F478162

General Info

Members Datasets Scaffolds Average Seq Length
734 280 1468 262

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0005981|Ga0495650_0005981_129_953
Length 274
Sequence VNASELKSPDVKSHIVIDKVSKVFDSDGRRMVALQDISLQVPRGQFVCLLGPSGCGKSTLLNAVAGFAPPTSGSILADGAPVTGPGPERGMVFQEYALFPWMTVEQNVGFGLEIKGMARAAIGARVAGLLKLLSLEDFAKRYPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDELLRLWAELKKTVIFVTHSIEEAIYLADRIVVMTYRPGTVKRDMLVELPRMRDPASAEFNALKRELGQLVMEEQQRHHEAEMRSAAVD

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
92 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
228 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
229 2516143018 Ensifer sp. BR816 Isolate Nodule
230 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
231 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
232 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
233 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
234 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
235 2643221556 Massilia sp. Root1485 Isolate Unclassified
236 2643221638 Duganella sp. Root336D2 Isolate Unclassified
237 2643221645 Massilia sp. Root351 Isolate Unclassified
238 2643221664 Massilia sp. Root418 Isolate Unclassified
239 2643221684 Massilia sp. Root133 Isolate Unclassified
240 2738541280 Massilia sp. GV090 Isolate Unclassified
241 2738541297 Duganella sp. GV083 Isolate Unclassified
242 2738541300 Massilia sp. GV016 Isolate Unclassified
243 2738541357 Duganella sp. GV053 Isolate Unclassified
244 2738543003 Duganella sp. GV066 Isolate Unclassified
245 2738543018 Massilia sp. GV045 Isolate Unclassified
246 2738543026 Duganella sp. GV089 Isolate Unclassified
247 2738543029 Duganella sp. GV039 Isolate Unclassified
248 2738543030 Massilia sp. GV097 Isolate Unclassified
249 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
250 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
251 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
252 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
253 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
254 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
255 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
256 2821131069 Duganella sp. 1224 Isolate Unclassified
257 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
258 2842711865 Duganella sp. R-73148 Isolate Unclassified
259 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
260 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
261 2857558681 Duganella sp. R-74565 Isolate Unclassified
262 2857564685 Duganella sp. R-74599 Isolate Unclassified
263 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
264 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
265 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
266 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
267 2904424332 Duganella sp. 1411 Isolate Rhizosphere
268 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
269 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
270 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
271 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
272 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
273 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
274 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
275 2919476304 Duganella sp. 3397 Isolate Unclassified
276 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
277 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
278 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
279 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
280 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.1
Metatranscriptomes 0
Isolates 7.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0.68
Rhizoplane 3.41
Rhizosphere 76.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0005981 3300046471 Bacteria 7707
2 JGI25152J39213_1000031 3300002773 Bacteria 96812
3 JGI25152J39213_1000097 3300002773 Bacteria 61941
4 JGI25152J39213_1012749 3300002773 Bacteria 1785
5 JGI25150J39212_1000687 3300002774 Bacteria 12280
6 JGI25150J39212_1001086 3300002774 Bacteria 8222
7 JGI25150J39212_1001098 3300002774 Bacteria 8153
8 JGI25159J45721_1007192 3300002987 Bacteria 3221
9 JGI25153J46596_10006075 3300003215 Bacteria 6203
10 JGI25160J50197_1000948 3300003354 Bacteria 15218
11 JGI25161J50226_1001292 3300003374 Bacteria 7955
12 Ga0055525_1000009 3300003759 Bacteria 596899
13 Ga0055526_1000251 3300003771 Bacteria 45724
14 Ga0055526_1001123 3300003771 Bacteria 19449
15 Ga0055526_1006357 3300003771 Bacteria 6431
16 Ga0055526_1006795 3300003771 Bacteria 6107
17 Ga0055537_1000269 3300003773 Bacteria 37710
18 Ga0055524_1000419 3300003775 Bacteria 35715
19 Ga0055524_1002356 3300003775 Bacteria 9826
20 Ga0055524_1003545 3300003775 Bacteria 7537
21 Ga0055524_1004497 3300003775 Bacteria 6423
22 Ga0055534_1001201 3300003784 Bacteria 10896
23 Ga0055534_1001831 3300003784 Bacteria 7940
24 Ga0055534_1008342 3300003784 Bacteria 2355
25 Ga0055528_1000043 3300003790 Bacteria 103664
26 Ga0055530_10015392 3300003791 Bacteria 2498
27 Ga0055530_10043578 3300003791 Bacteria 1081
28 Ga0055530_10046258 3300003791 Bacteria 1034
29 Ga0055543_1002289 3300004625 Bacteria 6464
30 Ga0065165_1002440 3300005262 Bacteria 15736
31 Ga0065165_1004264 3300005262 Bacteria 9032
32 Ga0065165_1020703 3300005262 Bacteria 2307
33 Ga0065165_1036792 3300005262 Bacteria 1490
34 Ga0070658_10137800 3300005327 Bacteria 2037
35 Ga0070658_10429077 3300005327 Bacteria 1137
36 Ga0068869_100119710 3300005334 Bacteria 2012
37 Ga0070666_10027008 3300005335 Bacteria 3756
38 Ga0070682_100034173 3300005337 Bacteria 3095
39 Ga0070660_100001319 3300005339 Bacteria 16886
40 Ga0070660_100025833 3300005339 Bacteria 4368
41 Ga0070660_100045746 3300005339 Bacteria 3352
42 Ga0070661_100002165 3300005344 Bacteria 13537
43 Ga0070661_100096337 3300005344 Bacteria 2195
44 Ga0070659_100080228 3300005366 Bacteria 2605
45 Ga0070659_100270634 3300005366 Bacteria 1411
46 Ga0070662_100188761 3300005457 Bacteria 1628
47 Ga0070681_10090822 3300005458 Bacteria 3004
48 Ga0068855_100035256 3300005563 Bacteria 5960
49 Ga0068855_100714287 3300005563 Bacteria 1071
50 Ga0070664_100149634 3300005564 Bacteria 2060
51 Ga0068854_100012263 3300005578 Bacteria 5611
52 Ga0068854_100015358 3300005578 Bacteria 5070
53 Ga0068854_100374036 3300005578 Bacteria 1172
54 Ga0068856_100708963 3300005614 Bacteria 1026
55 Ga0068858_100469584 3300005842 Bacteria 1214
56 Ga0068860_100045029 3300005843 Bacteria 4206
57 Ga0070712_100022180 3300006175 Bacteria 4179
58 Ga0079104_1024153 3300006946 Bacteria 1605
59 Ga0105244_10000862 3300009036 Bacteria 25605
60 Ga0105244_10001798 3300009036 Bacteria 16806
61 Ga0105244_10098048 3300009036 Bacteria 1436
62 Ga0105240_10026303 3300009093 Bacteria 7634
63 Ga0105240_10057485 3300009093 Bacteria 4859
64 Ga0105240_10067655 3300009093 Bacteria 4427
65 Ga0105245_10024611 3300009098 Bacteria 5288
66 Ga0105245_10109675 3300009098 Bacteria 2565
67 Ga0105241_10004855 3300009174 Bacteria 9915
