria | 3714 |
| 441 | Ga0466961_0080613 | 3300044693 | Bacteria | 2060 |
| 442 | Ga0466963_0003862 | 3300044694 | Bacteria | 8649 |
| 443 | Ga0466963_0004394 | 3300044694 | Bacteria | 8190 |
| 444 | Ga0466963_0011736 | 3300044694 | Bacteria | 5342 |
| 445 | Ga0466963_0022077 | 3300044694 | Bacteria | 4026 |
| 446 | Ga0466963_0034324 | 3300044694 | Bacteria | 3300 |
| 447 | Ga0466963_0489629 | 3300044694 | Bacteria | 868 |
| 448 | Ga0466963_0751444 | 3300044694 | Bacteria | 688 |
| 449 | Ga0466963_0935951 | 3300044694 | Bacteria | 610 |
| 450 | Ga0466964_0002916 | 3300044706 | Bacteria | 6178 |
| 451 | Ga0466964_0002988 | 3300044706 | Bacteria | 6122 |
| 452 | Ga0466964_0009352 | 3300044706 | Bacteria | 3689 |
| 453 | Ga0466964_0017077 | 3300044706 | Bacteria | 2776 |
| 454 | Ga0466964_0649753 | 3300044706 | Bacteria | 583 |
| 455 | Ga0466971_0000282 | 3300044719 | Bacteria | 19481 |
| 456 | Ga0466971_0151659 | 3300044719 | Bacteria | 1082 |
| 457 | Ga0466971_0539798 | 3300044719 | Unclassified | 578 |
| 458 | Ga0466968_0421634 | 3300044735 | Bacteria | 656 |
| 459 | Ga0466970_0633817 | 3300044765 | Bacteria | 621 |
| 460 | Ga0466957_0002174 | 3300044842 | Bacteria | 10505 |
| 461 | Ga0466957_0047874 | 3300044842 | Bacteria | 2598 |
| 462 | Ga0466957_0119300 | 3300044842 | Bacteria | 1680 |
| 463 | Ga0466957_0321553 | 3300044842 | Unclassified | 1044 |
| 464 | Ga0466957_0914483 | 3300044842 | Bacteria | 627 |
| 465 | Ga0466957_1117824 | 3300044842 | Bacteria | 568 |
| 466 | Ga0466960_0192719 | 3300044901 | Bacteria | 1110 |
| 467 | Ga0466959_0007644 | 3300045049 | Bacteria | 7601 |
| 468 | Ga0466959_0033459 | 3300045049 | Bacteria | 3801 |
| 469 | Ga0466959_0034408 | 3300045049 | Bacteria | 3747 |
| 470 | Ga0466959_0113114 | 3300045049 | Bacteria | 1935 |
| 471 | Ga0466959_0651726 | 3300045049 | Bacteria | 707 |
| 472 | Ga0466958_0004124 | 3300045836 | Bacteria | 7626 |
| 473 | Ga0466958_0012056 | 3300045836 | Bacteria | 4885 |
| 474 | Ga0466958_0288138 | 3300045836 | Bacteria | 1053 |
| 475 | Ga0466958_0323307 | 3300045836 | Bacteria | 991 |
| 476 | Ga0466967_0010340 | 3300045976 | Bacteria | 6994 |
| 477 | Ga0466967_0015053 | 3300045976 | Bacteria | 6052 |
| 478 | Ga0466967_0022022 | 3300045976 | Bacteria | 5190 |
| 479 | Ga0466967_0026965 | 3300045976 | Bacteria | 4770 |
| 480 | Ga0466967_0047524 | 3300045976 | Bacteria | 3741 |
| 481 | Ga0466967_0051218 | 3300045976 | Bacteria | 3617 |
| 482 | Ga0466967_0114041 | 3300045976 | Bacteria | 2487 |
| 483 | Ga0466967_0120211 | 3300045976 | Bacteria | 2426 |
| 484 | Ga0466967_0125131 | 3300045976 | Bacteria | 2380 |
| 485 | Ga0466967_0201452 | 3300045976 | Bacteria | 1885 |
| 486 | Ga0466967_0374137 | 3300045976 | Bacteria | 1382 |
| 487 | Ga0466967_0449371 | 3300045976 | Unclassified | 1259 |
| 488 | Ga0466967_0473827 | 3300045976 | Bacteria | 1226 |
| 489 | Ga0466967_0542474 | 3300045976 | Bacteria | 1144 |
| 490 | Ga0466967_0701550 | 3300045976 | Bacteria | 1002 |
| 491 | Ga0466967_0793879 | 3300045976 | Bacteria | 940 |
| 492 | Ga0466967_1331551 | 3300045976 | Unclassified | 715 |
| 493 | Ga0466967_2366019 | 3300045976 | Unclassified | 527 |
| 494 | Ga0495592_0352349 | 3300046454 | Bacteria | 943 |
| 495 | Ga0495629_0159054 | 3300046459 | Bacteria | 1569 |
| 496 | Ga0495629_0359342 | 3300046459 | Unclassified | 993 |
| 497 | Ga0495641_0000374 | 3300046461 | Bacteria | 37120 |
| 498 | Ga0495641_0028226 | 3300046461 | Bacteria | 2718 |
| 499 | Ga0495641_0092247 | 3300046461 | Unclassified | 1353 |
| 500 | Ga0495641_0191687 | 3300046461 | Bacteria | 916 |
| 501 | Ga0495641_0236485 | 3300046461 | Unclassified | 820 |
| 502 | Ga0495641_0250725 | 3300046461 | Bacteria | 796 |
| 503 | Ga0495651_0018440 | 3300046462 | Bacteria | 5405 |
| 504 | Ga0495651_0028003 | 3300046462 | Unclassified | 4392 |
| 505 | Ga0495651_0071904 | 3300046462 | Bacteria | 2629 |
| 506 | Ga0495651_0860151 | 3300046462 | Bacteria | 556 |
| 507 | Ga0495653_0015646 | 3300046463 | Bacteria | 6183 |
| 508 | Ga0495653_0123619 | 3300046463 | Bacteria | 1840 |
| 509 | Ga0495653_0213398 | 3300046463 | Bacteria | 1302 |
| 510 | Ga0495653_0308685 | 3300046463 | Bacteria | 1029 |
| 511 | Ga0495653_0392811 | 3300046463 | Unclassified | 883 |
| 512 | Ga0495582_0000124 | 3300046473 | Bacteria | 41197 |
| 513 | Ga0495582_0058377 | 3300046473 | Bacteria | 2128 |
| 514 | Ga0495582_0314568 | 3300046473 | Bacteria | 901 |
| 515 | Ga0495582_0403060 | 3300046473 | Bacteria | 789 |
| 516 | Ga0495582_0873677 | 3300046473 | Bacteria | 520 |
| 517 | Ga0495605_0054425 | 3300046474 | Bacteria | 1938 |
| 518 | Ga0495639_0000786 | 3300046475 | Bacteria | 14467 |
| 519 | Ga0495639_0322699 | 3300046475 | Bacteria | 772 |
| 520 | Ga0495662_0000898 | 3300046476 | Bacteria | 14537 |
| 521 | Ga0495664_0018607 | 3300046477 | Bacteria | 3984 |
| 522 | Ga0495664_0035313 | 3300046477 | Bacteria | 2943 |
| 523 | Ga0495664_0097484 | 3300046477 | Bacteria | 1770 |
| 524 | Ga0495664_0655644 | 3300046477 | Unclassified | 622 |
| 525 | Ga0495594_0085096 | 3300046499 | Unclassified | 1769 |
| 526 | Ga0495608_0010122 | 3300046511 | Bacteria | 6580 |
| 527 | Ga0495608_0029476 | 3300046511 | Bacteria | 3721 |
| 528 | Ga0495608_0127601 | 3300046511 | Bacteria | 1629 |
| 529 | Ga0495608_0283204 | 3300046511 | Unclassified | 1028 |
