F478162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 280 | 1468 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0005981|Ga0495650_0005981_129_953 |
| Length | 274 |
| Sequence | VNASELKSPDVKSHIVIDKVSKVFDSDGRRMVALQDISLQVPRGQFVCLLGPSGCGKSTLLNAVAGFAPPTSGSILADGAPVTGPGPERGMVFQEYALFPWMTVEQNVGFGLEIKGMARAAIGARVAGLLKLLSLEDFAKRYPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDELLRLWAELKKTVIFVTHSIEEAIYLADRIVVMTYRPGTVKRDMLVELPRMRDPASAEFNALKRELGQLVMEEQQRHHEAEMRSAAVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 51 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 92 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 93 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 106 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 107 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 108 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 109 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 110 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 111 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 114 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 208 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 211 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 212 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 213 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 221 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 226 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 227 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 228 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 229 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 230 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 231 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 232 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 233 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 234 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 235 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 236 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 237 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 238 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 239 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 240 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 241 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 242 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 243 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 244 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 245 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 246 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 247 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 248 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 249 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 250 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 251 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 252 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 253 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 254 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 255 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 256 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 257 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 258 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 259 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 260 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 261 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 262 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 263 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 264 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 265 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 266 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 267 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 268 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 269 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 270 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 271 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 272 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 273 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 274 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 275 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 276 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 277 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 278 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 279 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 280 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.1 |
| Metatranscriptomes | 0 |
| Isolates | 7.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.17 |
| Nodule | 0.68 |
| Rhizoplane | 3.41 |
| Rhizosphere | 76.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495650_0005981 | 3300046471 | Bacteria | 7707 |
| 2 | JGI25152J39213_1000031 | 3300002773 | Bacteria | 96812 |
| 3 | JGI25152J39213_1000097 | 3300002773 | Bacteria | 61941 |
| 4 | JGI25152J39213_1012749 | 3300002773 | Bacteria | 1785 |
| 5 | JGI25150J39212_1000687 | 3300002774 | Bacteria | 12280 |
| 6 | JGI25150J39212_1001086 | 3300002774 | Bacteria | 8222 |
| 7 | JGI25150J39212_1001098 | 3300002774 | Bacteria | 8153 |
| 8 | JGI25159J45721_1007192 | 3300002987 | Bacteria | 3221 |
| 9 | JGI25153J46596_10006075 | 3300003215 | Bacteria | 6203 |
| 10 | JGI25160J50197_1000948 | 3300003354 | Bacteria | 15218 |
| 11 | JGI25161J50226_1001292 | 3300003374 | Bacteria | 7955 |
| 12 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 13 | Ga0055526_1000251 | 3300003771 | Bacteria | 45724 |
| 14 | Ga0055526_1001123 | 3300003771 | Bacteria | 19449 |
| 15 | Ga0055526_1006357 | 3300003771 | Bacteria | 6431 |
| 16 | Ga0055526_1006795 | 3300003771 | Bacteria | 6107 |
| 17 | Ga0055537_1000269 | 3300003773 | Bacteria | 37710 |
| 18 | Ga0055524_1000419 | 3300003775 | Bacteria | 35715 |
| 19 | Ga0055524_1002356 | 3300003775 | Bacteria | 9826 |
| 20 | Ga0055524_1003545 | 3300003775 | Bacteria | 7537 |
| 21 | Ga0055524_1004497 | 3300003775 | Bacteria | 6423 |
| 22 | Ga0055534_1001201 | 3300003784 | Bacteria | 10896 |
| 23 | Ga0055534_1001831 | 3300003784 | Bacteria | 7940 |
| 24 | Ga0055534_1008342 | 3300003784 | Bacteria | 2355 |
| 25 | Ga0055528_1000043 | 3300003790 | Bacteria | 103664 |
| 26 | Ga0055530_10015392 | 3300003791 | Bacteria | 2498 |
| 27 | Ga0055530_10043578 | 3300003791 | Bacteria | 1081 |
| 28 | Ga0055530_10046258 | 3300003791 | Bacteria | 1034 |
| 29 | Ga0055543_1002289 | 3300004625 | Bacteria | 6464 |
| 30 | Ga0065165_1002440 | 3300005262 | Bacteria | 15736 |
| 31 | Ga0065165_1004264 | 3300005262 | Bacteria | 9032 |
| 32 | Ga0065165_1020703 | 3300005262 | Bacteria | 2307 |
| 33 | Ga0065165_1036792 | 3300005262 | Bacteria | 1490 |
| 34 | Ga0070658_10137800 | 3300005327 | Bacteria | 2037 |
| 35 | Ga0070658_10429077 | 3300005327 | Bacteria | 1137 |
| 36 | Ga0068869_100119710 | 3300005334 | Bacteria | 2012 |
| 37 | Ga0070666_10027008 | 3300005335 | Bacteria | 3756 |
| 38 | Ga0070682_100034173 | 3300005337 | Bacteria | 3095 |
| 39 | Ga0070660_100001319 | 3300005339 | Bacteria | 16886 |
| 40 | Ga0070660_100025833 | 3300005339 | Bacteria | 4368 |
| 41 | Ga0070660_100045746 | 3300005339 | Bacteria | 3352 |
| 42 | Ga0070661_100002165 | 3300005344 | Bacteria | 13537 |
| 43 | Ga0070661_100096337 | 3300005344 | Bacteria | 2195 |
| 44 | Ga0070659_100080228 | 3300005366 | Bacteria | 2605 |
| 45 | Ga0070659_100270634 | 3300005366 | Bacteria | 1411 |
| 46 | Ga0070662_100188761 | 3300005457 | Bacteria | 1628 |
| 47 | Ga0070681_10090822 | 3300005458 | Bacteria | 3004 |
| 48 | Ga0068855_100035256 | 3300005563 | Bacteria | 5960 |
| 49 | Ga0068855_100714287 | 3300005563 | Bacteria | 1071 |
| 50 | Ga0070664_100149634 | 3300005564 | Bacteria | 2060 |
| 51 | Ga0068854_100012263 | 3300005578 | Bacteria | 5611 |
| 52 | Ga0068854_100015358 | 3300005578 | Bacteria | 5070 |
| 53 | Ga0068854_100374036 | 3300005578 | Bacteria | 1172 |
| 54 | Ga0068856_100708963 | 3300005614 | Bacteria | 1026 |
| 55 | Ga0068858_100469584 | 3300005842 | Bacteria | 1214 |
| 56 | Ga0068860_100045029 | 3300005843 | Bacteria | 4206 |
| 57 | Ga0070712_100022180 | 3300006175 | Bacteria | 4179 |
| 58 | Ga0079104_1024153 | 3300006946 | Bacteria | 1605 |
| 59 | Ga0105244_10000862 | 3300009036 | Bacteria | 25605 |
| 60 | Ga0105244_10001798 | 3300009036 | Bacteria | 16806 |
| 61 | Ga0105244_10098048 | 3300009036 | Bacteria | 1436 |
| 62 | Ga0105240_10026303 | 3300009093 | Bacteria | 7634 |
| 63 | Ga0105240_10057485 | 3300009093 | Bacteria | 4859 |
| 64 | Ga0105240_10067655 | 3300009093 | Bacteria | 4427 |
| 65 | Ga0105245_10024611 | 3300009098 | Bacteria | 5288 |
| 66 | Ga0105245_10109675 | 3300009098 | Bacteria | 2565 |
| 67 | Ga0105241_10004855 | 3300009174 | Bacteria | 9915 |
| 68 | Ga0105241_10083618 | 3300009174 | Bacteria | 2504 |
| 69 | Ga0105237_10005007 | 3300009545 | Bacteria | 15084 |
| 70 | Ga0105238_10000004 | 3300009551 | Bacteria | 390514 |
| 71 | Ga0105238_10000695 | 3300009551 | Bacteria | 35248 |
| 72 | Ga0105238_10128291 | 3300009551 | Bacteria | 2514 |
| 73 | Ga0105239_10003999 | 3300010375 | Bacteria | 17858 |