68 Ga0105241_10083618 3300009174 Bacteria 2504
69 Ga0105237_10005007 3300009545 Bacteria 15084
70 Ga0105238_10000004 3300009551 Bacteria 390514
71 Ga0105238_10000695 3300009551 Bacteria 35248
72 Ga0105238_10128291 3300009551 Bacteria 2514
73 Ga0105239_10003999 3300010375 Bacteria 17858
74 Ga0105239_10007020 3300010375 Bacteria 12963
75 Ga0105239_10074203 3300010375 Bacteria 3740
76 Ga0105246_10043759 3300011119 Bacteria 3039
77 Ga0157369_10000747 3300013105 Bacteria 41842
78 Ga0157374_10249935 3300013296 Bacteria 1745
79 Ga0157372_10000727 3300013307 Bacteria 35890
80 Ga0157372_10595621 3300013307 Bacteria 1288
81 Ga0182008_10002279 3300014497 Bacteria 12112
82 Ga0182006_1000053 3300015261 Bacteria 180648
83 Ga0182007_10000075 3300015262 Bacteria 77567
84 Ga0182005_1000031 3300015265 Bacteria 202902
85 Ga0163161_10094160 3300017792 Bacteria 2220
86 Ga0213872_10003717 3300021361 Bacteria 8348
87 Ga0213872_10008665 3300021361 Bacteria 4911
88 Ga0209436_100187 3300025208 Bacteria 28922
89 Ga0209436_102170 3300025208 Bacteria 6129
90 Ga0209563_100015 3300025230 Bacteria 879901
91 Ga0207425_1000001 3300025245 Bacteria 2525432
92 Ga0207425_1000006 3300025245 Bacteria 808854
93 Ga0207425_1001309 3300025245 Bacteria 10741
94 Ga0207425_1002280 3300025245 Bacteria 6900
95 Ga0209646_1000042 3300025246 Bacteria 343923
96 Ga0209646_1000047 3300025246 Bacteria 323416
97 Ga0209677_103513 3300025253 Bacteria 5019
98 Ga0209148_1000957 3300025254 Bacteria 18874
99 Ga0209129_1000009 3300025258 Bacteria 633100
100 Ga0209129_1000093 3300025258 Bacteria 173163
101 Ga0209129_1006943 3300025258 Bacteria 3497
102 Ga0209565_1000006 3300025263 Bacteria 897294
103 Ga0209565_1000691 3300025263 Bacteria 20950
104 Ga0209565_1002714 3300025263 Bacteria 6173
105 Ga0209565_1003370 3300025263 Bacteria 5210
106 Ga0209565_1004202 3300025263 Bacteria 4461
107 Ga0209565_1005009 3300025263 Bacteria 3923
108 Ga0209673_1000004 3300025273 Bacteria 896155
109 Ga0209130_1002319 3300025284 Bacteria 9728
110 Ga0209130_1002511 3300025284 Bacteria 9046
111 Ga0209675_1000006 3300025291 Bacteria 732267
112 Ga0209675_1000280 3300025291 Bacteria 48644
113 Ga0209675_1002623 3300025291 Bacteria 9104
114 Ga0209675_1003041 3300025291 Bacteria 8229
115 Ga0209025_1006308 3300025294 Bacteria 9258
116 Ga0209564_1000006 3300025295 Bacteria 1100927
117 Ga0209564_1000010 3300025295 Bacteria 885399
118 Ga0209564_1000085 3300025295 Bacteria 251509
119 Ga0209564_1000146 3300025295 Bacteria 174811
120 Ga0209564_1003249 3300025295 Bacteria 11358
121 Ga0209758_1000047 3300025297 Bacteria 360971
122 Ga0209758_1000055 3300025297 Bacteria 336183
123 Ga0209050_1000064 3300025298 Bacteria 314803
124 Ga0209050_1004834 3300025298 Bacteria 8850
125 Ga0209050_1006531 3300025298 Bacteria 6870
126 Ga0209256_1000037 3300025299 Bacteria 377661
127 Ga0209256_1000080 3300025299 Bacteria 224592
128 Ga0209256_1000507 3300025299 Bacteria 57359
129 Ga0209256_1003251 3300025299 Bacteria 11686
130 Ga0209256_1003525 3300025299 Bacteria 10891
131 Ga0207426_1001004 3300025302 Bacteria 27429
132 Ga0209051_1017160 3300025303 Bacteria 3244
133 Ga0209257_1000010 3300025304 Bacteria 1158682
134 Ga0209257_1004733 3300025304 Bacteria 10178
135 Ga0209257_1051374 3300025304 Bacteria 1162
136 Ga0207655_1002959 3300025728 Bacteria 13055
137 Ga0207655_1012488 3300025728 Bacteria 4960
138 Ga0207647_10000311 3300025904 Bacteria 40365
139 Ga0207705_10003154 3300025909 Bacteria 12544
140 Ga0207707_10381146 3300025912 Bacteria 1212
141 Ga0207695_10000551 3300025913 Bacteria 77273
142 Ga0207695_10000965 3300025913 Bacteria 51285
143 Ga0207671_10001038 3300025914 Bacteria 33781
144 Ga0207671_10007221 3300025914 Bacteria 9676
145 Ga0207693_10067232 3300025915 Bacteria 2806
146 Ga0207657_10003453 3300025919 Bacteria 16866
147 Ga0207657_10009926 3300025919 Bacteria 9528
148 Ga0207657_10043093 3300025919 Bacteria 3978
149 Ga0207649_10000243 3300025920 Bacteria 44122
150 Ga0207649_10011483 3300025920 Bacteria 4885
151 Ga0207694_10000107 3300025924 Bacteria 87871
152 Ga0207687_10257365 3300025927 Bacteria 1390
153 Ga0207690_10053859 3300025932 Bacteria 2702
154 Ga0207706_10195082 3300025933 Bacteria 1776
155 Ga0207686_10165501 3300025934 Bacteria 1554
156 Ga0207679_10008180 3300025945 Bacteria 6657
157 Ga0207667_10001069 3300025949 Bacteria 34700
158 Ga0207667_10022321 3300025949 Bacteria 6994
159 Ga0207667_10056799 3300025949 Bacteria 4110
160 Ga0207640_10007380 3300025981 Bacteria 6070
161 Ga0207703_10091772 3300026035 Bacteria 2555
162 Ga0207639_10000604 3300026041 Bacteria 24775
163 Ga0207702_10428786 3300026078 Bacteria 1280
164 Ga0207674_10011589 3300026116 Bacteria 9901
165 Ga0316177_1059274 3300030731 Bacteria 2336
166 Ga0316182_1069093 3300030745 Bacteria 4692
167 Ga0265327_10006187 3300031251 Bacteria 9658
168 Ga0265316_10134164 3300031344 Bacteria 1863
169 Ga0265316_10166301 3300031344 Bacteria 1647
170 Ga0307408_100000120 3300031548 Bacteria 85916
171 Ga0307408_100003787 3300031548 Bacteria 10300
172 Ga0307408_100009784 3300031548 Bacteria 6321
173 Ga0307408_100137810 3300031548 Bacteria 1911
174 Ga0307408_100432089 3300031548 Bacteria 1138
175 Ga0265314_10037569 3300031711 Bacteria 3508
176 Ga0307416_100019376 3300032002 Bacteria 4822
177 Ga0307416_100704180 3300032002 Bacteria 1099
178 Ga0307414_10010855 3300032004 Bacteria 5312
179 Ga0395899_0003015 3300037312 Bacteria 13443
180 Ga0395899_0034472 3300037312 Bacteria 3801
181 Ga0395900_0004698 3300037418 Bacteria 14397
182 Ga0395900_0032736 3300037418 Bacteria 5346
183 Ga0395900_0051829 3300037418 Bacteria 4225
184 Ga0395900_0083144 3300037418 Bacteria 3289
185 Ga0395900_0096566 3300037418 Bacteria 3036
186 Ga0395900_0170970 3300037418 Bacteria 2212
187 Ga0395900_0215157 3300037418 Bacteria 1939
188 Ga0395898_0184000 3300037466 Bacteria 1996
189 Ga0395898_0185556 3300037466 Bacteria 1987
190 Ga0395905_0000256 3300037471 Bacteria 79866
191 Ga0395905_0095340 3300037471 Bacteria 2792
192 Ga0395905_0148096 3300037471 Bacteria 2209
193 Ga0395901_0000084 3300038443 Bacteria 127737
194 Ga0395901_0011546 3300038443 Bacteria 8951
195 Ga0395901_0502975 3300038443 Bacteria 1233
196 Ga0395901_0548723 3300038443 Bacteria 1171
197 Ga0395901_0550644 3300038443 Bacteria 1169
198 Ga0436361_0041926 3300039447 Bacteria 1542
199 Ga0436361_0314004 3300039447 Bacteria 9976
200 Ga0436361_0694154 3300039447 Bacteria 12008
201 Ga0439450_005119 3300042008 Bacteria 2286
202 Ga0439458_0009426 3300042157 Bacteria 2172
203 Ga0466969_0033223 3300044656 Bacteria 2621
204 Ga0466969_0149745 3300044656 Bacteria 1075
205 Ga0466972_0000772 3300044658 Bacteria 15224
206 Ga0466972_0019636 3300044658 Bacteria 3378
207 Ga0466982_0126269 3300044672 Bacteria 1576
208 Ga0466965_0006959 3300044683 Bacteria 5174
209 Ga0466965_0018612 3300044683 Bacteria 3331
210 Ga0466965_0036177 3300044683 Bacteria 2421
211 Ga0466965_0089758 3300044683 Bacteria 1562
212 Ga0466965_0132448 3300044683 Bacteria 1293
213 Ga0466966_0011608 3300044684 Bacteria 5839