| 530 | Ga0495618_0218690 | 3300046514 | Unclassified | 1202 |
| 531 | Ga0495618_0579624 | 3300046514 | Bacteria | 669 |
| 532 | Ga0495628_0026156 | 3300046516 | Bacteria | 4764 |
| 533 | Ga0495628_0079309 | 3300046516 | Unclassified | 2553 |
| 534 | Ga0495628_0105848 | 3300046516 | Bacteria | 2167 |
| 535 | Ga0495628_0291974 | 3300046516 | Unclassified | 1208 |
| 536 | Ga0495630_0029084 | 3300046517 | Bacteria | 4107 |
| 537 | Ga0495630_0110340 | 3300046517 | Bacteria | 2084 |
| 538 | Ga0495666_0166133 | 3300046526 | Bacteria | 1022 |
| 539 | Ga0495652_0311192 | 3300046529 | Bacteria | 1141 |
| 540 | Ga0495652_0314960 | 3300046529 | Bacteria | 1132 |
| 541 | Ga0495665_0086584 | 3300046531 | Unclassified | 1646 |
| 542 | Ga0495665_0086623 | 3300046531 | Bacteria | 1646 |
| 543 | Ga0495665_0631266 | 3300046531 | Unclassified | 534 |
| 544 | Ga0495640_0019423 | 3300046533 | Bacteria | 5015 |
| 545 | Ga0495640_0090361 | 3300046533 | Bacteria | 2022 |
| 546 | Ga0495586_0369894 | 3300046535 | Bacteria | 824 |
| 547 | Ga0495586_0902520 | 3300046535 | Bacteria | 509 |
| 548 | Ga0495587_0098432 | 3300046536 | Bacteria | 1686 |
| 549 | Ga0495587_0113705 | 3300046536 | Unclassified | 1553 |
| 550 | Ga0495587_0347101 | 3300046536 | Unclassified | 827 |
| 551 | Ga0495645_0178400 | 3300046543 | Bacteria | 1457 |
| 552 | Ga0495645_0221156 | 3300046543 | Unclassified | 1273 |
| 553 | Ga0495622_0219251 | 3300046557 | Bacteria | 843 |
| 554 | Ga0495667_0002397 | 3300046559 | Bacteria | 12532 |
| 555 | Ga0495667_0020012 | 3300046559 | Bacteria | 4513 |
| 556 | Ga0495667_0032795 | 3300046559 | Bacteria | 3477 |
| 557 | Ga0495667_0045214 | 3300046559 | Bacteria | 2916 |
| 558 | Ga0495634_0075065 | 3300046642 | Bacteria | 2221 |
| 559 | Ga0495634_0457328 | 3300046642 | Unclassified | 752 |
| 560 | Ga0495635_0030531 | 3300046663 | Bacteria | 3745 |
| 561 | Ga0495635_0036436 | 3300046663 | Bacteria | 3410 |
| 562 | Ga0495635_0118691 | 3300046663 | Bacteria | 1805 |
| 563 | Ga0495588_0734388 | 3300046674 | Bacteria | 516 |
| 564 | Ga0495657_0027919 | 3300046675 | Bacteria | 3974 |
| 565 | Ga0495657_0028795 | 3300046675 | Bacteria | 3902 |
| 566 | Ga0495657_0199563 | 3300046675 | Bacteria | 1220 |
| 567 | Ga0495657_0340598 | 3300046675 | Bacteria | 889 |
| 568 | Ga0495657_0370545 | 3300046675 | Bacteria | 845 |
| 569 | Ga0495599_0092733 | 3300046678 | Unclassified | 1884 |
| 570 | Ga0495599_0194893 | 3300046678 | Unclassified | 1245 |
| 571 | Ga0495599_0373445 | 3300046678 | Bacteria | 852 |
| 572 | Ga0495623_0040204 | 3300046679 | Bacteria | 2986 |
| 573 | Ga0495646_0035388 | 3300046680 | Bacteria | 3098 |
| 574 | Ga0495646_0078933 | 3300046680 | Bacteria | 1923 |
| 575 | Ga0495646_0082304 | 3300046680 | Bacteria | 1873 |
| 576 | Ga0495647_0004080 | 3300046681 | Bacteria | 4720 |
| 577 | Ga0495647_0601875 | 3300046681 | Bacteria | 516 |
| 578 | Ga0495647_0616179 | 3300046681 | Bacteria | 510 |
| 579 | Ga0495658_0000247 | 3300046683 | Bacteria | 30977 |
| 580 | Ga0495658_0032563 | 3300046683 | Bacteria | 2848 |
| 581 | Ga0495658_0070745 | 3300046683 | Bacteria | 2025 |
| 582 | Ga0495613_0013675 | 3300046689 | Bacteria | 6021 |
| 583 | Ga0495613_0032931 | 3300046689 | Bacteria | 3851 |
| 584 | Ga0495613_0693818 | 3300046689 | Unclassified | 671 |
| 585 | Ga0495624_0010741 | 3300046690 | Bacteria | 6310 |
| 586 | Ga0495624_0109848 | 3300046690 | Unclassified | 1696 |
| 587 | Ga0495624_0498767 | 3300046690 | Unclassified | 728 |
| 588 | Ga0495624_0551431 | 3300046690 | Bacteria | 688 |
| 589 | Ga0495624_0680530 | 3300046690 | Bacteria | 611 |
| 590 | Ga0495600_0017559 | 3300046809 | Bacteria | 4553 |
| 591 | Ga0495600_0059533 | 3300046809 | Bacteria | 2495 |
| 592 | Ga0495600_0504629 | 3300046809 | Bacteria | 743 |
| 593 | Ga0495581_0003701 | 3300047315 | Bacteria | 8805 |
| 594 | Ga0495581_0116740 | 3300047315 | Bacteria | 1552 |
| 595 | Ga0495581_0402584 | 3300047315 | Bacteria | 798 |
| 596 | Ga0495604_0016420 | 3300047317 | Bacteria | 5918 |
| 597 | Ga0495604_0033832 | 3300047317 | Bacteria | 4045 |
| 598 | Ga0495604_0083229 | 3300047317 | Bacteria | 2392 |
| 599 | Ga0495604_0259618 | 3300047317 | Bacteria | 1181 |
| 600 | Ga0495674_0003941 | 3300047319 | Bacteria | 14400 |
| 601 | Ga0495674_0019510 | 3300047319 | Bacteria | 6289 |
| 602 | Ga0495674_0129472 | 3300047319 | Bacteria | 2127 |
| 603 | Ga0495674_0257792 | 3300047319 | Bacteria | 1433 |
| 604 | Ga0495676_0001077 | 3300047321 | Bacteria | 23118 |
| 605 | Ga0495680_0006023 | 3300047322 | Bacteria | 11341 |
| 606 | Ga0495680_0011046 | 3300047322 | Bacteria | 8022 |
| 607 | Ga0495680_0036742 | 3300047322 | Unclassified | 3929 |
| 608 | Ga0495680_0555427 | 3300047322 | Bacteria | 773 |
| 609 | Ga0495675_0290391 | 3300047444 | Unclassified | 973 |
| 610 | Ga0495675_0357632 | 3300047444 | Bacteria | 858 |
| 611 | Ga0495675_0628620 | 3300047444 | Bacteria | 607 |
| 612 | Ga0495684_0001855 | 3300047471 | Bacteria | 16919 |
| 613 | Ga0495684_0018726 | 3300047471 | Bacteria | 5333 |
| 614 | Ga0495684_0283913 | 3300047471 | Unclassified | 1193 |
| 615 | Ga0495593_0012759 | 3300047673 | Bacteria | 4798 |
| 616 | Ga0495593_0129579 | 3300047673 | Bacteria | 1281 |
| 617 | Ga0495602_0122289 | 3300048088 | Bacteria | 2092 |