| 74 | Ga0105239_10007020 | 3300010375 | Bacteria | 12963 |
| 75 | Ga0105239_10074203 | 3300010375 | Bacteria | 3740 |
| 76 | Ga0105246_10043759 | 3300011119 | Bacteria | 3039 |
| 77 | Ga0157369_10000747 | 3300013105 | Bacteria | 41842 |
| 78 | Ga0157374_10249935 | 3300013296 | Bacteria | 1745 |
| 79 | Ga0157372_10000727 | 3300013307 | Bacteria | 35890 |
| 80 | Ga0157372_10595621 | 3300013307 | Bacteria | 1288 |
| 81 | Ga0182008_10002279 | 3300014497 | Bacteria | 12112 |
| 82 | Ga0182006_1000053 | 3300015261 | Bacteria | 180648 |
| 83 | Ga0182007_10000075 | 3300015262 | Bacteria | 77567 |
| 84 | Ga0182005_1000031 | 3300015265 | Bacteria | 202902 |
| 85 | Ga0163161_10094160 | 3300017792 | Bacteria | 2220 |
| 86 | Ga0213872_10003717 | 3300021361 | Bacteria | 8348 |
| 87 | Ga0213872_10008665 | 3300021361 | Bacteria | 4911 |
| 88 | Ga0209436_100187 | 3300025208 | Bacteria | 28922 |
| 89 | Ga0209436_102170 | 3300025208 | Bacteria | 6129 |
| 90 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 91 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 92 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 93 | Ga0207425_1001309 | 3300025245 | Bacteria | 10741 |
| 94 | Ga0207425_1002280 | 3300025245 | Bacteria | 6900 |
| 95 | Ga0209646_1000042 | 3300025246 | Bacteria | 343923 |
| 96 | Ga0209646_1000047 | 3300025246 | Bacteria | 323416 |
| 97 | Ga0209677_103513 | 3300025253 | Bacteria | 5019 |
| 98 | Ga0209148_1000957 | 3300025254 | Bacteria | 18874 |
| 99 | Ga0209129_1000009 | 3300025258 | Bacteria | 633100 |
| 100 | Ga0209129_1000093 | 3300025258 | Bacteria | 173163 |
| 101 | Ga0209129_1006943 | 3300025258 | Bacteria | 3497 |
| 102 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 103 | Ga0209565_1000691 | 3300025263 | Bacteria | 20950 |
| 104 | Ga0209565_1002714 | 3300025263 | Bacteria | 6173 |
| 105 | Ga0209565_1003370 | 3300025263 | Bacteria | 5210 |
| 106 | Ga0209565_1004202 | 3300025263 | Bacteria | 4461 |
| 107 | Ga0209565_1005009 | 3300025263 | Bacteria | 3923 |
| 108 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 109 | Ga0209130_1002319 | 3300025284 | Bacteria | 9728 |
| 110 | Ga0209130_1002511 | 3300025284 | Bacteria | 9046 |
| 111 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 112 | Ga0209675_1000280 | 3300025291 | Bacteria | 48644 |
| 113 | Ga0209675_1002623 | 3300025291 | Bacteria | 9104 |
| 114 | Ga0209675_1003041 | 3300025291 | Bacteria | 8229 |
| 115 | Ga0209025_1006308 | 3300025294 | Bacteria | 9258 |
| 116 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 117 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 118 | Ga0209564_1000085 | 3300025295 | Bacteria | 251509 |
| 119 | Ga0209564_1000146 | 3300025295 | Bacteria | 174811 |
| 120 | Ga0209564_1003249 | 3300025295 | Bacteria | 11358 |
| 121 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 122 | Ga0209758_1000055 | 3300025297 | Bacteria | 336183 |
| 123 | Ga0209050_1000064 | 3300025298 | Bacteria | 314803 |
| 124 | Ga0209050_1004834 | 3300025298 | Bacteria | 8850 |
| 125 | Ga0209050_1006531 | 3300025298 | Bacteria | 6870 |
| 126 | Ga0209256_1000037 | 3300025299 | Bacteria | 377661 |
| 127 | Ga0209256_1000080 | 3300025299 | Bacteria | 224592 |
| 128 | Ga0209256_1000507 | 3300025299 | Bacteria | 57359 |
| 129 | Ga0209256_1003251 | 3300025299 | Bacteria | 11686 |
| 130 | Ga0209256_1003525 | 3300025299 | Bacteria | 10891 |
| 131 | Ga0207426_1001004 | 3300025302 | Bacteria | 27429 |
| 132 | Ga0209051_1017160 | 3300025303 | Bacteria | 3244 |
| 133 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 134 | Ga0209257_1004733 | 3300025304 | Bacteria | 10178 |
| 135 | Ga0209257_1051374 | 3300025304 | Bacteria | 1162 |
| 136 | Ga0207655_1002959 | 3300025728 | Bacteria | 13055 |
| 137 | Ga0207655_1012488 | 3300025728 | Bacteria | 4960 |
| 138 | Ga0207647_10000311 | 3300025904 | Bacteria | 40365 |
| 139 | Ga0207705_10003154 | 3300025909 | Bacteria | 12544 |
| 140 | Ga0207707_10381146 | 3300025912 | Bacteria | 1212 |
| 141 | Ga0207695_10000551 | 3300025913 | Bacteria | 77273 |
| 142 | Ga0207695_10000965 | 3300025913 | Bacteria | 51285 |
| 143 | Ga0207671_10001038 | 3300025914 | Bacteria | 33781 |
| 144 | Ga0207671_10007221 | 3300025914 | Bacteria | 9676 |
| 145 | Ga0207693_10067232 | 3300025915 | Bacteria | 2806 |
| 146 | Ga0207657_10003453 | 3300025919 | Bacteria | 16866 |
| 147 | Ga0207657_10009926 | 3300025919 | Bacteria | 9528 |
| 148 | Ga0207657_10043093 | 3300025919 | Bacteria | 3978 |
| 149 | Ga0207649_10000243 | 3300025920 | Bacteria | 44122 |
| 150 | Ga0207649_10011483 | 3300025920 | Bacteria | 4885 |
| 151 | Ga0207694_10000107 | 3300025924 | Bacteria | 87871 |
| 152 | Ga0207687_10257365 | 3300025927 | Bacteria | 1390 |
| 153 | Ga0207690_10053859 | 3300025932 | Bacteria | 2702 |
| 154 | Ga0207706_10195082 | 3300025933 | Bacteria | 1776 |
| 155 | Ga0207686_10165501 | 3300025934 | Bacteria | 1554 |
| 156 | Ga0207679_10008180 | 3300025945 | Bacteria | 6657 |
| 157 | Ga0207667_10001069 | 3300025949 | Bacteria | 34700 |
| 158 | Ga0207667_10022321 | 3300025949 | Bacteria | 6994 |
| 159 | Ga0207667_10056799 | 3300025949 | Bacteria | 4110 |
| 160 | Ga0207640_10007380 | 3300025981 | Bacteria | 6070 |
| 161 | Ga0207703_10091772 | 3300026035 | Bacteria | 2555 |
| 162 | Ga0207639_10000604 | 3300026041 | Bacteria | 24775 |
| 163 | Ga0207702_10428786 | 3300026078 | Bacteria | 1280 |
| 164 | Ga0207674_10011589 | 3300026116 | Bacteria | 9901 |
| 165 | Ga0316177_1059274 | 3300030731 | Bacteria | 2336 |
| 166 | Ga0316182_1069093 | 3300030745 | Bacteria | 4692 |
| 167 | Ga0265327_10006187 | 3300031251 | Bacteria | 9658 |
| 168 | Ga0265316_10134164 | 3300031344 | Bacteria | 1863 |
| 169 | Ga0265316_10166301 | 3300031344 | Bacteria | 1647 |
| 170 | Ga0307408_100000120 | 3300031548 | Bacteria | 85916 |
| 171 | Ga0307408_100003787 | 3300031548 | Bacteria | 10300 |
| 172 | Ga0307408_100009784 | 3300031548 | Bacteria | 6321 |
| 173 | Ga0307408_100137810 | 3300031548 | Bacteria | 1911 |
| 174 | Ga0307408_100432089 | 3300031548 | Bacteria | 1138 |
| 175 | Ga0265314_10037569 | 3300031711 | Bacteria | 3508 |
| 176 | Ga0307416_100019376 | 3300032002 | Bacteria | 4822 |
| 177 | Ga0307416_100704180 | 3300032002 | Bacteria | 1099 |
| 178 | Ga0307414_10010855 | 3300032004 | Bacteria | 5312 |
| 179 | Ga0395899_0003015 | 3300037312 | Bacteria | 13443 |
| 180 | Ga0395899_0034472 | 3300037312 | Bacteria | 3801 |
| 181 | Ga0395900_0004698 | 3300037418 | Bacteria | 14397 |
| 182 | Ga0395900_0032736 | 3300037418 | Bacteria | 5346 |
| 183 | Ga0395900_0051829 | 3300037418 | Bacteria | 4225 |
| 184 | Ga0395900_0083144 | 3300037418 | Bacteria | 3289 |
| 185 | Ga0395900_0096566 | 3300037418 | Bacteria | 3036 |
| 186 | Ga0395900_0170970 | 3300037418 | Bacteria | 2212 |
| 187 | Ga0395900_0215157 | 3300037418 | Bacteria | 1939 |
| 188 | Ga0395898_0184000 | 3300037466 | Bacteria | 1996 |
| 189 | Ga0395898_0185556 | 3300037466 | Bacteria | 1987 |
| 190 | Ga0395905_0000256 | 3300037471 | Bacteria | 79866 |
| 191 | Ga0395905_0095340 | 3300037471 | Bacteria | 2792 |
| 192 | Ga0395905_0148096 | 3300037471 | Bacteria | 2209 |
| 193 | Ga0395901_0000084 | 3300038443 | Bacteria | 127737 |
| 194 | Ga0395901_0011546 | 3300038443 | Bacteria | 8951 |
| 195 | Ga0395901_0502975 | 3300038443 | Bacteria | 1233 |
| 196 | Ga0395901_0548723 | 3300038443 | Bacteria | 1171 |
| 197 | Ga0395901_0550644 | 3300038443 | Bacteria | 1169 |
| 198 | Ga0436361_0041926 | 3300039447 | Bacteria | 1542 |
| 199 | Ga0436361_0314004 | 3300039447 | Bacteria | 9976 |
| 200 | Ga0436361_0694154 | 3300039447 | Bacteria | 12008 |
| 201 | Ga0439450_005119 | 3300042008 | Bacteria | 2286 |
| 202 | Ga0439458_0009426 | 3300042157 | Bacteria | 2172 |
| 203 | Ga0466969_0033223 | 3300044656 | Bacteria | 2621 |
| 204 | Ga0466969_0149745 | 3300044656 | Bacteria | 1075 |
| 205 | Ga0466972_0000772 | 3300044658 | Bacteria | 15224 |
| 206 | Ga0466972_0019636 | 3300044658 | Bacteria | 3378 |
| 207 | Ga0466982_0126269 | 3300044672 | Bacteria | 1576 |
| 208 | Ga0466965_0006959 | 3300044683 | Bacteria | 5174 |
| 209 | Ga0466965_0018612 | 3300044683 | Bacteria | 3331 |
| 210 | Ga0466965_0036177 | 3300044683 | Bacteria | 2421 |
| 211 | Ga0466965_0089758 | 3300044683 | Bacteria | 1562 |
| 212 | Ga0466965_0132448 | 3300044683 | Bacteria | 1293 |
| 213 | Ga0466966_0011608 | 3300044684 | Bacteria | 5839 |
| 214 | Ga0466966_0102265 | 3300044684 | Bacteria | 1771 |
| 215 | Ga0466964_0005789 | 3300044706 | Bacteria | 4600 |
| 216 | Ga0466964_0010169 | 3300044706 | Bacteria | 3546 |
| 217 | Ga0466971_0175793 | 3300044719 | Bacteria | 1005 |
| 218 | Ga0466968_0084323 | 3300044735 | Bacteria | 1400 |
| 219 | Ga0466957_0007864 | 3300044842 | Bacteria | 6045 |
| 220 | Ga0466957_0273001 | 3300044842 | Bacteria | 1129 |
| 221 | Ga0466959_0017858 | 3300045049 | Bacteria | 5203 |
| 222 | Ga0466959_0069455 | 3300045049 | Bacteria | 2552 |
| 223 | Ga0451576_0035421 | 3300045051 | Bacteria | 5295 |
| 224 | Ga0466958_0013417 | 3300045836 | Bacteria | 4666 |
| 225 | Ga0466967_0023625 | 3300045976 | Bacteria | 5042 |
| 226 | Ga0466967_0494551 | 3300045976 | Bacteria | 1199 |
| 227 | Ga0466967_0807794 | 3300045976 | Bacteria | 931 |
| 228 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 229 | Ga0495617_003454 | 3300046452 | Bacteria | 5946 |
| 230 | Ga0495617_013505 | 3300046452 | Bacteria | 2780 |
| 231 | Ga0495617_046528 | 3300046452 | Bacteria | 1445 |
| 232 | Ga0495627_002339 | 3300046453 | Bacteria | 9290 |
| 233 | Ga0495603_0039895 | 3300046455 | Bacteria | 2811 |
| 234 | Ga0495603_0077384 | 3300046455 | Bacteria | 1951 |
| 235 | Ga0495590_0000014 | 3300046457 | Bacteria | 258314 |
| 236 | Ga0495590_0000044 | 3300046457 | Bacteria | 119833 |
| 237 | Ga0495590_0001237 | 3300046457 | Bacteria | 11138 |
| 238 | Ga0495590_0006392 | 3300046457 | Bacteria | 4598 |
| 239 | Ga0495590_0038967 | 3300046457 | Bacteria | 1657 |
| 240 | Ga0495590_0042877 | 3300046457 | Bacteria | 1578 |
| 241 | Ga0495591_001943 | 3300046458 | Bacteria | 12099 |
| 242 | Ga0495591_008472 | 3300046458 | Bacteria | 4210 |
| 243 | Ga0495629_0050132 | 3300046459 | Bacteria | 2925 |
| 244 | Ga0495638_0000133 | 3300046460 | Bacteria | 119393 |
| 245 | Ga0495638_0004830 | 3300046460 | Bacteria | 10154 |
| 246 | Ga0495638_0006572 | 3300046460 | Bacteria | 8455 |
| 247 | Ga0495638_0022586 | 3300046460 | Bacteria | 4128 |
| 248 | Ga0495638_0127852 | 3300046460 | Bacteria | 1496 |
| 249 | Ga0495638_0276778 | 3300046460 | Bacteria | 913 |
| 250 | Ga0495653_0052622 | 3300046463 | Bacteria | 3119 |
| 251 | Ga0495653_0075009 | 3300046463 | Bacteria | 2518 |
| 252 | Ga0495653_0076622 | 3300046463 | Bacteria | 2485 |
| 253 | Ga0495650_0000056 | 3300046471 | Bacteria | 307565 |
| 254 | Ga0495650_0000105 | 3300046471 | Bacteria | 205855 |
| 255 | Ga0495650_0000136 | 3300046471 | Bacteria | 171758 |
| 256 | Ga0495650_0000798 | 3300046471 | Bacteria | 38487 |
| 257 | Ga0495650_0002861 | 3300046471 | Bacteria | 13182 |
| 258 | Ga0495650_0033759 | 3300046471 | Bacteria | 2273 |
| 259 | Ga0495650_0045513 | 3300046471 | Bacteria | 1847 |
| 260 | Ga0495605_0000087 | 3300046474 | Bacteria | 120256 |
| 261 | Ga0495605_0000939 | 3300046474 | Bacteria | 19945 |
| 262 | Ga0495605_0003264 | 3300046474 | Bacteria | 9738 |
| 263 | Ga0495605_0006046 | 3300046474 | Bacteria | 6992 |
| 264 | Ga0495605_0011308 | 3300046474 | Bacteria | 4985 |
| 265 | Ga0495605_0013050 | 3300046474 | Bacteria | 4592 |
| 266 | Ga0495605_0029847 | 3300046474 | Bacteria | 2800 |
| 267 | Ga0495605_0059887 | 3300046474 | Bacteria | 1827 |
| 268 | Ga0495605_0128796 | 3300046474 | Bacteria | 1142 |
| 269 | Ga0495584_0000813 | 3300046491 | Bacteria | 20549 |
| 270 | Ga0495584_0001311 | 3300046491 | Bacteria | 15104 |
| 271 | Ga0495584_0001593 | 3300046491 | Bacteria | 13401 |
| 272 | Ga0495584_0002555 | 3300046491 | Bacteria | 10273 |
| 273 | Ga0495584_0002606 | 3300046491 | Bacteria | 10158 |
| 274 | Ga0495584_0009176 | 3300046491 | Bacteria | 5100 |
| 275 | Ga0495584_0134791 | 3300046491 | Bacteria | 1253 |
| 276 | Ga0495585_0008589 | 3300046492 | Bacteria | 6185 |
| 277 | Ga0495585_0042873 | 3300046492 | Bacteria | 2532 |
| 278 | Ga0495585_0101449 | 3300046492 | Bacteria | 1538 |
| 279 | Ga0495585_0127222 | 3300046492 | Bacteria | 1343 |
| 280 | Ga0495594_0004727 | 3300046499 | Bacteria | 7017 |
| 281 | Ga0495594_0024006 | 3300046499 | Bacteria | 3271 |
| 282 | Ga0495594_0094180 | 3300046499 | Bacteria | 1680 |
| 283 | Ga0495596_0001098 | 3300046500 | Bacteria | 15991 |
| 284 | Ga0495596_0002385 | 3300046500 | Bacteria | 10157 |
| 285 | Ga0495596_0006980 | 3300046500 | Bacteria | 5134 |
| 286 | Ga0495596_0026450 | 3300046500 | Bacteria | 2338 |
| 287 | Ga0495596_0037710 | 3300046500 | Bacteria | 1911 |
| 288 | Ga0495596_0062408 | 3300046500 | Bacteria | 1450 |
| 289 | Ga0495607_0003730 | 3300046501 | Bacteria | 11529 |
| 290 | Ga0495607_0008732 | 3300046501 | Bacteria | 6904 |
| 291 | Ga0495607_0012320 | 3300046501 | Bacteria | 5652 |
| 292 | Ga0495607_0016543 | 3300046501 | Bacteria | 4758 |
| 293 | Ga0495607_0017927 | 3300046501 | Bacteria | 4528 |
| 294 | Ga0495607_0019742 | 3300046501 | Bacteria | 4275 |
| 295 | Ga0495607_0028725 | 3300046501 | Bacteria | 3427 |
| 296 | Ga0495607_0053147 | 3300046501 | Bacteria | 2342 |
| 297 | Ga0495607_0053176 | 3300046501 | Bacteria | 2341 |
| 298 | Ga0495607_0062620 | 3300046501 | Bacteria | 2107 |
| 299 | Ga0495607_0088547 | 3300046501 | Bacteria | 1682 |
| 300 | Ga0495607_0101974 | 3300046501 | Bacteria | 1536 |
| 301 | Ga0495607_0229499 | 3300046501 | Bacteria | 903 |
| 302 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 303 | Ga0495583_0000044 | 3300046506 | Bacteria | 226264 |
| 304 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 305 | Ga0495583_0004345 | 3300046506 | Bacteria | 10216 |
| 306 | Ga0495583_0004630 | 3300046506 | Bacteria | 9721 |
| 307 | Ga0495583_0004791 | 3300046506 | Bacteria | 9487 |
| 308 | Ga0495583_0008328 | 3300046506 | Bacteria | 6354 |
| 309 | Ga0495583_0011766 | 3300046506 | Bacteria | 5006 |
| 310 | Ga0495583_0012910 | 3300046506 | Bacteria | 4694 |
| 311 | Ga0495583_0014931 | 3300046506 | Bacteria | 4250 |
| 312 | Ga0495583_0035112 | 3300046506 | Bacteria | 2396 |
| 313 | Ga0495583_0159420 | 3300046506 | Bacteria | 931 |
| 314 | Ga0495606_0000007 | 3300046507 | Bacteria | 323713 |
| 315 | Ga0495606_0000319 | 3300046507 | Bacteria | 82626 |
| 316 | Ga0495606_0000476 | 3300046507 | Bacteria | 65896 |
| 317 | Ga0495606_0000986 | 3300046507 | Bacteria | 41479 |
| 318 | Ga0495606_0002587 | 3300046507 | Bacteria | 20703 |
| 319 | Ga0495606_0006334 | 3300046507 | Bacteria | 10953 |
| 320 | Ga0495606_0046519 | 3300046507 | Bacteria | 2867 |
| 321 | Ga0495606_0049845 | 3300046507 | Bacteria | 2743 |
| 322 | Ga0495606_0054230 | 3300046507 | Bacteria | 2596 |
| 323 | Ga0495606_0077523 | 3300046507 | Bacteria | 2075 |
| 324 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 325 | Ga0495610_0000798 | 3300046512 | Bacteria | 29546 |
| 326 | Ga0495610_0003923 | 3300046512 | Bacteria | 11273 |
| 327 | Ga0495610_0006285 | 3300046512 | Bacteria | 8225 |
| 328 | Ga0495610_0072550 | 3300046512 | Bacteria | 1602 |
| 329 | Ga0495616_0001477 | 3300046513 | Bacteria | 16320 |
| 330 | Ga0495616_0002173 | 3300046513 | Bacteria | 13106 |
| 331 | Ga0495616_0004753 | 3300046513 | Bacteria | 8511 |
| 332 | Ga0495616_0009908 | 3300046513 | Bacteria | 5540 |
| 333 | Ga0495616_0021444 | 3300046513 | Bacteria | 3499 |
| 334 | Ga0495616_0027816 | 3300046513 | Bacteria | 2997 |
| 335 | Ga0495616_0036260 | 3300046513 | Bacteria | 2545 |
| 336 | Ga0495616_0057163 | 3300046513 | Bacteria | 1924 |
| 337 | Ga0495616_0066237 | 3300046513 | Bacteria | 1757 |
| 338 | Ga0495630_0009475 | 3300046517 | Bacteria | 7005 |
| 339 | Ga0495631_0006033 | 3300046518 | Bacteria | 6298 |
| 340 | Ga0495631_0006413 | 3300046518 | Bacteria | 6072 |
| 341 | Ga0495631_0009588 | 3300046518 | Bacteria | 4830 |
| 342 | Ga0495631_0015131 | 3300046518 | Bacteria | 3705 |
| 343 | Ga0495631_0040123 | 3300046518 | Bacteria | 2074 |
| 344 | Ga0495631_0132377 | 3300046518 | Bacteria | 1071 |
| 345 | Ga0495632_0000040 | 3300046519 | Bacteria | 149644 |
| 346 | Ga0495632_0001781 | 3300046519 | Bacteria | 17374 |
| 347 | Ga0495632_0006026 | 3300046519 | Bacteria | 7876 |
| 348 | Ga0495632_0006845 | 3300046519 | Bacteria | 7270 |
| 349 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 350 | Ga0495637_0001944 | 3300046520 | Bacteria | 11704 |
| 351 | Ga0495637_0010922 | 3300046520 | Bacteria | 4376 |
| 352 | Ga0495637_0086912 | 3300046520 | Bacteria | 1238 |
| 353 | Ga0495643_0000139 | 3300046522 | Bacteria | 117261 |
| 354 | Ga0495643_0000310 | 3300046522 | Bacteria | 67156 |
| 355 | Ga0495643_0001331 | 3300046522 | Bacteria | 23359 |
| 356 | Ga0495643_0002112 | 3300046522 | Bacteria | 16409 |
| 357 | Ga0495643_0015643 | 3300046522 | Bacteria | 4476 |
| 358 | Ga0495643_0036393 | 3300046522 | Bacteria | 2704 |
| 359 | Ga0495643_0060685 | 3300046522 | Bacteria | 2007 |
| 360 | Ga0495643_0093598 | 3300046522 | Bacteria | 1547 |
| 361 | Ga0495644_0000286 | 3300046523 | Bacteria | 23323 |
| 362 | Ga0495644_0000673 | 3300046523 | Bacteria | 14243 |
| 363 | Ga0495644_0001651 | 3300046523 | Bacteria | 9058 |
| 364 | Ga0495644_0002457 | 3300046523 | Bacteria | 7395 |
| 365 | Ga0495644_0005194 | 3300046523 | Bacteria | 5091 |
| 366 | Ga0495644_0006382 | 3300046523 | Bacteria | 4575 |
| 367 | Ga0495644_0008810 | 3300046523 | Bacteria | 3880 |
| 368 | Ga0495644_0018996 | 3300046523 | Bacteria | 2623 |
| 369 | Ga0495644_0046619 | 3300046523 | Bacteria | 1628 |
| 370 | Ga0495644_0063799 | 3300046523 | Bacteria | 1384 |
| 371 | Ga0495648_0000006 | 3300046524 | Bacteria | 361208 |
| 372 | Ga0495648_0000434 | 3300046524 | Bacteria | 45425 |
| 373 | Ga0495648_0000478 | 3300046524 | Bacteria | 43049 |
| 374 | Ga0495648_0003910 | 3300046524 | Bacteria | 12908 |
| 375 | Ga0495648_0006596 | 3300046524 | Bacteria | 9430 |
| 376 | Ga0495648_0020023 | 3300046524 | Bacteria | 4680 |
| 377 | Ga0495648_0024576 | 3300046524 | Bacteria | 4099 |
| 378 | Ga0495648_0029865 | 3300046524 | Bacteria | 3612 |
| 379 | Ga0495648_0029921 | 3300046524 | Bacteria | 3608 |
| 380 | Ga0495648_0070981 | 3300046524 | Bacteria | 2021 |
| 381 | Ga0495648_0114518 | 3300046524 | Bacteria | 1460 |
| 382 | Ga0495666_0002621 | 3300046526 | Bacteria | 8953 |
| 383 | Ga0495642_0005588 | 3300046528 | Bacteria | 4830 |
| 384 | Ga0495642_0008184 | 3300046528 | Bacteria | 3999 |
| 385 | Ga0495642_0008652 | 3300046528 | Bacteria | 3890 |
| 386 | Ga0495642_0030746 | 3300046528 | Bacteria | 2149 |
| 387 | Ga0495642_0054837 | 3300046528 | Bacteria | 1644 |
| 388 | Ga0495642_0089583 | 3300046528 | Bacteria | 1301 |
| 389 | Ga0495652_0009454 | 3300046529 | Bacteria | 8856 |
| 390 | Ga0495654_0006013 | 3300046530 | Bacteria | 6966 |
| 391 | Ga0495654_0007284 | 3300046530 | Bacteria | 6195 |
| 392 | Ga0495654_0011779 | 3300046530 | Bacteria | 4721 |
| 393 | Ga0495654_0021246 | 3300046530 | Bacteria | 3379 |
| 394 | Ga0495654_0030020 | 3300046530 | Bacteria | 2768 |
| 395 | Ga0495654_0080351 | 3300046530 | Bacteria | 1530 |
| 396 | Ga0495665_0016326 | 3300046531 | Bacteria | 4000 |
| 397 | Ga0495586_0059636 | 3300046535 | Bacteria | 2073 |
| 398 | Ga0495609_0000096 | 3300046538 | Bacteria | 104135 |
| 399 | Ga0495609_0001363 | 3300046538 | Bacteria | 16458 |
| 400 | Ga0495609_0001918 | 3300046538 | Bacteria | 13242 |
| 401 | Ga0495609_0004366 | 3300046538 | Bacteria | 7766 |
| 402 | Ga0495609_0004646 | 3300046538 | Bacteria | 7453 |
| 403 | Ga0495609_0005264 | 3300046538 | Bacteria | 6864 |
| 404 | Ga0495609_0008505 | 3300046538 | Bacteria | 5023 |
| 405 | Ga0495609_0010657 | 3300046538 | Bacteria | 4399 |
| 406 | Ga0495609_0021602 | 3300046538 | Bacteria | 2970 |
| 407 | Ga0495609_0028358 | 3300046538 | Bacteria | 2555 |
| 408 | Ga0495609_0153290 | 3300046538 | Bacteria | 979 |
| 409 | Ga0495597_0003029 | 3300046542 | Bacteria | 10134 |
| 410 | Ga0495597_0003559 | 3300046542 | Bacteria | 8991 |
| 411 | Ga0495597_0016331 | 3300046542 | Bacteria | 3505 |
| 412 | Ga0495597_0029211 | 3300046542 | Bacteria | 2518 |
| 413 | Ga0495597_0044777 | 3300046542 | Bacteria | 1966 |
| 414 | Ga0495645_0282447 | 3300046543 | Bacteria | 1091 |
| 415 | Ga0495622_0000136 | 3300046557 | Bacteria | 62960 |
| 416 | Ga0495622_0140550 | 3300046557 | Bacteria | 1096 |
| 417 | Ga0495622_0166244 | 3300046557 | Bacteria | 993 |
| 418 | Ga0495622_0213099 | 3300046557 | Bacteria | 857 |
| 419 | Ga0495633_0000509 | 3300046558 | Bacteria | 39153 |
| 420 | Ga0495633_0000625 | 3300046558 | Bacteria | 33168 |
| 421 | Ga0495633_0002772 | 3300046558 | Bacteria | 12117 |
| 422 | Ga0495633_0004255 | 3300046558 | Bacteria | 9160 |
| 423 | Ga0495633_0013485 | 3300046558 | Bacteria | 4305 |
| 424 | Ga0495633_0014924 | 3300046558 | Bacteria | 4039 |
| 425 | Ga0495633_0024462 | 3300046558 | Bacteria | 2984 |
| 426 | Ga0495633_0101188 | 3300046558 | Bacteria | 1337 |
| 427 | Ga0495656_0005587 | 3300046615 | Bacteria | 4348 |
| 428 | Ga0495656_0022661 | 3300046615 | Bacteria | 2462 |
| 429 | Ga0495656_0212473 | 3300046615 | Bacteria | 964 |
| 430 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 431 | Ga0495668_0000749 | 3300046616 | Bacteria | 38423 |
| 432 | Ga0495668_0001751 | 3300046616 | Bacteria | 19890 |
| 433 | Ga0495668_0003605 | 3300046616 | Bacteria | 11480 |
| 434 | Ga0495668_0004691 | 3300046616 | Bacteria | 9592 |
| 435 | Ga0495668_0004692 | 3300046616 | Bacteria | 9592 |
| 436 | Ga0495668_0007093 | 3300046616 | Bacteria | 7214 |
| 437 | Ga0495668_0139945 | 3300046616 | Bacteria | 1324 |
| 438 | Ga0495668_0154005 | 3300046616 | Bacteria | 1259 |
| 439 | Ga0495634_0007613 | 3300046642 | Bacteria | 8115 |
| 440 | Ga0495611_0003486 | 3300046648 | Bacteria | 6926 |
| 441 | Ga0495611_0007859 | 3300046648 | Bacteria | 4528 |
| 442 | Ga0495611_0050668 | 3300046648 | Bacteria | 1870 |
| 443 | Ga0495611_0057983 | 3300046648 | Bacteria | 1755 |
| 444 | Ga0495611_0122892 | 3300046648 | Bacteria | 1210 |
| 445 | Ga0495611_0134607 | 3300046648 | Bacteria | 1153 |
| 446 | Ga0495611_0146100 | 3300046648 | Bacteria | 1104 |
| 447 | Ga0495625_0000220 | 3300046660 | Bacteria | 90406 |
| 448 | Ga0495625_0001904 | 3300046660 | Bacteria | 23580 |
| 449 | Ga0495625_0004824 | 3300046660 | Bacteria | 12600 |
| 450 | Ga0495625_0014121 | 3300046660 | Bacteria | 6391 |
| 451 | Ga0495625_0014376 | 3300046660 | Bacteria | 6322 |
| 452 | Ga0495625_0017542 | 3300046660 | Bacteria | 5604 |
| 453 | Ga0495625_0073139 | 3300046660 | Bacteria | 2403 |
| 454 | Ga0495625_0110497 | 3300046660 | Bacteria | 1879 |
| 455 | Ga0495625_0205200 | 3300046660 | Bacteria | 1298 |
| 456 | Ga0495625_0232158 | 3300046660 | Bacteria | 1204 |
| 457 | Ga0495625_0253478 | 3300046660 | Bacteria | 1141 |
| 458 | Ga0495635_0035323 | 3300046663 | Bacteria | 3465 |
| 459 | Ga0495659_0000004 | 3300046664 | Bacteria | 143914 |
| 460 | Ga0495659_0000276 | 3300046664 | Bacteria | 20982 |
| 461 | Ga0495659_0000454 | 3300046664 | Bacteria | 15263 |
| 462 | Ga0495659_0000822 | 3300046664 | Bacteria | 11037 |
| 463 | Ga0495659_0002083 | 3300046664 | Bacteria | 6536 |
| 464 | Ga0495661_0000164 | 3300046665 | Bacteria | 78742 |
| 465 | Ga0495661_0001103 | 3300046665 | Bacteria | 23669 |
| 466 | Ga0495661_0006004 | 3300046665 | Bacteria | 8572 |
| 467 | Ga0495661_0009663 | 3300046665 | Bacteria | 6607 |
| 468 | Ga0495661_0011670 | 3300046665 | Bacteria | 5953 |
| 469 | Ga0495661_0025140 | 3300046665 | Bacteria | 3849 |
| 470 | Ga0495661_0025311 | 3300046665 | Bacteria | 3834 |
| 471 | Ga0495661_0083454 | 3300046665 | Bacteria | 1836 |
| 472 | Ga0495661_0089957 | 3300046665 | Bacteria | 1748 |
| 473 | Ga0495661_0100719 | 3300046665 | Bacteria | 1626 |
| 474 | Ga0495661_0131519 | 3300046665 | Bacteria | 1371 |
| 475 | Ga0495661_0132320 | 3300046665 | Bacteria | 1365 |
| 476 | Ga0495661_0159789 | 3300046665 | Bacteria | 1210 |
| 477 | Ga0495661_0186499 | 3300046665 | Bacteria | 1095 |
| 478 | Ga0495588_0000070 | 3300046674 | Bacteria | 227611 |
| 479 | Ga0495588_0010485 | 3300046674 | Bacteria | 4309 |
| 480 | Ga0495588_0101185 | 3300046674 | Bacteria | 1514 |
| 481 | Ga0495623_0018533 | 3300046679 | Bacteria | 4495 |
| 482 | Ga0495623_0080209 | 3300046679 | Bacteria | 2020 |
| 483 | Ga0495623_0088025 | 3300046679 | Bacteria | 1912 |
| 484 | Ga0495646_0069885 | 3300046680 | Bacteria | 2070 |
| 485 | Ga0495669_0000098 | 3300046684 | Bacteria | 54514 |
| 486 | Ga0495669_0019847 | 3300046684 | Bacteria | 2903 |
| 487 | Ga0495669_0061562 | 3300046684 | Bacteria | 1698 |
| 488 | Ga0495669_0111885 | 3300046684 | Bacteria | 1275 |
| 489 | Ga0495670_0002867 | 3300046691 | Bacteria | 8519 |
| 490 | Ga0495670_0007760 | 3300046691 | Bacteria | 5276 |
| 491 | Ga0495670_0018694 | 3300046691 | Bacteria | 3413 |
| 492 | Ga0495670_0045814 | 3300046691 | Bacteria | 2183 |
| 493 | Ga0495671_0000381 | 3300046692 | Bacteria | 36504 |
| 494 | Ga0495671_0001026 | 3300046692 | Bacteria | 19429 |
| 495 | Ga0495671_0001956 | 3300046692 | Bacteria | 13215 |
| 496 | Ga0495671_0006785 | 3300046692 | Bacteria | 6582 |
| 497 | Ga0495671_0014933 | 3300046692 | Bacteria | 4173 |
| 498 | Ga0495671_0020147 | 3300046692 | Bacteria | 3516 |
| 499 | Ga0495671_0043341 | 3300046692 | Bacteria | 2258 |
| 500 | Ga0495649_0002569 | 3300046694 | Bacteria | 12714 |
| 501 | Ga0495649_0007083 | 3300046694 | Bacteria | 6891 |
| 502 | Ga0495649_0022398 | 3300046694 | Bacteria | 3535 |
| 503 | Ga0495649_0038110 | 3300046694 | Bacteria | 2638 |
| 504 | Ga0495649_0077331 | 3300046694 | Bacteria | 1781 |
| 505 | Ga0495649_0081749 | 3300046694 | Bacteria | 1727 |
| 506 | Ga0495589_0000036 | 3300046794 | Bacteria | 153299 |
| 507 | Ga0495589_0000092 | 3300046794 | Bacteria | 85372 |
| 508 | Ga0495589_0008532 | 3300046794 | Bacteria | 5343 |
| 509 | Ga0495589_0012684 | 3300046794 | Bacteria | 4358 |
| 510 | Ga0495589_0049081 | 3300046794 | Bacteria | 2088 |
| 511 | Ga0495589_0071135 | 3300046794 | Bacteria | 1700 |
| 512 | Ga0495589_0126014 | 3300046794 | Bacteria | 1231 |
| 513 | Ga0495600_0022714 | 3300046809 | Bacteria | 4031 |
| 514 | Ga0495660_0000117 | 3300046810 | Bacteria | 85237 |
| 515 | Ga0495660_0001561 | 3300046810 | Bacteria | 15376 |
| 516 | Ga0495660_0006166 | 3300046810 | Bacteria | 7119 |
| 517 | Ga0495660_0012908 | 3300046810 | Bacteria | 4843 |
| 518 | Ga0495660_0016173 | 3300046810 | Bacteria | 4303 |
| 519 | Ga0495660_0017729 | 3300046810 | Bacteria | 4096 |
| 520 | Ga0495660_0022162 | 3300046810 | Bacteria | 3630 |
| 521 | Ga0495660_0036894 | 3300046810 | Bacteria | 2724 |
| 522 | Ga0495660_0065645 | 3300046810 | Bacteria | 1936 |
| 523 | Ga0495660_0079389 | 3300046810 | Bacteria | 1723 |
| 524 | Ga0495581_0063508 | 3300047315 | Bacteria | 2134 |
| 525 | Ga0495581_0099954 | 3300047315 | Bacteria | 1685 |
| 526 | Ga0495581_0315794 | 3300047315 | Bacteria | 913 |
| 527 | Ga0495604_0015614 | 3300047317 | Bacteria | 6063 |
| 528 | Ga0495604_0016076 | 3300047317 | Bacteria | 5977 |
| 529 | Ga0495604_0049222 | 3300047317 | Bacteria | 3276 |
| 530 | Ga0495636_0000886 | 3300047318 | Bacteria | 11087 |
| 531 | Ga0495636_0011944 | 3300047318 | Bacteria | 3441 |
| 532 | Ga0495636_0016313 | 3300047318 | Bacteria | 2965 |
| 533 | Ga0495672_0000045 | 3300047320 | Bacteria | 255145 |
| 534 | Ga0495672_0000086 | 3300047320 | Bacteria | 155010 |
| 535 | Ga0495672_0000287 | 3300047320 | Bacteria | 69547 |
| 536 | Ga0495672_0000349 | 3300047320 | Bacteria | 59139 |
| 537 | Ga0495672_0000427 | 3300047320 | Bacteria | 50460 |
| 538 | Ga0495672_0002132 | 3300047320 | Bacteria | 18542 |
| 539 | Ga0495672_0003870 | 3300047320 | Bacteria | 12583 |
| 540 | Ga0495672_0008053 | 3300047320 | Bacteria | 7838 |
| 541 | Ga0495672_0023577 | 3300047320 | Bacteria | 3981 |
| 542 | Ga0495672_0112466 | 3300047320 | Bacteria | 1459 |
| 543 | Ga0495672_0155506 | 3300047320 | Bacteria | 1181 |
| 544 | Ga0495676_0000035 | 3300047321 | Bacteria | 120519 |
| 545 | Ga0495680_0008120 | 3300047322 | Bacteria | 9567 |
| 546 | Ga0495680_0153451 | 3300047322 | Bacteria | 1677 |
| 547 | Ga0495683_0000080 | 3300047323 | Bacteria | 95388 |
| 548 | Ga0495683_0000901 | 3300047323 | Bacteria | 20977 |
| 549 | Ga0495683_0002733 | 3300047323 | Bacteria | 10511 |
| 550 | Ga0495683_0002975 | 3300047323 | Bacteria | 10006 |
| 551 | Ga0495683_0028446 | 3300047323 | Bacteria | 2856 |
| 552 | Ga0495683_0029949 | 3300047323 | Bacteria | 2779 |
| 553 | Ga0495683_0045627 | 3300047323 | Bacteria | 2202 |
| 554 | Ga0495683_0049412 | 3300047323 | Bacteria | 2106 |
| 555 | Ga0495683_0087929 | 3300047323 | Bacteria | 1509 |
| 556 | Ga0495687_000074 | 3300047443 | Bacteria | 153464 |
| 557 | Ga0495687_000154 | 3300047443 | Bacteria | 104740 |
| 558 | Ga0495687_000199 | 3300047443 | Bacteria | 86090 |
| 559 | Ga0495687_000643 | 3300047443 | Bacteria | 40048 |
| 560 | Ga0495687_000885 | 3300047443 | Bacteria | 31640 |
| 561 | Ga0495687_000887 | 3300047443 | Bacteria | 31523 |
| 562 | Ga0495687_001753 | 3300047443 | Bacteria | 19181 |
| 563 | Ga0495687_002544 | 3300047443 | Bacteria | 14438 |
| 564 | Ga0495687_002568 | 3300047443 | Bacteria | 14327 |
| 565 | Ga0495687_007461 | 3300047443 | Bacteria | 6435 |
| 566 | Ga0495687_017525 | 3300047443 | Bacteria | 3570 |
| 567 | Ga0495675_0008867 | 3300047444 | Bacteria | 6246 |
| 568 | Ga0495675_0011101 | 3300047444 | Bacteria | 5647 |
| 569 | Ga0495677_0000037 | 3300047445 | Bacteria | 78595 |
| 570 | Ga0495677_0001543 | 3300047445 | Bacteria | 9273 |
| 571 | Ga0495677_0002365 | 3300047445 | Bacteria | 7411 |
| 572 | Ga0495677_0003565 | 3300047445 | Bacteria | 6038 |
| 573 | Ga0495677_0040572 | 3300047445 | Bacteria | 1702 |
| 574 | Ga0495679_009220 | 3300047446 | Bacteria | 3964 |
| 575 | Ga0495679_011167 | 3300047446 | Bacteria | 3482 |
| 576 | Ga0495679_020428 | 3300047446 | Bacteria | 2306 |
| 577 | Ga0495685_000005 | 3300047447 | Bacteria | 112142 |
| 578 | Ga0495685_000013 | 3300047447 | Bacteria | 79924 |
| 579 | Ga0495685_012340 | 3300047447 | Bacteria | 2894 |
| 580 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 581 | Ga0495673_0064572 | 3300047469 | Bacteria | 1556 |
| 582 | Ga0495673_0094825 | 3300047469 | Bacteria | 1214 |
| 583 | Ga0495681_0001860 | 3300047470 | Bacteria | 15489 |
| 584 | Ga0495681_0004155 | 3300047470 | Bacteria | 9945 |
| 585 | Ga0495681_0010505 | 3300047470 | Bacteria | 5601 |
| 586 | Ga0495681_0072558 | 3300047470 | Bacteria | 1556 |
| 587 | Ga0495686_0000809 | 3300047472 | Bacteria | 40533 |
| 588 | Ga0495686_0002297 | 3300047472 | Bacteria | 18290 |
| 589 | Ga0495686_0016679 | 3300047472 | Bacteria | 4972 |
| 590 | Ga0495686_0016920 | 3300047472 | Bacteria | 4927 |
| 591 | Ga0495686_0142061 | 3300047472 | Bacteria | 1416 |
| 592 | Ga0495593_0153294 | 3300047673 | Bacteria | 1165 |
| 593 | Ga0495593_0248083 | 3300047673 | Bacteria | 891 |
| 594 | Ga0495602_0004656 | 3300048088 | Bacteria | 14322 |
| 595 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 596 | Ga0495626_0011330 | 3300048091 | Bacteria | 4721 |
| 597 | Ga0495626_0037492 | 3300048091 | Bacteria | 2303 |
| 598 | Ga0495626_0053240 | 3300048091 | Bacteria | 1863 |
| 599 | Ga0495626_0059775 | 3300048091 | Bacteria | 1738 |
| 600 | Ga0495626_0064703 | 3300048091 | Bacteria | 1656 |
| 601 | Ga0496100_0155716 | 3300048903 | Bacteria | 1634 |
| 602 | Ga0496101_0057107 | 3300048904 | Bacteria | 2822 |
| 603 | Ga0496102_0007696 | 3300048905 | Bacteria | 9203 |
| 604 | Ga0496102_0015860 | 3300048905 | Bacteria | 6570 |
| 605 | Ga0496102_0409753 | 3300048905 | Bacteria | 1273 |
| 606 | Ga0496102_0572401 | 3300048905 | Bacteria | 1052 |
| 607 | Ga0496103_0014532 | 3300048906 | Bacteria | 4674 |
| 608 | Ga0496103_0041340 | 3300048906 | Bacteria | 2834 |
| 609 | Ga0496104_0134766 | 3300048907 | Bacteria | 2373 |
| 610 | Ga0496104_0583676 | 3300048907 | Bacteria | 1028 |
| 611 | Ga0496105_0119299 | 3300048908 | Bacteria | 2176 |
| 612 | Ga0496106_0004396 | 3300048909 | Bacteria | 10460 |
| 613 | Ga0496107_0051556 | 3300048910 | Bacteria | 2968 |
| 614 | Ga0496108_0349515 | 3300048911 | Bacteria | 1290 |
| 615 | Ga0496109_0060519 | 3300048912 | Bacteria | 3460 |
| 616 | Ga0496110_0000799 | 3300048913 | Bacteria | 22012 |
| 617 | Ga0496110_0035645 | 3300048913 | Bacteria | 4317 |
| 618 | Ga0496111_0014912 | 3300048914 | Bacteria | 5320 |
| 619 | Ga0496111_0151362 | 3300048914 | Bacteria | 1721 |
| 620 | Ga0496111_0320672 | 3300048914 | Bacteria | 1148 |
| 621 | Ga0496113_0121610 | 3300048916 | Bacteria | 2041 |
| 622 | Ga0496113_0342250 | 3300048916 | Bacteria | 1199 |
| 623 | Ga0496114_0114485 | 3300048917 | Bacteria | 2313 |
| 624 | Ga0496115_0408335 | 3300048918 | Bacteria | 1101 |
| 625 | Ga0496116_0015835 | 3300048919 | Bacteria | 5936 |
| 626 | Ga0496116_0063938 | 3300048919 | Bacteria | 2367 |
| 627 | Ga0496117_0000032 | 3300048920 | Bacteria | 375533 |
| 628 | Ga0496118_0000027 | 3300048921 | Bacteria | 375533 |
| 629 | Ga0496121_0003068 | 3300048924 | Bacteria | 24191 |
| 630 | Ga0496121_0113551 | 3300048924 | Bacteria | 2061 |
| 631 | Ga0496121_0303516 | 3300048924 | Bacteria | 1082 |
| 632 | Ga0496122_0003391 | 3300048925 | Bacteria | 20976 |
| 633 | Ga0496122_0012642 | 3300048925 | Bacteria | 8371 |
| 634 | Ga0496122_0012962 | 3300048925 | Bacteria | 8227 |
| 635 | Ga0496122_0030147 | 3300048925 | Bacteria | 4554 |
| 636 | Ga0496122_0196718 | 3300048925 | Bacteria | 1183 |
| 637 | Ga0496123_0000851 | 3300048926 | Bacteria | 48703 |
| 638 | Ga0496123_0005384 | 3300048926 | Bacteria | 12900 |
| 639 | Ga0496123_0012698 | 3300048926 | Bacteria | 7147 |
| 640 | Ga0496124_0104928 | 3300048927 | Bacteria | 2284 |
| 641 | Ga0496124_0197063 | 3300048927 | Bacteria | 1535 |
| 642 | Ga0496124_0242653 | 3300048927 | Bacteria | 1339 |
| 643 | Ga0496124_0341354 | 3300048927 | Bacteria | 1063 |
| 644 | Ga0496125_0012670 | 3300048928 | Bacteria | 8346 |
| 645 | Ga0495678_000843 | 3300049459 | Bacteria | 27375 |
| 646 | Ga0495678_001072 | 3300049459 | Bacteria | 23117 |
| 647 | Ga0495678_001392 | 3300049459 | Bacteria | 19229 |
| 648 | Ga0495678_002783 | 3300049459 | Bacteria | 11423 |
| 649 | Ga0495678_003031 | 3300049459 | Bacteria | 10681 |
| 650 | Ga0495678_003341 | 3300049459 | Bacteria | 9994 |
| 651 | Ga0495678_004899 | 3300049459 | Bacteria | 7563 |
| 652 | Ga0495678_014473 | 3300049459 | Bacteria | 3667 |
| 653 | Ga0495678_049124 | 3300049459 | Bacteria | 1641 |
| 654 | Ga0495678_055844 | 3300049459 | Bacteria | 1504 |
| 655 | Ga0495682_0000126 | 3300049460 | Bacteria | 66245 |
| 656 | Ga0495682_0000724 | 3300049460 | Bacteria | 21435 |
| 657 | Ga0495682_0003079 | 3300049460 | Bacteria | 7566 |
| 658 | Ga0495682_0014223 | 3300049460 | Bacteria | 3019 |
| 659 | Ga0495682_0022957 | 3300049460 | Bacteria | 2330 |
| 660 | Ga0495682_0025337 | 3300049460 | Bacteria | 2208 |
| 661 | Ga0495682_0065168 | 3300049460 | Bacteria | 1313 |
| 662 | Ga0495682_0119319 | 3300049460 | Bacteria | 944 |
| 663 | Ga0501034_0122395 | 3300049571 | Bacteria | 2588 |
| 664 | Ga0501227_001355 | 3300049665 | Bacteria | 5500 |
| 665 | Ga0501227_004117 | 3300049665 | Bacteria | 3129 |
| 666 | Ga0501249_011989 | 3300049679 | Bacteria | 1828 |
| 667 | Ga0501263_001301 | 3300049760 | Bacteria | 2310 |
| 668 | Ga0501269_000064 | 3300049766 | Bacteria | 33135 |
| 669 | Ga0501269_000280 | 3300049766 | Bacteria | 14271 |
| 670 | Ga0501279_000841 | 3300049775 | Bacteria | 4045 |
| 671 | Ga0501044_0031544 | 3300049823 | Bacteria | 5577 |
| 672 | Ga0500618_000714 | 3300053125 | Bacteria | 19198 |
| 673 | Ga0500618_002337 | 3300053125 | Bacteria | 7251 |
| 674 | Ga0500586_000015 | 3300053145 | Bacteria | 35201 |
| 675 | Ga0500586_000753 | 3300053145 | Bacteria | 6639 |
| 676 | Ga0466962_0152683 | 3300061719 | Bacteria | 1120 |
| 677 | 2511248853 | 2511231003 | Bacteria | 5606035 |
| 678 | 2511386032 | 2511231026 | Bacteria | 5225445 |
| 679 | 2516206805 | 2516143018 | Bacteria | 6951533 |
| 680 | 2521561105 | 2521172590 | Bacteria | 5047645 |
| 681 | 2550694713 | 2548876994 | Bacteria | 4904866 |
| 682 | 2553006019 | 2551306416 | Bacteria | 6152985 |
| 683 | 2601671784 | 2600255292 | Bacteria | 6300551 |
| 684 | 2643788711 | 2643221554 | Bacteria | 6603920 |
| 685 | 2643797750 | 2643221556 | Bacteria | 7251154 |
| 686 | 2644213264 | 2643221638 | Bacteria | 6579467 |
| 687 | 2644249618 | 2643221645 | Bacteria | 7207331 |
| 688 | 2644356182 | 2643221664 | Bacteria | 7272945 |
| 689 | 2644470468 | 2643221684 | Bacteria | 7145183 |
| 690 | 2738738828 | 2738541280 | Bacteria | 6630198 |
| 691 | 2738739165 | 2738541280 | Bacteria | 6630198 |
| 692 | 2738825557 | 2738541297 | Bacteria | 6549566 |
| 693 | 2738846399 | 2738541300 | Bacteria | 6675882 |
| 694 | 2739149354 | 2738541357 | Bacteria | 6549408 |
| 695 | 2739191273 | 2738543003 | Bacteria | 6549560 |
| 696 | 2739274952 | 2738543018 | Bacteria | 6718814 |
| 697 | 2739317750 | 2738543026 | Bacteria | 6549408 |
| 698 | 2739335991 | 2738543029 | Bacteria | 6549249 |
| 699 | 2739343996 | 2738543030 | Bacteria | 6719714 |
| 700 | 2765567541 | 2765235838 | Bacteria | 5445269 |
| 701 | 2808983019 | 2808606386 | Bacteria | 4471946 |
| 702 | 2809130538 | 2808606415 | Bacteria | 4576710 |
| 703 | 2809144248 | 2808606418 | Bacteria | 6724496 |
| 704 | 2809149985 | 2808606419 | Bacteria | 4576925 |
| 705 | 2819593818 | 2818991445 | Bacteria | 4955017 |
| 706 | 2819617485 | 2818991449 | Bacteria | 5518009 |
| 707 | 2821134158 | 2821131069 | Bacteria | 6108407 |
| 708 | 2839095120 | 2839094727 | Bacteria | 5534556 |
| 709 | 2842711977 | 2842711865 | Bacteria | 7155354 |
| 710 | 2842717113 | 2842711865 | Bacteria | 7155354 |
| 711 | 2852621796 | 2852618963 | Bacteria | 4577824 |
| 712 | 2857552094 | 2857547612 | Bacteria | 6179999 |
| 713 | 2857559066 | 2857558681 | Bacteria | 6617694 |
| 714 | 2857559491 | 2857558681 | Bacteria | 6617694 |
| 715 | 2857565972 | 2857564685 | Bacteria | 6290584 |
| 716 | 2884812155 | 2884811622 | Bacteria | 5552861 |
| 717 | 2884839646 | 2884836552 | Bacteria | 5219991 |
| 718 | 2884856543 | 2884852848 | Bacteria | 5221161 |
| 719 | 2896158909 | 2896154374 | Bacteria | 5221518 |
| 720 | 2904428037 | 2904424332 | Bacteria | 7633521 |
| 721 | 2904429028 | 2904424332 | Bacteria | 7633521 |
| 722 | 2904442263 | 2904439833 | Bacteria | 5931679 |
| 723 | 2904533542 | 2904530477 | Bacteria | 5876334 |
| 724 | 2904586497 | 2904584206 | Bacteria | 6028872 |
| 725 | 2904591690 | 2904589729 | Bacteria | 6113573 |
| 726 | 2904602157 | 2904601388 | Bacteria | 5884906 |
| 727 | 2919051181 | 2919046199 | Bacteria | 5567169 |
| 728 | 2919083504 | 2919079590 | Bacteria | 5946433 |
| 729 | 2919479169 | 2919476304 | Bacteria | 5888696 |
| 730 | 2923514943 | 2923510766 | Bacteria | 5926163 |
| 731 | 2928133569 | 2928130867 | Bacteria | 5467269 |
| 732 | 2932413834 | 2932410948 | Bacteria | 6312192 |
| 733 | 2932417894 | 2932416698 | Bacteria | 6315112 |
| 734 | 8047679055 | 8047673197 | Bacteria | 7395230 |
| 735 | Ga0495650_0005981 | |||
| 736 | JGI25152J39213_1000031 | |||
| 737 | JGI25152J39213_1000097 | |||
| 738 | JGI25152J39213_1012749 | |||
| 739 | JGI25150J39212_1000687 | |||
| 740 | JGI25150J39212_1001086 | |||
| 741 | JGI25150J39212_1001098 | |||
| 742 | JGI25159J45721_1007192 | |||
| 743 | JGI25153J46596_10006075 | |||
| 744 | JGI25160J50197_1000948 | |||
| 745 | JGI25161J50226_1001292 | |||
| 746 | Ga0055525_1000009 | |||
| 747 | Ga0055526_1000251 | |||
| 748 | Ga0055526_1001123 | |||
| 749 | Ga0055526_1006357 | |||
| 750 | Ga0055526_1006795 | |||
| 751 | Ga0055537_1000269 | |||
| 752 | Ga0055524_1000419 | |||
| 753 | Ga0055524_1002356 | |||
| 754 | Ga0055524_1003545 | |||
| 755 | Ga0055524_1004497 | |||
| 756 | Ga0055534_1001201 | |||
| 757 | Ga0055534_1001831 | |||
| 758 | Ga0055534_1008342 | |||
| 759 | Ga0055528_1000043 | |||
| 760 | Ga0055530_10015392 | |||
| 761 | Ga0055530_10043578 | |||
| 762 | Ga0055530_10046258 | |||
| 763 | Ga0055543_1002289 | |||
| 764 | Ga0065165_1002440 | |||
| 765 | Ga0065165_1004264 | |||
| 766 | Ga0065165_1020703 | |||
| 767 | Ga0065165_1036792 | |||
| 768 | Ga0070658_10137800 | |||
| 769 | Ga0070658_10429077 | |||
| 770 | Ga0068869_100119710 | |||
| 771 | Ga0070666_10027008 | |||
| 772 | Ga0070682_100034173 | |||
| 773 | Ga0070660_100001319 | |||
| 774 | Ga0070660_100025833 | |||
| 775 | Ga0070660_100045746 | |||
| 776 | Ga0070661_100002165 | |||
| 777 | Ga0070661_100096337 | |||
| 778 | Ga0070659_100080228 | |||
| 779 | Ga0070659_100270634 | |||
| 780 | Ga0070662_100188761 | |||
| 781 | Ga0070681_10090822 | |||
| 782 | Ga0068855_100035256 | |||
| 783 | Ga0068855_100714287 | |||
| 784 | Ga0070664_100149634 | |||
| 785 | Ga0068854_100012263 | |||
| 786 | Ga0068854_100015358 | |||
| 787 | Ga0068854_100374036 | |||
| 788 | Ga0068856_100708963 | |||
| 789 | Ga0068858_100469584 | |||
| 790 | Ga0068860_100045029 | |||
| 791 | Ga0070712_100022180 | |||
| 792 | Ga0079104_1024153 | |||
| 793 | Ga0105244_10000862 | |||
| 794 | Ga0105244_10001798 | |||
| 795 | Ga0105244_10098048 | |||
| 796 | Ga0105240_10026303 | |||
| 797 | Ga0105240_10057485 | |||
| 798 | Ga0105240_10067655 | |||
| 799 | Ga0105245_10024611 | |||
| 800 | Ga0105245_10109675 | |||
| 801 | Ga0105241_10004855 | |||
| 802 | Ga0105241_10083618 | |||
| 803 | Ga0105237_10005007 | |||
| 804 | Ga0105238_10000004 | |||
| 805 | Ga0105238_10000695 | |||
| 806 | Ga0105238_10128291 | |||
| 807 | Ga0105239_10003999 | |||
| 808 | Ga0105239_10007020 | |||
| 809 | Ga0105239_10074203 | |||
| 810 | Ga0105246_10043759 | |||
| 811 | Ga0157369_10000747 | |||
| 812 | Ga0157374_10249935 | |||
| 813 | Ga0157372_10000727 | |||
| 814 | Ga0157372_10595621 | |||
| 815 | Ga0182008_10002279 | |||
| 816 | Ga0182006_1000053 | |||
| 817 | Ga0182007_10000075 | |||
| 818 | Ga0182005_1000031 | |||
| 819 | Ga0163161_10094160 | |||
| 820 | Ga0213872_10003717 | |||
| 821 | Ga0213872_10008665 | |||
| 822 | Ga0209436_100187 | |||
| 823 | Ga0209436_102170 | |||
| 824 | Ga0209563_100015 | |||
| 825 | Ga0207425_1000001 | |||
| 826 | Ga0207425_1000006 | |||
| 827 | Ga0207425_1001309 | |||
| 828 | Ga0207425_1002280 | |||
| 829 | Ga0209646_1000042 | |||
| 830 | Ga0209646_1000047 | |||
| 831 | Ga0209677_103513 | |||
| 832 | Ga0209148_1000957 | |||
| 833 | Ga0209129_1000009 | |||
| 834 | Ga0209129_1000093 | |||
| 835 | Ga0209129_1006943 | |||
| 836 | Ga0209565_1000006 | |||
| 837 | Ga0209565_1000691 | |||
| 838 | Ga0209565_1002714 | |||
| 839 | Ga0209565_1003370 | |||
| 840 | Ga0209565_1004202 | |||
| 841 | Ga0209565_1005009 | |||
| 842 | Ga0209673_1000004 | |||
| 843 | Ga0209130_1002319 | |||
| 844 | Ga0209130_1002511 | |||
| 845 | Ga0209675_1000006 | |||
| 846 | Ga0209675_1000280 | |||
| 847 | Ga0209675_1002623 | |||
| 848 | Ga0209675_1003041 | |||
| 849 | Ga0209025_1006308 | |||
| 850 | Ga0209564_1000006 | |||
| 851 | Ga0209564_1000010 | |||
| 852 | Ga0209564_1000085 | |||
| 853 | Ga0209564_1000146 | |||
| 854 | Ga0209564_1003249 | |||
| 855 | Ga0209758_1000047 | |||
| 856 | Ga0209758_1000055 | |||
| 857 | Ga0209050_1000064 | |||
| 858 | Ga0209050_1004834 | |||
| 859 | Ga0209050_1006531 | |||
| 860 | Ga0209256_1000037 | |||
| 861 | Ga0209256_1000080 | |||
| 862 | Ga0209256_1000507 | |||
| 863 | Ga0209256_1003251 | |||
| 864 | Ga0209256_1003525 | |||
| 865 | Ga0207426_1001004 | |||
| 866 | Ga0209051_1017160 | |||
| 867 | Ga0209257_1000010 | |||
| 868 | Ga0209257_1004733 | |||
| 869 | Ga0209257_1051374 | |||
| 870 | Ga0207655_1002959 | |||
| 871 | Ga0207655_1012488 | |||
| 872 | Ga0207647_10000311 | |||
| 873 | Ga0207705_10003154 | |||
| 874 | Ga0207707_10381146 | |||
| 875 | Ga0207695_10000551 | |||
| 876 | Ga0207695_10000965 | |||
| 877 | Ga0207671_10001038 | |||
| 878 | Ga0207671_10007221 | |||
| 879 | Ga0207693_10067232 | |||
| 880 | Ga0207657_10003453 | |||
| 881 | Ga0207657_10009926 | |||
| 882 | Ga0207657_10043093 | |||
| 883 | Ga0207649_10000243 | |||
| 884 | Ga0207649_10011483 | |||
| 885 | Ga0207694_10000107 | |||
| 886 | Ga0207687_10257365 | |||
| 887 | Ga0207690_10053859 | |||
| 888 | Ga0207706_10195082 | |||
| 889 | Ga0207686_10165501 | |||
| 890 | Ga0207679_10008180 | |||
| 891 | Ga0207667_10001069 | |||
| 892 | Ga0207667_10022321 | |||
| 893 | Ga0207667_10056799 | |||
| 894 | Ga0207640_10007380 | |||
| 895 | Ga0207703_10091772 | |||
| 896 | Ga0207639_10000604 | |||
| 897 | Ga0207702_10428786 | |||
| 898 | Ga0207674_10011589 | |||
| 899 | Ga0316177_1059274 | |||
| 900 | Ga0316182_1069093 | |||
| 901 | Ga0265327_10006187 | |||
| 902 | Ga0265316_10134164 | |||
| 903 | Ga0265316_10166301 | |||
| 904 | Ga0307408_100000120 | |||
| 905 | Ga0307408_100003787 | |||
| 906 | Ga0307408_100009784 | |||
| 907 | Ga0307408_100137810 | |||
| 908 | Ga0307408_100432089 | |||
| 909 | Ga0265314_10037569 | |||
| 910 | Ga0307416_100019376 | |||
| 911 | Ga0307416_100704180 | |||
| 912 | Ga0307414_10010855 | |||
| 913 | Ga0395899_0003015 | |||
| 914 | Ga0395899_0034472 | |||
| 915 | Ga0395900_0004698 | |||
| 916 | Ga0395900_0032736 | |||
| 917 | Ga0395900_0051829 | |||
| 918 | Ga0395900_0083144 | |||
| 919 | Ga0395900_0096566 | |||
| 920 | Ga0395900_0170970 | |||
| 921 | Ga0395900_0215157 | |||
| 922 | Ga0395898_0184000 | |||
| 923 | Ga0395898_0185556 | |||
| 924 | Ga0395905_0000256 | |||
| 925 | Ga0395905_0095340 | |||
| 926 | Ga0395905_0148096 | |||
| 927 | Ga0395901_0000084 | |||
| 928 | Ga0395901_0011546 | |||
| 929 | Ga0395901_0502975 | |||
| 930 | Ga0395901_0548723 | |||
| 931 | Ga0395901_0550644 | |||
| 932 | Ga0436361_0041926 | |||
| 933 | Ga0436361_0314004 | |||
| 934 | Ga0436361_0694154 | |||
| 935 | Ga0439450_005119 | |||
| 936 | Ga0439458_0009426 | |||
| 937 | Ga0466969_0033223 | |||
| 938 | Ga0466969_0149745 | |||
| 939 | Ga0466972_0000772 | |||
| 940 | Ga0466972_0019636 | |||
| 941 | Ga0466982_0126269 | |||
| 942 | Ga0466965_0006959 | |||
| 943 | Ga0466965_0018612 | |||
| 944 | Ga0466965_0036177 | |||
| 945 | Ga0466965_0089758 | |||
| 946 | Ga0466965_0132448 | |||
| 947 | Ga0466966_0011608 | |||
| 948 | Ga0466966_0102265 | |||
| 949 | Ga0466964_0005789 | |||
| 950 | Ga0466964_0010169 | |||
| 951 | Ga0466971_0175793 | |||
| 952 | Ga0466968_0084323 | |||
| 953 | Ga0466957_0007864 | |||
| 954 | Ga0466957_0273001 | |||
| 955 | Ga0466959_0017858 | |||
| 956 | Ga0466959_0069455 | |||
| 957 | Ga0451576_0035421 | |||
| 958 | Ga0466958_0013417 | |||
| 959 | Ga0466967_0023625 | |||
| 960 | Ga0466967_0494551 | |||
| 961 | Ga0466967_0807794 | |||
| 962 | Ga0495617_000002 | |||
| 963 | Ga0495617_003454 | |||
| 964 | Ga0495617_013505 | |||
| 965 | Ga0495617_046528 | |||
| 966 | Ga0495627_002339 | |||
| 967 | Ga0495603_0039895 | |||
| 968 | Ga0495603_0077384 | |||
| 969 | Ga0495590_0000014 | |||
| 970 | Ga0495590_0000044 | |||
| 971 | Ga0495590_0001237 | |||
| 972 | Ga0495590_0006392 | |||
| 973 | Ga0495590_0038967 | |||
| 974 | Ga0495590_0042877 | |||
| 975 | Ga0495591_001943 | |||
| 976 | Ga0495591_008472 | |||
| 977 | Ga0495629_0050132 | |||
| 978 | Ga0495638_0000133 | |||
| 979 | Ga0495638_0004830 | |||
| 980 | Ga0495638_0006572 | |||
| 981 | Ga0495638_0022586 | |||
| 982 | Ga0495638_0127852 | |||
| 983 | Ga0495638_0276778 | |||
| 984 | Ga0495653_0052622 | |||
| 985 | Ga0495653_0075009 | |||
| 986 | Ga0495653_0076622 | |||
| 987 | Ga0495650_0000056 | |||
| 988 | Ga0495650_0000105 | |||
| 989 | Ga0495650_0000136 | |||
| 990 | Ga0495650_0000798 | |||
| 991 | Ga0495650_0002861 | |||
| 992 | Ga0495650_0033759 | |||
| 993 | Ga0495650_0045513 | |||
| 994 | Ga0495605_0000087 | |||
| 995 | Ga0495605_0000939 | |||
| 996 | Ga0495605_0003264 | |||
| 997 | Ga0495605_0006046 | |||
| 998 | Ga0495605_0011308 | |||
| 999 | Ga0495605_0013050 | |||
| 1000 | Ga0495605_0029847 | |||
| 1001 | Ga0495605_0059887 | |||
| 1002 | Ga0495605_0128796 | |||
| 1003 | Ga0495584_0000813 | |||
| 1004 | Ga0495584_0001311 | |||
| 1005 | Ga0495584_0001593 | |||
| 1006 | Ga0495584_0002555 | |||
| 1007 | Ga0495584_0002606 | |||
| 1008 | Ga0495584_0009176 | |||
| 1009 | Ga0495584_0134791 | |||
| 1010 | Ga0495585_0008589 | |||
| 1011 | Ga0495585_0042873 | |||
| 1012 | Ga0495585_0101449 | |||
| 1013 | Ga0495585_0127222 | |||
| 1014 | Ga0495594_0004727 | |||
| 1015 | Ga0495594_0024006 | |||
| 1016 | Ga0495594_0094180 | |||
| 1017 | Ga0495596_0001098 | |||
| 1018 | Ga0495596_0002385 | |||
| 1019 | Ga0495596_0006980 | |||
| 1020 | Ga0495596_0026450 | |||
| 1021 | Ga0495596_0037710 | |||
| 1022 | Ga0495596_0062408 | |||
| 1023 | Ga0495607_0003730 | |||
| 1024 | Ga0495607_0008732 | |||
| 1025 | Ga0495607_0012320 | |||
| 1026 | Ga0495607_0016543 | |||
| 1027 | Ga0495607_0017927 | |||
| 1028 | Ga0495607_0019742 | |||
| 1029 | Ga0495607_0028725 | |||
| 1030 | Ga0495607_0053147 | |||
| 1031 | Ga0495607_0053176 | |||
| 1032 | Ga0495607_0062620 | |||
| 1033 | Ga0495607_0088547 | |||
| 1034 | Ga0495607_0101974 | |||
| 1035 | Ga0495607_0229499 | |||
| 1036 | Ga0495583_0000004 | |||
| 1037 | Ga0495583_0000044 | |||
| 1038 | Ga0495583_0000056 | |||
| 1039 | Ga0495583_0004345 | |||
| 1040 | Ga0495583_0004630 | |||
| 1041 | Ga0495583_0004791 | |||
| 1042 | Ga0495583_0008328 | |||
| 1043 | Ga0495583_0011766 | |||
| 1044 | Ga0495583_0012910 | |||
| 1045 | Ga0495583_0014931 | |||
| 1046 | Ga0495583_0035112 | |||
| 1047 | Ga0495583_0159420 | |||
| 1048 | Ga0495606_0000007 | |||
| 1049 | Ga0495606_0000319 | |||
| 1050 | Ga0495606_0000476 | |||
| 1051 | Ga0495606_0000986 | |||
| 1052 | Ga0495606_0002587 | |||
| 1053 | Ga0495606_0006334 | |||
| 1054 | Ga0495606_0046519 | |||
| 1055 | Ga0495606_0049845 | |||
| 1056 | Ga0495606_0054230 | |||
| 1057 | Ga0495606_0077523 | |||
| 1058 | Ga0495610_0000004 | |||
| 1059 | Ga0495610_0000798 | |||
| 1060 | Ga0495610_0003923 | |||
| 1061 | Ga0495610_0006285 | |||
| 1062 | Ga0495610_0072550 | |||
| 1063 | Ga0495616_0001477 | |||
| 1064 | Ga0495616_0002173 | |||
| 1065 | Ga0495616_0004753 | |||
| 1066 | Ga0495616_0009908 | |||
| 1067 | Ga0495616_0021444 | |||
| 1068 | Ga0495616_0027816 | |||
| 1069 | Ga0495616_0036260 | |||
| 1070 | Ga0495616_0057163 | |||
| 1071 | Ga0495616_0066237 | |||
| 1072 | Ga0495630_0009475 | |||
| 1073 | Ga0495631_0006033 | |||
| 1074 | Ga0495631_0006413 | |||
| 1075 | Ga0495631_0009588 | |||
| 1076 | Ga0495631_0015131 | |||
| 1077 | Ga0495631_0040123 | |||
| 1078 | Ga0495631_0132377 | |||
| 1079 | Ga0495632_0000040 | |||
| 1080 | Ga0495632_0001781 | |||
| 1081 | Ga0495632_0006026 | |||
| 1082 | Ga0495632_0006845 | |||
| 1083 | Ga0495637_0000006 | |||
| 1084 | Ga0495637_0001944 | |||
| 1085 | Ga0495637_0010922 | |||
| 1086 | Ga0495637_0086912 | |||
| 1087 | Ga0495643_0000139 | |||
| 1088 | Ga0495643_0000310 | |||
| 1089 | Ga0495643_0001331 | |||
| 1090 | Ga0495643_0002112 | |||
| 1091 | Ga0495643_0015643 | |||
| 1092 | Ga0495643_0036393 | |||
| 1093 | Ga0495643_0060685 | |||
| 1094 | Ga0495643_0093598 | |||
| 1095 | Ga0495644_0000286 | |||
| 1096 | Ga0495644_0000673 | |||
| 1097 | Ga0495644_0001651 | |||
| 1098 | Ga0495644_0002457 | |||
| 1099 | Ga0495644_0005194 | |||
| 1100 | Ga0495644_0006382 | |||
| 1101 | Ga0495644_0008810 | |||
| 1102 | Ga0495644_0018996 | |||
| 1103 | Ga0495644_0046619 | |||
| 1104 | Ga0495644_0063799 | |||
| 1105 | Ga0495648_0000006 | |||
| 1106 | Ga0495648_0000434 | |||
| 1107 | Ga0495648_0000478 | |||
| 1108 | Ga0495648_0003910 | |||
| 1109 | Ga0495648_0006596 | |||
| 1110 | Ga0495648_0020023 | |||
| 1111 | Ga0495648_0024576 | |||
| 1112 | Ga0495648_0029865 | |||
| 1113 | Ga0495648_0029921 | |||
| 1114 | Ga0495648_0070981 | |||
| 1115 | Ga0495648_0114518 | |||
| 1116 | Ga0495666_0002621 | |||
| 1117 | Ga0495642_0005588 | |||
| 1118 | Ga0495642_0008184 | |||
| 1119 | Ga0495642_0008652 | |||
| 1120 | Ga0495642_0030746 | |||
| 1121 | Ga0495642_0054837 | |||
| 1122 | Ga0495642_0089583 | |||
| 1123 | Ga0495652_0009454 | |||
| 1124 | Ga0495654_0006013 | |||
| 1125 | Ga0495654_0007284 | |||
| 1126 | Ga0495654_0011779 | |||
| 1127 | Ga0495654_0021246 | |||
| 1128 | Ga0495654_0030020 | |||
| 1129 | Ga0495654_0080351 | |||
| 1130 | Ga0495665_0016326 | |||
| 1131 | Ga0495586_0059636 | |||
| 1132 | Ga0495609_0000096 | |||
| 1133 | Ga0495609_0001363 | |||
| 1134 | Ga0495609_0001918 | |||
| 1135 | Ga0495609_0004366 | |||
| 1136 | Ga0495609_0004646 | |||
| 1137 | Ga0495609_0005264 | |||
| 1138 | Ga0495609_0008505 | |||
| 1139 | Ga0495609_0010657 | |||
| 1140 | Ga0495609_0021602 | |||
| 1141 | Ga0495609_0028358 | |||
| 1142 | Ga0495609_0153290 | |||
| 1143 | Ga0495597_0003029 | |||
| 1144 | Ga0495597_0003559 | |||
| 1145 | Ga0495597_0016331 | |||
| 1146 | Ga0495597_0029211 | |||
| 1147 | Ga0495597_0044777 | |||
| 1148 | Ga0495645_0282447 | |||
| 1149 | Ga0495622_0000136 | |||
| 1150 | Ga0495622_0140550 | |||
| 1151 | Ga0495622_0166244 | |||
| 1152 | Ga0495622_0213099 | |||
| 1153 | Ga0495633_0000509 | |||
| 1154 | Ga0495633_0000625 | |||
| 1155 | Ga0495633_0002772 | |||
| 1156 | Ga0495633_0004255 | |||
| 1157 | Ga0495633_0013485 | |||
| 1158 | Ga0495633_0014924 | |||
| 1159 | Ga0495633_0024462 | |||
| 1160 | Ga0495633_0101188 | |||
| 1161 | Ga0495656_0005587 | |||
| 1162 | Ga0495656_0022661 | |||
| 1163 | Ga0495656_0212473 | |||
| 1164 | Ga0495668_0000025 | |||
| 1165 | Ga0495668_0000749 | |||
| 1166 | Ga0495668_0001751 | |||
| 1167 | Ga0495668_0003605 | |||
| 1168 | Ga0495668_0004691 | |||
| 1169 | Ga0495668_0004692 | |||
| 1170 | Ga0495668_0007093 | |||
| 1171 | Ga0495668_0139945 | |||
| 1172 | Ga0495668_0154005 | |||
| 1173 | Ga0495634_0007613 | |||
| 1174 | Ga0495611_0003486 | |||
| 1175 | Ga0495611_0007859 | |||
| 1176 | Ga0495611_0050668 | |||
| 1177 | Ga0495611_0057983 | |||
| 1178 | Ga0495611_0122892 | |||
| 1179 | Ga0495611_0134607 | |||
| 1180 | Ga0495611_0146100 | |||
| 1181 | Ga0495625_0000220 | |||
| 1182 | Ga0495625_0001904 | |||
| 1183 | Ga0495625_0004824 | |||
| 1184 | Ga0495625_0014121 | |||
| 1185 | Ga0495625_0014376 | |||
| 1186 | Ga0495625_0017542 | |||
| 1187 | Ga0495625_0073139 | |||
| 1188 | Ga0495625_0110497 | |||
| 1189 | Ga0495625_0205200 | |||
| 1190 | Ga0495625_0232158 | |||
| 1191 | Ga0495625_0253478 | |||
| 1192 | Ga0495635_0035323 | |||
| 1193 | Ga0495659_0000004 | |||
| 1194 | Ga0495659_0000276 | |||
| 1195 | Ga0495659_0000454 | |||
| 1196 | Ga0495659_0000822 | |||
| 1197 | Ga0495659_0002083 | |||
| 1198 | Ga0495661_0000164 | |||
| 1199 | Ga0495661_0001103 | |||
| 1200 | Ga0495661_0006004 | |||
| 1201 | Ga0495661_0009663 | |||
| 1202 | Ga0495661_0011670 | |||
| 1203 | Ga0495661_0025140 | |||
| 1204 | Ga0495661_0025311 | |||
| 1205 | Ga0495661_0083454 | |||
| 1206 | Ga0495661_0089957 | |||
| 1207 | Ga0495661_0100719 | |||
| 1208 | Ga0495661_0131519 | |||
| 1209 | Ga0495661_0132320 | |||
| 1210 | Ga0495661_0159789 | |||
| 1211 | Ga0495661_0186499 | |||
| 1212 | Ga0495588_0000070 | |||
| 1213 | Ga0495588_0010485 | |||
| 1214 | Ga0495588_0101185 | |||
| 1215 | Ga0495623_0018533 | |||
| 1216 | Ga0495623_0080209 | |||
| 1217 | Ga0495623_0088025 | |||
| 1218 | Ga0495646_0069885 | |||
| 1219 | Ga0495669_0000098 | |||
| 1220 | Ga0495669_0019847 | |||
| 1221 | Ga0495669_0061562 | |||
| 1222 | Ga0495669_0111885 | |||
| 1223 | Ga0495670_0002867 | |||
| 1224 | Ga0495670_0007760 | |||
| 1225 | Ga0495670_0018694 | |||
| 1226 | Ga0495670_0045814 | |||
| 1227 | Ga0495671_0000381 | |||
| 1228 | Ga0495671_0001026 | |||
| 1229 | Ga0495671_0001956 | |||
| 1230 | Ga0495671_0006785 | |||
| 1231 | Ga0495671_0014933 | |||
| 1232 | Ga0495671_0020147 | |||
| 1233 | Ga0495671_0043341 | |||
| 1234 | Ga0495649_0002569 | |||
| 1235 | Ga0495649_0007083 | |||
| 1236 | Ga0495649_0022398 | |||
| 1237 | Ga0495649_0038110 | |||
| 1238 | Ga0495649_0077331 | |||
| 1239 | Ga0495649_0081749 | |||
| 1240 | Ga0495589_0000036 | |||
| 1241 | Ga0495589_0000092 | |||
| 1242 | Ga0495589_0008532 | |||
| 1243 | Ga0495589_0012684 | |||
| 1244 | Ga0495589_0049081 | |||
| 1245 | Ga0495589_0071135 | |||
| 1246 | Ga0495589_0126014 | |||
| 1247 | Ga0495600_0022714 | |||
| 1248 | Ga0495660_0000117 | |||
| 1249 | Ga0495660_0001561 | |||
| 1250 | Ga0495660_0006166 | |||
| 1251 | Ga0495660_0012908 | |||
| 1252 | Ga0495660_0016173 | |||
| 1253 | Ga0495660_0017729 | |||
| 1254 | Ga0495660_0022162 | |||
| 1255 | Ga0495660_0036894 | |||
| 1256 | Ga0495660_0065645 | |||
| 1257 | Ga0495660_0079389 | |||
| 1258 | Ga0495581_0063508 | |||
| 1259 | Ga0495581_0099954 | |||
| 1260 | Ga0495581_0315794 | |||
| 1261 | Ga0495604_0015614 | |||
| 1262 | Ga0495604_0016076 | |||
| 1263 | Ga0495604_0049222 | |||
| 1264 | Ga0495636_0000886 | |||
| 1265 | Ga0495636_0011944 | |||
| 1266 | Ga0495636_0016313 | |||
| 1267 | Ga0495672_0000045 | |||
| 1268 | Ga0495672_0000086 | |||
| 1269 | Ga0495672_0000287 | |||
| 1270 | Ga0495672_0000349 | |||
| 1271 | Ga0495672_0000427 | |||
| 1272 | Ga0495672_0002132 | |||
| 1273 | Ga0495672_0003870 | |||
| 1274 | Ga0495672_0008053 | |||
| 1275 | Ga0495672_0023577 | |||
| 1276 | Ga0495672_0112466 | |||
| 1277 | Ga0495672_0155506 | |||
| 1278 | Ga0495676_0000035 | |||
| 1279 | Ga0495680_0008120 | |||
| 1280 | Ga0495680_0153451 | |||
| 1281 | Ga0495683_0000080 | |||
| 1282 | Ga0495683_0000901 | |||
| 1283 | Ga0495683_0002733 | |||
| 1284 | Ga0495683_0002975 | |||
| 1285 | Ga0495683_0028446 | |||
| 1286 | Ga0495683_0029949 | |||
| 1287 | Ga0495683_0045627 | |||
| 1288 | Ga0495683_0049412 | |||
| 1289 | Ga0495683_0087929 | |||
| 1290 | Ga0495687_000074 | |||
| 1291 | Ga0495687_000154 | |||
| 1292 | Ga0495687_000199 | |||
| 1293 | Ga0495687_000643 | |||
| 1294 | Ga0495687_000885 | |||
| 1295 | Ga0495687_000887 | |||
| 1296 | Ga0495687_001753 | |||
| 1297 | Ga0495687_002544 | |||
| 1298 | Ga0495687_002568 | |||
| 1299 | Ga0495687_007461 | |||
| 1300 | Ga0495687_017525 | |||
| 1301 | Ga0495675_0008867 | |||
| 1302 | Ga0495675_0011101 | |||
| 1303 | Ga0495677_0000037 | |||
| 1304 | Ga0495677_0001543 | |||
| 1305 | Ga0495677_0002365 | |||
| 1306 | Ga0495677_0003565 | |||
| 1307 | Ga0495677_0040572 | |||
| 1308 | Ga0495679_009220 | |||
| 1309 | Ga0495679_011167 | |||
| 1310 | Ga0495679_020428 | |||
| 1311 | Ga0495685_000005 | |||
| 1312 | Ga0495685_000013 | |||
| 1313 | Ga0495685_012340 | |||
| 1314 | Ga0495673_0000017 | |||
| 1315 | Ga0495673_0064572 | |||
| 1316 | Ga0495673_0094825 | |||
| 1317 | Ga0495681_0001860 | |||
| 1318 | Ga0495681_0004155 | |||
| 1319 | Ga0495681_0010505 | |||
| 1320 | Ga0495681_0072558 | |||
| 1321 | Ga0495686_0000809 | |||
| 1322 | Ga0495686_0002297 | |||
| 1323 | Ga0495686_0016679 | |||
| 1324 | Ga0495686_0016920 | |||
| 1325 | Ga0495686_0142061 | |||
| 1326 | Ga0495593_0153294 | |||
| 1327 | Ga0495593_0248083 | |||
| 1328 | Ga0495602_0004656 | |||
| 1329 | Ga0495626_0000006 | |||
| 1330 | Ga0495626_0011330 | |||
| 1331 | Ga0495626_0037492 | |||
| 1332 | Ga0495626_0053240 | |||
| 1333 | Ga0495626_0059775 | |||
| 1334 | Ga0495626_0064703 | |||
| 1335 | Ga0496100_0155716 | |||
| 1336 | Ga0496101_0057107 | |||
| 1337 | Ga0496102_0007696 | |||
| 1338 | Ga0496102_0015860 | |||
| 1339 | Ga0496102_0409753 | |||
| 1340 | Ga0496102_0572401 | |||
| 1341 | Ga0496103_0014532 | |||
| 1342 | Ga0496103_0041340 | |||
| 1343 | Ga0496104_0134766 | |||
| 1344 | Ga0496104_0583676 | |||
| 1345 | Ga0496105_0119299 | |||
| 1346 | Ga0496106_0004396 | |||
| 1347 | Ga0496107_0051556 | |||
| 1348 | Ga0496108_0349515 | |||
| 1349 | Ga0496109_0060519 | |||
| 1350 | Ga0496110_0000799 | |||
| 1351 | Ga0496110_0035645 | |||
| 1352 | Ga0496111_0014912 | |||
| 1353 | Ga0496111_0151362 | |||
| 1354 | Ga0496111_0320672 | |||
| 1355 | Ga0496113_0121610 | |||
| 1356 | Ga0496113_0342250 | |||
| 1357 | Ga0496114_0114485 | |||
| 1358 | Ga0496115_0408335 | |||
| 1359 | Ga0496116_0015835 | |||
| 1360 | Ga0496116_0063938 | |||
| 1361 | Ga0496117_0000032 | |||
| 1362 | Ga0496118_0000027 | |||
| 1363 | Ga0496121_0003068 | |||
| 1364 | Ga0496121_0113551 | |||
| 1365 | Ga0496121_0303516 | |||
| 1366 | Ga0496122_0003391 | |||
| 1367 | Ga0496122_0012642 | |||
| 1368 | Ga0496122_0012962 | |||
| 1369 | Ga0496122_0030147 | |||
| 1370 | Ga0496122_0196718 | |||
| 1371 | Ga0496123_0000851 | |||
| 1372 | Ga0496123_0005384 | |||
| 1373 | Ga0496123_0012698 | |||
| 1374 | Ga0496124_0104928 | |||
| 1375 | Ga0496124_0197063 | |||
| 1376 | Ga0496124_0242653 | |||
| 1377 | Ga0496124_0341354 | |||
| 1378 | Ga0496125_0012670 | |||
| 1379 | Ga0495678_000843 | |||
| 1380 | Ga0495678_001072 | |||
| 1381 | Ga0495678_001392 | |||
| 1382 | Ga0495678_002783 | |||
| 1383 | Ga0495678_003031 | |||
| 1384 | Ga0495678_003341 | |||
| 1385 | Ga0495678_004899 | |||
| 1386 | Ga0495678_014473 | |||
| 1387 | Ga0495678_049124 | |||
| 1388 | Ga0495678_055844 | |||
| 1389 | Ga0495682_0000126 | |||
| 1390 | Ga0495682_0000724 | |||
| 1391 | Ga0495682_0003079 | |||
| 1392 | Ga0495682_0014223 | |||
| 1393 | Ga0495682_0022957 | |||
| 1394 | Ga0495682_0025337 | |||
| 1395 | Ga0495682_0065168 | |||
| 1396 | Ga0495682_0119319 | |||
| 1397 | Ga0501034_0122395 | |||
| 1398 | Ga0501227_001355 | |||
| 1399 | Ga0501227_004117 | |||
| 1400 | Ga0501249_011989 | |||
| 1401 | Ga0501263_001301 | |||
| 1402 | Ga0501269_000064 | |||
| 1403 | Ga0501269_000280 | |||
| 1404 | Ga0501279_000841 | |||
| 1405 | Ga0501044_0031544 | |||
| 1406 | Ga0500618_000714 | |||
| 1407 | Ga0500618_002337 | |||
| 1408 | Ga0500586_000015 | |||
| 1409 | Ga0500586_000753 | |||
| 1410 | Ga0466962_0152683 | |||
| 1411 | 2511248853 | |||
| 1412 | 2511386032 | |||
| 1413 | 2516206805 | |||
| 1414 | 2521561105 | |||
| 1415 | 2550694713 | |||
| 1416 | 2553006019 | |||
| 1417 | 2601671784 | |||
| 1418 | 2643788711 | |||
| 1419 | 2643797750 | |||
| 1420 | 2644213264 | |||
| 1421 | 2644249618 | |||
| 1422 | 2644356182 | |||
| 1423 | 2644470468 | |||
| 1424 | 2738738828 | |||
| 1425 | 2738739165 | |||
| 1426 | 2738825557 | |||
| 1427 | 2738846399 | |||
| 1428 | 2739149354 | |||
| 1429 | 2739191273 | |||
| 1430 | 2739274952 | |||
| 1431 | 2739317750 | |||
| 1432 | 2739335991 | |||
| 1433 | 2739343996 | |||
| 1434 | 2765567541 | |||
| 1435 | 2808983019 | |||
| 1436 | 2809130538 | |||
| 1437 | 2809144248 | |||
| 1438 | 2809149985 | |||
| 1439 | 2819593818 | |||
| 1440 | 2819617485 | |||
| 1441 | 2821134158 | |||
| 1442 | 2839095120 | |||
| 1443 | 2842711977 | |||
| 1444 | 2842717113 | |||
| 1445 | 2852621796 | |||
| 1446 | 2857552094 | |||
| 1447 | 2857559066 | |||
| 1448 | 2857559491 | |||
| 1449 | 2857565972 | |||
| 1450 | 2884812155 | |||
| 1451 | 2884839646 | |||
| 1452 | 2884856543 | |||
| 1453 | 2896158909 | |||
| 1454 | 2904428037 | |||
| 1455 | 2904429028 | |||
| 1456 | 2904442263 | |||
| 1457 | 2904533542 | |||
| 1458 | 2904586497 | |||
| 1459 | 2904591690 | |||
| 1460 | 2904602157 | |||
| 1461 | 2919051181 | |||
| 1462 | 2919083504 | |||
| 1463 | 2919479169 | |||
| 1464 | 2923514943 | |||
| 1465 | 2928133569 | |||
| 1466 | 2932413834 | |||
| 1467 | 2932417894 | |||
| 1468 | 8047679055 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9426 | 6 | 224 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9419 | 3 | 220 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9376 | 6 | 222 |
| 8ja7-assembly1.cif.gz_D | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.9374 | 6 | 224 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9347 | 6 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9856 | 5 | 243 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9696 | 5 | 243 | 3.40.50.300 |
| af_P77737_9_333_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9368 | 4 | 211 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9364 | 6 | 236 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9344 | 4 | 221 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A8F6D6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9823 | 2 | 254 |
GO:0005524
GO:0016887 |
| AF-A0A1Q6DVK8-F1-model_v4 | ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component | 0.9809 | 6 | 245 |
GO:0005524
GO:0016887 |
| AF-A0A534WP09-F1-model_v4 | ABC transporter ATP-binding protein | 0.9771 | 1 | 256 |
GO:0005524
GO:0016887 |
| AF-A0A1Q6XDC8-F1-model_v4 | Nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein | 0.9755 | 2 | 257 |
GO:0005524
GO:0016887 |
| AF-A0A858WY56-F1-model_v4 | ABC transporter ATP-binding protein | 0.9752 | 2 | 253 |
GO:0005524
GO:0016887 |