214 Ga0466966_0102265 3300044684 Bacteria 1771
215 Ga0466964_0005789 3300044706 Bacteria 4600
216 Ga0466964_0010169 3300044706 Bacteria 3546
217 Ga0466971_0175793 3300044719 Bacteria 1005
218 Ga0466968_0084323 3300044735 Bacteria 1400
219 Ga0466957_0007864 3300044842 Bacteria 6045
220 Ga0466957_0273001 3300044842 Bacteria 1129
221 Ga0466959_0017858 3300045049 Bacteria 5203
222 Ga0466959_0069455 3300045049 Bacteria 2552
223 Ga0451576_0035421 3300045051 Bacteria 5295
224 Ga0466958_0013417 3300045836 Bacteria 4666
225 Ga0466967_0023625 3300045976 Bacteria 5042
226 Ga0466967_0494551 3300045976 Bacteria 1199
227 Ga0466967_0807794 3300045976 Bacteria 931
228 Ga0495617_000002 3300046452 Bacteria 710121
229 Ga0495617_003454 3300046452 Bacteria 5946
230 Ga0495617_013505 3300046452 Bacteria 2780
231 Ga0495617_046528 3300046452 Bacteria 1445
232 Ga0495627_002339 3300046453 Bacteria 9290
233 Ga0495603_0039895 3300046455 Bacteria 2811
234 Ga0495603_0077384 3300046455 Bacteria 1951
235 Ga0495590_0000014 3300046457 Bacteria 258314
236 Ga0495590_0000044 3300046457 Bacteria 119833
237 Ga0495590_0001237 3300046457 Bacteria 11138
238 Ga0495590_0006392 3300046457 Bacteria 4598
239 Ga0495590_0038967 3300046457 Bacteria 1657
240 Ga0495590_0042877 3300046457 Bacteria 1578
241 Ga0495591_001943 3300046458 Bacteria 12099
242 Ga0495591_008472 3300046458 Bacteria 4210
243 Ga0495629_0050132 3300046459 Bacteria 2925
244 Ga0495638_0000133 3300046460 Bacteria 119393
245 Ga0495638_0004830 3300046460 Bacteria 10154
246 Ga0495638_0006572 3300046460 Bacteria 8455
247 Ga0495638_0022586 3300046460 Bacteria 4128
248 Ga0495638_0127852 3300046460 Bacteria 1496
249 Ga0495638_0276778 3300046460 Bacteria 913
250 Ga0495653_0052622 3300046463 Bacteria 3119
251 Ga0495653_0075009 3300046463 Bacteria 2518
252 Ga0495653_0076622 3300046463 Bacteria 2485
253 Ga0495650_0000056 3300046471 Bacteria 307565
254 Ga0495650_0000105 3300046471 Bacteria 205855
255 Ga0495650_0000136 3300046471 Bacteria 171758
256 Ga0495650_0000798 3300046471 Bacteria 38487
257 Ga0495650_0002861 3300046471 Bacteria 13182
258 Ga0495650_0033759 3300046471 Bacteria 2273
259 Ga0495650_0045513 3300046471 Bacteria 1847
260 Ga0495605_0000087 3300046474 Bacteria 120256
261 Ga0495605_0000939 3300046474 Bacteria 19945
262 Ga0495605_0003264 3300046474 Bacteria 9738
263 Ga0495605_0006046 3300046474 Bacteria 6992
264 Ga0495605_0011308 3300046474 Bacteria 4985
265 Ga0495605_0013050 3300046474 Bacteria 4592
266 Ga0495605_0029847 3300046474 Bacteria 2800
267 Ga0495605_0059887 3300046474 Bacteria 1827
268 Ga0495605_0128796 3300046474 Bacteria 1142
269 Ga0495584_0000813 3300046491 Bacteria 20549
270 Ga0495584_0001311 3300046491 Bacteria 15104
271 Ga0495584_0001593 3300046491 Bacteria 13401
272 Ga0495584_0002555 3300046491 Bacteria 10273
273 Ga0495584_0002606 3300046491 Bacteria 10158
274 Ga0495584_0009176 3300046491 Bacteria 5100
275 Ga0495584_0134791 3300046491 Bacteria 1253
276 Ga0495585_0008589 3300046492 Bacteria 6185
277 Ga0495585_0042873 3300046492 Bacteria 2532
278 Ga0495585_0101449 3300046492 Bacteria 1538
279 Ga0495585_0127222 3300046492 Bacteria 1343
280 Ga0495594_0004727 3300046499 Bacteria 7017
281 Ga0495594_0024006 3300046499 Bacteria 3271
282 Ga0495594_0094180 3300046499 Bacteria 1680
283 Ga0495596_0001098 3300046500 Bacteria 15991
284 Ga0495596_0002385 3300046500 Bacteria 10157
285 Ga0495596_0006980 3300046500 Bacteria 5134
286 Ga0495596_0026450 3300046500 Bacteria 2338
287 Ga0495596_0037710 3300046500 Bacteria 1911
288 Ga0495596_0062408 3300046500 Bacteria 1450
289 Ga0495607_0003730 3300046501 Bacteria 11529
290 Ga0495607_0008732 3300046501 Bacteria 6904
291 Ga0495607_0012320 3300046501 Bacteria 5652
292 Ga0495607_0016543 3300046501 Bacteria 4758
293 Ga0495607_0017927 3300046501 Bacteria 4528
294 Ga0495607_0019742 3300046501 Bacteria 4275
295 Ga0495607_0028725 3300046501 Bacteria 3427
296 Ga0495607_0053147 3300046501 Bacteria 2342
297 Ga0495607_0053176 3300046501 Bacteria 2341
298 Ga0495607_0062620 3300046501 Bacteria 2107
299 Ga0495607_0088547 3300046501 Bacteria 1682
300 Ga0495607_0101974 3300046501 Bacteria 1536
301 Ga0495607_0229499 3300046501 Bacteria 903
302 Ga0495583_0000004 3300046506 Bacteria 655287
303 Ga0495583_0000044 3300046506 Bacteria 226264
304 Ga0495583_0000056 3300046506 Bacteria 200858
305 Ga0495583_0004345 3300046506 Bacteria 10216
306 Ga0495583_0004630 3300046506 Bacteria 9721
307 Ga0495583_0004791 3300046506 Bacteria 9487
308 Ga0495583_0008328 3300046506 Bacteria 6354
309 Ga0495583_0011766 3300046506 Bacteria 5006
310 Ga0495583_0012910 3300046506 Bacteria 4694
311 Ga0495583_0014931 3300046506 Bacteria 4250
312 Ga0495583_0035112 3300046506 Bacteria 2396
313 Ga0495583_0159420 3300046506 Bacteria 931
314 Ga0495606_0000007 3300046507 Bacteria 323713
315 Ga0495606_0000319 3300046507 Bacteria 82626
316 Ga0495606_0000476 3300046507 Bacteria 65896
317 Ga0495606_0000986 3300046507 Bacteria 41479
318 Ga0495606_0002587 3300046507 Bacteria 20703
319 Ga0495606_0006334 3300046507 Bacteria 10953
320 Ga0495606_0046519 3300046507 Bacteria 2867
321 Ga0495606_0049845 3300046507 Bacteria 2743
322 Ga0495606_0054230 3300046507 Bacteria 2596
323 Ga0495606_0077523 3300046507 Bacteria 2075
324 Ga0495610_0000004 3300046512 Bacteria 1006135
325 Ga0495610_0000798 3300046512 Bacteria 29546
326 Ga0495610_0003923 3300046512 Bacteria 11273
327 Ga0495610_0006285 3300046512 Bacteria 8225
328 Ga0495610_0072550 3300046512 Bacteria 1602
329 Ga0495616_0001477 3300046513 Bacteria 16320
330 Ga0495616_0002173 3300046513 Bacteria 13106
331 Ga0495616_0004753 3300046513 Bacteria 8511
332 Ga0495616_0009908 3300046513 Bacteria 5540
333 Ga0495616_0021444 3300046513 Bacteria 3499
334 Ga0495616_0027816 3300046513 Bacteria 2997
335 Ga0495616_0036260 3300046513 Bacteria 2545
336 Ga0495616_0057163 3300046513 Bacteria 1924
337 Ga0495616_0066237 3300046513 Bacteria 1757
338 Ga0495630_0009475 3300046517 Bacteria 7005
339 Ga0495631_0006033 3300046518 Bacteria 6298
340 Ga0495631_0006413 3300046518 Bacteria 6072
341 Ga0495631_0009588 3300046518 Bacteria 4830
342 Ga0495631_0015131 3300046518 Bacteria 3705
343 Ga0495631_0040123 3300046518 Bacteria 2074
344 Ga0495631_0132377 3300046518 Bacteria 1071
345 Ga0495632_0000040 3300046519 Bacteria 149644
346 Ga0495632_0001781 3300046519 Bacteria 17374
347 Ga0495632_0006026 3300046519 Bacteria 7876
348 Ga0495632_0006845 3300046519 Bacteria 7270
349 Ga0495637_0000006 3300046520 Bacteria 435763
350 Ga0495637_0001944 3300046520 Bacteria 11704
351 Ga0495637_0010922 3300046520 Bacteria 4376
352 Ga0495637_0086912 3300046520 Bacteria 1238
353 Ga0495643_0000139 3300046522 Bacteria 117261
354 Ga0495643_0000310 3300046522 Bacteria 67156
355 Ga0495643_0001331 3300046522 Bacteria 23359
356 Ga0495643_0002112 3300046522 Bacteria 16409
357 Ga0495643_0015643 3300046522 Bacteria 4476
358 Ga0495643_0036393 3300046522 Bacteria 2704
359 Ga0495643_0060685 3300046522 Bacteria 2007
360 Ga0495643_0093598 3300046522 Bacteria 1547
361 Ga0495644_0000286 3300046523 Bacteria 23323