| 618 | Ga0495602_0150988 | 3300048088 | Bacteria | 1826 |
| 619 | Ga0495602_0193124 | 3300048088 | Bacteria | 1559 |
| 620 | Ga0495602_0577756 | 3300048088 | Unclassified | 775 |
| 621 | Ga0495614_0013434 | 3300048089 | Bacteria | 3592 |
| 622 | Ga0495614_0074716 | 3300048089 | Unclassified | 1464 |
| 623 | Ga0495614_0331388 | 3300048089 | Bacteria | 707 |
| 624 | Ga0496100_0001575 | 3300048903 | Bacteria | 11237 |
| 625 | Ga0496100_0010229 | 3300048903 | Bacteria | 5306 |
| 626 | Ga0496100_0071371 | 3300048903 | Bacteria | 2318 |
| 627 | Ga0496100_0402453 | 3300048903 | Unclassified | 1043 |
| 628 | Ga0496101_0012134 | 3300048904 | Bacteria | 5743 |
| 629 | Ga0496101_0012361 | 3300048904 | Bacteria | 5696 |
| 630 | Ga0496101_0045876 | 3300048904 | Bacteria | 3132 |
| 631 | Ga0496101_0058115 | 3300048904 | Bacteria | 2799 |
| 632 | Ga0496101_0193072 | 3300048904 | Bacteria | 1572 |
| 633 | Ga0496102_0062684 | 3300048905 | Bacteria | 3405 |
| 634 | Ga0496102_0219062 | 3300048905 | Bacteria | 1794 |
| 635 | Ga0496102_0340261 | 3300048905 | Bacteria | 1413 |
| 636 | Ga0496102_0633389 | 3300048905 | Unclassified | 992 |
| 637 | Ga0496103_0071012 | 3300048906 | Bacteria | 2179 |
| 638 | Ga0496103_0095128 | 3300048906 | Bacteria | 1882 |
| 639 | Ga0496103_0232184 | 3300048906 | Bacteria | 1187 |
| 640 | Ga0496103_0745970 | 3300048906 | Bacteria | 619 |
| 641 | Ga0496103_0787844 | 3300048906 | Unclassified | 600 |
| 642 | Ga0496103_0924022 | 3300048906 | Bacteria | 546 |
| 643 | Ga0496103_0959002 | 3300048906 | Unclassified | 534 |
| 644 | Ga0496104_0089440 | 3300048907 | Bacteria | 2941 |
| 645 | Ga0496104_0136449 | 3300048907 | Bacteria | 2357 |
| 646 | Ga0496104_0860390 | 3300048907 | Bacteria | 812 |
| 647 | Ga0496105_0028970 | 3300048908 | Bacteria | 4530 |
| 648 | Ga0496105_0034310 | 3300048908 | Bacteria | 4172 |
| 649 | Ga0496105_0460266 | 3300048908 | Unclassified | 1003 |
| 650 | Ga0496105_0463314 | 3300048908 | Bacteria | 999 |
| 651 | Ga0496106_0017922 | 3300048909 | Bacteria | 5237 |
| 652 | Ga0496106_0060221 | 3300048909 | Bacteria | 2877 |
| 653 | Ga0496106_0176793 | 3300048909 | Bacteria | 1693 |
| 654 | Ga0496107_0045134 | 3300048910 | Bacteria | 3169 |
| 655 | Ga0496107_0063540 | 3300048910 | Bacteria | 2675 |
| 656 | Ga0496107_0207827 | 3300048910 | Bacteria | 1455 |
| 657 | Ga0496107_1065703 | 3300048910 | Unclassified | 585 |
| 658 | Ga0496108_0028066 | 3300048911 | Bacteria | 4656 |
| 659 | Ga0496108_0181259 | 3300048911 | Bacteria | 1824 |
| 660 | Ga0496108_1619868 | 3300048911 | Bacteria | 535 |
| 661 | Ga0496109_0017699 | 3300048912 | Bacteria | 6251 |
| 662 | Ga0496109_0409127 | 3300048912 | Unclassified | 1282 |
| 663 | Ga0496109_0410478 | 3300048912 | Bacteria | 1279 |
| 664 | Ga0496110_0119476 | 3300048913 | Bacteria | 2374 |
| 665 | Ga0496110_1067199 | 3300048913 | Unclassified | 716 |
| 666 | Ga0496110_1160701 | 3300048913 | Bacteria | 681 |
| 667 | Ga0496111_0028408 | 3300048914 | Bacteria | 3964 |
| 668 | Ga0496111_0400626 | 3300048914 | Bacteria | 1014 |
| 669 | Ga0496111_0800764 | 3300048914 | Bacteria | 682 |
| 670 | Ga0496111_1301213 | 3300048914 | Unclassified | 512 |
| 671 | Ga0496112_0021620 | 3300048915 | Bacteria | 6119 |
| 672 | Ga0496112_0069713 | 3300048915 | Bacteria | 3473 |
| 673 | Ga0496112_0081215 | 3300048915 | Bacteria | 3206 |
| 674 | Ga0496112_0098797 | 3300048915 | Bacteria | 2888 |
| 675 | Ga0496112_0102149 | 3300048915 | Bacteria | 2837 |
| 676 | Ga0496112_0163385 | 3300048915 | Bacteria | 2193 |
| 677 | Ga0496112_0442222 | 3300048915 | Unclassified | 1238 |
| 678 | Ga0496112_0469710 | 3300048915 | Bacteria | 1195 |
| 679 | Ga0496112_0760301 | 3300048915 | Bacteria | 895 |
| 680 | Ga0496112_1172625 | 3300048915 | Bacteria | 685 |
| 681 | Ga0496113_0452541 | 3300048916 | Bacteria | 1032 |
| 682 | Ga0496113_1518759 | 3300048916 | Unclassified | 517 |
| 683 | Ga0496114_0001536 | 3300048917 | Bacteria | 17490 |
| 684 | Ga0496114_0012463 | 3300048917 | Bacteria | 6806 |
| 685 | Ga0496114_0044736 | 3300048917 | Bacteria | 3675 |
| 686 | Ga0496114_0165087 | 3300048917 | Bacteria | 1927 |
| 687 | Ga0496114_0301577 | 3300048917 | Bacteria | 1414 |
| 688 | Ga0496114_0468153 | 3300048917 | Bacteria | 1115 |
| 689 | Ga0496115_0006958 | 3300048918 | Bacteria | 8308 |
| 690 | Ga0496115_0007667 | 3300048918 | Bacteria | 7953 |
| 691 | Ga0496115_0016034 | 3300048918 | Bacteria | 5698 |
| 692 | Ga0496115_0079832 | 3300048918 | Bacteria | 2663 |
| 693 | Ga0496115_0092031 | 3300048918 | Bacteria | 2479 |
| 694 | Ga0496115_0489336 | 3300048918 | Bacteria | 990 |
| 695 | Ga0496115_0848060 | 3300048918 | Unclassified | 708 |
| 696 | Ga0501038_1035824 | 3300049574 | Bacteria | 601 |
| 697 | Ga0501047_0036325 | 3300049581 | Bacteria | 4762 |
| 698 | Ga0501067_0000684 | 3300049583 | Bacteria | 18236 |
| 699 | Ga0501067_0040552 | 3300049583 | Bacteria | 2585 |
| 700 | Ga0501067_0404865 | 3300049583 | Bacteria | 761 |
| 701 | Ga0501067_0480507 | 3300049583 | Unclassified | 695 |
| 702 | Ga0501069_0085031 | 3300049585 | Bacteria | 1785 |
| 703 | Ga0501069_0116351 | 3300049585 | Bacteria | 1525 |
| 704 | Ga0501069_0546615 | 3300049585 | Bacteria | 693 |
| 705 | Ga0501070_0059846 | 3300049586 | Bacteria | 3157 |
| 706 | Ga0501070_0535568 | 3300049586 | Bacteria | 938 |
| 707 | Ga0501070_1470355 | 3300049586 | Bacteria | 516 |
| 708 | Ga0501073_0262784 | 3300049589 | Bacteria | 1191 |
| 709 | Ga0501074_0060768 | 3300049590 | Bacteria | 2722 |
| 710 | Ga0501074_0809281 | 3300049590 | Bacteria | 660 |
| 711 | Ga0501079_0304870 | 3300049741 | Unclassified | 1246 |
| 712 | Ga0501080_0596119 | 3300049742 | Bacteria | 981 |
| 713 | Ga0501044_0377656 | 3300049823 | Bacteria | 1333 |
| 714 | nmdc:mga05p37_1332511_c1 | 3300050507 | Bacteria | 729 |
| 715 | nmdc:mga0n895_6128_c1 | 3300050512 | Bacteria | 10157 |
| 716 | nmdc:mga0rr50_519562_c1 | 3300050513 | Unclassified | 514 |
| 717 | nmdc:mga0rr50_65197_c1 | 3300050513 | Bacteria | 2758 |
| 718 | nmdc:mga0a205_113505_c1 | 3300050515 | Bacteria | 2608 |
| 719 | nmdc:mga0a205_13182_c2 | 3300050515 | Bacteria | 4726 |
| 720 | Ga0495601_0140522 | 3300053077 | Bacteria | 1575 |
| 721 | Ga0495601_0349453 | 3300053077 | Unclassified | 961 |
| 722 | Ga0495601_0591430 | 3300053077 | Unclassified | 712 |
| 723 | Ga0495612_0059843 | 3300053078 | Bacteria | 1576 |
| 724 | Ga0495612_0115817 | 3300053078 | Bacteria | 1150 |
| 725 | Ga0495612_0119035 | 3300053078 | Unclassified | 1135 |
| 726 | Ga0495655_0012607 | 3300053083 | Bacteria | 1727 |
| 727 | Ga0495595_0018976 | 3300053084 | Unclassified | 2978 |
| 728 | Ga0495595_0039102 | 3300053084 | Bacteria | 2164 |
| 729 | Ga0495595_0095196 | 3300053084 | Bacteria | 1432 |
| 730 | Ga0495595_0153361 | 3300053084 | Bacteria | 1134 |
| 731 | Ga0495619_0025945 | 3300053085 | Bacteria | 3767 |
| 732 | Ga0466962_0006119 | 3300061719 | Bacteria | 5785 |
| 733 | Ga0466962_0017977 | 3300061719 | Bacteria | 3402 |
| 734 | Ga0466962_0165499 | 3300061719 | Unclassified | 1076 |
| 735 | Ga0466962_0541639 | 3300061719 | Bacteria | 591 |
| 736 | Ga0070713_101742256 | |||
| 737 | rootH1_10318263 | |||
| 738 | Ga0058863_11596509 | |||
| 739 | Ga0058861_11831151 | |||
| 740 | Ga0058861_11878822 | |||
| 741 | Ga0058862_12611363 | |||
| 742 | Ga0058862_12661891 | |||
| 743 | Ga0070658_10011654 | |||
| 744 | Ga0070658_10296871 | |||
| 745 | Ga0070658_10416077 | |||
| 746 | Ga0070658_10944829 | |||
| 747 | Ga0070658_11150855 | |||
| 748 | Ga0070658_11243912 | |||
| 749 | Ga0070658_11588302 | |||
| 750 | Ga0070683_100014696 | |||
| 751 | Ga0070683_100033750 | |||
| 752 | Ga0070683_100310901 | |||
| 753 | Ga0070683_100476407 | |||
| 754 | Ga0070683_100491134 | |||
| 755 | Ga0070683_100555635 | |||
| 756 | Ga0070690_101061516 | |||
| 757 | Ga0070666_11119805 | |||
| 758 | Ga0070680_100020219 | |||
| 759 | Ga0070680_100107422 | |||
| 760 | Ga0070680_100147622 | |||
| 761 | Ga0070680_100197229 | |||
| 762 | Ga0070680_100463495 | |||
| 763 | Ga0070680_100533901 | |||
| 764 | Ga0070680_100788299 | |||
| 765 | Ga0070680_100834072 | |||
| 766 | Ga0070660_100003611 | |||
| 767 | Ga0070660_100006608 | |||
| 768 | Ga0070660_100051211 | |||
| 769 | Ga0070660_100105017 | |||
| 770 | Ga0070660_100214122 | |||
| 771 | Ga0070660_100316888 | |||
| 772 | Ga0070660_100636610 | |||
| 773 | Ga0070661_100020146 | |||
| 774 | Ga0070661_100070569 | |||
| 775 | Ga0070661_100151903 | |||
| 776 | Ga0070661_100194475 | |||
| 777 | Ga0070661_100655231 | |||
| 778 | Ga0070661_100792816 | |||
| 779 | Ga0070661_101045530 | |||
| 780 | Ga0070671_100016842 | |||
| 781 | Ga0070671_101113840 | |||
| 782 | Ga0070673_100354771 | |||
| 783 | Ga0070659_100068194 | |||
| 784 | Ga0070659_100148416 | |||
| 785 | Ga0070659_101852264 | |||
| 786 | Ga0070659_101852848 | |||
| 787 | Ga0070709_10207559 | |||
| 788 | Ga0070714_100061015 | |||
| 789 | Ga0070714_100128444 | |||
| 790 | Ga0070714_100229411 | |||
| 791 | Ga0070714_100376426 | |||
| 792 | Ga0070714_100676054 | |||
| 793 | Ga0070714_100715282 | |||
| 794 | Ga0070714_100900617 | |||
| 795 | Ga0070714_101121314 | |||
| 796 | Ga0070714_101318007 | |||
| 797 | Ga0070714_101932282 | |||
| 798 | Ga0070713_100176256 | |||
| 799 | Ga0070713_100618717 | |||
| 800 | Ga0070713_102374955 | |||
| 801 | Ga0070710_10319995 | |||
| 802 | Ga0070710_11497549 | |||
| 803 | Ga0070711_100119762 | |||
| 804 | Ga0070708_100519482 | |||
| 805 | Ga0070678_100420577 | |||
| 806 | Ga0070678_102186213 | |||
| 807 | Ga0070681_10001213 | |||
| 808 | Ga0070681_10065555 | |||
| 809 | Ga0070681_10104999 | |||
| 810 | Ga0070681_10270523 | |||
| 811 | Ga0070681_10600876 | |||
| 812 | Ga0070681_10665058 | |||
| 813 | Ga0070681_10795706 | |||
| 814 | Ga0070698_100912672 | |||
| 815 | Ga0070698_101439670 | |||
| 816 | Ga0070679_100004486 | |||
| 817 | Ga0070679_100020574 | |||
| 818 | Ga0070679_100058769 | |||
| 819 | Ga0070679_100136865 | |||
| 820 | Ga0070679_100292527 | |||
| 821 | Ga0070679_100512764 | |||
| 822 | Ga0070679_100549503 | |||
| 823 | Ga0070679_100815110 | |||
| 824 | Ga0070684_100013758 | |||
| 825 | Ga0070684_100034651 | |||
| 826 | Ga0070684_100318025 | |||
| 827 | Ga0070684_100330605 | |||
| 828 | Ga0070684_100341558 | |||
| 829 | Ga0070684_100360746 | |||
| 830 | Ga0070684_101206585 | |||
| 831 | Ga0070697_100712728 | |||
| 832 | Ga0068853_100092663 | |||
| 833 | Ga0068853_100306706 | |||
| 834 | Ga0068853_100708198 | |||
| 835 | Ga0068853_100801253 | |||
| 836 | Ga0070696_100006574 | |||
| 837 | Ga0070696_101883192 | |||
| 838 | Ga0070665_100281583 | |||