362 Ga0495644_0000673 3300046523 Bacteria 14243
363 Ga0495644_0001651 3300046523 Bacteria 9058
364 Ga0495644_0002457 3300046523 Bacteria 7395
365 Ga0495644_0005194 3300046523 Bacteria 5091
366 Ga0495644_0006382 3300046523 Bacteria 4575
367 Ga0495644_0008810 3300046523 Bacteria 3880
368 Ga0495644_0018996 3300046523 Bacteria 2623
369 Ga0495644_0046619 3300046523 Bacteria 1628
370 Ga0495644_0063799 3300046523 Bacteria 1384
371 Ga0495648_0000006 3300046524 Bacteria 361208
372 Ga0495648_0000434 3300046524 Bacteria 45425
373 Ga0495648_0000478 3300046524 Bacteria 43049
374 Ga0495648_0003910 3300046524 Bacteria 12908
375 Ga0495648_0006596 3300046524 Bacteria 9430
376 Ga0495648_0020023 3300046524 Bacteria 4680
377 Ga0495648_0024576 3300046524 Bacteria 4099
378 Ga0495648_0029865 3300046524 Bacteria 3612
379 Ga0495648_0029921 3300046524 Bacteria 3608
380 Ga0495648_0070981 3300046524 Bacteria 2021
381 Ga0495648_0114518 3300046524 Bacteria 1460
382 Ga0495666_0002621 3300046526 Bacteria 8953
383 Ga0495642_0005588 3300046528 Bacteria 4830
384 Ga0495642_0008184 3300046528 Bacteria 3999
385 Ga0495642_0008652 3300046528 Bacteria 3890
386 Ga0495642_0030746 3300046528 Bacteria 2149
387 Ga0495642_0054837 3300046528 Bacteria 1644
388 Ga0495642_0089583 3300046528 Bacteria 1301
389 Ga0495652_0009454 3300046529 Bacteria 8856
390 Ga0495654_0006013 3300046530 Bacteria 6966
391 Ga0495654_0007284 3300046530 Bacteria 6195
392 Ga0495654_0011779 3300046530 Bacteria 4721
393 Ga0495654_0021246 3300046530 Bacteria 3379
394 Ga0495654_0030020 3300046530 Bacteria 2768
395 Ga0495654_0080351 3300046530 Bacteria 1530
396 Ga0495665_0016326 3300046531 Bacteria 4000
397 Ga0495586_0059636 3300046535 Bacteria 2073
398 Ga0495609_0000096 3300046538 Bacteria 104135
399 Ga0495609_0001363 3300046538 Bacteria 16458
400 Ga0495609_0001918 3300046538 Bacteria 13242
401 Ga0495609_0004366 3300046538 Bacteria 7766
402 Ga0495609_0004646 3300046538 Bacteria 7453
403 Ga0495609_0005264 3300046538 Bacteria 6864
404 Ga0495609_0008505 3300046538 Bacteria 5023
405 Ga0495609_0010657 3300046538 Bacteria 4399
406 Ga0495609_0021602 3300046538 Bacteria 2970
407 Ga0495609_0028358 3300046538 Bacteria 2555
408 Ga0495609_0153290 3300046538 Bacteria 979
409 Ga0495597_0003029 3300046542 Bacteria 10134
410 Ga0495597_0003559 3300046542 Bacteria 8991
411 Ga0495597_0016331 3300046542 Bacteria 3505
412 Ga0495597_0029211 3300046542 Bacteria 2518
413 Ga0495597_0044777 3300046542 Bacteria 1966
414 Ga0495645_0282447 3300046543 Bacteria 1091
415 Ga0495622_0000136 3300046557 Bacteria 62960
416 Ga0495622_0140550 3300046557 Bacteria 1096
417 Ga0495622_0166244 3300046557 Bacteria 993
418 Ga0495622_0213099 3300046557 Bacteria 857
419 Ga0495633_0000509 3300046558 Bacteria 39153
420 Ga0495633_0000625 3300046558 Bacteria 33168
421 Ga0495633_0002772 3300046558 Bacteria 12117
422 Ga0495633_0004255 3300046558 Bacteria 9160
423 Ga0495633_0013485 3300046558 Bacteria 4305
424 Ga0495633_0014924 3300046558 Bacteria 4039
425 Ga0495633_0024462 3300046558 Bacteria 2984
426 Ga0495633_0101188 3300046558 Bacteria 1337
427 Ga0495656_0005587 3300046615 Bacteria 4348
428 Ga0495656_0022661 3300046615 Bacteria 2462
429 Ga0495656_0212473 3300046615 Bacteria 964
430 Ga0495668_0000025 3300046616 Bacteria 304546
431 Ga0495668_0000749 3300046616 Bacteria 38423
432 Ga0495668_0001751 3300046616 Bacteria 19890
433 Ga0495668_0003605 3300046616 Bacteria 11480
434 Ga0495668_0004691 3300046616 Bacteria 9592
435 Ga0495668_0004692 3300046616 Bacteria 9592
436 Ga0495668_0007093 3300046616 Bacteria 7214
437 Ga0495668_0139945 3300046616 Bacteria 1324
438 Ga0495668_0154005 3300046616 Bacteria 1259
439 Ga0495634_0007613 3300046642 Bacteria 8115
440 Ga0495611_0003486 3300046648 Bacteria 6926
441 Ga0495611_0007859 3300046648 Bacteria 4528
442 Ga0495611_0050668 3300046648 Bacteria 1870
443 Ga0495611_0057983 3300046648 Bacteria 1755
444 Ga0495611_0122892 3300046648 Bacteria 1210
445 Ga0495611_0134607 3300046648 Bacteria 1153
446 Ga0495611_0146100 3300046648 Bacteria 1104
447 Ga0495625_0000220 3300046660 Bacteria 90406
448 Ga0495625_0001904 3300046660 Bacteria 23580
449 Ga0495625_0004824 3300046660 Bacteria 12600
450 Ga0495625_0014121 3300046660 Bacteria 6391
451 Ga0495625_0014376 3300046660 Bacteria 6322
452 Ga0495625_0017542 3300046660 Bacteria 5604
453 Ga0495625_0073139 3300046660 Bacteria 2403
454 Ga0495625_0110497 3300046660 Bacteria 1879
455 Ga0495625_0205200 3300046660 Bacteria 1298
456 Ga0495625_0232158 3300046660 Bacteria 1204
457 Ga0495625_0253478 3300046660 Bacteria 1141
458 Ga0495635_0035323 3300046663 Bacteria 3465
459 Ga0495659_0000004 3300046664 Bacteria 143914
460 Ga0495659_0000276 3300046664 Bacteria 20982
461 Ga0495659_0000454 3300046664 Bacteria 15263
462 Ga0495659_0000822 3300046664 Bacteria 11037
463 Ga0495659_0002083 3300046664 Bacteria 6536
464 Ga0495661_0000164 3300046665 Bacteria 78742
465 Ga0495661_0001103 3300046665 Bacteria 23669
466 Ga0495661_0006004 3300046665 Bacteria 8572
467 Ga0495661_0009663 3300046665 Bacteria 6607
468 Ga0495661_0011670 3300046665 Bacteria 5953
469 Ga0495661_0025140 3300046665 Bacteria 3849
470 Ga0495661_0025311 3300046665 Bacteria 3834
471 Ga0495661_0083454 3300046665 Bacteria 1836
472 Ga0495661_0089957 3300046665 Bacteria 1748
473 Ga0495661_0100719 3300046665 Bacteria 1626
474 Ga0495661_0131519 3300046665 Bacteria 1371
475 Ga0495661_0132320 3300046665 Bacteria 1365
476 Ga0495661_0159789 3300046665 Bacteria 1210
477 Ga0495661_0186499 3300046665 Bacteria 1095
478 Ga0495588_0000070 3300046674 Bacteria 227611
479 Ga0495588_0010485 3300046674 Bacteria 4309
480 Ga0495588_0101185 3300046674 Bacteria 1514
481 Ga0495623_0018533 3300046679 Bacteria 4495
482 Ga0495623_0080209 3300046679 Bacteria 2020
483 Ga0495623_0088025 3300046679 Bacteria 1912
484 Ga0495646_0069885 3300046680 Bacteria 2070
485 Ga0495669_0000098 3300046684 Bacteria 54514
486 Ga0495669_0019847 3300046684 Bacteria 2903
487 Ga0495669_0061562 3300046684 Bacteria 1698
488 Ga0495669_0111885 3300046684 Bacteria 1275
489 Ga0495670_0002867 3300046691 Bacteria 8519
490 Ga0495670_0007760 3300046691 Bacteria 5276
491 Ga0495670_0018694 3300046691 Bacteria 3413
492 Ga0495670_0045814 3300046691 Bacteria 2183
493 Ga0495671_0000381 3300046692 Bacteria 36504
494 Ga0495671_0001026 3300046692 Bacteria 19429
495 Ga0495671_0001956 3300046692 Bacteria 13215
496 Ga0495671_0006785 3300046692 Bacteria 6582
497 Ga0495671_0014933 3300046692 Bacteria 4173
498 Ga0495671_0020147 3300046692 Bacteria 3516
499 Ga0495671_0043341 3300046692 Bacteria 2258
500 Ga0495649_0002569 3300046694 Bacteria 12714
501 Ga0495649_0007083 3300046694 Bacteria 6891
502 Ga0495649_0022398 3300046694 Bacteria 3535
503 Ga0495649_0038110 3300046694 Bacteria 2638
504 Ga0495649_0077331 3300046694 Bacteria 1781
505 Ga0495649_0081749 3300046694 Bacteria 1727
506 Ga0495589_0000036 3300046794 Bacteria 153299
507 Ga0495589_0000092 3300046794 Bacteria 85372
508 Ga0495589_0008532 3300046794 Bacteria 5343
509 Ga0495589_0012684 3300046794 Bacteria 4358