| 839 | Ga0068855_100022769 | |||
| 840 | Ga0068855_100063071 | |||
| 841 | Ga0068855_100132958 | |||
| 842 | Ga0068855_100163556 | |||
| 843 | Ga0068855_100200959 | |||
| 844 | Ga0068855_100510856 | |||
| 845 | Ga0068855_100556072 | |||
| 846 | Ga0070664_100988054 | |||
| 847 | Ga0068857_100044123 | |||
| 848 | Ga0068857_100088246 | |||
| 849 | Ga0068857_100292510 | |||
| 850 | Ga0068857_100620593 | |||
| 851 | Ga0068857_102003365 | |||
| 852 | Ga0068854_101811561 | |||
| 853 | Ga0068856_100218148 | |||
| 854 | Ga0068856_100333179 | |||
| 855 | Ga0068856_100784388 | |||
| 856 | Ga0068856_100824817 | |||
| 857 | Ga0068852_100027110 | |||
| 858 | Ga0068852_100258189 | |||
| 859 | Ga0068851_10608150 | |||
| 860 | Ga0070717_10064666 | |||
| 861 | Ga0070717_10226281 | |||
| 862 | Ga0070717_10286109 | |||
| 863 | Ga0070717_10466886 | |||
| 864 | Ga0070715_10403900 | |||
| 865 | Ga0070716_100779797 | |||
| 866 | Ga0070716_100990470 | |||
| 867 | Ga0070712_100061780 | |||
| 868 | Ga0070712_100128214 | |||
| 869 | Ga0070712_101378596 | |||
| 870 | Ga0070712_101817520 | |||
| 871 | Ga0097621_100347645 | |||
| 872 | Ga0068871_100555044 | |||
| 873 | Ga0068871_100653553 | |||
| 874 | Ga0068871_100863694 | |||
| 875 | Ga0068871_102230491 | |||
| 876 | Ga0075433_10038807 | |||
| 877 | Ga0075434_100038125 | |||
| 878 | Ga0068865_100687104 | |||
| 879 | Ga0075436_100842737 | |||
| 880 | Ga0075435_100073743 | |||
| 881 | Ga0075435_102046186 | |||
| 882 | Ga0105240_10016420 | |||
| 883 | Ga0105240_10238489 | |||
| 884 | Ga0105240_10289254 | |||
| 885 | Ga0105240_10466430 | |||
| 886 | Ga0105240_10660834 | |||
| 887 | Ga0105245_10144642 | |||
| 888 | Ga0105245_11206405 | |||
| 889 | Ga0105245_11263114 | |||
| 890 | Ga0114129_11867614 | |||
| 891 | Ga0105243_10915197 | |||
| 892 | Ga0105241_10360025 | |||
| 893 | Ga0105241_10699621 | |||
| 894 | Ga0105241_10847936 | |||
| 895 | Ga0105241_11159294 | |||
| 896 | Ga0105241_11800201 | |||
| 897 | Ga0105242_10050202 | |||
| 898 | Ga0105242_10511307 | |||
| 899 | Ga0105242_10874994 | |||
| 900 | Ga0105237_10039262 | |||
| 901 | Ga0105237_11090377 | |||
| 902 | Ga0105237_11352527 | |||
| 903 | Ga0105237_11514314 | |||
| 904 | Ga0105238_10051504 | |||
| 905 | Ga0105238_10123201 | |||
| 906 | Ga0105238_10524196 | |||
| 907 | Ga0105238_10743440 | |||
| 908 | Ga0105238_11635108 | |||
| 909 | Ga0105238_12347921 | |||
| 910 | Ga0105239_10237715 | |||
| 911 | Ga0105239_10335437 | |||
| 912 | Ga0105239_11976934 | |||
| 913 | Ga0105246_11601761 | |||
| 914 | Ga0105246_11867008 | |||
| 915 | Ga0157373_10753344 | |||
| 916 | Ga0157371_10210646 | |||
| 917 | Ga0157371_10570819 | |||
| 918 | Ga0157370_10021632 | |||
| 919 | Ga0157370_10064360 | |||
| 920 | Ga0157370_10070570 | |||
| 921 | Ga0157370_10388142 | |||
| 922 | Ga0157370_10519965 | |||
| 923 | Ga0157370_10973060 | |||
| 924 | Ga0157369_10155660 | |||
| 925 | Ga0157369_10202624 | |||
| 926 | Ga0157369_10515452 | |||
| 927 | Ga0157369_10649099 | |||
| 928 | Ga0157369_10794367 | |||
| 929 | Ga0157374_10116329 | |||
| 930 | Ga0157374_11275962 | |||
| 931 | Ga0157374_11468015 | |||
| 932 | Ga0157378_10324391 | |||
| 933 | Ga0157378_11059795 | |||
| 934 | Ga0157378_11252824 | |||
| 935 | Ga0157372_10081192 | |||
| 936 | Ga0157372_10140995 | |||
| 937 | Ga0157372_10142507 | |||
| 938 | Ga0157372_10548720 | |||
| 939 | Ga0157372_10683127 | |||
| 940 | Ga0157372_10937920 | |||
| 941 | Ga0157375_11126518 | |||
| 942 | Ga0182008_10152147 | |||
| 943 | Ga0182008_10672405 | |||
| 944 | Ga0157376_10768776 | |||
| 945 | Ga0197907_10930522 | |||
| 946 | Ga0197907_11151862 | |||
| 947 | Ga0197907_11361063 | |||
| 948 | Ga0206356_10428047 | |||
| 949 | Ga0206356_10429965 | |||
| 950 | Ga0206356_11685916 | |||
| 951 | Ga0206349_1108614 | |||
| 952 | Ga0206355_1054366 | |||
| 953 | Ga0206355_1060814 | |||
| 954 | Ga0206355_1721177 | |||
| 955 | Ga0206351_10198018 | |||
| 956 | Ga0206352_11259618 | |||
| 957 | Ga0206350_10116138 | |||
| 958 | Ga0206350_10949612 | |||
| 959 | Ga0206354_10139567 | |||
| 960 | Ga0206354_10899407 | |||
| 961 | Ga0206353_10123035 | |||
| 962 | Ga0206353_10721544 | |||
| 963 | Ga0206353_12056592 | |||
| 964 | Ga0206353_12068744 | |||
| 965 | Ga0154015_1053496 | |||
| 966 | Ga0154015_1316928 | |||
| 967 | Ga0213874_10120501 | |||
| 968 | Ga0213875_10237802 | |||
| 969 | Ga0224712_10018854 | |||
| 970 | Ga0224712_10095789 | |||
| 971 | Ga0207692_10138561 | |||
| 972 | Ga0207692_10491593 | |||
| 973 | Ga0207692_10504185 | |||
| 974 | Ga0207685_10011327 | |||
| 975 | Ga0207685_10319871 | |||
| 976 | Ga0207699_10152627 | |||
| 977 | Ga0207705_10021888 | |||
| 978 | Ga0207705_10121403 | |||
| 979 | Ga0207705_10136378 | |||
| 980 | Ga0207705_10287374 | |||
| 981 | Ga0207705_10512084 | |||
| 982 | Ga0207705_10653238 | |||
| 983 | Ga0207705_10933019 | |||
| 984 | Ga0207654_11390618 | |||
| 985 | Ga0207707_10002380 | |||
| 986 | Ga0207707_10034890 | |||
| 987 | Ga0207707_10053386 | |||
| 988 | Ga0207707_10185569 | |||
| 989 | Ga0207707_10185716 | |||
| 990 | Ga0207707_10227797 | |||
| 991 | Ga0207707_10497417 | |||
| 992 | Ga0207695_10261844 | |||
| 993 | Ga0207695_10360715 | |||
| 994 | Ga0207671_10054864 | |||
| 995 | Ga0207671_10490275 | |||
| 996 | Ga0207671_10993853 | |||
| 997 | Ga0207693_10026100 | |||