510 Ga0495589_0049081 3300046794 Bacteria 2088
511 Ga0495589_0071135 3300046794 Bacteria 1700
512 Ga0495589_0126014 3300046794 Bacteria 1231
513 Ga0495600_0022714 3300046809 Bacteria 4031
514 Ga0495660_0000117 3300046810 Bacteria 85237
515 Ga0495660_0001561 3300046810 Bacteria 15376
516 Ga0495660_0006166 3300046810 Bacteria 7119
517 Ga0495660_0012908 3300046810 Bacteria 4843
518 Ga0495660_0016173 3300046810 Bacteria 4303
519 Ga0495660_0017729 3300046810 Bacteria 4096
520 Ga0495660_0022162 3300046810 Bacteria 3630
521 Ga0495660_0036894 3300046810 Bacteria 2724
522 Ga0495660_0065645 3300046810 Bacteria 1936
523 Ga0495660_0079389 3300046810 Bacteria 1723
524 Ga0495581_0063508 3300047315 Bacteria 2134
525 Ga0495581_0099954 3300047315 Bacteria 1685
526 Ga0495581_0315794 3300047315 Bacteria 913
527 Ga0495604_0015614 3300047317 Bacteria 6063
528 Ga0495604_0016076 3300047317 Bacteria 5977
529 Ga0495604_0049222 3300047317 Bacteria 3276
530 Ga0495636_0000886 3300047318 Bacteria 11087
531 Ga0495636_0011944 3300047318 Bacteria 3441
532 Ga0495636_0016313 3300047318 Bacteria 2965
533 Ga0495672_0000045 3300047320 Bacteria 255145
534 Ga0495672_0000086 3300047320 Bacteria 155010
535 Ga0495672_0000287 3300047320 Bacteria 69547
536 Ga0495672_0000349 3300047320 Bacteria 59139
537 Ga0495672_0000427 3300047320 Bacteria 50460
538 Ga0495672_0002132 3300047320 Bacteria 18542
539 Ga0495672_0003870 3300047320 Bacteria 12583
540 Ga0495672_0008053 3300047320 Bacteria 7838
541 Ga0495672_0023577 3300047320 Bacteria 3981
542 Ga0495672_0112466 3300047320 Bacteria 1459
543 Ga0495672_0155506 3300047320 Bacteria 1181
544 Ga0495676_0000035 3300047321 Bacteria 120519
545 Ga0495680_0008120 3300047322 Bacteria 9567
546 Ga0495680_0153451 3300047322 Bacteria 1677
547 Ga0495683_0000080 3300047323 Bacteria 95388
548 Ga0495683_0000901 3300047323 Bacteria 20977
549 Ga0495683_0002733 3300047323 Bacteria 10511
550 Ga0495683_0002975 3300047323 Bacteria 10006
551 Ga0495683_0028446 3300047323 Bacteria 2856
552 Ga0495683_0029949 3300047323 Bacteria 2779
553 Ga0495683_0045627 3300047323 Bacteria 2202
554 Ga0495683_0049412 3300047323 Bacteria 2106
555 Ga0495683_0087929 3300047323 Bacteria 1509
556 Ga0495687_000074 3300047443 Bacteria 153464
557 Ga0495687_000154 3300047443 Bacteria 104740
558 Ga0495687_000199 3300047443 Bacteria 86090
559 Ga0495687_000643 3300047443 Bacteria 40048
560 Ga0495687_000885 3300047443 Bacteria 31640
561 Ga0495687_000887 3300047443 Bacteria 31523
562 Ga0495687_001753 3300047443 Bacteria 19181
563 Ga0495687_002544 3300047443 Bacteria 14438
564 Ga0495687_002568 3300047443 Bacteria 14327
565 Ga0495687_007461 3300047443 Bacteria 6435
566 Ga0495687_017525 3300047443 Bacteria 3570
567 Ga0495675_0008867 3300047444 Bacteria 6246
568 Ga0495675_0011101 3300047444 Bacteria 5647
569 Ga0495677_0000037 3300047445 Bacteria 78595
570 Ga0495677_0001543 3300047445 Bacteria 9273
571 Ga0495677_0002365 3300047445 Bacteria 7411
572 Ga0495677_0003565 3300047445 Bacteria 6038
573 Ga0495677_0040572 3300047445 Bacteria 1702
574 Ga0495679_009220 3300047446 Bacteria 3964
575 Ga0495679_011167 3300047446 Bacteria 3482
576 Ga0495679_020428 3300047446 Bacteria 2306
577 Ga0495685_000005 3300047447 Bacteria 112142
578 Ga0495685_000013 3300047447 Bacteria 79924
579 Ga0495685_012340 3300047447 Bacteria 2894
580 Ga0495673_0000017 3300047469 Bacteria 574970
581 Ga0495673_0064572 3300047469 Bacteria 1556
582 Ga0495673_0094825 3300047469 Bacteria 1214
583 Ga0495681_0001860 3300047470 Bacteria 15489
584 Ga0495681_0004155 3300047470 Bacteria 9945
585 Ga0495681_0010505 3300047470 Bacteria 5601
586 Ga0495681_0072558 3300047470 Bacteria 1556
587 Ga0495686_0000809 3300047472 Bacteria 40533
588 Ga0495686_0002297 3300047472 Bacteria 18290
589 Ga0495686_0016679 3300047472 Bacteria 4972
590 Ga0495686_0016920 3300047472 Bacteria 4927
591 Ga0495686_0142061 3300047472 Bacteria 1416
592 Ga0495593_0153294 3300047673 Bacteria 1165
593 Ga0495593_0248083 3300047673 Bacteria 891
594 Ga0495602_0004656 3300048088 Bacteria 14322
595 Ga0495626_0000006 3300048091 Bacteria 284977
596 Ga0495626_0011330 3300048091 Bacteria 4721
597 Ga0495626_0037492 3300048091 Bacteria 2303
598 Ga0495626_0053240 3300048091 Bacteria 1863
599 Ga0495626_0059775 3300048091 Bacteria 1738
600 Ga0495626_0064703 3300048091 Bacteria 1656
601 Ga0496100_0155716 3300048903 Bacteria 1634
602 Ga0496101_0057107 3300048904 Bacteria 2822
603 Ga0496102_0007696 3300048905 Bacteria 9203
604 Ga0496102_0015860 3300048905 Bacteria 6570
605 Ga0496102_0409753 3300048905 Bacteria 1273
606 Ga0496102_0572401 3300048905 Bacteria 1052
607 Ga0496103_0014532 3300048906 Bacteria 4674
608 Ga0496103_0041340 3300048906 Bacteria 2834
609 Ga0496104_0134766 3300048907 Bacteria 2373
610 Ga0496104_0583676 3300048907 Bacteria 1028
611 Ga0496105_0119299 3300048908 Bacteria 2176
612 Ga0496106_0004396 3300048909 Bacteria 10460
613 Ga0496107_0051556 3300048910 Bacteria 2968
614 Ga0496108_0349515 3300048911 Bacteria 1290
615 Ga0496109_0060519 3300048912 Bacteria 3460
616 Ga0496110_0000799 3300048913 Bacteria 22012
617 Ga0496110_0035645 3300048913 Bacteria 4317
618 Ga0496111_0014912 3300048914 Bacteria 5320
619 Ga0496111_0151362 3300048914 Bacteria 1721
620 Ga0496111_0320672 3300048914 Bacteria 1148
621 Ga0496113_0121610 3300048916 Bacteria 2041
622 Ga0496113_0342250 3300048916 Bacteria 1199
623 Ga0496114_0114485 3300048917 Bacteria 2313
624 Ga0496115_0408335 3300048918 Bacteria 1101
625 Ga0496116_0015835 3300048919 Bacteria 5936
626 Ga0496116_0063938 3300048919 Bacteria 2367
627 Ga0496117_0000032 3300048920 Bacteria 375533
628 Ga0496118_0000027 3300048921 Bacteria 375533
629 Ga0496121_0003068 3300048924 Bacteria 24191
630 Ga0496121_0113551 3300048924 Bacteria 2061
631 Ga0496121_0303516 3300048924 Bacteria 1082
632 Ga0496122_0003391 3300048925 Bacteria 20976
633 Ga0496122_0012642 3300048925 Bacteria 8371
634 Ga0496122_0012962 3300048925 Bacteria 8227
635 Ga0496122_0030147 3300048925 Bacteria 4554
636 Ga0496122_0196718 3300048925 Bacteria 1183
637 Ga0496123_0000851 3300048926 Bacteria 48703
638 Ga0496123_0005384 3300048926 Bacteria 12900
639 Ga0496123_0012698 3300048926 Bacteria 7147
640 Ga0496124_0104928 3300048927 Bacteria 2284
641 Ga0496124_0197063 3300048927 Bacteria 1535
642 Ga0496124_0242653 3300048927 Bacteria 1339
643 Ga0496124_0341354 3300048927 Bacteria 1063
644 Ga0496125_0012670 3300048928 Bacteria 8346
645 Ga0495678_000843 3300049459 Bacteria 27375
646 Ga0495678_001072 3300049459 Bacteria 23117
647 Ga0495678_001392 3300049459 Bacteria 19229
648 Ga0495678_002783 3300049459 Bacteria 11423
649 Ga0495678_003031 3300049459 Bacteria 10681
650 Ga0495678_003341 3300049459 Bacteria 9994
651 Ga0495678_004899 3300049459 Bacteria 7563
652 Ga0495678_014473 3300049459 Bacteria 3667
653 Ga0495678_049124 3300049459 Bacteria 1641
654 Ga0495678_055844 3300049459 Bacteria 1504
655 Ga0495682_0000126 3300049460 Bacteria 66245
656 Ga0495682_0000724 3300049460 Bacteria 21435
657 Ga0495682_0003079 3300049460 Bacteria 7566
658 Ga0495682_0014223 3300049460 Bacteria 3019
659 Ga0495682_0022957 3300049460 Bacteria 2330
660 Ga0495682_0025337 3300049460 Bacteria 2208
661 Ga0495682_0065168 3300049460 Bacteria 1313
662 Ga0495682_0119319 3300049460 Bacteria 944
663 Ga0501034_0122395 3300049571 Bacteria 2588
664 Ga0501227_001355 3300049665 Bacteria 5500
665 Ga0501227_004117 3300049665 Bacteria 3129
666 Ga0501249_011989 3300049679 Bacteria 1828
667 Ga0501263_001301 3300049760 Bacteria 2310
668 Ga0501269_000064 3300049766 Bacteria 33135
669 Ga0501269_000280 3300049766 Bacteria 14271
670 Ga0501279_000841 3300049775 Bacteria 4045
671 Ga0501044_0031544 3300049823 Bacteria 5577
672 Ga0500618_000714 3300053125 Bacteria 19198
673 Ga0500618_002337 3300053125 Bacteria 7251
674 Ga0500586_000015 3300053145 Bacteria 35201
675 Ga0500586_000753 3300053145 Bacteria 6639
676 Ga0466962_0152683 3300061719 Bacteria 1120
677 2511248853 2511231003 Bacteria 5606035
678 2511386032 2511231026 Bacteria 5225445
679 2516206805 2516143018 Bacteria 6951533
680 2521561105 2521172590 Bacteria 5047645
681 2550694713 2548876994 Bacteria 4904866
682 2553006019 2551306416 Bacteria 6152985
683 2601671784 2600255292 Bacteria 6300551
684 2643788711 2643221554 Bacteria 6603920
685 2643797750 2643221556 Bacteria 7251154
686 2644213264 2643221638 Bacteria 6579467
687 2644249618 2643221645 Bacteria 7207331
688 2644356182 2643221664 Bacteria 7272945
689 2644470468 2643221684 Bacteria 7145183
690 2738738828 2738541280 Bacteria 6630198
691 2738739165 2738541280 Bacteria 6630198
692 2738825557 2738541297 Bacteria 6549566
693 2738846399 2738541300 Bacteria 6675882
694 2739149354 2738541357 Bacteria 6549408
695 2739191273 2738543003 Bacteria 6549560
696 2739274952 2738543018 Bacteria 6718814
697 2739317750 2738543026 Bacteria 6549408
698 2739335991 2738543029 Bacteria 6549249
699 2739343996 2738543030 Bacteria 6719714
700 2765567541 2765235838 Bacteria 5445269
701 2808983019 2808606386 Bacteria 4471946
702 2809130538 2808606415 Bacteria 4576710
703 2809144248 2808606418 Bacteria 6724496
704 2809149985 2808606419 Bacteria 4576925
705 2819593818 2818991445 Bacteria 4955017
706 2819617485 2818991449 Bacteria 5518009
707 2821134158 2821131069 Bacteria 6108407
708 2839095120 2839094727 Bacteria 5534556
709 2842711977 2842711865 Bacteria 7155354
710 2842717113 2842711865 Bacteria 7155354
711 2852621796 2852618963 Bacteria 4577824
712 2857552094 2857547612 Bacteria 6179999
713 2857559066 2857558681 Bacteria 6617694
714 2857559491 2857558681 Bacteria 6617694
715 2857565972 2857564685 Bacteria 6290584
716 2884812155 2884811622 Bacteria 5552861
717 2884839646 2884836552 Bacteria 5219991
718 2884856543 2884852848 Bacteria 5221161
719 2896158909 2896154374 Bacteria 5221518
720 2904428037 2904424332 Bacteria 7633521
721 2904429028 2904424332 Bacteria 7633521
722 2904442263 2904439833 Bacteria 5931679
723 2904533542 2904530477 Bacteria 5876334
724 2904586497 2904584206 Bacteria 6028872
725 2904591690 2904589729 Bacteria 6113573
726 2904602157 2904601388 Bacteria 5884906
727 2919051181 2919046199 Bacteria 5567169
728 2919083504 2919079590 Bacteria 5946433
729 2919479169 2919476304 Bacteria 5888696
730 2923514943 2923510766 Bacteria 5926163
731 2928133569 2928130867 Bacteria 5467269
732 2932413834 2932410948 Bacteria 6312192
733 2932417894 2932416698 Bacteria 6315112
734 8047679055 8047673197 Bacteria 7395230
735 Ga0495650_0005981
736 JGI25152J39213_1000031
737 JGI25152J39213_1000097
738 JGI25152J39213_1012749
739 JGI25150J39212_1000687
740 JGI25150J39212_1001086
741 JGI25150J39212_1001098
742 JGI25159J45721_1007192
743 JGI25153J46596_10006075
744 JGI25160J50197_1000948
745 JGI25161J50226_1001292
746 Ga0055525_1000009
747 Ga0055526_1000251
748 Ga0055526_1001123
749 Ga0055526_1006357
750 Ga0055526_1006795
751 Ga0055537_1000269
752 Ga0055524_1000419
753 Ga0055524_1002356
754 Ga0055524_1003545
755 Ga0055524_1004497
756 Ga0055534_1001201
757 Ga0055534_1001831
758 Ga0055534_1008342
759 Ga0055528_1000043
760 Ga0055530_10015392
761 Ga0055530_10043578
762 Ga0055530_10046258
763 Ga0055543_1002289
764 Ga0065165_1002440
765 Ga0065165_1004264
766 Ga0065165_1020703
767 Ga0065165_1036792
768 Ga0070658_10137800
769 Ga0070658_10429077
770 Ga0068869_100119710
771 Ga0070666_10027008
772 Ga0070682_100034173
773 Ga0070660_100001319
774 Ga0070660_100025833
775 Ga0070660_100045746
776 Ga0070661_100002165
777 Ga0070661_100096337
778 Ga0070659_100080228
779 Ga0070659_100270634
780 Ga0070662_100188761
781 Ga0070681_10090822
782 Ga0068855_100035256
783 Ga0068855_100714287
784 Ga0070664_100149634
785 Ga0068854_100012263
786 Ga0068854_100015358
787 Ga0068854_100374036
788 Ga0068856_100708963
789 Ga0068858_100469584
790 Ga0068860_100045029
791 Ga0070712_100022180
792 Ga0079104_1024153
793 Ga0105244_10000862
794 Ga0105244_10001798
795 Ga0105244_10098048
796 Ga0105240_10026303
797 Ga0105240_10057485
798 Ga0105240_10067655
799 Ga0105245_10024611
800 Ga0105245_10109675
801 Ga0105241_10004855
802 Ga0105241_10083618
803 Ga0105237_10005007
804 Ga0105238_10000004
805 Ga0105238_10000695
806 Ga0105238_10128291
807 Ga0105239_10003999
808 Ga0105239_10007020
809 Ga0105239_10074203
810 Ga0105246_10043759
811 Ga0157369_10000747
812 Ga0157374_10249935
813 Ga0157372_10000727
814 Ga0157372_10595621
815 Ga0182008_10002279
816 Ga0182006_1000053
817 Ga0182007_10000075
818 Ga0182005_1000031
819 Ga0163161_10094160
820 Ga0213872_10003717
821 Ga0213872_10008665
822 Ga0209436_100187
823 Ga0209436_102170
824 Ga0209563_100015
825 Ga0207425_1000001
826 Ga0207425_1000006
827 Ga0207425_1001309
828 Ga0207425_1002280
829 Ga0209646_1000042
830 Ga0209646_1000047
831 Ga0209677_103513
832 Ga0209148_1000957
833 Ga0209129_1000009
834 Ga0209129_1000093
835 Ga0209129_1006943
836 Ga0209565_1000006
837 Ga0209565_1000691
838 Ga0209565_1002714
839 Ga0209565_1003370
840 Ga0209565_1004202
841 Ga0209565_1005009
842 Ga0209673_1000004
843 Ga0209130_1002319
844 Ga0209130_1002511
845 Ga0209675_1000006
846 Ga0209675_1000280
847 Ga0209675_1002623
848 Ga0209675_1003041
849 Ga0209025_1006308
850 Ga0209564_1000006
851 Ga0209564_1000010
852 Ga0209564_1000085
853 Ga0209564_1000146
854 Ga0209564_1003249
855 Ga0209758_1000047
856 Ga0209758_1000055
857 Ga0209050_1000064
858 Ga0209050_1004834
859 Ga0209050_1006531
860 Ga0209256_1000037
861 Ga0209256_1000080
862 Ga0209256_1000507
863 Ga0209256_1003251
864 Ga0209256_1003525
865 Ga0207426_1001004
866 Ga0209051_1017160
867 Ga0209257_1000010
868 Ga0209257_1004733
869 Ga0209257_1051374
870 Ga0207655_1002959
871 Ga0207655_1012488
872 Ga0207647_10000311
873 Ga0207705_10003154
874 Ga0207707_10381146
875 Ga0207695_10000551
876 Ga0207695_10000965
877 Ga0207671_10001038
878 Ga0207671_10007221
879 Ga0207693_10067232
880 Ga0207657_10003453
881 Ga0207657_10009926
882 Ga0207657_10043093
883 Ga0207649_10000243
884 Ga0207649_10011483
885 Ga0207694_10000107
886 Ga0207687_10257365
887 Ga0207690_10053859
888 Ga0207706_10195082
889 Ga0207686_10165501
890 Ga0207679_10008180
891 Ga0207667_10001069
892 Ga0207667_10022321
893 Ga0207667_10056799
894 Ga0207640_10007380
895 Ga0207703_10091772
896 Ga0207639_10000604
897 Ga0207702_10428786
898 Ga0207674_10011589
899 Ga0316177_1059274
900 Ga0316182_1069093
901 Ga0265327_10006187
902 Ga0265316_10134164
903 Ga0265316_10166301
904 Ga0307408_100000120
905 Ga0307408_100003787
906 Ga0307408_100009784
907 Ga0307408_100137810
908 Ga0307408_100432089
909 Ga0265314_10037569
910 Ga0307416_100019376
911 Ga0307416_100704180
912 Ga0307414_10010855
913 Ga0395899_0003015
914 Ga0395899_0034472
915 Ga0395900_0004698
916 Ga0395900_0032736
917 Ga0395900_0051829
918 Ga0395900_0083144
919 Ga0395900_0096566
920 Ga0395900_0170970
921 Ga0395900_0215157
922 Ga0395898_0184000
923 Ga0395898_0185556
924 Ga0395905_0000256
925 Ga0395905_0095340
926 Ga0395905_0148096
927 Ga0395901_0000084
928 Ga0395901_0011546
929 Ga0395901_0502975
930 Ga0395901_0548723
931 Ga0395901_0550644
932 Ga0436361_0041926
933 Ga0436361_0314004
934 Ga0436361_0694154
935 Ga0439450_005119
936 Ga0439458_0009426
937 Ga0466969_0033223
938 Ga0466969_0149745
939 Ga0466972_0000772
940 Ga0466972_0019636
941 Ga0466982_0126269
942 Ga0466965_0006959
943 Ga0466965_0018612
944 Ga0466965_0036177
945 Ga0466965_0089758
946 Ga0466965_0132448
947 Ga0466966_0011608
948 Ga0466966_0102265
949 Ga0466964_0005789
950 Ga0466964_0010169
951 Ga0466971_0175793
952 Ga0466968_0084323
953 Ga0466957_0007864
954 Ga0466957_0273001
955 Ga0466959_0017858
956 Ga0466959_0069455
957 Ga0451576_0035421
958 Ga0466958_0013417
959 Ga0466967_0023625
960 Ga0466967_0494551
961 Ga0466967_0807794
962 Ga0495617_000002
963 Ga0495617_003454
964 Ga0495617_013505
965 Ga0495617_046528
966 Ga0495627_002339
967 Ga0495603_0039895
968 Ga0495603_0077384
969 Ga0495590_0000014
970 Ga0495590_0000044
971 Ga0495590_0001237
972 Ga0495590_0006392
973 Ga0495590_0038967
974 Ga0495590_0042877
975 Ga0495591_001943
976 Ga0495591_008472
977 Ga0495629_0050132
978 Ga0495638_0000133
979 Ga0495638_0004830
980 Ga0495638_0006572
981 Ga0495638_0022586
982 Ga0495638_0127852
983 Ga0495638_0276778
984 Ga0495653_0052622
985 Ga0495653_0075009
986 Ga0495653_0076622
987 Ga0495650_0000056
988 Ga0495650_0000105
989 Ga0495650_0000136
990 Ga0495650_0000798
991 Ga0495650_0002861
992 Ga0495650_0033759
993 Ga0495650_0045513
994 Ga0495605_0000087
995 Ga0495605_0000939
996 Ga0495605_0003264
997 Ga0495605_0006046
998 Ga0495605_0011308
999 Ga0495605_0013050
1000 Ga0495605_0029847
1001 Ga0495605_0059887
1002 Ga0495605_0128796
1003 Ga0495584_0000813
1004 Ga0495584_0001311
1005 Ga0495584_0001593
1006 Ga0495584_0002555
1007 Ga0495584_0002606
1008 Ga0495584_0009176
1009 Ga0495584_0134791
1010 Ga0495585_0008589
1011 Ga0495585_0042873
1012 Ga0495585_0101449
1013 Ga0495585_0127222
1014 Ga0495594_0004727
1015 Ga0495594_0024006
1016 Ga0495594_0094180
1017 Ga0495596_0001098
1018 Ga0495596_0002385
1019 Ga0495596_0006980
1020 Ga0495596_0026450
1021 Ga0495596_0037710
1022 Ga0495596_0062408
1023 Ga0495607_0003730
1024 Ga0495607_0008732
1025 Ga0495607_0012320
1026 Ga0495607_0016543
1027 Ga0495607_0017927
1028 Ga0495607_0019742
1029 Ga0495607_0028725
1030 Ga0495607_0053147
1031 Ga0495607_0053176
1032 Ga0495607_0062620
1033 Ga0495607_0088547
1034 Ga0495607_0101974
1035 Ga0495607_0229499
1036 Ga0495583_0000004
1037 Ga0495583_0000044
1038 Ga0495583_0000056
1039 Ga0495583_0004345
1040 Ga0495583_0004630
1041 Ga0495583_0004791
1042 Ga0495583_0008328
1043 Ga0495583_0011766
1044 Ga0495583_0012910
1045 Ga0495583_0014931
1046 Ga0495583_0035112
1047 Ga0495583_0159420
1048 Ga0495606_0000007
1049 Ga0495606_0000319
1050 Ga0495606_0000476
1051 Ga0495606_0000986
1052 Ga0495606_0002587
1053 Ga0495606_0006334
1054 Ga0495606_0046519
1055 Ga0495606_0049845
1056 Ga0495606_0054230
1057 Ga0495606_0077523
1058 Ga0495610_0000004
1059 Ga0495610_0000798
1060 Ga0495610_0003923
1061 Ga0495610_0006285
1062 Ga0495610_0072550
1063 Ga0495616_0001477
1064 Ga0495616_0002173
1065 Ga0495616_0004753
1066 Ga0495616_0009908
1067 Ga0495616_0021444
1068 Ga0495616_0027816
1069 Ga0495616_0036260
1070 Ga0495616_0057163
1071 Ga0495616_0066237
1072 Ga0495630_0009475
1073 Ga0495631_0006033
1074 Ga0495631_0006413
1075 Ga0495631_0009588
1076 Ga0495631_0015131
1077 Ga0495631_0040123
1078 Ga0495631_0132377
1079 Ga0495632_0000040
1080 Ga0495632_0001781
1081 Ga0495632_0006026
1082 Ga0495632_0006845
1083 Ga0495637_0000006
1084 Ga0495637_0001944
1085 Ga0495637_0010922
1086 Ga0495637_0086912
1087 Ga0495643_0000139
1088 Ga0495643_0000310
1089 Ga0495643_0001331
1090 Ga0495643_0002112
1091 Ga0495643_0015643
1092 Ga0495643_0036393
1093 Ga0495643_0060685
1094 Ga0495643_0093598
1095 Ga0495644_0000286
1096 Ga0495644_0000673
1097 Ga0495644_0001651
1098 Ga0495644_0002457
1099 Ga0495644_0005194
1100 Ga0495644_0006382
1101 Ga0495644_0008810
1102 Ga0495644_0018996
1103 Ga0495644_0046619
1104 Ga0495644_0063799
1105 Ga0495648_0000006
1106 Ga0495648_0000434
1107 Ga0495648_0000478
1108 Ga0495648_0003910
1109 Ga0495648_0006596
1110 Ga0495648_0020023
1111 Ga0495648_0024576
1112 Ga0495648_0029865
1113 Ga0495648_0029921
1114 Ga0495648_0070981
1115 Ga0495648_0114518
1116 Ga0495666_0002621
1117 Ga0495642_0005588
1118 Ga0495642_0008184
1119 Ga0495642_0008652
1120 Ga0495642_0030746
1121 Ga0495642_0054837
1122 Ga0495642_0089583
1123 Ga0495652_0009454
1124 Ga0495654_0006013
1125 Ga0495654_0007284
1126 Ga0495654_0011779
1127 Ga0495654_0021246
1128 Ga0495654_0030020
1129 Ga0495654_0080351
1130 Ga0495665_0016326
1131 Ga0495586_0059636
1132 Ga0495609_0000096
1133 Ga0495609_0001363
1134 Ga0495609_0001918
1135 Ga0495609_0004366
1136 Ga0495609_0004646
1137 Ga0495609_0005264
1138 Ga0495609_0008505
1139 Ga0495609_0010657
1140 Ga0495609_0021602
1141 Ga0495609_0028358
1142 Ga0495609_0153290
1143 Ga0495597_0003029
1144 Ga0495597_0003559
1145 Ga0495597_0016331
1146 Ga0495597_0029211
1147 Ga0495597_0044777
1148 Ga0495645_0282447
1149 Ga0495622_0000136
1150 Ga0495622_0140550
1151 Ga0495622_0166244
1152 Ga0495622_0213099
1153 Ga0495633_0000509
1154 Ga0495633_0000625
1155 Ga0495633_0002772
1156 Ga0495633_0004255
1157 Ga0495633_0013485
1158 Ga0495633_0014924
1159 Ga0495633_0024462
1160 Ga0495633_0101188
1161 Ga0495656_0005587
1162 Ga0495656_0022661
1163 Ga0495656_0212473
1164 Ga0495668_0000025
1165 Ga0495668_0000749
1166 Ga0495668_0001751
1167 Ga0495668_0003605
1168 Ga0495668_0004691
1169 Ga0495668_0004692
1170 Ga0495668_0007093
1171 Ga0495668_0139945
1172 Ga0495668_0154005
1173 Ga0495634_0007613
1174 Ga0495611_0003486
1175 Ga0495611_0007859
1176 Ga0495611_0050668
1177 Ga0495611_0057983
1178 Ga0495611_0122892
1179 Ga0495611_0134607
1180 Ga0495611_0146100
1181 Ga0495625_0000220
1182 Ga0495625_0001904
1183 Ga0495625_0004824
1184 Ga0495625_0014121
1185 Ga0495625_0014376
1186 Ga0495625_0017542
1187 Ga0495625_0073139
1188 Ga0495625_0110497
1189 Ga0495625_0205200
1190 Ga0495625_0232158
1191 Ga0495625_0253478
1192 Ga0495635_0035323
1193 Ga0495659_0000004
1194 Ga0495659_0000276
1195 Ga0495659_0000454
1196 Ga0495659_0000822
1197 Ga0495659_0002083
1198 Ga0495661_0000164
1199 Ga0495661_0001103
1200 Ga0495661_0006004
1201 Ga0495661_0009663
1202 Ga0495661_0011670
1203 Ga0495661_0025140
1204 Ga0495661_0025311
1205 Ga0495661_0083454
1206 Ga0495661_0089957
1207 Ga0495661_0100719
1208 Ga0495661_0131519
1209 Ga0495661_0132320
1210 Ga0495661_0159789
1211 Ga0495661_0186499
1212 Ga0495588_0000070
1213 Ga0495588_0010485
1214 Ga0495588_0101185
1215 Ga0495623_0018533
1216 Ga0495623_0080209
1217 Ga0495623_0088025
1218 Ga0495646_0069885
1219 Ga0495669_0000098
1220 Ga0495669_0019847
1221 Ga0495669_0061562
1222 Ga0495669_0111885
1223 Ga0495670_0002867
1224 Ga0495670_0007760
1225 Ga0495670_0018694
1226 Ga0495670_0045814
1227 Ga0495671_0000381
1228 Ga0495671_0001026
1229 Ga0495671_0001956
1230 Ga0495671_0006785
1231 Ga0495671_0014933
1232 Ga0495671_0020147
1233 Ga0495671_0043341
1234 Ga0495649_0002569
1235 Ga0495649_0007083
1236 Ga0495649_0022398
1237 Ga0495649_0038110
1238 Ga0495649_0077331
1239 Ga0495649_0081749
1240 Ga0495589_0000036
1241 Ga0495589_0000092
1242 Ga0495589_0008532
1243 Ga0495589_0012684
1244 Ga0495589_0049081
1245 Ga0495589_0071135
1246 Ga0495589_0126014
1247 Ga0495600_0022714
1248 Ga0495660_0000117
1249 Ga0495660_0001561
1250 Ga0495660_0006166
1251 Ga0495660_0012908
1252 Ga0495660_0016173
1253 Ga0495660_0017729
1254 Ga0495660_0022162
1255 Ga0495660_0036894
1256 Ga0495660_0065645
1257 Ga0495660_0079389
1258 Ga0495581_0063508
1259 Ga0495581_0099954
1260 Ga0495581_0315794
1261 Ga0495604_0015614
1262 Ga0495604_0016076
1263 Ga0495604_0049222
1264 Ga0495636_0000886
1265 Ga0495636_0011944
1266 Ga0495636_0016313
1267 Ga0495672_0000045
1268 Ga0495672_0000086
1269 Ga0495672_0000287
1270 Ga0495672_0000349
1271 Ga0495672_0000427
1272 Ga0495672_0002132
1273 Ga0495672_0003870
1274 Ga0495672_0008053
1275 Ga0495672_0023577
1276 Ga0495672_0112466
1277 Ga0495672_0155506
1278 Ga0495676_0000035
1279 Ga0495680_0008120
1280 Ga0495680_0153451
1281 Ga0495683_0000080
1282 Ga0495683_0000901
1283 Ga0495683_0002733
1284 Ga0495683_0002975
1285 Ga0495683_0028446
1286 Ga0495683_0029949
1287 Ga0495683_0045627
1288 Ga0495683_0049412
1289 Ga0495683_0087929
1290 Ga0495687_000074
1291 Ga0495687_000154
1292 Ga0495687_000199
1293 Ga0495687_000643
1294 Ga0495687_000885
1295 Ga0495687_000887
1296 Ga0495687_001753
1297 Ga0495687_002544
1298 Ga0495687_002568
1299 Ga0495687_007461
1300 Ga0495687_017525
1301 Ga0495675_0008867
1302 Ga0495675_0011101
1303 Ga0495677_0000037
1304 Ga0495677_0001543
1305 Ga0495677_0002365
1306 Ga0495677_0003565
1307 Ga0495677_0040572
1308 Ga0495679_009220
1309 Ga0495679_011167
1310 Ga0495679_020428
1311 Ga0495685_000005
1312 Ga0495685_000013
1313 Ga0495685_012340
1314 Ga0495673_0000017
1315 Ga0495673_0064572
1316 Ga0495673_0094825
1317 Ga0495681_0001860
1318 Ga0495681_0004155
1319 Ga0495681_0010505
1320 Ga0495681_0072558
1321 Ga0495686_0000809
1322 Ga0495686_0002297
1323 Ga0495686_0016679
1324 Ga0495686_0016920
1325 Ga0495686_0142061
1326 Ga0495593_0153294
1327 Ga0495593_0248083
1328 Ga0495602_0004656
1329 Ga0495626_0000006
1330 Ga0495626_0011330
1331 Ga0495626_0037492
1332 Ga0495626_0053240
1333 Ga0495626_0059775
1334 Ga0495626_0064703
1335 Ga0496100_0155716
1336 Ga0496101_0057107
1337 Ga0496102_0007696
1338 Ga0496102_0015860
1339 Ga0496102_0409753
1340 Ga0496102_0572401
1341 Ga0496103_0014532
1342 Ga0496103_0041340
1343 Ga0496104_0134766
1344 Ga0496104_0583676
1345 Ga0496105_0119299
1346 Ga0496106_0004396
1347 Ga0496107_0051556
1348 Ga0496108_0349515
1349 Ga0496109_0060519
1350 Ga0496110_0000799
1351 Ga0496110_0035645
1352 Ga0496111_0014912
1353 Ga0496111_0151362
1354 Ga0496111_0320672
1355 Ga0496113_0121610
1356 Ga0496113_0342250
1357 Ga0496114_0114485
1358 Ga0496115_0408335
1359 Ga0496116_0015835
1360 Ga0496116_0063938
1361 Ga0496117_0000032
1362 Ga0496118_0000027
1363 Ga0496121_0003068
1364 Ga0496121_0113551
1365 Ga0496121_0303516
1366 Ga0496122_0003391
1367 Ga0496122_0012642
1368 Ga0496122_0012962
1369 Ga0496122_0030147
1370 Ga0496122_0196718
1371 Ga0496123_0000851
1372 Ga0496123_0005384
1373 Ga0496123_0012698
1374 Ga0496124_0104928
1375 Ga0496124_0197063
1376 Ga0496124_0242653
1377 Ga0496124_0341354
1378 Ga0496125_0012670
1379 Ga0495678_000843
1380 Ga0495678_001072
1381 Ga0495678_001392
1382 Ga0495678_002783
1383 Ga0495678_003031
1384 Ga0495678_003341
1385 Ga0495678_004899
1386 Ga0495678_014473
1387 Ga0495678_049124
1388 Ga0495678_055844
1389 Ga0495682_0000126
1390 Ga0495682_0000724
1391 Ga0495682_0003079
1392 Ga0495682_0014223
1393 Ga0495682_0022957
1394 Ga0495682_0025337
1395 Ga0495682_0065168
1396 Ga0495682_0119319
1397 Ga0501034_0122395
1398 Ga0501227_001355
1399 Ga0501227_004117
1400 Ga0501249_011989
1401 Ga0501263_001301
1402 Ga0501269_000064
1403 Ga0501269_000280
1404 Ga0501279_000841
1405 Ga0501044_0031544
1406 Ga0500618_000714
1407 Ga0500618_002337
1408 Ga0500586_000015
1409 Ga0500586_000753
1410 Ga0466962_0152683
1411 2511248853
1412 2511386032
1413 2516206805
1414 2521561105
1415 2550694713
1416 2553006019
1417 2601671784
1418 2643788711
1419 2643797750
1420 2644213264
1421 2644249618
1422 2644356182
1423 2644470468
1424 2738738828
1425 2738739165
1426 2738825557
1427 2738846399
1428 2739149354
1429 2739191273
1430 2739274952
1431 2739317750
1432 2739335991
1433 2739343996
1434 2765567541
1435 2808983019
1436 2809130538
1437 2809144248
1438 2809149985
1439 2819593818
1440 2819617485
1441 2821134158
1442 2839095120
1443 2842711977
1444 2842717113
1445 2852621796
1446 2857552094
1447 2857559066
1448 2857559491
1449 2857565972
1450 2884812155
1451 2884839646
1452 2884856543
1453 2896158909
1454 2904428037
1455 2904429028
1456 2904442263
1457 2904533542
1458 2904586497
1459 2904591690
1460 2904602157
1461 2919051181
1462 2919083504
1463 2919479169
1464 2923514943
1465 2928133569
1466 2932413834
1467 2932417894
1468 8047679055

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

174

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9426 6 224
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9419 3 220
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9376 6 222
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9374 6 224
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9347 6 222
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9856 5 243 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9696 5 243 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9368 4 211 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9364 6 236 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9344 4 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3A8F6D6-F1-model_v4 ABC transporter ATP-binding protein 0.9823 2 254 GO:0005524
GO:0016887
AF-A0A1Q6DVK8-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component 0.9809 6 245 GO:0005524
GO:0016887
AF-A0A534WP09-F1-model_v4 ABC transporter ATP-binding protein 0.9771 1 256 GO:0005524
GO:0016887
AF-A0A1Q6XDC8-F1-model_v4 Nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein 0.9755 2 257 GO:0005524
GO:0016887
AF-A0A858WY56-F1-model_v4 ABC transporter ATP-binding protein 0.9752 2 253 GO:0005524
GO:0016887

Map