| 998 | Ga0207693_10107272 | |||
| 999 | Ga0207693_10429445 | |||
| 1000 | Ga0207693_11144320 | |||
| 1001 | Ga0207663_10016856 | |||
| 1002 | Ga0207663_10069621 | |||
| 1003 | Ga0207663_10079452 | |||
| 1004 | Ga0207663_11170464 | |||
| 1005 | Ga0207660_10012183 | |||
| 1006 | Ga0207660_10093840 | |||
| 1007 | Ga0207660_10136020 | |||
| 1008 | Ga0207660_10155159 | |||
| 1009 | Ga0207660_10498913 | |||
| 1010 | Ga0207660_10634303 | |||
| 1011 | Ga0207660_10848435 | |||
| 1012 | Ga0207660_10892777 | |||
| 1013 | Ga0207657_10000054 | |||
| 1014 | Ga0207657_10001075 | |||
| 1015 | Ga0207657_10004160 | |||
| 1016 | Ga0207657_10033290 | |||
| 1017 | Ga0207657_10197179 | |||
| 1018 | Ga0207657_10337525 | |||
| 1019 | Ga0207657_10969627 | |||
| 1020 | Ga0207649_10058016 | |||
| 1021 | Ga0207649_10327546 | |||
| 1022 | Ga0207649_10350243 | |||
| 1023 | Ga0207649_10358166 | |||
| 1024 | Ga0207649_10695383 | |||
| 1025 | Ga0207649_10766771 | |||
| 1026 | Ga0207649_11073449 | |||
| 1027 | Ga0207652_10147522 | |||
| 1028 | Ga0207652_10160480 | |||
| 1029 | Ga0207652_10160688 | |||
| 1030 | Ga0207652_10166388 | |||
| 1031 | Ga0207652_10201891 | |||
| 1032 | Ga0207652_10952591 | |||
| 1033 | Ga0207652_11196502 | |||
| 1034 | Ga0207652_11229674 | |||
| 1035 | Ga0207652_11852294 | |||
| 1036 | Ga0207646_10317404 | |||
| 1037 | Ga0207646_10323367 | |||
| 1038 | Ga0207694_10534356 | |||
| 1039 | Ga0207687_10205832 | |||
| 1040 | Ga0207700_10390438 | |||
| 1041 | Ga0207700_10652256 | |||
| 1042 | Ga0207664_10156674 | |||
| 1043 | Ga0207664_10231381 | |||
| 1044 | Ga0207664_10337959 | |||
| 1045 | Ga0207664_10377808 | |||
| 1046 | Ga0207664_10590707 | |||
| 1047 | Ga0207690_10043519 | |||
| 1048 | Ga0207690_10451550 | |||
| 1049 | Ga0207686_10992522 | |||
| 1050 | Ga0207709_10654215 | |||
| 1051 | Ga0207665_10111072 | |||
| 1052 | Ga0207665_10237768 | |||
| 1053 | Ga0207665_10997836 | |||
| 1054 | Ga0207661_10026264 | |||
| 1055 | Ga0207661_10218085 | |||
| 1056 | Ga0207661_10418043 | |||
| 1057 | Ga0207661_10652825 | |||
| 1058 | Ga0207661_11825387 | |||
| 1059 | Ga0207679_10147944 | |||
| 1060 | Ga0207679_11387893 | |||
| 1061 | Ga0207667_10040671 | |||
| 1062 | Ga0207667_10096249 | |||
| 1063 | Ga0207667_10175124 | |||
| 1064 | Ga0207667_10310584 | |||
| 1065 | Ga0207667_10330871 | |||
| 1066 | Ga0207667_10415856 | |||
| 1067 | Ga0207667_11119018 | |||
| 1068 | Ga0207640_10522246 | |||
| 1069 | Ga0207640_11581895 | |||
| 1070 | Ga0207658_10130663 | |||
| 1071 | Ga0207677_10115980 | |||
| 1072 | Ga0207639_10056492 | |||
| 1073 | Ga0207639_10269163 | |||
| 1074 | Ga0207639_10682248 | |||
| 1075 | Ga0207639_12202683 | |||
| 1076 | Ga0207678_11135068 | |||
| 1077 | Ga0207702_10032479 | |||
| 1078 | Ga0207702_10143631 | |||
| 1079 | Ga0207702_10688072 | |||
| 1080 | Ga0207702_11591926 | |||
| 1081 | Ga0207674_10056847 | |||
| 1082 | Ga0207674_10066998 | |||
| 1083 | Ga0207674_10358692 | |||
| 1084 | Ga0207683_10447707 | |||
| 1085 | Ga0207698_10095007 | |||
| 1086 | Ga0207698_10218876 | |||
| 1087 | Ga0207698_10685427 | |||
| 1088 | Ga0268266_10253992 | |||
| 1089 | Ga0265319_1036087 | |||
| 1090 | Ga0265334_10013764 | |||
| 1091 | Ga0265318_10048967 | |||
| 1092 | Ga0265322_10040434 | |||
| 1093 | Ga0265336_10268026 | |||
| 1094 | Ga0265324_10230764 | |||
| 1095 | Ga0265330_10064920 | |||
| 1096 | Ga0265320_10046447 | |||
| 1097 | Ga0265325_10074032 | |||
| 1098 | Ga0265329_10155352 | |||
| 1099 | Ga0265340_10063816 | |||
| 1100 | Ga0265339_10441662 | |||
| 1101 | Ga0265327_10016624 | |||
| 1102 | Ga0265316_10031777 | |||
| 1103 | Ga0265313_10030460 | |||
| 1104 | Ga0265314_10214934 | |||
| 1105 | Ga0265314_10235694 | |||
| 1106 | Ga0265342_10079201 | |||
| 1107 | Ga0373926_0198757 | |||
| 1108 | Ga0373926_0298366 | |||
| 1109 | Ga0373936_0009649 | |||
| 1110 | Ga0373936_0090715 | |||
| 1111 | Ga0373945_0023282 | |||
| 1112 | Ga0373945_0194304 | |||
| 1113 | Ga0373956_0522272 | |||
| 1114 | Ga0373943_0000101 | |||
| 1115 | Ga0373943_0001881 | |||
| 1116 | Ga0373943_0021015 | |||
| 1117 | Ga0373946_0006107 | |||
| 1118 | Ga0373946_0079806 | |||
| 1119 | Ga0373946_0193601 | |||
| 1120 | Ga0373955_0247281 | |||
| 1121 | Ga0373931_1300492 | |||
| 1122 | Ga0373935_0026073 | |||
| 1123 | Ga0373935_0052840 | |||
| 1124 | Ga0373935_0295829 | |||
| 1125 | Ga0373927_0053528 | |||
| 1126 | Ga0373927_0093584 | |||
| 1127 | Ga0373927_0429770 | |||
| 1128 | Ga0373933_0192407 | |||
| 1129 | Ga0373947_0004085 | |||
| 1130 | Ga0373947_0005625 | |||
| 1131 | Ga0373947_0039963 | |||
| 1132 | Ga0373937_0283207 | |||
| 1133 | Ga0373937_0471658 | |||
| 1134 | Ga0373925_0001828 | |||
| 1135 | Ga0373925_0148942 | |||
| 1136 | Ga0395899_0023795 | |||
| 1137 | Ga0395899_0085357 | |||
| 1138 | Ga0395900_0021884 | |||
| 1139 | Ga0395900_0114172 | |||
| 1140 | Ga0395900_0183662 | |||
| 1141 | Ga0395900_0266290 | |||
| 1142 | Ga0395900_0937121 | |||
| 1143 | Ga0395900_1211859 | |||
| 1144 | Ga0395898_0001509 | |||
| 1145 | Ga0395898_0004411 | |||
| 1146 | Ga0395898_0091755 | |||
| 1147 | Ga0395898_0153557 | |||
| 1148 | Ga0395898_0442076 | |||
| 1149 | Ga0395905_0045512 | |||
| 1150 | Ga0395905_0265388 | |||
| 1151 | Ga0395905_1292120 | |||
| 1152 | Ga0436364_0244893 | |||
| 1153 | Ga0395901_0009334 | |||
| 1154 | Ga0395901_0276606 | |||
| 1155 | Ga0395901_0301484 | |||
| 1156 | Ga0395901_0772371 | |||
| 1157 | Ga0436365_0007111 | |||
| 1158 | Ga0436365_0008576 | |||
| 1159 | Ga0436365_0644646 | |||
| 1160 | Ga0436363_0783829 | |||
| 1161 | Ga0436363_0811044 | |||
| 1162 | Ga0436363_0979416 | |||
| 1163 | Ga0436363_1065067 | |||
| 1164 | Ga0436362_0326961 | |||
| 1165 | Ga0451789_0989819 | |||
| 1166 | Ga0451802_0769261 | |||
| 1167 | Ga0451853_1672016 | |||
| 1168 | Ga0466972_0480817 | |||
| 1169 | Ga0466965_0162990 | |||
| 1170 | Ga0466965_0746125 | |||
| 1171 | Ga0466966_0008410 | |||
| 1172 | Ga0466966_0125538 | |||
| 1173 | Ga0466966_0199752 | |||
| 1174 | Ga0466961_0019467 | |||
| 1175 | Ga0466961_0026671 | |||
| 1176 | Ga0466961_0080613 | |||
| 1177 | Ga0466963_0003862 | |||
| 1178 | Ga0466963_0004394 | |||
| 1179 | Ga0466963_0011736 | |||
| 1180 | Ga0466963_0022077 | |||
| 1181 | Ga0466963_0034324 | |||
| 1182 | Ga0466963_0489629 | |||
| 1183 | Ga0466963_0751444 | |||
| 1184 | Ga0466963_0935951 | |||
| 1185 | Ga0466964_0002916 | |||
| 1186 | Ga0466964_0002988 | |||
| 1187 | Ga0466964_0009352 | |||
| 1188 | Ga0466964_0017077 | |||
| 1189 | Ga0466964_0649753 | |||
| 1190 | Ga0466971_0000282 | |||
| 1191 | Ga0466971_0151659 | |||
| 1192 | Ga0466971_0539798 | |||
| 1193 | Ga0466968_0421634 | |||
| 1194 | Ga0466970_0633817 | |||
| 1195 | Ga0466957_0002174 | |||
| 1196 | Ga0466957_0047874 | |||
| 1197 | Ga0466957_0119300 | |||
| 1198 | Ga0466957_0321553 | |||
| 1199 | Ga0466957_0914483 | |||
| 1200 | Ga0466957_1117824 | |||
| 1201 | Ga0466960_0192719 | |||
| 1202 | Ga0466959_0007644 | |||
| 1203 | Ga0466959_0033459 | |||
| 1204 | Ga0466959_0034408 | |||
| 1205 | Ga0466959_0113114 | |||
| 1206 | Ga0466959_0651726 | |||
| 1207 | Ga0466958_0004124 | |||
| 1208 | Ga0466958_0012056 | |||
| 1209 | Ga0466958_0288138 | |||
| 1210 | Ga0466958_0323307 | |||
| 1211 | Ga0466967_0010340 | |||
| 1212 | Ga0466967_0015053 | |||
| 1213 | Ga0466967_0022022 | |||
| 1214 | Ga0466967_0026965 | |||
| 1215 | Ga0466967_0047524 | |||
| 1216 | Ga0466967_0051218 | |||
| 1217 | Ga0466967_0114041 | |||
| 1218 | Ga0466967_0120211 | |||
| 1219 | Ga0466967_0125131 | |||
| 1220 | Ga0466967_0201452 | |||
| 1221 | Ga0466967_0374137 | |||
| 1222 | Ga0466967_0449371 | |||
| 1223 | Ga0466967_0473827 | |||
| 1224 | Ga0466967_0542474 | |||
| 1225 | Ga0466967_0701550 | |||
| 1226 | Ga0466967_0793879 | |||
| 1227 | Ga0466967_1331551 | |||
| 1228 | Ga0466967_2366019 | |||
| 1229 | Ga0495592_0352349 | |||
| 1230 | Ga0495629_0159054 | |||
| 1231 | Ga0495629_0359342 | |||
| 1232 | Ga0495641_0000374 | |||
| 1233 | Ga0495641_0028226 | |||
| 1234 | Ga0495641_0092247 | |||
| 1235 | Ga0495641_0191687 | |||
| 1236 | Ga0495641_0236485 | |||
| 1237 | Ga0495641_0250725 | |||
| 1238 | Ga0495651_0018440 | |||
| 1239 | Ga0495651_0028003 | |||
| 1240 | Ga0495651_0071904 | |||
| 1241 | Ga0495651_0860151 | |||
| 1242 | Ga0495653_0015646 | |||
| 1243 | Ga0495653_0123619 | |||
| 1244 | Ga0495653_0213398 | |||
| 1245 | Ga0495653_0308685 | |||
| 1246 | Ga0495653_0392811 | |||
| 1247 | Ga0495582_0000124 | |||
| 1248 | Ga0495582_0058377 | |||
| 1249 | Ga0495582_0314568 | |||
| 1250 | Ga0495582_0403060 | |||
| 1251 | Ga0495582_0873677 | |||
| 1252 | Ga0495605_0054425 | |||
| 1253 | Ga0495639_0000786 | |||
| 1254 | Ga0495639_0322699 | |||
| 1255 | Ga0495662_0000898 | |||
| 1256 | Ga0495664_0018607 | |||
| 1257 | Ga0495664_0035313 | |||
| 1258 | Ga0495664_0097484 | |||
| 1259 | Ga0495664_0655644 | |||
| 1260 | Ga0495594_0085096 | |||
| 1261 | Ga0495608_0010122 | |||
| 1262 | Ga0495608_0029476 | |||
| 1263 | Ga0495608_0127601 | |||
| 1264 | Ga0495608_0283204 | |||
| 1265 | Ga0495618_0218690 | |||
| 1266 | Ga0495618_0579624 | |||
| 1267 | Ga0495628_0026156 | |||
| 1268 | Ga0495628_0079309 | |||
| 1269 | Ga0495628_0105848 | |||
| 1270 | Ga0495628_0291974 | |||
| 1271 | Ga0495630_0029084 | |||
| 1272 | Ga0495630_0110340 | |||
| 1273 | Ga0495666_0166133 | |||
| 1274 | Ga0495652_0311192 | |||
| 1275 | Ga0495652_0314960 | |||
| 1276 | Ga0495665_0086584 | |||
| 1277 | Ga0495665_0086623 | |||
| 1278 | Ga0495665_0631266 | |||
| 1279 | Ga0495640_0019423 | |||
| 1280 | Ga0495640_0090361 | |||
| 1281 | Ga0495586_0369894 | |||
| 1282 | Ga0495586_0902520 | |||
| 1283 | Ga0495587_0098432 | |||
| 1284 | Ga0495587_0113705 | |||
| 1285 | Ga0495587_0347101 | |||
| 1286 | Ga0495645_0178400 | |||
| 1287 | Ga0495645_0221156 | |||
| 1288 | Ga0495622_0219251 | |||
| 1289 | Ga0495667_0002397 | |||
| 1290 | Ga0495667_0020012 | |||
| 1291 | Ga0495667_0032795 | |||
| 1292 | Ga0495667_0045214 | |||
| 1293 | Ga0495634_0075065 | |||
| 1294 | Ga0495634_0457328 | |||
| 1295 | Ga0495635_0030531 | |||
| 1296 | Ga0495635_0036436 | |||
| 1297 | Ga0495635_0118691 | |||
| 1298 | Ga0495588_0734388 | |||
| 1299 | Ga0495657_0027919 | |||
| 1300 | Ga0495657_0028795 | |||
| 1301 | Ga0495657_0199563 | |||
| 1302 | Ga0495657_0340598 | |||
| 1303 | Ga0495657_0370545 | |||
| 1304 | Ga0495599_0092733 | |||
| 1305 | Ga0495599_0194893 | |||
| 1306 | Ga0495599_0373445 | |||
| 1307 | Ga0495623_0040204 | |||
| 1308 | Ga0495646_0035388 | |||
| 1309 | Ga0495646_0078933 | |||
| 1310 | Ga0495646_0082304 | |||
| 1311 | Ga0495647_0004080 | |||
| 1312 | Ga0495647_0601875 | |||
| 1313 | Ga0495647_0616179 | |||
| 1314 | Ga0495658_0000247 | |||
| 1315 | Ga0495658_0032563 | |||
| 1316 | Ga0495658_0070745 | |||
| 1317 | Ga0495613_0013675 | |||
| 1318 | Ga0495613_0032931 | |||
| 1319 | Ga0495613_0693818 | |||
| 1320 | Ga0495624_0010741 | |||
| 1321 | Ga0495624_0109848 | |||
| 1322 | Ga0495624_0498767 | |||
| 1323 | Ga0495624_0551431 | |||
| 1324 | Ga0495624_0680530 | |||
| 1325 | Ga0495600_0017559 | |||
| 1326 | Ga0495600_0059533 | |||
| 1327 | Ga0495600_0504629 | |||
| 1328 | Ga0495581_0003701 | |||
| 1329 | Ga0495581_0116740 | |||
| 1330 | Ga0495581_0402584 | |||
| 1331 | Ga0495604_0016420 | |||
| 1332 | Ga0495604_0033832 | |||
| 1333 | Ga0495604_0083229 | |||
| 1334 | Ga0495604_0259618 | |||
| 1335 | Ga0495674_0003941 | |||
| 1336 | Ga0495674_0019510 | |||
| 1337 | Ga0495674_0129472 | |||
| 1338 | Ga0495674_0257792 | |||
| 1339 | Ga0495676_0001077 | |||
| 1340 | Ga0495680_0006023 | |||
| 1341 | Ga0495680_0011046 | |||
| 1342 | Ga0495680_0036742 | |||
| 1343 | Ga0495680_0555427 | |||
| 1344 | Ga0495675_0290391 | |||
| 1345 | Ga0495675_0357632 | |||
| 1346 | Ga0495675_0628620 | |||
| 1347 | Ga0495684_0001855 | |||
| 1348 | Ga0495684_0018726 | |||
| 1349 | Ga0495684_0283913 | |||
| 1350 | Ga0495593_0012759 | |||
| 1351 | Ga0495593_0129579 | |||
| 1352 | Ga0495602_0122289 | |||
| 1353 | Ga0495602_0150988 | |||
| 1354 | Ga0495602_0193124 | |||
| 1355 | Ga0495602_0577756 | |||
| 1356 | Ga0495614_0013434 | |||
| 1357 | Ga0495614_0074716 | |||
| 1358 | Ga0495614_0331388 | |||
| 1359 | Ga0496100_0001575 | |||
| 1360 | Ga0496100_0010229 | |||
| 1361 | Ga0496100_0071371 | |||
| 1362 | Ga0496100_0402453 | |||
| 1363 | Ga0496101_0012134 | |||
| 1364 | Ga0496101_0012361 | |||
| 1365 | Ga0496101_0045876 | |||
| 1366 | Ga0496101_0058115 | |||
| 1367 | Ga0496101_0193072 | |||
| 1368 | Ga0496102_0062684 | |||
| 1369 | Ga0496102_0219062 | |||
| 1370 | Ga0496102_0340261 | |||
| 1371 | Ga0496102_0633389 | |||
| 1372 | Ga0496103_0071012 | |||
| 1373 | Ga0496103_0095128 | |||
| 1374 | Ga0496103_0232184 | |||
| 1375 | Ga0496103_0745970 | |||
| 1376 | Ga0496103_0787844 | |||
| 1377 | Ga0496103_0924022 | |||
| 1378 | Ga0496103_0959002 | |||
| 1379 | Ga0496104_0089440 | |||
| 1380 | Ga0496104_0136449 | |||
| 1381 | Ga0496104_0860390 | |||
| 1382 | Ga0496105_0028970 | |||
| 1383 | Ga0496105_0034310 | |||
| 1384 | Ga0496105_0460266 | |||
| 1385 | Ga0496105_0463314 | |||
| 1386 | Ga0496106_0017922 | |||
| 1387 | Ga0496106_0060221 | |||
| 1388 | Ga0496106_0176793 | |||
| 1389 | Ga0496107_0045134 | |||
| 1390 | Ga0496107_0063540 | |||
| 1391 | Ga0496107_0207827 | |||
| 1392 | Ga0496107_1065703 | |||
| 1393 | Ga0496108_0028066 | |||
| 1394 | Ga0496108_0181259 | |||
| 1395 | Ga0496108_1619868 | |||
| 1396 | Ga0496109_0017699 | |||
| 1397 | Ga0496109_0409127 | |||
| 1398 | Ga0496109_0410478 | |||
| 1399 | Ga0496110_0119476 | |||
| 1400 | Ga0496110_1067199 | |||
| 1401 | Ga0496110_1160701 | |||
| 1402 | Ga0496111_0028408 | |||
| 1403 | Ga0496111_0400626 | |||
| 1404 | Ga0496111_0800764 | |||
| 1405 | Ga0496111_1301213 | |||
| 1406 | Ga0496112_0021620 | |||
| 1407 | Ga0496112_0069713 | |||
| 1408 | Ga0496112_0081215 | |||
| 1409 | Ga0496112_0098797 | |||
| 1410 | Ga0496112_0102149 | |||
| 1411 | Ga0496112_0163385 | |||
| 1412 | Ga0496112_0442222 | |||
| 1413 | Ga0496112_0469710 | |||
| 1414 | Ga0496112_0760301 | |||
| 1415 | Ga0496112_1172625 | |||
| 1416 | Ga0496113_0452541 | |||
| 1417 | Ga0496113_1518759 | |||
| 1418 | Ga0496114_0001536 | |||
| 1419 | Ga0496114_0012463 | |||
| 1420 | Ga0496114_0044736 | |||
| 1421 | Ga0496114_0165087 | |||
| 1422 | Ga0496114_0301577 | |||
| 1423 | Ga0496114_0468153 | |||
| 1424 | Ga0496115_0006958 | |||
| 1425 | Ga0496115_0007667 | |||
| 1426 | Ga0496115_0016034 | |||
| 1427 | Ga0496115_0079832 | |||
| 1428 | Ga0496115_0092031 | |||
| 1429 | Ga0496115_0489336 | |||
| 1430 | Ga0496115_0848060 | |||
| 1431 | Ga0501038_1035824 | |||
| 1432 | Ga0501047_0036325 | |||
| 1433 | Ga0501067_0000684 | |||
| 1434 | Ga0501067_0040552 | |||
| 1435 | Ga0501067_0404865 | |||
| 1436 | Ga0501067_0480507 | |||
| 1437 | Ga0501069_0085031 | |||
| 1438 | Ga0501069_0116351 | |||
| 1439 | Ga0501069_0546615 | |||
| 1440 | Ga0501070_0059846 | |||
| 1441 | Ga0501070_0535568 | |||
| 1442 | Ga0501070_1470355 | |||
| 1443 | Ga0501073_0262784 | |||
| 1444 | Ga0501074_0060768 | |||
| 1445 | Ga0501074_0809281 | |||
| 1446 | Ga0501079_0304870 | |||
| 1447 | Ga0501080_0596119 | |||
| 1448 | Ga0501044_0377656 | |||
| 1449 | nmdc:mga05p37_1332511_c1 | |||
| 1450 | nmdc:mga0n895_6128_c1 | |||
| 1451 | nmdc:mga0rr50_519562_c1 | |||
| 1452 | nmdc:mga0rr50_65197_c1 | |||
| 1453 | nmdc:mga0a205_113505_c1 | |||
| 1454 | nmdc:mga0a205_13182_c2 | |||
| 1455 | Ga0495601_0140522 | |||
| 1456 | Ga0495601_0349453 | |||
| 1457 | Ga0495601_0591430 | |||
| 1458 | Ga0495612_0059843 | |||
| 1459 | Ga0495612_0115817 | |||
| 1460 | Ga0495612_0119035 | |||
| 1461 | Ga0495655_0012607 | |||
| 1462 | Ga0495595_0018976 | |||
| 1463 | Ga0495595_0039102 | |||
| 1464 | Ga0495595_0095196 | |||
| 1465 | Ga0495595_0153361 | |||
| 1466 | Ga0495619_0025945 | |||
| 1467 | Ga0466962_0006119 | |||
| 1468 | Ga0466962_0017977 | |||
| 1469 | Ga0466962_0165499 | |||
| 1470 | Ga0466962_0541639 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy