F478142
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 237 | 734 | 492 |
Family's Representative Sequence
| Representative Sequence | 3300025292|Ga0209676_1000273|Ga0209676_100027381 |
| Length | 519 |
| Sequence | VSAAGAQRAGNEGHSSTILTGTTLLLAGVVLAVSNFMVVLDTTIANVSVAHIAGGLGISSSEGTWVITSYAVAEAICVPLTGWLSRRLGTVKLFAGGMLGFGIFSFLCGTATSLTMLIAFRIGQGICGGPLMALSQTLLLRVFPKDKHAMTMGIWAMTTLTAPIFGPILGGTISDSWGWHWIFFINVPVAAICAFTAWTVLRKAETEKVSEPVDGFGLVLLVLWVGALQLMLDLGREHDWFSADIIIQLAIIAIVGFASFLIWELTADKPVVDLRPFRHRGFTVSVIALVFAYGTFFASLVVIPQWLQGAMGYTATWAGYATAFNGVAAVLMAPIVAKRMTEVDPRRLVFIGVLWLAGTSLLRVFWWNSGSDFWTLALPQLIQGAGMPFFFVPLTTIALGAVDEEETASAAGVMNFLRTMAGAVAVAISTTLWYDGAQEKRDGLSGVLHGTQAAIDGMMAKGYSLEQARLIVSQMVDKEATALATGQTFVWAAFVFAAAASIIWLAPRPTRAVDTSSVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 180 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 181 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 182 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 183 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 184 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 228 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 231 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 232 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 233 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 234 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 235 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 236 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3 |
| Nodule | 0 |
| Rhizoplane | 2.45 |
| Rhizosphere | 93.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001268 | 3300001904 | Bacteria | 4640 |
| 2 | JGI24736J21556_1002566 | 3300001904 | Bacteria | 3200 |
| 3 | JGI24741J21665_1008183 | 3300001915 | Bacteria | 1985 |
| 4 | JGI24740J21852_10000395 | 3300001979 | Bacteria | 18718 |
| 5 | JGI24740J21852_10023866 | 3300001979 | Bacteria | 2082 |
| 6 | JGI24740J21852_10025113 | 3300001979 | Bacteria | 2013 |
| 7 | JGI24739J22299_10001257 | 3300001989 | Bacteria | 9505 |
| 8 | JGI24739J22299_10015261 | 3300001989 | Bacteria | 2790 |
| 9 | JGI24739J22299_10018892 | 3300001989 | Bacteria | 2472 |
| 10 | JGI24737J22298_10000051 | 3300001990 | Bacteria | 34099 |
| 11 | JGI24737J22298_10000165 | 3300001990 | Bacteria | 21156 |
| 12 | JGI24737J22298_10004914 | 3300001990 | Bacteria | 4634 |
| 13 | JGI24743J22301_10004952 | 3300001991 | Bacteria | 2197 |
| 14 | JGI24735J21928_10002842 | 3300002067 | Bacteria | 5972 |
| 15 | JGI24750J21931_1000372 | 3300002070 | Bacteria | 7592 |
| 16 | JGI24748J21848_1000049 | 3300002074 | Bacteria | 56032 |
| 17 | JGI24738J21930_10000027 | 3300002075 | Bacteria | 27178 |
| 18 | JGI24738J21930_10004118 | 3300002075 | Bacteria | 3589 |
| 19 | JGI24749J21850_1000068 | 3300002076 | Bacteria | 18789 |
| 20 | JGI24744J21845_10002683 | 3300002077 | Bacteria | 3628 |
| 21 | JGI24034J26672_10000033 | 3300002239 | Bacteria | 88341 |
| 22 | JGI24751J29686_10000400 | 3300002459 | Bacteria | 14104 |
| 23 | JGI24751J29686_10003332 | 3300002459 | Bacteria | 3239 |
| 24 | rootH2_10040129 | 3300003320 | Bacteria | 3170 |
| 25 | Ga0055531_10000021 | 3300003794 | Bacteria | 167213 |
| 26 | Ga0065707_10082133 | 3300005295 | Bacteria | 21190 |
| 27 | Ga0065707_10089113 | 3300005295 | Bacteria | 4466 |
| 28 | Ga0065707_10096768 | 3300005295 | Bacteria | 3235 |
| 29 | Ga0070658_10004633 | 3300005327 | Bacteria | 11178 |
| 30 | Ga0070658_10033056 | 3300005327 | Bacteria | 4160 |
| 31 | Ga0070658_10052651 | 3300005327 | Bacteria | 3302 |
| 32 | Ga0070658_10055565 | 3300005327 | Bacteria | 3216 |
| 33 | Ga0070658_10112571 | 3300005327 | Bacteria | 2256 |
| 34 | Ga0070658_10131856 | 3300005327 | Bacteria | 2083 |
| 35 | Ga0070676_10004834 | 3300005328 | Bacteria | 7128 |
| 36 | Ga0070676_10043886 | 3300005328 | Bacteria | 2600 |
| 37 | Ga0070683_100020582 | 3300005329 | Bacteria | 5871 |
| 38 | Ga0070683_100206723 | 3300005329 | Bacteria | 1865 |
| 39 | Ga0070690_100000014 | 3300005330 | Bacteria | 87494 |
| 40 | Ga0070690_100013207 | 3300005330 | Bacteria | 4876 |
| 41 | Ga0070670_100000047 | 3300005331 | Bacteria | 136625 |
| 42 | Ga0070670_100006640 | 3300005331 | Bacteria | 9806 |
| 43 | Ga0070670_100012044 | 3300005331 | Bacteria | 7399 |
| 44 | Ga0070670_100117212 | 3300005331 | Bacteria | 2297 |
| 45 | Ga0070670_100129327 | 3300005331 | Bacteria | 2180 |
| 46 | Ga0070677_10000829 | 3300005333 | Bacteria | 10143 |
| 47 | Ga0068869_100001996 | 3300005334 | Bacteria | 12259 |
| 48 | Ga0070666_10000027 | 3300005335 | Bacteria | 151010 |
| 49 | Ga0070666_10024010 | 3300005335 | Bacteria | 3970 |
| 50 | Ga0070666_10053109 | 3300005335 | Bacteria | 2732 |
| 51 | Ga0070666_10057578 | 3300005335 | Bacteria | 2626 |
| 52 | Ga0070666_10059332 | 3300005335 | Bacteria | 2588 |
| 53 | Ga0070680_100007272 | 3300005336 | Bacteria | 8438 |
| 54 | Ga0070682_100016005 | 3300005337 | Bacteria | 4355 |
| 55 | Ga0070682_100103904 | 3300005337 | Bacteria | 1881 |
| 56 | Ga0068868_100020578 | 3300005338 | Bacteria | 4960 |
| 57 | Ga0068868_100032545 | 3300005338 | Bacteria | 4012 |
| 58 | Ga0070660_100000767 | 3300005339 | Bacteria | 21303 |
| 59 | Ga0070660_100021183 | 3300005339 | Bacteria | 4790 |
| 60 | Ga0070660_100023164 | 3300005339 | Bacteria | 4599 |
| 61 | Ga0070660_100038535 | 3300005339 | Bacteria | 3629 |
| 62 | Ga0070660_100075152 | 3300005339 | Bacteria | 2645 |
| 63 | Ga0070689_100001657 | 3300005340 | Bacteria | 14241 |
| 64 | Ga0070689_100050373 | 3300005340 | Bacteria | 3217 |
| 65 | Ga0070691_10003231 | 3300005341 | Bacteria | 7305 |
| 66 | Ga0070661_100006327 | 3300005344 | Bacteria | 8169 |
| 67 | Ga0070661_100007808 | 3300005344 | Bacteria | 7385 |
| 68 | Ga0070661_100014597 | 3300005344 | Bacteria | 5538 |
| 69 | Ga0070661_100024568 | 3300005344 | Bacteria | 4322 |
| 70 | Ga0070661_100032766 | 3300005344 | Bacteria | 3762 |
| 71 | Ga0070661_100043650 | 3300005344 | Bacteria | 3275 |
| 72 | Ga0070668_100006365 | 3300005347 | Bacteria | 8747 |
| 73 | Ga0070668_100018826 | 3300005347 | Bacteria | 5187 |
| 74 | Ga0070668_100033901 | 3300005347 | Bacteria | 3890 |
| 75 | Ga0070668_100072193 | 3300005347 | Bacteria | 2689 |
| 76 | Ga0070668_100123140 | 3300005347 | Bacteria | 2075 |
| 77 | Ga0070669_100000099 | 3300005353 | Bacteria | 85328 |
| 78 | Ga0070669_100000162 | 3300005353 | Bacteria | 58781 |
| 79 | Ga0070669_100000699 | 3300005353 | Bacteria | 24602 |
| 80 | Ga0070669_100005466 | 3300005353 | Bacteria | 9170 |
| 81 | Ga0070669_100014681 | 3300005353 | Bacteria | 5575 |
| 82 | Ga0070675_100003584 | 3300005354 | Bacteria | 11805 |
| 83 | Ga0070675_100012015 | 3300005354 | Bacteria | 6788 |
| 84 | Ga0070675_100149121 | 3300005354 | Bacteria | 2004 |
| 85 | Ga0070671_100003886 | 3300005355 | Bacteria | 11743 |
| 86 | Ga0070671_100007605 | 3300005355 | Bacteria | 8666 |
| 87 | Ga0070671_100018586 | 3300005355 | Bacteria | 5647 |
| 88 | Ga0070671_100018748 | 3300005355 | Bacteria | 5624 |
| 89 | Ga0070671_100022038 | 3300005355 | Bacteria | 5204 |
| 90 | Ga0070671_100022628 | 3300005355 | Bacteria | 5134 |
| 91 | Ga0070671_100107298 | 3300005355 | Bacteria | 2345 |
| 92 | Ga0070674_100003989 | 3300005356 | Bacteria | 8364 |
| 93 | Ga0070674_100028068 | 3300005356 | Bacteria | 3694 |
| 94 | Ga0070673_100003743 | 3300005364 | Bacteria | 9537 |
| 95 | Ga0070673_100009898 | 3300005364 | Bacteria | 6423 |
| 96 | Ga0070673_100072205 | 3300005364 | Bacteria | 2775 |
| 97 | Ga0070659_100000753 | 3300005366 | Bacteria | 23494 |
| 98 | Ga0070659_100027561 | 3300005366 | Bacteria | 4379 |
| 99 | Ga0070659_100030220 | 3300005366 | Bacteria | 4191 |
| 100 | Ga0070659_100036766 | 3300005366 | Bacteria | 3817 |
| 101 | Ga0070659_100044578 | 3300005366 | Bacteria | 3473 |
| 102 | Ga0070659_100051876 | 3300005366 | Bacteria | 3225 |
| 103 | Ga0070667_100001558 | 3300005367 | Bacteria | 20556 |
| 104 | Ga0070667_100001726 | 3300005367 | Bacteria | 19526 |
| 105 | Ga0070667_100004197 | 3300005367 | Bacteria | 12165 |
| 106 | Ga0070667_100006262 | 3300005367 | Bacteria | 9895 |
| 107 | Ga0070667_100026747 | 3300005367 | Bacteria | 4800 |
| 108 | Ga0070714_100041839 | 3300005435 | Bacteria | 3868 |
| 109 | Ga0070714_100096013 | 3300005435 | Bacteria | 2604 |
| 110 | Ga0070694_100041086 | 3300005444 | Bacteria | 3083 |
| 111 | Ga0070663_100007411 | 3300005455 | Bacteria | 6676 |
| 112 | Ga0070663_100048258 | 3300005455 | Bacteria | 3018 |
| 113 | Ga0070663_100066749 | 3300005455 | Bacteria | 2607 |
| 114 | Ga0070663_100083195 | 3300005455 | Bacteria | 2356 |
| 115 | Ga0070678_100013659 | 3300005456 | Bacteria | 5101 |
| 116 | Ga0070662_100002248 | 3300005457 | Bacteria | 11841 |
| 117 | Ga0070662_100032902 | 3300005457 | Bacteria | 3648 |
| 118 | Ga0070662_100034495 | 3300005457 | Bacteria | 3568 |
| 119 | Ga0070662_100115658 | 3300005457 | Bacteria | 2049 |
| 120 | Ga0068867_100011915 | 3300005459 | Bacteria | 6142 |
| 121 | Ga0070685_10000101 | 3300005466 | Bacteria | 54043 |
| 122 | Ga0068853_100006221 | 3300005539 | Bacteria | 9456 |
| 123 | Ga0068853_100007344 | 3300005539 | Bacteria | 8818 |
| 124 | Ga0068853_100036633 | 3300005539 | Bacteria | 4173 |
| 125 | Ga0068853_100094723 | 3300005539 | Bacteria | 2631 |
| 126 | Ga0070672_100000234 | 3300005543 | Bacteria | 31015 |
| 127 | Ga0070672_100001207 | 3300005543 | Bacteria | 15822 |
| 128 | Ga0070672_100155391 | 3300005543 | Bacteria | 1894 |
| 129 | Ga0070686_100000010 | 3300005544 | Bacteria | 192116 |
| 130 | Ga0070665_100000254 | 3300005548 | Bacteria | 88587 |
| 131 | Ga0070665_100003744 | 3300005548 | Bacteria | 16104 |
| 132 | Ga0070665_100011289 | 3300005548 | Bacteria | 9034 |
| 133 | Ga0070665_100016958 | 3300005548 | Bacteria | 7303 |
| 134 | Ga0070665_100018536 | 3300005548 | Bacteria | 6975 |
| 135 | Ga0070665_100030502 | 3300005548 | Bacteria | 5424 |
| 136 | Ga0070665_100097864 | 3300005548 | Bacteria | 2939 |
| 137 | Ga0070665_100177255 | 3300005548 | Bacteria | 2132 |
| 138 | Ga0068855_100001164 | 3300005563 | Bacteria | 32603 |
| 139 | Ga0068855_100001723 | 3300005563 | Bacteria | 27344 |
| 140 | Ga0068855_100003156 | 3300005563 | Bacteria | 20171 |
| 141 | Ga0068855_100056306 | 3300005563 | Bacteria | 4614 |
| 142 | Ga0070664_100002457 | 3300005564 | Bacteria | 14923 |
| 143 | Ga0070664_100002747 | 3300005564 | Bacteria | 14203 |
| 144 | Ga0070664_100007368 | 3300005564 | Bacteria | 8872 |
| 145 | Ga0070664_100007907 | 3300005564 | Bacteria | 8589 |
| 146 | Ga0070664_100040646 | 3300005564 | Bacteria | 3921 |
| 147 | Ga0068857_100003650 | 3300005577 | Bacteria | 12902 |
| 148 | Ga0068857_100004327 | 3300005577 | Bacteria | 11979 |
| 149 | Ga0068857_100005444 | 3300005577 | Bacteria | 10855 |
| 150 | Ga0068857_100007919 | 3300005577 | Bacteria | 9169 |
| 151 | Ga0068857_100013071 | 3300005577 | Bacteria | 7233 |
| 152 | Ga0068857_100037783 | 3300005577 | Bacteria | 4278 |
| 153 | Ga0068857_100064545 | 3300005577 | Bacteria | 3256 |
| 154 | Ga0068857_100084161 | 3300005577 | Bacteria | 2842 |
| 155 | Ga0068854_100000061 | 3300005578 | Bacteria | 78663 |
| 156 | Ga0068854_100001151 | 3300005578 | Bacteria | 15907 |
| 157 | Ga0068854_100004904 | 3300005578 | Bacteria | 8442 |
| 158 | Ga0068854_100005672 | 3300005578 | Bacteria | 7888 |
| 159 | Ga0068854_100010327 | 3300005578 | Bacteria | 6050 |
| 160 | Ga0068854_100025690 | 3300005578 | Bacteria | 4041 |
| 161 | Ga0068854_100027723 | 3300005578 | Bacteria | 3907 |
| 162 | Ga0068854_100076804 | 3300005578 | Bacteria | 2456 |
| 163 | Ga0068856_100000449 | 3300005614 | Bacteria | 45445 |
| 164 | Ga0068856_100004411 | 3300005614 | Bacteria | 14026 |
| 165 | Ga0068856_100046595 | 3300005614 | Bacteria | 4270 |
| 166 | Ga0068856_100058084 | 3300005614 | Bacteria | 3821 |
| 167 | Ga0068856_100090626 | 3300005614 | Bacteria | 3041 |
| 168 | Ga0068852_100000847 | 3300005616 | Bacteria | 20320 |
| 169 | Ga0068852_100001197 | 3300005616 | Bacteria | 17227 |
| 170 | Ga0068852_100013939 | 3300005616 | Bacteria | 6165 |
| 171 | Ga0068852_100024513 | 3300005616 | Bacteria | 4877 |
| 172 | Ga0068859_100000324 | 3300005617 | Bacteria | 47483 |
| 173 | Ga0068859_100003001 | 3300005617 | Bacteria | 17114 |
| 174 | Ga0068859_100011614 | 3300005617 | Bacteria | 8858 |
| 175 | Ga0068859_100024123 | 3300005617 | Bacteria | 6104 |
| 176 | Ga0068859_100024318 | 3300005617 | Bacteria | 6079 |
| 177 | Ga0068859_100025027 | 3300005617 | Bacteria | 5992 |
| 178 | Ga0068859_100037329 | 3300005617 | Bacteria | 4876 |
| 179 | Ga0068859_100069451 | 3300005617 | Bacteria | 3558 |
| 180 | Ga0068859_100086978 | 3300005617 | Bacteria | 3172 |
| 181 | Ga0068859_100101242 | 3300005617 | Bacteria | 2938 |
| 182 | Ga0068864_100000051 | 3300005618 | Bacteria | 136621 |
| 183 | Ga0068864_100000743 | 3300005618 | Bacteria | 27310 |
| 184 | Ga0068864_100002131 | 3300005618 | Bacteria | 16369 |
| 185 | Ga0068864_100002488 | 3300005618 | Bacteria | 15223 |
| 186 | Ga0068864_100007461 | 3300005618 | Bacteria | 9008 |
| 187 | Ga0068864_100024966 | 3300005618 | Bacteria | 5029 |
| 188 | Ga0068864_100118777 | 3300005618 | Bacteria | 2361 |
| 189 | Ga0068861_100011286 | 3300005719 | Bacteria | 6204 |
| 190 | Ga0068861_100023488 | 3300005719 | Bacteria | 4448 |
| 191 | Ga0068861_100066733 | 3300005719 | Bacteria | 2774 |
| 192 | Ga0068861_100072992 | 3300005719 | Bacteria | 2664 |
| 193 | Ga0068851_10014735 | 3300005834 | Bacteria | 3716 |
| 194 | Ga0068851_10019078 | 3300005834 | Bacteria | 3313 |
| 195 | Ga0068851_10022284 | 3300005834 | Bacteria | 3083 |
| 196 | Ga0068863_100000214 | 3300005841 | Bacteria | 62106 |
| 197 | Ga0068863_100006673 | 3300005841 | Bacteria | 11329 |
| 198 | Ga0068863_100007339 | 3300005841 | Bacteria | 10790 |
| 199 | Ga0068863_100069572 | 3300005841 | Bacteria | 3328 |
| 200 | Ga0068858_100001674 | 3300005842 | Bacteria | 22661 |
| 201 | Ga0068858_100006175 | 3300005842 | Bacteria | 11685 |
| 202 | Ga0068858_100006917 | 3300005842 | Bacteria | 11021 |
| 203 | Ga0068858_100007137 | 3300005842 | Bacteria | 10853 |
| 204 | Ga0068858_100007575 | 3300005842 | Bacteria | 10488 |
| 205 | Ga0068858_100024881 | 3300005842 | Bacteria | 5574 |
| 206 | Ga0068858_100037115 | 3300005842 | Bacteria | 4517 |
| 207 | Ga0068858_100038487 | 3300005842 | Bacteria | 4436 |
| 208 | Ga0068858_100040082 | 3300005842 | Bacteria | 4343 |
| 209 | Ga0068858_100051634 | 3300005842 | Bacteria | 3804 |
| 210 | Ga0068860_100000080 | 3300005843 | Bacteria | 170152 |
| 211 | Ga0068860_100000353 | 3300005843 | Bacteria | 61803 |
| 212 | Ga0068860_100009742 | 3300005843 | Bacteria | 9538 |
| 213 | Ga0068860_100011757 | 3300005843 | Bacteria | 8626 |
| 214 | Ga0068860_100014764 | 3300005843 | Bacteria | 7639 |
| 215 | Ga0068860_100032025 | 3300005843 | Bacteria | 5055 |
| 216 | Ga0068860_100059152 | 3300005843 | Bacteria | 3644 |
| 217 | Ga0068860_100107896 | 3300005843 | Bacteria | 2661 |
| 218 | Ga0068860_100222950 | 3300005843 | Bacteria | 1831 |
| 219 | Ga0068862_100000036 | 3300005844 | Bacteria | 173453 |
| 220 | Ga0068862_100000198 | 3300005844 | Bacteria | 66534 |
| 221 | Ga0068862_100000357 | 3300005844 | Bacteria | 49510 |
| 222 | Ga0068862_100018625 | 3300005844 | Bacteria | 5784 |
| 223 | Ga0068862_100023491 | 3300005844 | Bacteria | 5167 |
| 224 | Ga0068862_100028554 | 3300005844 | Bacteria | 4699 |
| 225 | Ga0068862_100035008 | 3300005844 | Bacteria | 4250 |
| 226 | Ga0068862_100048188 | 3300005844 | Bacteria | 3638 |
| 227 | Ga0068862_100076145 | 3300005844 | Bacteria | 2904 |
| 228 | Ga0081455_10000564 | 3300005937 | Bacteria | 48268 |
| 229 | Ga0081455_10004231 | 3300005937 | Bacteria | 16183 |
| 230 | Ga0081455_10065401 | 3300005937 | Bacteria | 3041 |
| 231 | Ga0081539_10058522 | 3300005985 | Bacteria | 2126 |
| 232 | Ga0075366_10007553 | 3300006195 | Bacteria | 6013 |
| 233 | Ga0097621_100020152 | 3300006237 | Bacteria | 5135 |
| 234 | Ga0097621_100034584 | 3300006237 | Bacteria | 4032 |
| 235 | Ga0097621_100120820 | 3300006237 | Bacteria | 2222 |
| 236 | Ga0097621_100123826 | 3300006237 | Bacteria | 2195 |
| 237 | Ga0075370_10004706 | 3300006353 | Bacteria | 6665 |
| 238 | Ga0075370_10007682 | 3300006353 | Bacteria | 5506 |
| 239 | Ga0068871_100057229 | 3300006358 | Bacteria | 3171 |
| 240 | Ga0075431_100123846 | 3300006847 | Bacteria | 2667 |
| 241 | Ga0068865_100000434 | 3300006881 | Bacteria | 23266 |
| 242 | Ga0068865_100011662 | 3300006881 | Bacteria | 5506 |
| 243 | Ga0068865_100028784 | 3300006881 | Bacteria | 3680 |
| 244 | Ga0097620_100000324 | 3300006931 | Bacteria | 47483 |
| 245 | Ga0097620_100003001 | 3300006931 | Bacteria | 17114 |
| 246 | Ga0097620_100011614 | 3300006931 | Bacteria | 8858 |
| 247 | Ga0097620_100024122 | 3300006931 | Bacteria | 6104 |
| 248 | Ga0097620_100024317 | 3300006931 | Bacteria | 6079 |
| 249 | Ga0097620_100025028 | 3300006931 | Bacteria | 5992 |
| 250 | Ga0097620_100037328 | 3300006931 | Bacteria | 4876 |
| 251 | Ga0097620_100069449 | 3300006931 | Bacteria | 3558 |
| 252 | Ga0097620_100086981 | 3300006931 | Bacteria | 3172 |
| 253 | Ga0097620_100101251 | 3300006931 | Bacteria | 2938 |
| 254 | Ga0105251_10043986 | 3300009011 | Bacteria | 2160 |
| 255 | Ga0105240_10003880 | 3300009093 | Bacteria | 23090 |
| 256 | Ga0105240_10066649 | 3300009093 | Bacteria | 4465 |
| 257 | Ga0105240_10102679 | 3300009093 | Bacteria | 3474 |
| 258 | Ga0105240_10184912 | 3300009093 | Bacteria | 2455 |
| 259 | Ga0105240_10188228 | 3300009093 | Bacteria | 2429 |
| 260 | Ga0105240_10200736 | 3300009093 | Bacteria | 2337 |
| 261 | Ga0105240_10205940 | 3300009093 | Bacteria | 2303 |
| 262 | Ga0105245_10000424 | 3300009098 | Bacteria | 39397 |
| 263 | Ga0105245_10048655 | 3300009098 | Bacteria | 3793 |
| 264 | Ga0105245_10222158 | 3300009098 | Bacteria | 1823 |
| 265 | Ga0105247_10030004 | 3300009101 | Bacteria | 3297 |
| 266 | Ga0105243_10031215 | 3300009148 | Bacteria | 4107 |
| 267 | Ga0105241_10166782 | 3300009174 | Bacteria | 1815 |
| 268 | Ga0105242_10083959 | 3300009176 | Bacteria | 2668 |
| 269 | Ga0105248_10000123 | 3300009177 | Bacteria | 89301 |
| 270 | Ga0105248_10000159 | 3300009177 | Bacteria | 78504 |
| 271 | Ga0105248_10000407 | 3300009177 | Bacteria | 49981 |
| 272 | Ga0105248_10024980 | 3300009177 | Bacteria | 6640 |
| 273 | Ga0105248_10031334 | 3300009177 | Bacteria | 5943 |
| 274 | Ga0105248_10105654 | 3300009177 | Bacteria | 3175 |
| 275 | Ga0105248_10119460 | 3300009177 | Bacteria | 2973 |
| 276 | Ga0105237_10003982 | 3300009545 | Bacteria | 17262 |
| 277 | Ga0105237_10018540 | 3300009545 | Bacteria | 7202 |
| 278 | Ga0105237_10144916 | 3300009545 | Bacteria | 2370 |
| 279 | Ga0105237_10159970 | 3300009545 | Bacteria | 2250 |
| 280 | Ga0105237_10225391 | 3300009545 | Bacteria | 1875 |
| 281 | Ga0105238_10018232 | 3300009551 | Bacteria | 7139 |
| 282 | Ga0105238_10052066 | 3300009551 | Bacteria | 4116 |
| 283 | Ga0105238_10053533 | 3300009551 | Bacteria | 4055 |
| 284 | Ga0105238_10069566 | 3300009551 | Bacteria | 3520 |
| 285 | Ga0105238_10096252 | 3300009551 | Bacteria | 2946 |
| 286 | Ga0105238_10145698 | 3300009551 | Bacteria | 2345 |
| 287 | Ga0105249_10000015 | 3300009553 | Bacteria | 282138 |
| 288 | Ga0105249_10000064 | 3300009553 | Bacteria | 151646 |
| 289 | Ga0105249_10011234 | 3300009553 | Bacteria | 7862 |
| 290 | Ga0105249_10019672 | 3300009553 | Bacteria | 6026 |
| 291 | Ga0105239_10002388 | 3300010375 | Bacteria | 23941 |
| 292 | Ga0105239_10019413 | 3300010375 | Bacteria | 7505 |
| 293 | Ga0105239_10051754 | 3300010375 | Bacteria | 4502 |
| 294 | Ga0105239_10114796 | 3300010375 | Bacteria | 2987 |
| 295 | Ga0105239_10153247 | 3300010375 | Bacteria | 2573 |
| 296 | Ga0105239_10265085 | 3300010375 | Bacteria | 1931 |
| 297 | Ga0105246_10003940 | 3300011119 | Bacteria | 8995 |
| 298 | Ga0157373_10012675 | 3300013100 | Bacteria | 6197 |
| 299 | Ga0157371_10003598 | 3300013102 | Bacteria | 13964 |
| 300 | Ga0157371_10013675 | 3300013102 | Bacteria | 6157 |
| 301 | Ga0157370_10005586 | 3300013104 | Bacteria | 14085 |
| 302 | Ga0157370_10014806 | 3300013104 | Bacteria | 7959 |
| 303 | Ga0157370_10027355 | 3300013104 | Bacteria | 5624 |
| 304 | Ga0157370_10030792 | 3300013104 | Bacteria | 5255 |
| 305 | Ga0157370_10054688 | 3300013104 | Bacteria | 3805 |
| 306 | Ga0157370_10092659 | 3300013104 | Bacteria | 2836 |
| 307 | Ga0157370_10232362 | 3300013104 | Bacteria | 1706 |
| 308 | Ga0157369_10000385 | 3300013105 | Bacteria | 58590 |
| 309 | Ga0157369_10012084 | 3300013105 | Bacteria | 9804 |
| 310 | Ga0157369_10016507 | 3300013105 | Bacteria | 8303 |
| 311 | Ga0157369_10034107 | 3300013105 | Bacteria | 5588 |
| 312 | Ga0157378_10000018 | 3300013297 | Bacteria | 134075 |
| 313 | Ga0157378_10006264 | 3300013297 | Bacteria | 10415 |
| 314 | Ga0157378_10022160 | 3300013297 | Bacteria | 5590 |
| 315 | Ga0157378_10083214 | 3300013297 | Bacteria | 2895 |
| 316 | Ga0163162_10002274 | 3300013306 | Bacteria | 18032 |
| 317 | Ga0163162_10013200 | 3300013306 | Bacteria | 8067 |
| 318 | Ga0163162_10058690 | 3300013306 | Bacteria | 3878 |
| 319 | Ga0163162_10187894 | 3300013306 | Bacteria | 2193 |
| 320 | Ga0157372_10061043 | 3300013307 | Bacteria | 4220 |
| 321 | Ga0157372_10068118 | 3300013307 | Bacteria | 4002 |
| 322 | Ga0157372_10099151 | 3300013307 | Bacteria | 3323 |
| 323 | Ga0157372_10180763 | 3300013307 | Bacteria | 2442 |
| 324 | Ga0157372_10188569 | 3300013307 | Bacteria | 2388 |
| 325 | Ga0157375_10064297 | 3300013308 | Bacteria | 3653 |
| 326 | Ga0157375_10081028 | 3300013308 | Bacteria | 3285 |
| 327 | Ga0163163_10000265 | 3300014325 | Bacteria | 52453 |
| 328 | Ga0163163_10013362 | 3300014325 | Bacteria | 7515 |
| 329 | Ga0163163_10103722 | 3300014325 | Bacteria | 2868 |
| 330 | Ga0157380_10000332 | 3300014326 | Bacteria | 28459 |
| 331 | Ga0157379_10001201 | 3300014968 | Bacteria | 21082 |
| 332 | Ga0157379_10015227 | 3300014968 | Bacteria | 6744 |
| 333 | Ga0157376_10044100 | 3300014969 | Bacteria | 3664 |
| 334 | Ga0163161_10000110 | 3300017792 | Bacteria | 78102 |
| 335 | Ga0207672_1000729 | 3300025223 | Bacteria | 3662 |
| 336 | Ga0209759_1011916 | 3300025256 | Bacteria | 2438 |
| 337 | Ga0209676_1000273 | 3300025292 | Bacteria | 107724 |
| 338 | Ga0209676_1009644 | 3300025292 | Bacteria | 4137 |
| 339 | Ga0209025_1020025 | 3300025294 | Bacteria | 3683 |
| 340 | Ga0209051_1004538 | 3300025303 | Bacteria | 8511 |
| 341 | Ga0209051_1009617 | 3300025303 | Bacteria | 4964 |
| 342 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 343 | Ga0209257_1000458 | 3300025304 | Bacteria | 75709 |
| 344 | Ga0207697_10002358 | 3300025315 | Bacteria | 9839 |
| 345 | Ga0207697_10002531 | 3300025315 | Bacteria | 9422 |
| 346 | Ga0207656_10019188 | 3300025321 | Bacteria | 2703 |
| 347 | Ga0207682_10003777 | 3300025893 | Bacteria | 6502 |
| 348 | Ga0207710_10014589 | 3300025900 | Bacteria | 3316 |
| 349 | Ga0207688_10000018 | 3300025901 | Bacteria | 51641 |
| 350 | Ga0207688_10024275 | 3300025901 | Bacteria | 3324 |
| 351 | Ga0207688_10026512 | 3300025901 | Bacteria | 3187 |
| 352 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 353 | Ga0207680_10012998 | 3300025903 | Bacteria | 4259 |
| 354 | Ga0207647_10000232 | 3300025904 | Bacteria | 46114 |
| 355 | Ga0207647_10000333 | 3300025904 | Bacteria | 38836 |
| 356 | Ga0207647_10001648 | 3300025904 | Bacteria | 17173 |
| 357 | Ga0207647_10013372 | 3300025904 | Bacteria | 5693 |
| 358 | Ga0207647_10014933 | 3300025904 | Bacteria | 5336 |
| 359 | Ga0207647_10021572 | 3300025904 | Bacteria | 4298 |
| 360 | Ga0207647_10024185 | 3300025904 | Bacteria | 4007 |
| 361 | Ga0207647_10033137 | 3300025904 | Bacteria | 3311 |
| 362 | Ga0207647_10056231 | 3300025904 | Bacteria | 2414 |
| 363 | Ga0207645_10008012 | 3300025907 | Bacteria | 7410 |
| 364 | Ga0207645_10082577 | 3300025907 | Bacteria | 2060 |
| 365 | Ga0207643_10055164 | 3300025908 | Bacteria | 2259 |
| 366 | Ga0207705_10000059 | 3300025909 | Bacteria | 155683 |
| 367 | Ga0207705_10001692 | 3300025909 | Bacteria | 17538 |
| 368 | Ga0207705_10016137 | 3300025909 | Bacteria | 5360 |
| 369 | Ga0207705_10089454 | 3300025909 | Bacteria | 2253 |
| 370 | Ga0207654_10008896 | 3300025911 | Bacteria | 5093 |
| 371 | Ga0207654_10027098 | 3300025911 | Bacteria | 3112 |
| 372 | Ga0207654_10079171 | 3300025911 | Bacteria | 1974 |
| 373 | Ga0207695_10011197 | 3300025913 | Bacteria | 10882 |
| 374 | Ga0207695_10021396 | 3300025913 | Bacteria | 7378 |
| 375 | Ga0207695_10048837 | 3300025913 | Bacteria | 4466 |
| 376 | Ga0207671_10000841 | 3300025914 | Bacteria | 38929 |
| 377 | Ga0207671_10033115 | 3300025914 | Bacteria | 3846 |
| 378 | Ga0207671_10071063 | 3300025914 | Bacteria | 2596 |
| 379 | Ga0207657_10003142 | 3300025919 | Bacteria | 17669 |
| 380 | Ga0207657_10004185 | 3300025919 | Bacteria | 15290 |
| 381 | Ga0207657_10008595 | 3300025919 | Bacteria | 10342 |
| 382 | Ga0207657_10008817 | 3300025919 | Bacteria | 10202 |
| 383 | Ga0207657_10009428 | 3300025919 | Bacteria | 9811 |
| 384 | Ga0207657_10030517 | 3300025919 | Bacteria | 4892 |
| 385 | Ga0207657_10051528 | 3300025919 | Bacteria | 3578 |
| 386 | Ga0207657_10066083 | 3300025919 | Bacteria | 3080 |
| 387 | Ga0207649_10004902 | 3300025920 | Bacteria | 7238 |
| 388 | Ga0207649_10008761 | 3300025920 | Bacteria | 5523 |
| 389 | Ga0207649_10017197 | 3300025920 | Bacteria | 4097 |
| 390 | Ga0207649_10030987 | 3300025920 | Bacteria | 3174 |
| 391 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 392 | Ga0207681_10001180 | 3300025923 | Bacteria | 16821 |
| 393 | Ga0207681_10001989 | 3300025923 | Bacteria | 13129 |
| 394 | Ga0207694_10002118 | 3300025924 | Bacteria | 16344 |
| 395 | Ga0207694_10005478 | 3300025924 | Bacteria | 9751 |
| 396 | Ga0207694_10023373 | 3300025924 | Bacteria | 4692 |
| 397 | Ga0207694_10038326 | 3300025924 | Bacteria | 3685 |
| 398 | Ga0207694_10103667 | 3300025924 | Bacteria | 2256 |
| 399 | Ga0207650_10000038 | 3300025925 | Bacteria | 206081 |
| 400 | Ga0207650_10014405 | 3300025925 | Bacteria | 5497 |
| 401 | Ga0207650_10032714 | 3300025925 | Bacteria | 3763 |
| 402 | Ga0207650_10099346 | 3300025925 | Bacteria | 2237 |
| 403 | Ga0207659_10007405 | 3300025926 | Bacteria | 6746 |
| 404 | Ga0207687_10012203 | 3300025927 | Bacteria | 5619 |
| 405 | Ga0207664_10033267 | 3300025929 | Bacteria | 3959 |
| 406 | Ga0207644_10000512 | 3300025931 | Bacteria | 25021 |
| 407 | Ga0207644_10007430 | 3300025931 | Bacteria | 7142 |
| 408 | Ga0207644_10013409 | 3300025931 | Bacteria | 5462 |
| 409 | Ga0207644_10016807 | 3300025931 | Bacteria | 4928 |
| 410 | Ga0207644_10041587 | 3300025931 | Bacteria | 3252 |
| 411 | Ga0207690_10014349 | 3300025932 | Bacteria | 4786 |
| 412 | Ga0207706_10000171 | 3300025933 | Bacteria | 72122 |
| 413 | Ga0207706_10002226 | 3300025933 | Bacteria | 18934 |
| 414 | Ga0207706_10002480 | 3300025933 | Bacteria | 17985 |
| 415 | Ga0207706_10006168 | 3300025933 | Bacteria | 11130 |
| 416 | Ga0207706_10019005 | 3300025933 | Bacteria | 6181 |
| 417 | Ga0207706_10046960 | 3300025933 | Bacteria | 3822 |
| 418 | Ga0207706_10111062 | 3300025933 | Bacteria | 2412 |
| 419 | Ga0207686_10071119 | 3300025934 | Bacteria | 2238 |
| 420 | Ga0207709_10028961 | 3300025935 | Bacteria | 3206 |
| 421 | Ga0207709_10054348 | 3300025935 | Bacteria | 2469 |
| 422 | Ga0207670_10022219 | 3300025936 | Bacteria | 3929 |
| 423 | Ga0207669_10050360 | 3300025937 | Bacteria | 2489 |
| 424 | Ga0207704_10001207 | 3300025938 | Bacteria | 11520 |
| 425 | Ga0207704_10067513 | 3300025938 | Bacteria | 2250 |
| 426 | Ga0207691_10000070 | 3300025940 | Bacteria | 84000 |
| 427 | Ga0207691_10000442 | 3300025940 | Bacteria | 41154 |
| 428 | Ga0207691_10012078 | 3300025940 | Bacteria | 8282 |
| 429 | Ga0207691_10034316 | 3300025940 | Bacteria | 4718 |
| 430 | Ga0207711_10000100 | 3300025941 | Bacteria | 91024 |
| 431 | Ga0207711_10000607 | 3300025941 | Bacteria | 36172 |
| 432 | Ga0207711_10002610 | 3300025941 | Bacteria | 16002 |
| 433 | Ga0207711_10009352 | 3300025941 | Bacteria | 8184 |
| 434 | Ga0207711_10012993 | 3300025941 | Bacteria | 6918 |
| 435 | Ga0207711_10059979 | 3300025941 | Bacteria | 3277 |
| 436 | Ga0207711_10086011 | 3300025941 | Bacteria | 2756 |
| 437 | Ga0207689_10000123 | 3300025942 | Bacteria | 64762 |
| 438 | Ga0207689_10008724 | 3300025942 | Bacteria | 8822 |
| 439 | Ga0207689_10017657 | 3300025942 | Bacteria | 6030 |
| 440 | Ga0207679_10002516 | 3300025945 | Bacteria | 11298 |
| 441 | Ga0207679_10017882 | 3300025945 | Bacteria | 4739 |
| 442 | Ga0207679_10132261 | 3300025945 | Bacteria | 2003 |
| 443 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 444 | Ga0207667_10000503 | 3300025949 | Bacteria | 51606 |
| 445 | Ga0207667_10011731 | 3300025949 | Bacteria | 10164 |
| 446 | Ga0207667_10021710 | 3300025949 | Bacteria | 7112 |
| 447 | Ga0207667_10030020 | 3300025949 | Bacteria | 5887 |
| 448 | Ga0207667_10048962 | 3300025949 | Bacteria | 4466 |
| 449 | Ga0207667_10094862 | 3300025949 | Bacteria | 3080 |
| 450 | Ga0207651_10000332 | 3300025960 | Bacteria | 20079 |
| 451 | Ga0207651_10033606 | 3300025960 | Bacteria | 3310 |
| 452 | Ga0207651_10081205 | 3300025960 | Bacteria | 2336 |
| 453 | Ga0207712_10000023 | 3300025961 | Bacteria | 282081 |
| 454 | Ga0207712_10000044 | 3300025961 | Bacteria | 171240 |
| 455 | Ga0207712_10000873 | 3300025961 | Bacteria | 21920 |
| 456 | Ga0207668_10002284 | 3300025972 | Bacteria | 11190 |
| 457 | Ga0207668_10006304 | 3300025972 | Bacteria | 7012 |
| 458 | Ga0207668_10067676 | 3300025972 | Bacteria | 2536 |
| 459 | Ga0207640_10002840 | 3300025981 | Bacteria | 9291 |
| 460 | Ga0207640_10006873 | 3300025981 | Bacteria | 6257 |
| 461 | Ga0207640_10034778 | 3300025981 | Bacteria | 3147 |
| 462 | Ga0207640_10035086 | 3300025981 | Bacteria | 3136 |
| 463 | Ga0207640_10048529 | 3300025981 | Bacteria | 2745 |
| 464 | Ga0207640_10070849 | 3300025981 | Bacteria | 2346 |
| 465 | Ga0207640_10099237 | 3300025981 | Bacteria | 2038 |
| 466 | Ga0207640_10113553 | 3300025981 | Bacteria | 1925 |
| 467 | Ga0207658_10000592 | 3300025986 | Bacteria | 32483 |
| 468 | Ga0207658_10001131 | 3300025986 | Bacteria | 21482 |
| 469 | Ga0207658_10001592 | 3300025986 | Bacteria | 17502 |
| 470 | Ga0207658_10048397 | 3300025986 | Bacteria | 3117 |
| 471 | Ga0207658_10052764 | 3300025986 | Bacteria | 3001 |
| 472 | Ga0207677_10016237 | 3300026023 | Bacteria | 4403 |
| 473 | Ga0207677_10070670 | 3300026023 | Bacteria | 2461 |
| 474 | Ga0207703_10001186 | 3300026035 | Bacteria | 24509 |
| 475 | Ga0207703_10002719 | 3300026035 | Bacteria | 15153 |
| 476 | Ga0207703_10005654 | 3300026035 | Bacteria | 10038 |
| 477 | Ga0207703_10006383 | 3300026035 | Bacteria | 9425 |
| 478 | Ga0207703_10007545 | 3300026035 | Bacteria | 8625 |
| 479 | Ga0207703_10017446 | 3300026035 | Bacteria | 5603 |
| 480 | Ga0207639_10002215 | 3300026041 | Bacteria | 13090 |
| 481 | Ga0207639_10021938 | 3300026041 | Bacteria | 4593 |
| 482 | Ga0207639_10052430 | 3300026041 | Bacteria | 3109 |
| 483 | Ga0207639_10085102 | 3300026041 | Bacteria | 2514 |
| 484 | Ga0207639_10090113 | 3300026041 | Bacteria | 2452 |
| 485 | Ga0207639_10121859 | 3300026041 | Bacteria | 2144 |
| 486 | Ga0207678_10000198 | 3300026067 | Bacteria | 52573 |
| 487 | Ga0207678_10014684 | 3300026067 | Bacteria | 6891 |
| 488 | Ga0207678_10090619 | 3300026067 | Bacteria | 2613 |
| 489 | Ga0207702_10000430 | 3300026078 | Bacteria | 48112 |
| 490 | Ga0207702_10003048 | 3300026078 | Bacteria | 15571 |
| 491 | Ga0207702_10005307 | 3300026078 | Bacteria | 11305 |
| 492 | Ga0207702_10008058 | 3300026078 | Bacteria | 8912 |
| 493 | Ga0207702_10017344 | 3300026078 | Bacteria | 5957 |
| 494 | Ga0207702_10018151 | 3300026078 | Bacteria | 5821 |
| 495 | Ga0207702_10020863 | 3300026078 | Bacteria | 5421 |
| 496 | Ga0207702_10100994 | 3300026078 | Bacteria | 2546 |
| 497 | Ga0207641_10000047 | 3300026088 | Bacteria | 179977 |
| 498 | Ga0207641_10002327 | 3300026088 | Bacteria | 17629 |
| 499 | Ga0207641_10003117 | 3300026088 | Bacteria | 14907 |
| 500 | Ga0207641_10011082 | 3300026088 | Bacteria | 7394 |
| 501 | Ga0207641_10012433 | 3300026088 | Bacteria | 6980 |
| 502 | Ga0207641_10037126 | 3300026088 | Bacteria | 4068 |
| 503 | Ga0207648_10000317 | 3300026089 | Bacteria | 52853 |
| 504 | Ga0207648_10006135 | 3300026089 | Bacteria | 11982 |
| 505 | Ga0207648_10027744 | 3300026089 | Bacteria | 5025 |
| 506 | Ga0207648_10078277 | 3300026089 | Bacteria | 2884 |
| 507 | Ga0207676_10000034 | 3300026095 | Bacteria | 206058 |
| 508 | Ga0207676_10000378 | 3300026095 | Bacteria | 37895 |
| 509 | Ga0207676_10001136 | 3300026095 | Bacteria | 20113 |
| 510 | Ga0207676_10010624 | 3300026095 | Bacteria | 6563 |
| 511 | Ga0207676_10048265 | 3300026095 | Bacteria | 3304 |
| 512 | Ga0207676_10060871 | 3300026095 | Bacteria | 2988 |
| 513 | Ga0207676_10160767 | 3300026095 | Bacteria | 1945 |
| 514 | Ga0207674_10000937 | 3300026116 | Bacteria | 38029 |
| 515 | Ga0207674_10001303 | 3300026116 | Bacteria | 32594 |
| 516 | Ga0207674_10002718 | 3300026116 | Bacteria | 22070 |
| 517 | Ga0207674_10006989 | 3300026116 | Bacteria | 13205 |
| 518 | Ga0207674_10008395 | 3300026116 | Bacteria | 11939 |
| 519 | Ga0207674_10012673 | 3300026116 | Bacteria | 9420 |
| 520 | Ga0207674_10014814 | 3300026116 | Bacteria | 8600 |
| 521 | Ga0207674_10031878 | 3300026116 | Bacteria | 5532 |
| 522 | Ga0207674_10045622 | 3300026116 | Bacteria | 4507 |
| 523 | Ga0207675_100003730 | 3300026118 | Bacteria | 14838 |
| 524 | Ga0207675_100007062 | 3300026118 | Bacteria | 10611 |
| 525 | Ga0207675_100021446 | 3300026118 | Bacteria | 6017 |
| 526 | Ga0207675_100022045 | 3300026118 | Bacteria | 5929 |
| 527 | Ga0207675_100038664 | 3300026118 | Bacteria | 4452 |
| 528 | Ga0207675_100074463 | 3300026118 | Bacteria | 3177 |
| 529 | Ga0207675_100098758 | 3300026118 | Bacteria | 2750 |
| 530 | Ga0207683_10009217 | 3300026121 | Bacteria | 8411 |
| 531 | Ga0207683_10207570 | 3300026121 | Bacteria | 1782 |
| 532 | Ga0207698_10003405 | 3300026142 | Bacteria | 9573 |
| 533 | Ga0207698_10005663 | 3300026142 | Bacteria | 7737 |
| 534 | Ga0207698_10026840 | 3300026142 | Bacteria | 4079 |
| 535 | Ga0207698_10057375 | 3300026142 | Bacteria | 3012 |
| 536 | Ga0207698_10087331 | 3300026142 | Bacteria | 2540 |
| 537 | Ga0268266_10000069 | 3300028379 | Bacteria | 239714 |
| 538 | Ga0268266_10009139 | 3300028379 | Bacteria | 8747 |
| 539 | Ga0268266_10021182 | 3300028379 | Bacteria | 5538 |
| 540 | Ga0268266_10024362 | 3300028379 | Bacteria | 5147 |
| 541 | Ga0268266_10039290 | 3300028379 | Bacteria | 4030 |
| 542 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 543 | Ga0268265_10000052 | 3300028380 | Bacteria | 174254 |
| 544 | Ga0268265_10000197 | 3300028380 | Bacteria | 70306 |
| 545 | Ga0268265_10004932 | 3300028380 | Bacteria | 9179 |
| 546 | Ga0268265_10008194 | 3300028380 | Bacteria | 7059 |
| 547 | Ga0268265_10010028 | 3300028380 | Bacteria | 6396 |
| 548 | Ga0268265_10012793 | 3300028380 | Bacteria | 5697 |
| 549 | Ga0268265_10015604 | 3300028380 | Bacteria | 5201 |
| 550 | Ga0268265_10017401 | 3300028380 | Bacteria | 4959 |
| 551 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 552 | Ga0268264_10000131 | 3300028381 | Bacteria | 181459 |
| 553 | Ga0268264_10000567 | 3300028381 | Bacteria | 45270 |
| 554 | Ga0268264_10001814 | 3300028381 | Bacteria | 19523 |
| 555 | Ga0268264_10002173 | 3300028381 | Bacteria | 17473 |
| 556 | Ga0268264_10009033 | 3300028381 | Bacteria | 8270 |
| 557 | Ga0268264_10023705 | 3300028381 | Bacteria | 5005 |
| 558 | Ga0265327_10001003 | 3300031251 | Bacteria | 40039 |
| 559 | Ga0307408_100006789 | 3300031548 | Bacteria | 7587 |
| 560 | Ga0307508_10016531 | 3300031616 | Bacteria | 6718 |
| 561 | Ga0307405_10002100 | 3300031731 | Bacteria | 8682 |
| 562 | Ga0307406_10002601 | 3300031901 | Bacteria | 9832 |
| 563 | Ga0307407_10058832 | 3300031903 | Bacteria | 2236 |
| 564 | Ga0307412_10002490 | 3300031911 | Bacteria | 10252 |
| 565 | Ga0307416_100013524 | 3300032002 | Bacteria | 5551 |
| 566 | Ga0307415_100028341 | 3300032126 | Bacteria | 3561 |
| 567 | Ga0373943_0011882 | 3300035170 | Bacteria | 3919 |
| 568 | Ga0373942_0003470 | 3300035207 | Bacteria | 3703 |
| 569 | Ga0373935_0016099 | 3300035692 | Bacteria | 4525 |
| 570 | Ga0373927_0025861 | 3300035695 | Bacteria | 3837 |
| 571 | Ga0395899_0000104 | 3300037312 | Bacteria | 147238 |
| 572 | Ga0395899_0010084 | 3300037312 | Bacteria | 7243 |
| 573 | Ga0395899_0013362 | 3300037312 | Bacteria | 6281 |
| 574 | Ga0395899_0023792 | 3300037312 | Bacteria | 4635 |
| 575 | Ga0395899_0030923 | 3300037312 | Bacteria | 4025 |
| 576 | Ga0395899_0038373 | 3300037312 | Bacteria | 3588 |
| 577 | Ga0395899_0039880 | 3300037312 | Bacteria | 3514 |
| 578 | Ga0395899_0048079 | 3300037312 | Bacteria | 3175 |
| 579 | Ga0395899_0064655 | 3300037312 | Bacteria | 2689 |
| 580 | Ga0395899_0067646 | 3300037312 | Bacteria | 2621 |
| 581 | Ga0395899_0068026 | 3300037312 | Bacteria | 2612 |
| 582 | Ga0395899_0145899 | 3300037312 | Bacteria | 1681 |
| 583 | Ga0395900_0000161 | 3300037418 | Bacteria | 110637 |
| 584 | Ga0395900_0001979 | 3300037418 | Bacteria | 23128 |
| 585 | Ga0395900_0002464 | 3300037418 | Bacteria | 20376 |
| 586 | Ga0395900_0004869 | 3300037418 | Bacteria | 14150 |
| 587 | Ga0395900_0033711 | 3300037418 | Bacteria | 5269 |
| 588 | Ga0395900_0034176 | 3300037418 | Bacteria | 5235 |
| 589 | Ga0395900_0037569 | 3300037418 | Bacteria | 4992 |
| 590 | Ga0395900_0043596 | 3300037418 | Bacteria | 4624 |
| 591 | Ga0395900_0056008 | 3300037418 | Bacteria | 4059 |
| 592 | Ga0395900_0065428 | 3300037418 | Bacteria | 3735 |
| 593 | Ga0395900_0066531 | 3300037418 | Bacteria | 3702 |
| 594 | Ga0395900_0067047 | 3300037418 | Bacteria | 3688 |
| 595 | Ga0395900_0090191 | 3300037418 | Bacteria | 3151 |
| 596 | Ga0395900_0097049 | 3300037418 | Bacteria | 3028 |
| 597 | Ga0395900_0134622 | 3300037418 | Bacteria | 2531 |
| 598 | Ga0395900_0156766 | 3300037418 | Bacteria | 2325 |
| 599 | Ga0395900_0164563 | 3300037418 | Bacteria | 2261 |
| 600 | Ga0395898_0000169 | 3300037466 | Bacteria | 168667 |
| 601 | Ga0395898_0006568 | 3300037466 | Bacteria | 12408 |
| 602 | Ga0395898_0011480 | 3300037466 | Bacteria | 9199 |
| 603 | Ga0395898_0024479 | 3300037466 | Bacteria | 6089 |
| 604 | Ga0395898_0077624 | 3300037466 | Bacteria | 3206 |
| 605 | Ga0395898_0080899 | 3300037466 | Bacteria | 3133 |
| 606 | Ga0395898_0083517 | 3300037466 | Bacteria | 3078 |
| 607 | Ga0395898_0090063 | 3300037466 | Bacteria | 2952 |
| 608 | Ga0395898_0106979 | 3300037466 | Bacteria | 2682 |
| 609 | Ga0395898_0129242 | 3300037466 | Bacteria | 2420 |
| 610 | Ga0395898_0129678 | 3300037466 | Bacteria | 2415 |
| 611 | Ga0395905_0000104 | 3300037471 | Bacteria | 141965 |
| 612 | Ga0395905_0000120 | 3300037471 | Bacteria | 130865 |
| 613 | Ga0395905_0002668 | 3300037471 | Bacteria | 19575 |
| 614 | Ga0395905_0003971 | 3300037471 | Bacteria | 15563 |
| 615 | Ga0395905_0011281 | 3300037471 | Bacteria | 8637 |
| 616 | Ga0395905_0012663 | 3300037471 | Bacteria | 8115 |
| 617 | Ga0395905_0023425 | 3300037471 | Bacteria | 5834 |
| 618 | Ga0395905_0024005 | 3300037471 | Bacteria | 5757 |
| 619 | Ga0395905_0025552 | 3300037471 | Bacteria | 5569 |
| 620 | Ga0395905_0028768 | 3300037471 | Bacteria | 5236 |
| 621 | Ga0395905_0037509 | 3300037471 | Bacteria | 4549 |
| 622 | Ga0395905_0039312 | 3300037471 | Bacteria | 4438 |
| 623 | Ga0395905_0040894 | 3300037471 | Bacteria | 4349 |
| 624 | Ga0395905_0049225 | 3300037471 | Bacteria | 3949 |
| 625 | Ga0395905_0077714 | 3300037471 | Bacteria | 3110 |
| 626 | Ga0395905_0080011 | 3300037471 | Bacteria | 3063 |
| 627 | Ga0395901_0000664 | 3300038443 | Bacteria | 39548 |
| 628 | Ga0395901_0005588 | 3300038443 | Bacteria | 12729 |
| 629 | Ga0395901_0014971 | 3300038443 | Bacteria | 7882 |
| 630 | Ga0395901_0022137 | 3300038443 | Bacteria | 6512 |
| 631 | Ga0395901_0024686 | 3300038443 | Bacteria | 6171 |
| 632 | Ga0395901_0030692 | 3300038443 | Bacteria | 5538 |
| 633 | Ga0395901_0059178 | 3300038443 | Bacteria | 3986 |
| 634 | Ga0395901_0059393 | 3300038443 | Bacteria | 3978 |
| 635 | Ga0395901_0062430 | 3300038443 | Bacteria | 3877 |
| 636 | Ga0395901_0066271 | 3300038443 | Bacteria | 3761 |
| 637 | Ga0395901_0077369 | 3300038443 | Bacteria | 3472 |
| 638 | Ga0395901_0096271 | 3300038443 | Bacteria | 3102 |
| 639 | Ga0395901_0123348 | 3300038443 | Bacteria | 2722 |
| 640 | Ga0395901_0186020 | 3300038443 | Bacteria | 2178 |
| 641 | Ga0436361_0200088 | 3300039447 | Bacteria | 5440 |
| 642 | Ga0436361_0897280 | 3300039447 | Bacteria | 17229 |
| 643 | Ga0439445_0002579 | 3300042004 | Bacteria | 4031 |
| 644 | Ga0439448_0001144 | 3300042005 | Bacteria | 6711 |
| 645 | Ga0439455_0000293 | 3300042012 | Bacteria | 6235 |
| 646 | Ga0439458_0000011 | 3300042157 | Bacteria | 29034 |
| 647 | Ga0439458_0000051 | 3300042157 | Bacteria | 19754 |
| 648 | Ga0439458_0003106 | 3300042157 | Bacteria | 3949 |
| 649 | Ga0439464_0000713 | 3300042439 | Bacteria | 7200 |
| 650 | Ga0439464_0003431 | 3300042439 | Bacteria | 3997 |
| 651 | Ga0451577_0039515 | 3300042876 | Bacteria | 4240 |
| 652 | Ga0466969_0016598 | 3300044656 | Bacteria | 3851 |
| 653 | Ga0466969_0048135 | 3300044656 | Bacteria | 2108 |
| 654 | Ga0466972_0000786 | 3300044658 | Bacteria | 15066 |
| 655 | Ga0466965_0031256 | 3300044683 | Bacteria | 2596 |
| 656 | Ga0466966_0000052 | 3300044684 | Bacteria | 88472 |
| 657 | Ga0466966_0002388 | 3300044684 | Bacteria | 12268 |
| 658 | Ga0466961_0034809 | 3300044693 | Bacteria | 3233 |
| 659 | Ga0466963_0000815 | 3300044694 | Bacteria | 15585 |
| 660 | Ga0466963_0024046 | 3300044694 | Bacteria | 3875 |
| 661 | Ga0466963_0038518 | 3300044694 | Bacteria | 3126 |
| 662 | Ga0466963_0089749 | 3300044694 | Bacteria | 2091 |
| 663 | Ga0466963_0103096 | 3300044694 | Bacteria | 1954 |
| 664 | Ga0466964_0012472 | 3300044706 | Bacteria | 3215 |
| 665 | Ga0466964_0024705 | 3300044706 | Bacteria | 2342 |
| 666 | Ga0466971_0005602 | 3300044719 | Bacteria | 5460 |
| 667 | Ga0466971_0012210 | 3300044719 | Bacteria | 3763 |
| 668 | Ga0466968_0037164 | 3300044735 | Bacteria | 2042 |
| 669 | Ga0466970_0018763 | 3300044765 | Bacteria | 3583 |
| 670 | Ga0466970_0076593 | 3300044765 | Bacteria | 1802 |
| 671 | Ga0466957_0001952 | 3300044842 | Bacteria | 10954 |
| 672 | Ga0466957_0009863 | 3300044842 | Bacteria | 5461 |
| 673 | Ga0466960_0003591 | 3300044901 | Bacteria | 5983 |
| 674 | Ga0466960_0044746 | 3300044901 | Bacteria | 2111 |
| 675 | Ga0466960_0045153 | 3300044901 | Bacteria | 2103 |
| 676 | Ga0466960_0071728 | 3300044901 | Bacteria | 1726 |
| 677 | Ga0451576_0004130 | 3300045051 | Bacteria | 19149 |
| 678 | Ga0466958_0000611 | 3300045836 | Bacteria | 15263 |
| 679 | Ga0466958_0007378 | 3300045836 | Bacteria | 6044 |
| 680 | Ga0466958_0071292 | 3300045836 | Bacteria | 2127 |
| 681 | Ga0466967_0002752 | 3300045976 | Bacteria | 11116 |
| 682 | Ga0466967_0003933 | 3300045976 | Bacteria | 9871 |
| 683 | Ga0466967_0044109 | 3300045976 | Bacteria | 3865 |
| 684 | Ga0466967_0072847 | 3300045976 | Bacteria | 3080 |
| 685 | Ga0495590_0002741 | 3300046457 | Bacteria | 7272 |
| 686 | Ga0495638_0001102 | 3300046460 | Bacteria | 26299 |
| 687 | Ga0495638_0009092 | 3300046460 | Bacteria | 6994 |
| 688 | Ga0495625_0002352 | 3300046660 | Bacteria | 20624 |
| 689 | Ga0495625_0014697 | 3300046660 | Bacteria | 6235 |
| 690 | Ga0495669_0012674 | 3300046684 | Bacteria | 3590 |
| 691 | Ga0495670_0000005 | 3300046691 | Bacteria | 289725 |
| 692 | Ga0495687_000125 | 3300047443 | Bacteria | 118053 |
| 693 | Ga0495686_0000063 | 3300047472 | Bacteria | 228575 |
| 694 | Ga0495686_0001670 | 3300047472 | Bacteria | 23070 |
| 695 | Ga0496100_0012996 | 3300048903 | Bacteria | 4791 |
| 696 | Ga0496101_0002179 | 3300048904 | Bacteria | 11959 |
| 697 | Ga0496101_0062635 | 3300048904 | Bacteria | 2705 |
| 698 | Ga0496102_0016769 | 3300048905 | Bacteria | 6406 |
| 699 | Ga0496102_0019775 | 3300048905 | Bacteria | 5935 |
| 700 | Ga0496103_0000748 | 3300048906 | Bacteria | 23924 |
| 701 | Ga0496104_0038950 | 3300048907 | Bacteria | 4449 |
| 702 | Ga0496104_0067365 | 3300048907 | Bacteria | 3401 |
| 703 | Ga0496105_0024060 | 3300048908 | Bacteria | 4947 |
| 704 | Ga0496106_0067082 | 3300048909 | Bacteria | 2734 |
| 705 | Ga0496107_0005708 | 3300048910 | Bacteria | 8521 |
| 706 | Ga0496108_0015736 | 3300048911 | Bacteria | 6168 |
| 707 | Ga0496109_0009291 | 3300048912 | Bacteria | 8377 |
| 708 | Ga0496110_0003818 | 3300048913 | Bacteria | 11611 |
| 709 | Ga0496110_0015846 | 3300048913 | Bacteria | 6285 |
| 710 | Ga0496111_0020538 | 3300048914 | Bacteria | 4598 |
| 711 | Ga0496112_0066085 | 3300048915 | Bacteria | 3568 |
| 712 | Ga0496112_0215668 | 3300048915 | Bacteria | 1876 |
| 713 | Ga0496116_0026563 | 3300048919 | Bacteria | 4232 |
| 714 | Ga0496121_0001925 | 3300048924 | Bacteria | 33163 |
| 715 | Ga0496125_0111856 | 3300048928 | Bacteria | 1975 |
| 716 | Ga0495678_042987 | 3300049459 | Bacteria | 1798 |
| 717 | Ga0501034_0200126 | 3300049571 | Bacteria | 1956 |
| 718 | Ga0501083_0044244 | 3300049744 | Bacteria | 3014 |
| 719 | nmdc:mga07m45_3124_c1 | 3300050496 | Bacteria | 7932 |
| 720 | nmdc:mga07m45_4755_c1 | 3300050496 | Bacteria | 6674 |
| 721 | nmdc:mga07m45_505_c1 | 3300050496 | Bacteria | 16509 |
| 722 | nmdc:mga06r32_19192_c1 | 3300050510 | Bacteria | 6274 |
| 723 | nmdc:mga0n895_395853_c1 | 3300050512 | Bacteria | 1397 |
| 724 | Ga0500643_000006 | 3300053087 | Bacteria | 479605 |
| 725 | Ga0500643_000232 | 3300053087 | Bacteria | 51502 |
| 726 | Ga0500592_000718 | 3300053116 | Bacteria | 5439 |
| 727 | Ga0500595_020074 | 3300053119 | Bacteria | 2412 |
| 728 | Ga0500568_0005404 | 3300053139 | Bacteria | 6605 |
| 729 | Ga0500622_0000165 | 3300053156 | Bacteria | 70459 |
| 730 | Ga0500622_0005497 | 3300053156 | Bacteria | 7600 |
| 731 | Ga0500645_002746 | 3300053730 | Bacteria | 7633 |
| 732 | Ga0501084_0116813 | 3300054114 | Bacteria | 2243 |
| 733 | Ga0466962_0000727 | 3300061719 | Bacteria | 14741 |
| 734 | Ga0466962_0035764 | 3300061719 | Bacteria | 2376 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10131856 | Ga0070658_101318561 | 352 |
| 2 | 3300050512 | nmdc:mga0n895_395853_c1 | nmdc:mga0n895_395853_c1_15_1181 | 385 |
| 3 | 3300037312 | Ga0395899_0145899 | Ga0395899_0145899_361_1644 | 406 |
| 4 | 3300037466 | Ga0395898_0024479 | Ga0395898_0024479_3038_4579 | 412 |
| 5 | 3300048915 | Ga0496112_0066085 | Ga0496112_0066085_2286_3554 | 412 |
| 6 | 3300037312 | Ga0395899_0039880 | Ga0395899_0039880_1463_2998 | 414 |
| 7 | 3300037418 | Ga0395900_0037569 | Ga0395900_0037569_853_2388 | 414 |
| 8 | 3300038443 | Ga0395901_0096271 | Ga0395901_0096271_1075_2610 | 414 |
| 9 | 3300038443 | Ga0395901_0062430 | Ga0395901_0062430_393_1931 | 417 |
| 10 | 3300001979 | JGI24740J21852_10000395 | JGI24740J21852_1000039516 | 419 |
| 11 | 3300001989 | JGI24739J22299_10018892 | JGI24739J22299_100188922 | 419 |
| 12 | 3300001991 | JGI24743J22301_10004952 | JGI24743J22301_100049521 | 419 |
| 13 | 3300002075 | JGI24738J21930_10004118 | JGI24738J21930_100041183 | 419 |
| 14 | 3300005329 | Ga0070683_100020582 | Ga0070683_1000205822 | 419 |
| 15 | 3300005336 | Ga0070680_100007272 | Ga0070680_1000072726 | 419 |
| 16 | 3300005337 | Ga0070682_100016005 | Ga0070682_1000160053 | 419 |
| 17 | 3300005337 | Ga0070682_100103904 | Ga0070682_1001039042 | 419 |
| 18 | 3300005339 | Ga0070660_100075152 | Ga0070660_1000751522 | 419 |
| 19 | 3300005341 | Ga0070691_10003231 | Ga0070691_100032315 | 419 |
| 20 | 3300005344 | Ga0070661_100024568 | Ga0070661_1000245682 | 419 |
| 21 | 3300005355 | Ga0070671_100107298 | Ga0070671_1001072982 | 419 |
| 22 | 3300005366 | Ga0070659_100051876 | Ga0070659_1000518763 | 419 |
| 23 | 3300005455 | Ga0070663_100007411 | Ga0070663_1000074115 | 419 |
| 24 | 3300005539 | Ga0068853_100036633 | Ga0068853_1000366334 | 419 |
| 25 | 3300005548 | Ga0070665_100016958 | Ga0070665_1000169582 | 419 |
| 26 | 3300005564 | Ga0070664_100002457 | Ga0070664_1000024574 | 419 |
| 27 | 3300005577 | Ga0068857_100007919 | Ga0068857_1000079193 | 419 |
| 28 | 3300005578 | Ga0068854_100001151 | Ga0068854_1000011512 | 419 |
| 29 | 3300005834 | Ga0068851_10019078 | Ga0068851_100190782 | 419 |
| 30 | 3300009093 | Ga0105240_10184912 | Ga0105240_101849122 | 419 |
| 31 | 3300009545 | Ga0105237_10159970 | Ga0105237_101599702 | 419 |
| 32 | 3300009551 | Ga0105238_10096252 | Ga0105238_100962522 | 419 |
| 33 | 3300013104 | Ga0157370_10232362 | Ga0157370_102323622 | 419 |
| 34 | 3300013307 | Ga0157372_10068118 | Ga0157372_100681183 | 419 |
| 35 | 3300013307 | Ga0157372_10188569 | Ga0157372_101885692 | 419 |
| 36 | 3300025904 | Ga0207647_10001648 | Ga0207647_100016485 | 419 |
| 37 | 3300025904 | Ga0207647_10033137 | Ga0207647_100331372 | 419 |
| 38 | 3300025919 | Ga0207657_10004185 | Ga0207657_100041853 | 419 |
| 39 | 3300025919 | Ga0207657_10008817 | Ga0207657_100088177 | 419 |
| 40 | 3300025933 | Ga0207706_10006168 | Ga0207706_100061688 | 419 |
| 41 | 3300025949 | Ga0207667_10094862 | Ga0207667_100948623 | 419 |
| 42 | 3300025981 | Ga0207640_10070849 | Ga0207640_100708492 | 419 |
| 43 | 3300026067 | Ga0207678_10000198 | Ga0207678_1000019853 | 419 |
| 44 | 3300026116 | Ga0207674_10006989 | Ga0207674_100069899 | 419 |
| 45 | 3300028379 | Ga0268266_10039290 | Ga0268266_100392902 | 419 |
| 46 | 3300037466 | Ga0395898_0083517 | Ga0395898_0083517_580_2121 | 419 |
| 47 | 3300044706 | Ga0466964_0012472 | Ga0466964_0012472_1111_2457 | 421 |
| 48 | 3300038443 | Ga0395901_0066271 | Ga0395901_0066271_1474_3009 | 423 |
| 49 | 3300049459 | Ga0495678_042987 | Ga0495678_042987_17_1360 | 424 |
| 50 | 3300044901 | Ga0466960_0071728 | Ga0466960_0071728_64_1599 | 429 |
| 51 | 3300038443 | Ga0395901_0059178 | Ga0395901_0059178_672_2177 | 433 |
| 52 | 3300013104 | Ga0157370_10005586 | Ga0157370_100055862 | 435 |
| 53 | 3300037312 | Ga0395899_0048079 | Ga0395899_0048079_425_1960 | 435 |
| 54 | 3300037418 | Ga0395900_0033711 | Ga0395900_0033711_3310_4845 | 435 |
| 55 | 3300037466 | Ga0395898_0011480 | Ga0395898_0011480_4355_5890 | 435 |
| 56 | 3300037471 | Ga0395905_0037509 | Ga0395905_0037509_2590_4125 | 435 |
| 57 | 3300038443 | Ga0395901_0024686 | Ga0395901_0024686_3421_4956 | 435 |
| 58 | 3300044765 | Ga0466970_0018763 | Ga0466970_0018763_169_1710 | 435 |
| 59 | 3300037471 | Ga0395905_0028768 | Ga0395905_0028768_199_1734 | 437 |
| 60 | 3300045836 | Ga0466958_0071292 | Ga0466958_0071292_346_1878 | 438 |
| 61 | 3300037418 | Ga0395900_0156766 | Ga0395900_0156766_282_1823 | 439 |
| 62 | 3300037466 | Ga0395898_0080899 | Ga0395898_0080899_1006_2547 | 439 |
| 63 | 3300048913 | Ga0496110_0015846 | Ga0496110_0015846_26_1354 | 441 |
| 64 | 3300037418 | Ga0395900_0056008 | Ga0395900_0056008_309_1844 | 442 |
| 65 | 3300037471 | Ga0395905_0012663 | Ga0395905_0012663_6256_7797 | 442 |
| 66 | 3300031251 | Ga0265327_10001003 | Ga0265327_1000100341 | 443 |
| 67 | 3300037312 | Ga0395899_0030923 | Ga0395899_0030923_2458_3987 | 443 |
| 68 | 3300037418 | Ga0395900_0066531 | Ga0395900_0066531_204_1733 | 443 |
| 69 | 3300037466 | Ga0395898_0129678 | Ga0395898_0129678_204_1733 | 443 |
| 70 | 3300038443 | Ga0395901_0186020 | Ga0395901_0186020_204_1733 | 443 |
| 71 | 3300045836 | Ga0466958_0007378 | Ga0466958_0007378_1145_2686 | 443 |
| 72 | 3300037471 | Ga0395905_0049225 | Ga0395905_0049225_2572_3936 | 444 |
| 73 | 3300037471 | Ga0395905_0080011 | Ga0395905_0080011_320_1825 | 448 |
| 74 | 3300045976 | Ga0466967_0072847 | Ga0466967_0072847_209_1750 | 448 |
| 75 | 3300026116 | Ga0207674_10045622 | Ga0207674_100456222 | 449 |
| 76 | 3300037418 | Ga0395900_0034176 | Ga0395900_0034176_108_1643 | 449 |
| 77 | 3300042157 | Ga0439458_0000011 | Ga0439458_0000011_7415_8953 | 451 |
| 78 | 3300037471 | Ga0395905_0040894 | Ga0395905_0040894_235_1773 | 452 |
| 79 | 3300046691 | Ga0495670_0000005 | Ga0495670_0000005_34449_35984 | 453 |
| 80 | 3300026121 | Ga0207683_10207570 | Ga0207683_102075701 | 456 |
| 81 | 3300053119 | Ga0500595_020074 | Ga0500595_020074_175_1710 | 456 |
| 82 | 3300035207 | Ga0373942_0003470 | Ga0373942_0003470_838_2385 | 457 |
| 83 | 3300037418 | Ga0395900_0065428 | Ga0395900_0065428_1840_3378 | 457 |
| 84 | 3300037471 | Ga0395905_0003971 | Ga0395905_0003971_13746_15284 | 457 |
| 85 | 3300038443 | Ga0395901_0077369 | Ga0395901_0077369_1201_2739 | 457 |
| 86 | 3300005548 | Ga0070665_100018536 | Ga0070665_1000185365 | 458 |
| 87 | 3300037466 | Ga0395898_0129242 | Ga0395898_0129242_448_1983 | 458 |
| 88 | 3300037471 | Ga0395905_0025552 | Ga0395905_0025552_3378_4916 | 458 |
| 89 | 3300005614 | Ga0068856_100004411 | Ga0068856_10000441117 | 460 |
| 90 | 3300013105 | Ga0157369_10016507 | Ga0157369_1001650710 | 460 |
| 91 | 3300026078 | Ga0207702_10018151 | Ga0207702_100181512 | 460 |
| 92 | 3300037418 | Ga0395900_0067047 | Ga0395900_0067047_1587_3128 | 460 |
| 93 | 3300037471 | Ga0395905_0023425 | Ga0395905_0023425_586_2127 | 460 |
| 94 | 3300037471 | Ga0395905_0039312 | Ga0395905_0039312_2851_4389 | 460 |
| 95 | 3300009545 | Ga0105237_10225391 | Ga0105237_102253912 | 461 |
| 96 | 3300037418 | Ga0395900_0002464 | Ga0395900_0002464_5057_6598 | 461 |
| 97 | 3300037466 | Ga0395898_0090063 | Ga0395898_0090063_619_2160 | 461 |
| 98 | 3300037471 | Ga0395905_0002668 | Ga0395905_0002668_6087_7628 | 461 |
| 99 | 3300038443 | Ga0395901_0123348 | Ga0395901_0123348_794_2335 | 461 |
| 100 | 3300005435 | Ga0070714_100041839 | Ga0070714_1000418393 | 462 |
| 101 | 3300025929 | Ga0207664_10033267 | Ga0207664_100332671 | 462 |
| 102 | 3300044694 | Ga0466963_0089749 | Ga0466963_0089749_511_2052 | 462 |
| 103 | 3300005457 | Ga0070662_100115658 | Ga0070662_1001156581 | 463 |
| 104 | 3300044694 | Ga0466963_0038518 | Ga0466963_0038518_1380_2921 | 463 |
| 105 | 3300005366 | Ga0070659_100044578 | Ga0070659_1000445781 | 464 |
| 106 | 3300006881 | Ga0068865_100011662 | Ga0068865_1000116622 | 464 |
| 107 | 3300044735 | Ga0466968_0037164 | Ga0466968_0037164_13_1539 | 465 |
| 108 | 3300044658 | Ga0466972_0000786 | Ga0466972_0000786_6424_7959 | 467 |
| 109 | 3300044901 | Ga0466960_0003591 | Ga0466960_0003591_1929_3464 | 467 |
| 110 | 3300006237 | Ga0097621_100123826 | Ga0097621_1001238263 | 468 |
| 111 | 3300054114 | Ga0501084_0116813 | Ga0501084_0116813_718_2214 | 468 |
| 112 | 3300005842 | Ga0068858_100040082 | Ga0068858_1000400825 | 469 |
| 113 | 3300005985 | Ga0081539_10058522 | Ga0081539_100585222 | 469 |
| 114 | 3300026035 | Ga0207703_10007545 | Ga0207703_100075456 | 469 |
| 115 | 3300026118 | Ga0207675_100074463 | Ga0207675_1000744633 | 469 |
| 116 | 3300042876 | Ga0451577_0039515 | Ga0451577_0039515_1618_3147 | 469 |
| 117 | 3300045051 | Ga0451576_0004130 | Ga0451576_0004130_9622_11151 | 469 |
| 118 | 3300048924 | Ga0496121_0001925 | Ga0496121_0001925_28897_30456 | 469 |
| 119 | 3300005844 | Ga0068862_100028554 | Ga0068862_1000285542 | 470 |
| 120 | 3300013104 | Ga0157370_10092659 | Ga0157370_100926591 | 470 |
| 121 | 3300028380 | Ga0268265_10015604 | Ga0268265_100156044 | 470 |
| 122 | 3300013306 | Ga0163162_10187894 | Ga0163162_101878942 | 471 |
| 123 | 3300037312 | Ga0395899_0010084 | Ga0395899_0010084_4285_5823 | 471 |
| 124 | 3300037418 | Ga0395900_0001979 | Ga0395900_0001979_13580_15118 | 471 |
| 125 | 3300037471 | Ga0395905_0011281 | Ga0395905_0011281_6258_7796 | 471 |
| 126 | 3300038443 | Ga0395901_0005588 | Ga0395901_0005588_4217_5755 | 471 |
| 127 | 3300039447 | Ga0436361_0200088 | Ga0436361_0200088_342_1820 | 471 |
| 128 | 3300005327 | Ga0070658_10112571 | Ga0070658_101125712 | 472 |
| 129 | 3300005331 | Ga0070670_100117212 | Ga0070670_1001172122 | 472 |
| 130 | 3300005347 | Ga0070668_100033901 | Ga0070668_1000339012 | 472 |
| 131 | 3300005617 | Ga0068859_100069451 | Ga0068859_1000694513 | 472 |
| 132 | 3300005843 | Ga0068860_100032025 | Ga0068860_1000320257 | 472 |
| 133 | 3300006931 | Ga0097620_100069449 | Ga0097620_1000694493 | 472 |
| 134 | 3300044694 | Ga0466963_0103096 | Ga0466963_0103096_69_1607 | 472 |
| 135 | 3300044719 | Ga0466971_0005602 | Ga0466971_0005602_550_2088 | 472 |
| 136 | 3300044842 | Ga0466957_0009863 | Ga0466957_0009863_966_2501 | 472 |
| 137 | 3300045976 | Ga0466967_0003933 | Ga0466967_0003933_1946_3484 | 472 |
| 138 | 3300061719 | Ga0466962_0000727 | Ga0466962_0000727_12336_13874 | 472 |
| 139 | 3300002067 | JGI24735J21928_10002842 | JGI24735J21928_100028422 | 473 |
| 140 | 3300005327 | Ga0070658_10052651 | Ga0070658_100526512 | 473 |
| 141 | 3300005339 | Ga0070660_100023164 | Ga0070660_1000231645 | 473 |
| 142 | 3300005344 | Ga0070661_100032766 | Ga0070661_1000327665 | 473 |
| 143 | 3300005366 | Ga0070659_100027561 | Ga0070659_1000275615 | 473 |
| 144 | 3300005539 | Ga0068853_100007344 | Ga0068853_1000073447 | 473 |
| 145 | 3300005577 | Ga0068857_100084161 | Ga0068857_1000841611 | 473 |
| 146 | 3300005842 | Ga0068858_100006175 | Ga0068858_1000061758 | 473 |
| 147 | 3300009093 | Ga0105240_10003880 | Ga0105240_100038807 | 473 |
| 148 | 3300009545 | Ga0105237_10003982 | Ga0105237_100039827 | 473 |
| 149 | 3300010375 | Ga0105239_10002388 | Ga0105239_1000238823 | 473 |
| 150 | 3300013297 | Ga0157378_10083214 | Ga0157378_100832142 | 473 |
| 151 | 3300014325 | Ga0163163_10013362 | Ga0163163_100133625 | 473 |
| 152 | 3300025904 | Ga0207647_10024185 | Ga0207647_100241853 | 473 |
| 153 | 3300025909 | Ga0207705_10089454 | Ga0207705_100894542 | 473 |
| 154 | 3300025913 | Ga0207695_10011197 | Ga0207695_100111971 | 473 |
| 155 | 3300025914 | Ga0207671_10071063 | Ga0207671_100710632 | 473 |
| 156 | 3300025919 | Ga0207657_10008595 | Ga0207657_1000859510 | 473 |
| 157 | 3300025924 | Ga0207694_10005478 | Ga0207694_100054788 | 473 |
| 158 | 3300026041 | Ga0207639_10002215 | Ga0207639_1000221512 | 473 |
| 159 | 3300026116 | Ga0207674_10014814 | Ga0207674_100148147 | 473 |
| 160 | 3300042157 | Ga0439458_0000051 | Ga0439458_0000051_17983_19524 | 473 |
| 161 | 3300048928 | Ga0496125_0111856 | Ga0496125_0111856_148_1734 | 473 |
| 162 | 3300053156 | Ga0500622_0005497 | Ga0500622_0005497_4319_5812 | 473 |
| 163 | 3300005937 | Ga0081455_10004231 | Ga0081455_100042317 | 474 |
| 164 | 3300045976 | Ga0466967_0044109 | Ga0466967_0044109_1904_3439 | 474 |
| 165 | 3300046460 | Ga0495638_0009092 | Ga0495638_0009092_2944_4467 | 474 |
| 166 | 3300046660 | Ga0495625_0002352 | Ga0495625_0002352_5769_7292 | 474 |
| 167 | 3300025256 | Ga0209759_1011916 | Ga0209759_10119162 | 475 |
| 168 | 3300025292 | Ga0209676_1009644 | Ga0209676_10096442 | 475 |
| 169 | 3300025294 | Ga0209025_1020025 | Ga0209025_10200251 | 475 |
| 170 | 3300046457 | Ga0495590_0002741 | Ga0495590_0002741_402_1943 | 475 |
| 171 | 3300005295 | Ga0065707_10096768 | Ga0065707_100967683 | 476 |
| 172 | 3300005328 | Ga0070676_10043886 | Ga0070676_100438862 | 476 |
| 173 | 3300009098 | Ga0105245_10048655 | Ga0105245_100486552 | 476 |
| 174 | 3300009176 | Ga0105242_10083959 | Ga0105242_100839593 | 476 |
| 175 | 3300025907 | Ga0207645_10082577 | Ga0207645_100825772 | 476 |
| 176 | 3300025927 | Ga0207687_10012203 | Ga0207687_100122035 | 476 |
| 177 | 3300025934 | Ga0207686_10071119 | Ga0207686_100711192 | 476 |
| 178 | 3300025935 | Ga0207709_10054348 | Ga0207709_100543482 | 476 |
| 179 | 3300026089 | Ga0207648_10006135 | Ga0207648_100061357 | 476 |
| 180 | 3300037312 | Ga0395899_0000104 | Ga0395899_0000104_125903_127408 | 476 |
| 181 | 3300037312 | Ga0395899_0038373 | Ga0395899_0038373_1065_2603 | 476 |
| 182 | 3300037418 | Ga0395900_0000161 | Ga0395900_0000161_52007_53512 | 476 |
| 183 | 3300037418 | Ga0395900_0097049 | Ga0395900_0097049_891_2429 | 476 |
| 184 | 3300037418 | Ga0395900_0134622 | Ga0395900_0134622_454_1995 | 476 |
| 185 | 3300037466 | Ga0395898_0000169 | Ga0395898_0000169_138839_140344 | 476 |
| 186 | 3300037471 | Ga0395905_0000120 | Ga0395905_0000120_52195_53700 | 476 |
| 187 | 3300038443 | Ga0395901_0000664 | Ga0395901_0000664_21756_23261 | 476 |
| 188 | 3300009101 | Ga0105247_10030004 | Ga0105247_100300042 | 477 |
| 189 | 3300025900 | Ga0207710_10014589 | Ga0207710_100145894 | 477 |
| 190 | 3300025904 | Ga0207647_10021572 | Ga0207647_100215722 | 477 |
| 191 | 3300028381 | Ga0268264_10009033 | Ga0268264_100090339 | 477 |
| 192 | 3300047472 | Ga0495686_0000063 | Ga0495686_0000063_172071_173603 | 477 |
| 193 | 3300005539 | Ga0068853_100094723 | Ga0068853_1000947232 | 478 |
| 194 | 3300005618 | Ga0068864_100024966 | Ga0068864_1000249661 | 478 |
| 195 | 3300006237 | Ga0097621_100020152 | Ga0097621_1000201524 | 478 |
| 196 | 3300006358 | Ga0068871_100057229 | Ga0068871_1000572294 | 478 |
| 197 | 3300009545 | Ga0105237_10144916 | Ga0105237_101449163 | 478 |
| 198 | 3300009551 | Ga0105238_10018232 | Ga0105238_100182324 | 478 |
| 199 | 3300013307 | Ga0157372_10061043 | Ga0157372_100610432 | 478 |
| 200 | 3300025911 | Ga0207654_10079171 | Ga0207654_100791712 | 478 |
| 201 | 3300026041 | Ga0207639_10121859 | Ga0207639_101218592 | 478 |
| 202 | 3300026095 | Ga0207676_10048265 | Ga0207676_100482652 | 478 |
| 203 | 3300026095 | Ga0207676_10060871 | Ga0207676_100608712 | 478 |
| 204 | 3300028381 | Ga0268264_10023705 | Ga0268264_100237053 | 478 |
| 205 | 3300031616 | Ga0307508_10016531 | Ga0307508_100165312 | 478 |
| 206 | 3300005578 | Ga0068854_100027723 | Ga0068854_1000277233 | 479 |
| 207 | 3300001990 | JGI24737J22298_10004914 | JGI24737J22298_100049142 | 480 |
| 208 | 3300002077 | JGI24744J21845_10002683 | JGI24744J21845_100026832 | 480 |
| 209 | 3300005335 | Ga0070666_10024010 | Ga0070666_100240102 | 480 |
| 210 | 3300005354 | Ga0070675_100149121 | Ga0070675_1001491212 | 480 |
| 211 | 3300005548 | Ga0070665_100177255 | Ga0070665_1001772552 | 480 |
| 212 | 3300005563 | Ga0068855_100001164 | Ga0068855_1000011645 | 480 |
| 213 | 3300005577 | Ga0068857_100005444 | Ga0068857_1000054447 | 480 |
| 214 | 3300005578 | Ga0068854_100025690 | Ga0068854_1000256906 | 480 |
| 215 | 3300005844 | Ga0068862_100000198 | Ga0068862_10000019867 | 480 |
| 216 | 3300009093 | Ga0105240_10188228 | Ga0105240_101882283 | 480 |
| 217 | 3300009177 | Ga0105248_10024980 | Ga0105248_100249803 | 480 |
| 218 | 3300009545 | Ga0105237_10018540 | Ga0105237_100185406 | 480 |
| 219 | 3300009553 | Ga0105249_10000015 | Ga0105249_10000015277 | 480 |
| 220 | 3300010375 | Ga0105239_10114796 | Ga0105239_101147964 | 480 |
| 221 | 3300025901 | Ga0207688_10024275 | Ga0207688_100242752 | 480 |
| 222 | 3300025904 | Ga0207647_10056231 | Ga0207647_100562312 | 480 |
| 223 | 3300025914 | Ga0207671_10033115 | Ga0207671_100331154 | 480 |
| 224 | 3300025941 | Ga0207711_10009352 | Ga0207711_100093525 | 480 |
| 225 | 3300025949 | Ga0207667_10000017 | Ga0207667_10000017266 | 480 |
| 226 | 3300025961 | Ga0207712_10000023 | Ga0207712_100000238 | 480 |
| 227 | 3300025981 | Ga0207640_10006873 | Ga0207640_100068733 | 480 |
| 228 | 3300026088 | Ga0207641_10037126 | Ga0207641_100371263 | 480 |
| 229 | 3300026089 | Ga0207648_10027744 | Ga0207648_100277442 | 480 |
| 230 | 3300026116 | Ga0207674_10002718 | Ga0207674_1000271812 | 480 |
| 231 | 3300028380 | Ga0268265_10000021 | Ga0268265_10000021238 | 480 |
| 232 | 3300005327 | Ga0070658_10055565 | Ga0070658_100555653 | 481 |
| 233 | 3300005614 | Ga0068856_100000449 | Ga0068856_1000004492 | 481 |
| 234 | 3300025911 | Ga0207654_10027098 | Ga0207654_100270982 | 481 |
| 235 | 3300025949 | Ga0207667_10030020 | Ga0207667_100300202 | 481 |
| 236 | 3300026078 | Ga0207702_10000430 | Ga0207702_100004302 | 481 |
| 237 | 3300037471 | Ga0395905_0024005 | Ga0395905_0024005_1775_3280 | 481 |
| 238 | 3300048904 | Ga0496101_0062635 | Ga0496101_0062635_493_1998 | 481 |
| 239 | 3300048905 | Ga0496102_0019775 | Ga0496102_0019775_1826_3331 | 481 |
| 240 | 3300048907 | Ga0496104_0038950 | Ga0496104_0038950_1816_3321 | 481 |
| 241 | 3300048909 | Ga0496106_0067082 | Ga0496106_0067082_740_2245 | 481 |
| 242 | 3300048910 | Ga0496107_0005708 | Ga0496107_0005708_4770_6275 | 481 |
| 243 | 3300048911 | Ga0496108_0015736 | Ga0496108_0015736_2058_3563 | 481 |
| 244 | 3300048913 | Ga0496110_0003818 | Ga0496110_0003818_3533_5038 | 481 |
| 245 | 3300048914 | Ga0496111_0020538 | Ga0496111_0020538_1165_2670 | 481 |
| 246 | 3300048915 | Ga0496112_0215668 | Ga0496112_0215668_417_1865 | 481 |
| 247 | 3300002070 | JGI24750J21931_1000372 | JGI24750J21931_10003726 | 482 |
| 248 | 3300005330 | Ga0070690_100000014 | Ga0070690_10000001458 | 482 |
| 249 | 3300005335 | Ga0070666_10000027 | Ga0070666_1000002717 | 482 |
| 250 | 3300005339 | Ga0070660_100038535 | Ga0070660_1000385353 | 482 |
| 251 | 3300005344 | Ga0070661_100014597 | Ga0070661_1000145973 | 482 |
| 252 | 3300005366 | Ga0070659_100036766 | Ga0070659_1000367663 | 482 |
| 253 | 3300005367 | Ga0070667_100006262 | Ga0070667_1000062628 | 482 |
| 254 | 3300005544 | Ga0070686_100000010 | Ga0070686_100000010152 | 482 |
| 255 | 3300005563 | Ga0068855_100001723 | Ga0068855_1000017234 | 482 |
| 256 | 3300005578 | Ga0068854_100010327 | Ga0068854_1000103275 | 482 |
| 257 | 3300005614 | Ga0068856_100046595 | Ga0068856_1000465953 | 482 |
| 258 | 3300005614 | Ga0068856_100058084 | Ga0068856_1000580844 | 482 |
| 259 | 3300005616 | Ga0068852_100013939 | Ga0068852_1000139395 | 482 |
| 260 | 3300005618 | Ga0068864_100007461 | Ga0068864_1000074612 | 482 |
| 261 | 3300005719 | Ga0068861_100072992 | Ga0068861_1000729922 | 482 |
| 262 | 3300005841 | Ga0068863_100069572 | Ga0068863_1000695722 | 482 |
| 263 | 3300005843 | Ga0068860_100000080 | Ga0068860_100000080151 | 482 |
| 264 | 3300005937 | Ga0081455_10000564 | Ga0081455_100005648 | 482 |
| 265 | 3300009093 | Ga0105240_10066649 | Ga0105240_100666492 | 482 |
| 266 | 3300009174 | Ga0105241_10166782 | Ga0105241_101667822 | 482 |
| 267 | 3300009551 | Ga0105238_10145698 | Ga0105238_101456982 | 482 |
| 268 | 3300009553 | Ga0105249_10000064 | Ga0105249_1000006418 | 482 |
| 269 | 3300013100 | Ga0157373_10012675 | Ga0157373_100126753 | 482 |
| 270 | 3300013102 | Ga0157371_10013675 | Ga0157371_100136755 | 482 |
| 271 | 3300013104 | Ga0157370_10027355 | Ga0157370_100273553 | 482 |
| 272 | 3300013105 | Ga0157369_10034107 | Ga0157369_100341073 | 482 |
| 273 | 3300013307 | Ga0157372_10180763 | Ga0157372_101807633 | 482 |
| 274 | 3300017792 | Ga0163161_10000110 | Ga0163161_1000011017 | 482 |
| 275 | 3300025903 | Ga0207680_10000009 | Ga0207680_10000009154 | 482 |
| 276 | 3300025913 | Ga0207695_10021396 | Ga0207695_100213962 | 482 |
| 277 | 3300025919 | Ga0207657_10051528 | Ga0207657_100515283 | 482 |
| 278 | 3300025920 | Ga0207649_10017197 | Ga0207649_100171973 | 482 |
| 279 | 3300025924 | Ga0207694_10103667 | Ga0207694_101036672 | 482 |
| 280 | 3300025949 | Ga0207667_10000503 | Ga0207667_1000050348 | 482 |
| 281 | 3300025961 | Ga0207712_10000044 | Ga0207712_10000044151 | 482 |
| 282 | 3300025986 | Ga0207658_10001131 | Ga0207658_1000113110 | 482 |
| 283 | 3300026035 | Ga0207703_10002719 | Ga0207703_100027198 | 482 |
| 284 | 3300026078 | Ga0207702_10017344 | Ga0207702_100173443 | 482 |
| 285 | 3300026078 | Ga0207702_10100994 | Ga0207702_101009943 | 482 |
| 286 | 3300026088 | Ga0207641_10011082 | Ga0207641_100110828 | 482 |
| 287 | 3300026142 | Ga0207698_10026840 | Ga0207698_100268403 | 482 |
| 288 | 3300028381 | Ga0268264_10000131 | Ga0268264_10000131151 | 482 |
| 289 | 3300037312 | Ga0395899_0067646 | Ga0395899_0067646_204_1736 | 482 |
| 290 | 3300037418 | Ga0395900_0090191 | Ga0395900_0090191_1562_3094 | 482 |
| 291 | 3300037466 | Ga0395898_0077624 | Ga0395898_0077624_1257_2789 | 482 |
| 292 | 3300037471 | Ga0395905_0077714 | Ga0395905_0077714_1145_2671 | 482 |
| 293 | 3300038443 | Ga0395901_0030692 | Ga0395901_0030692_2770_4302 | 482 |
| 294 | 3300047472 | Ga0495686_0001670 | Ga0495686_0001670_6850_8382 | 482 |
| 295 | 3300005616 | Ga0068852_100001197 | Ga0068852_10000119720 | 483 |
| 296 | 3300005937 | Ga0081455_10065401 | Ga0081455_100654012 | 483 |
| 297 | 3300013105 | Ga0157369_10012084 | Ga0157369_100120843 | 483 |
| 298 | 3300013306 | Ga0163162_10058690 | Ga0163162_100586903 | 483 |
| 299 | 3300025924 | Ga0207694_10023373 | Ga0207694_100233732 | 483 |
| 300 | 3300026142 | Ga0207698_10087331 | Ga0207698_100873312 | 483 |
| 301 | 3300044656 | Ga0466969_0016598 | Ga0466969_0016598_2030_3568 | 483 |
| 302 | 3300044706 | Ga0466964_0024705 | Ga0466964_0024705_53_1591 | 483 |
| 303 | 3300048919 | Ga0496116_0026563 | Ga0496116_0026563_642_2177 | 483 |
| 304 | 3300061719 | Ga0466962_0035764 | Ga0466962_0035764_126_1664 | 483 |
| 305 | 3300002074 | JGI24748J21848_1000049 | JGI24748J21848_100004957 | 484 |
| 306 | 3300002076 | JGI24749J21850_1000068 | JGI24749J21850_10000687 | 484 |
| 307 | 3300002239 | JGI24034J26672_10000033 | JGI24034J26672_1000003331 | 484 |
| 308 | 3300002459 | JGI24751J29686_10000400 | JGI24751J29686_100004007 | 484 |
| 309 | 3300002459 | JGI24751J29686_10003332 | JGI24751J29686_100033321 | 484 |
| 310 | 3300005295 | Ga0065707_10082133 | Ga0065707_100821334 | 484 |
| 311 | 3300005331 | Ga0070670_100000047 | Ga0070670_10000004723 | 484 |
| 312 | 3300005340 | Ga0070689_100001657 | Ga0070689_1000016578 | 484 |
| 313 | 3300005340 | Ga0070689_100050373 | Ga0070689_1000503732 | 484 |
| 314 | 3300005347 | Ga0070668_100018826 | Ga0070668_1000188262 | 484 |
| 315 | 3300005353 | Ga0070669_100000099 | Ga0070669_1000000997 | 484 |
| 316 | 3300005353 | Ga0070669_100000162 | Ga0070669_10000016220 | 484 |
| 317 | 3300005355 | Ga0070671_100022628 | Ga0070671_1000226285 | 484 |
| 318 | 3300005466 | Ga0070685_10000101 | Ga0070685_1000010145 | 484 |
| 319 | 3300005548 | Ga0070665_100000254 | Ga0070665_10000025426 | 484 |
| 320 | 3300005617 | Ga0068859_100011614 | Ga0068859_1000116149 | 484 |
| 321 | 3300005617 | Ga0068859_100024123 | Ga0068859_1000241234 | 484 |
| 322 | 3300005618 | Ga0068864_100000051 | Ga0068864_10000005122 | 484 |
| 323 | 3300005719 | Ga0068861_100011286 | Ga0068861_1000112864 | 484 |
| 324 | 3300005841 | Ga0068863_100000214 | Ga0068863_10000021431 | 484 |
| 325 | 3300005842 | Ga0068858_100007575 | Ga0068858_1000075759 | 484 |
| 326 | 3300005844 | Ga0068862_100000036 | Ga0068862_10000003623 | 484 |
| 327 | 3300005844 | Ga0068862_100000357 | Ga0068862_1000003579 | 484 |
| 328 | 3300005844 | Ga0068862_100018625 | Ga0068862_1000186252 | 484 |
| 329 | 3300006931 | Ga0097620_100011614 | Ga0097620_1000116149 | 484 |
| 330 | 3300006931 | Ga0097620_100024122 | Ga0097620_1000241225 | 484 |
| 331 | 3300009177 | Ga0105248_10000407 | Ga0105248_100004079 | 484 |
| 332 | 3300014326 | Ga0157380_10000332 | Ga0157380_100003322 | 484 |
| 333 | 3300014968 | Ga0157379_10015227 | Ga0157379_100152275 | 484 |
| 334 | 3300025223 | Ga0207672_1000729 | Ga0207672_10007292 | 484 |
| 335 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003627 | 484 |
| 336 | 3300025925 | Ga0207650_10000038 | Ga0207650_1000003873 | 484 |
| 337 | 3300025931 | Ga0207644_10013409 | Ga0207644_100134095 | 484 |
| 338 | 3300025936 | Ga0207670_10022219 | Ga0207670_100222192 | 484 |
| 339 | 3300025941 | Ga0207711_10000607 | Ga0207711_1000060722 | 484 |
| 340 | 3300025941 | Ga0207711_10059979 | Ga0207711_100599794 | 484 |
| 341 | 3300025972 | Ga0207668_10006304 | Ga0207668_100063043 | 484 |
| 342 | 3300025986 | Ga0207658_10001592 | Ga0207658_1000159210 | 484 |
| 343 | 3300026041 | Ga0207639_10021938 | Ga0207639_100219384 | 484 |
| 344 | 3300026088 | Ga0207641_10000047 | Ga0207641_1000004734 | 484 |
| 345 | 3300026095 | Ga0207676_10000034 | Ga0207676_10000034110 | 484 |
| 346 | 3300026118 | Ga0207675_100003730 | Ga0207675_1000037308 | 484 |
| 347 | 3300026118 | Ga0207675_100007062 | Ga0207675_10000706210 | 484 |
| 348 | 3300026118 | Ga0207675_100021446 | Ga0207675_1000214462 | 484 |
| 349 | 3300028379 | Ga0268266_10000069 | Ga0268266_10000069154 | 484 |
| 350 | 3300028380 | Ga0268265_10000052 | Ga0268265_1000005222 | 484 |
| 351 | 3300028380 | Ga0268265_10000197 | Ga0268265_1000019756 | 484 |
| 352 | 3300028380 | Ga0268265_10004932 | Ga0268265_100049327 | 484 |
| 353 | 3300037466 | Ga0395898_0106979 | Ga0395898_0106979_456_1991 | 484 |
| 354 | 3300038443 | Ga0395901_0022137 | Ga0395901_0022137_2959_4494 | 484 |
| 355 | 3300044683 | Ga0466965_0031256 | Ga0466965_0031256_431_1969 | 484 |
| 356 | 3300044684 | Ga0466966_0002388 | Ga0466966_0002388_3485_5029 | 484 |
| 357 | 3300044901 | Ga0466960_0045153 | Ga0466960_0045153_55_1593 | 484 |
| 358 | 3300046460 | Ga0495638_0001102 | Ga0495638_0001102_3600_5141 | 484 |
| 359 | 3300048906 | Ga0496103_0000748 | Ga0496103_0000748_7135_8670 | 484 |
| 360 | 3300048907 | Ga0496104_0067365 | Ga0496104_0067365_1263_2798 | 484 |
| 361 | 3300050496 | nmdc:mga07m45_4755_c1 | nmdc:mga07m45_4755_c1_4526_6061 | 484 |
| 362 | 3300053116 | Ga0500592_000718 | Ga0500592_000718_3407_4942 | 484 |
| 363 | 3300003794 | Ga0055531_10000021 | Ga0055531_1000002185 | 485 |
| 364 | 3300005578 | Ga0068854_100076804 | Ga0068854_1000768042 | 485 |
| 365 | 3300009177 | Ga0105248_10105654 | Ga0105248_101056542 | 485 |
| 366 | 3300009551 | Ga0105238_10069566 | Ga0105238_100695662 | 485 |
| 367 | 3300013104 | Ga0157370_10014806 | Ga0157370_100148068 | 485 |
| 368 | 3300014325 | Ga0163163_10103722 | Ga0163163_101037222 | 485 |
| 369 | 3300025303 | Ga0209051_1009617 | Ga0209051_10096173 | 485 |
| 370 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032434 | 485 |
| 371 | 3300025981 | Ga0207640_10113553 | Ga0207640_101135532 | 485 |
| 372 | 3300035170 | Ga0373943_0011882 | Ga0373943_0011882_239_1729 | 485 |
| 373 | 3300035692 | Ga0373935_0016099 | Ga0373935_0016099_900_2390 | 485 |
| 374 | 3300035695 | Ga0373927_0025861 | Ga0373927_0025861_2225_3715 | 485 |
| 375 | 3300042012 | Ga0439455_0000293 | Ga0439455_0000293_4603_6138 | 485 |
| 376 | 3300042157 | Ga0439458_0003106 | Ga0439458_0003106_2376_3911 | 485 |
| 377 | 3300003320 | rootH2_10040129 | rootH2_100401295 | 486 |
| 378 | 3300025933 | Ga0207706_10111062 | Ga0207706_101110622 | 486 |
| 379 | 3300039447 | Ga0436361_0897280 | Ga0436361_0897280_11817_13346 | 486 |
| 380 | 3300046684 | Ga0495669_0012674 | Ga0495669_0012674_1171_2706 | 486 |
| 381 | 3300053730 | Ga0500645_002746 | Ga0500645_002746_2341_3876 | 486 |
| 382 | 3300005355 | Ga0070671_100007605 | Ga0070671_1000076057 | 487 |
| 383 | 3300005367 | Ga0070667_100001726 | Ga0070667_10000172613 | 487 |
| 384 | 3300005548 | Ga0070665_100003744 | Ga0070665_10000374415 | 487 |
| 385 | 3300005617 | Ga0068859_100000324 | Ga0068859_1000003243 | 487 |
| 386 | 3300005618 | Ga0068864_100000743 | Ga0068864_1000007438 | 487 |
| 387 | 3300005841 | Ga0068863_100007339 | Ga0068863_1000073398 | 487 |
| 388 | 3300005842 | Ga0068858_100006917 | Ga0068858_1000069178 | 487 |
| 389 | 3300005843 | Ga0068860_100000353 | Ga0068860_10000035312 | 487 |
| 390 | 3300005843 | Ga0068860_100011757 | Ga0068860_1000117573 | 487 |
| 391 | 3300005843 | Ga0068860_100107896 | Ga0068860_1001078962 | 487 |
| 392 | 3300005844 | Ga0068862_100076145 | Ga0068862_1000761452 | 487 |
| 393 | 3300006195 | Ga0075366_10007553 | Ga0075366_100075535 | 487 |
| 394 | 3300006353 | Ga0075370_10004706 | Ga0075370_100047063 | 487 |
| 395 | 3300006931 | Ga0097620_100000324 | Ga0097620_1000003243 | 487 |
| 396 | 3300009177 | Ga0105248_10000123 | Ga0105248_1000012376 | 487 |
| 397 | 3300013306 | Ga0163162_10002274 | Ga0163162_1000227410 | 487 |
| 398 | 3300013308 | Ga0157375_10081028 | Ga0157375_100810283 | 487 |
| 399 | 3300014325 | Ga0163163_10000265 | Ga0163163_1000026534 | 487 |
| 400 | 3300025303 | Ga0209051_1004538 | Ga0209051_10045385 | 487 |
| 401 | 3300025931 | Ga0207644_10041587 | Ga0207644_100415872 | 487 |
| 402 | 3300025941 | Ga0207711_10000100 | Ga0207711_1000010078 | 487 |
| 403 | 3300025960 | Ga0207651_10081205 | Ga0207651_100812052 | 487 |
| 404 | 3300025986 | Ga0207658_10000592 | Ga0207658_1000059214 | 487 |
| 405 | 3300026023 | Ga0207677_10070670 | Ga0207677_100706702 | 487 |
| 406 | 3300026035 | Ga0207703_10001186 | Ga0207703_1000118626 | 487 |
| 407 | 3300026088 | Ga0207641_10003117 | Ga0207641_100031172 | 487 |
| 408 | 3300026095 | Ga0207676_10000378 | Ga0207676_100003783 | 487 |
| 409 | 3300028379 | Ga0268266_10009139 | Ga0268266_100091393 | 487 |
| 410 | 3300028380 | Ga0268265_10017401 | Ga0268265_100174011 | 487 |
| 411 | 3300028381 | Ga0268264_10000021 | Ga0268264_1000002152 | 487 |
| 412 | 3300028381 | Ga0268264_10001814 | Ga0268264_1000181417 | 487 |
| 413 | 3300047443 | Ga0495687_000125 | Ga0495687_000125_29387_30931 | 487 |
| 414 | 3300050496 | nmdc:mga07m45_505_c1 | nmdc:mga07m45_505_c1_3926_5470 | 487 |
| 415 | 3300005548 | Ga0070665_100011289 | Ga0070665_1000112893 | 488 |
| 416 | 3300005719 | Ga0068861_100023488 | Ga0068861_1000234882 | 488 |
| 417 | 3300026118 | Ga0207675_100038664 | Ga0207675_1000386644 | 488 |
| 418 | 3300037312 | Ga0395899_0064655 | Ga0395899_0064655_315_1856 | 488 |
| 419 | 3300037466 | Ga0395898_0006568 | Ga0395898_0006568_10416_11957 | 488 |
| 420 | 3300038443 | Ga0395901_0014971 | Ga0395901_0014971_5274_6815 | 488 |
| 421 | 3300005328 | Ga0070676_10004834 | Ga0070676_100048343 | 490 |
| 422 | 3300005333 | Ga0070677_10000829 | Ga0070677_100008296 | 490 |
| 423 | 3300005347 | Ga0070668_100006365 | Ga0070668_1000063658 | 490 |
| 424 | 3300005353 | Ga0070669_100005466 | Ga0070669_10000546610 | 490 |
| 425 | 3300005354 | Ga0070675_100003584 | Ga0070675_10000358411 | 490 |
| 426 | 3300005355 | Ga0070671_100018586 | Ga0070671_1000185863 | 490 |
| 427 | 3300005356 | Ga0070674_100003989 | Ga0070674_1000039895 | 490 |
| 428 | 3300005456 | Ga0070678_100013659 | Ga0070678_1000136597 | 490 |
| 429 | 3300005543 | Ga0070672_100001207 | Ga0070672_1000012076 | 490 |
| 430 | 3300005617 | Ga0068859_100101242 | Ga0068859_1001012422 | 490 |
| 431 | 3300006931 | Ga0097620_100101251 | Ga0097620_1001012512 | 490 |
| 432 | 3300025925 | Ga0207650_10014405 | Ga0207650_100144052 | 490 |
| 433 | 3300025926 | Ga0207659_10007405 | Ga0207659_100074055 | 490 |
| 434 | 3300025940 | Ga0207691_10000442 | Ga0207691_1000044230 | 490 |
| 435 | 3300026116 | Ga0207674_10031878 | Ga0207674_100318788 | 490 |
| 436 | 3300026121 | Ga0207683_10009217 | Ga0207683_100092173 | 490 |
| 437 | 3300028380 | Ga0268265_10012793 | Ga0268265_100127932 | 490 |
| 438 | 3300031903 | Ga0307407_10058832 | Ga0307407_100588323 | 490 |
| 439 | 3300032126 | Ga0307415_100028341 | Ga0307415_1000283414 | 490 |
| 440 | 3300042439 | Ga0439464_0003431 | Ga0439464_0003431_2289_3824 | 490 |
| 441 | 3300001990 | JGI24737J22298_10000051 | JGI24737J22298_1000005125 | 491 |
| 442 | 3300001990 | JGI24737J22298_10000165 | JGI24737J22298_100001655 | 491 |
| 443 | 3300002075 | JGI24738J21930_10000027 | JGI24738J21930_1000002720 | 491 |
| 444 | 3300005330 | Ga0070690_100013207 | Ga0070690_1000132072 | 491 |
| 445 | 3300005331 | Ga0070670_100012044 | Ga0070670_1000120446 | 491 |
| 446 | 3300005334 | Ga0068869_100001996 | Ga0068869_1000019966 | 491 |
| 447 | 3300005335 | Ga0070666_10057578 | Ga0070666_100575782 | 491 |
| 448 | 3300005335 | Ga0070666_10059332 | Ga0070666_100593322 | 491 |
| 449 | 3300005338 | Ga0068868_100032545 | Ga0068868_1000325453 | 491 |
| 450 | 3300005339 | Ga0070660_100000767 | Ga0070660_10000076715 | 491 |
| 451 | 3300005344 | Ga0070661_100007808 | Ga0070661_1000078084 | 491 |
| 452 | 3300005344 | Ga0070661_100043650 | Ga0070661_1000436503 | 491 |
| 453 | 3300005347 | Ga0070668_100072193 | Ga0070668_1000721934 | 491 |
| 454 | 3300005353 | Ga0070669_100000699 | Ga0070669_10000069914 | 491 |
| 455 | 3300005354 | Ga0070675_100012015 | Ga0070675_1000120152 | 491 |
| 456 | 3300005355 | Ga0070671_100003886 | Ga0070671_1000038864 | 491 |
| 457 | 3300005355 | Ga0070671_100018748 | Ga0070671_1000187482 | 491 |
| 458 | 3300005356 | Ga0070674_100028068 | Ga0070674_1000280683 | 491 |
| 459 | 3300005364 | Ga0070673_100003743 | Ga0070673_1000037439 | 491 |
| 460 | 3300005366 | Ga0070659_100000753 | Ga0070659_10000075317 | 491 |
| 461 | 3300005366 | Ga0070659_100030220 | Ga0070659_1000302204 | 491 |
| 462 | 3300005367 | Ga0070667_100001558 | Ga0070667_1000015587 | 491 |
| 463 | 3300005367 | Ga0070667_100004197 | Ga0070667_1000041974 | 491 |
| 464 | 3300005444 | Ga0070694_100041086 | Ga0070694_1000410862 | 491 |
| 465 | 3300005457 | Ga0070662_100002248 | Ga0070662_1000022483 | 491 |
| 466 | 3300005539 | Ga0068853_100006221 | Ga0068853_1000062217 | 491 |
| 467 | 3300005543 | Ga0070672_100000234 | Ga0070672_10000023410 | 491 |
| 468 | 3300005543 | Ga0070672_100155391 | Ga0070672_1001553912 | 491 |
| 469 | 3300005548 | Ga0070665_100030502 | Ga0070665_1000305026 | 491 |
| 470 | 3300005548 | Ga0070665_100097864 | Ga0070665_1000978644 | 491 |
| 471 | 3300005563 | Ga0068855_100003156 | Ga0068855_10000315614 | 491 |
| 472 | 3300005563 | Ga0068855_100056306 | Ga0068855_1000563063 | 491 |
| 473 | 3300005564 | Ga0070664_100002747 | Ga0070664_1000027474 | 491 |
| 474 | 3300005564 | Ga0070664_100040646 | Ga0070664_1000406461 | 491 |
| 475 | 3300005577 | Ga0068857_100003650 | Ga0068857_1000036506 | 491 |
| 476 | 3300005577 | Ga0068857_100004327 | Ga0068857_1000043276 | 491 |
| 477 | 3300005577 | Ga0068857_100064545 | Ga0068857_1000645453 | 491 |
| 478 | 3300005578 | Ga0068854_100000061 | Ga0068854_10000006126 | 491 |
| 479 | 3300005614 | Ga0068856_100090626 | Ga0068856_1000906262 | 491 |
| 480 | 3300005616 | Ga0068852_100000847 | Ga0068852_1000008473 | 491 |
| 481 | 3300005617 | Ga0068859_100024318 | Ga0068859_1000243183 | 491 |
| 482 | 3300005617 | Ga0068859_100025027 | Ga0068859_1000250277 | 491 |
| 483 | 3300005617 | Ga0068859_100037329 | Ga0068859_1000373293 | 491 |
| 484 | 3300005618 | Ga0068864_100002131 | Ga0068864_1000021313 | 491 |
| 485 | 3300005618 | Ga0068864_100002488 | Ga0068864_1000024889 | 491 |
| 486 | 3300005618 | Ga0068864_100118777 | Ga0068864_1001187772 | 491 |
| 487 | 3300005841 | Ga0068863_100006673 | Ga0068863_1000066734 | 491 |
| 488 | 3300005842 | Ga0068858_100007137 | Ga0068858_1000071372 | 491 |
| 489 | 3300005842 | Ga0068858_100038487 | Ga0068858_1000384872 | 491 |
| 490 | 3300005843 | Ga0068860_100009742 | Ga0068860_1000097424 | 491 |
| 491 | 3300005843 | Ga0068860_100014764 | Ga0068860_1000147643 | 491 |
| 492 | 3300005843 | Ga0068860_100059152 | Ga0068860_1000591524 | 491 |
| 493 | 3300005843 | Ga0068860_100222950 | Ga0068860_1002229502 | 491 |
| 494 | 3300005844 | Ga0068862_100023491 | Ga0068862_1000234914 | 491 |
| 495 | 3300005844 | Ga0068862_100035008 | Ga0068862_1000350083 | 491 |
| 496 | 3300006237 | Ga0097621_100120820 | Ga0097621_1001208202 | 491 |
| 497 | 3300006847 | Ga0075431_100123846 | Ga0075431_1001238462 | 491 |
| 498 | 3300006881 | Ga0068865_100000434 | Ga0068865_1000004348 | 491 |
| 499 | 3300006931 | Ga0097620_100024317 | Ga0097620_1000243175 | 491 |
| 500 | 3300006931 | Ga0097620_100025028 | Ga0097620_1000250282 | 491 |
| 501 | 3300006931 | Ga0097620_100037328 | Ga0097620_1000373283 | 491 |
| 502 | 3300009011 | Ga0105251_10043986 | Ga0105251_100439863 | 491 |
| 503 | 3300009093 | Ga0105240_10200736 | Ga0105240_102007362 | 491 |
| 504 | 3300009098 | Ga0105245_10000424 | Ga0105245_1000042422 | 491 |
| 505 | 3300009148 | Ga0105243_10031215 | Ga0105243_100312153 | 491 |
| 506 | 3300009177 | Ga0105248_10000159 | Ga0105248_1000015918 | 491 |
| 507 | 3300009177 | Ga0105248_10031334 | Ga0105248_100313346 | 491 |
| 508 | 3300009551 | Ga0105238_10053533 | Ga0105238_100535336 | 491 |
| 509 | 3300009553 | Ga0105249_10019672 | Ga0105249_100196724 | 491 |
| 510 | 3300010375 | Ga0105239_10019413 | Ga0105239_100194133 | 491 |
| 511 | 3300010375 | Ga0105239_10051754 | Ga0105239_100517543 | 491 |
| 512 | 3300011119 | Ga0105246_10003940 | Ga0105246_100039407 | 491 |
| 513 | 3300013102 | Ga0157371_10003598 | Ga0157371_100035988 | 491 |
| 514 | 3300013297 | Ga0157378_10006264 | Ga0157378_100062645 | 491 |
| 515 | 3300013306 | Ga0163162_10013200 | Ga0163162_100132006 | 491 |
| 516 | 3300013308 | Ga0157375_10064297 | Ga0157375_100642973 | 491 |
| 517 | 3300014968 | Ga0157379_10001201 | Ga0157379_100012015 | 491 |
| 518 | 3300025315 | Ga0207697_10002358 | Ga0207697_100023587 | 491 |
| 519 | 3300025901 | Ga0207688_10000018 | Ga0207688_1000001831 | 491 |
| 520 | 3300025901 | Ga0207688_10026512 | Ga0207688_100265126 | 491 |
| 521 | 3300025903 | Ga0207680_10012998 | Ga0207680_100129983 | 491 |
| 522 | 3300025904 | Ga0207647_10000232 | Ga0207647_1000023230 | 491 |
| 523 | 3300025904 | Ga0207647_10000333 | Ga0207647_1000033319 | 491 |
| 524 | 3300025908 | Ga0207643_10055164 | Ga0207643_100551643 | 491 |
| 525 | 3300025919 | Ga0207657_10003142 | Ga0207657_1000314211 | 491 |
| 526 | 3300025919 | Ga0207657_10066083 | Ga0207657_100660834 | 491 |
| 527 | 3300025920 | Ga0207649_10008761 | Ga0207649_100087614 | 491 |
| 528 | 3300025920 | Ga0207649_10030987 | Ga0207649_100309873 | 491 |
| 529 | 3300025923 | Ga0207681_10001180 | Ga0207681_100011807 | 491 |
| 530 | 3300025925 | Ga0207650_10032714 | Ga0207650_100327142 | 491 |
| 531 | 3300025931 | Ga0207644_10000512 | Ga0207644_1000051215 | 491 |
| 532 | 3300025931 | Ga0207644_10007430 | Ga0207644_100074303 | 491 |
| 533 | 3300025932 | Ga0207690_10014349 | Ga0207690_100143494 | 491 |
| 534 | 3300025933 | Ga0207706_10000171 | Ga0207706_1000017121 | 491 |
| 535 | 3300025933 | Ga0207706_10002226 | Ga0207706_1000222612 | 491 |
| 536 | 3300025935 | Ga0207709_10028961 | Ga0207709_100289613 | 491 |
| 537 | 3300025937 | Ga0207669_10050360 | Ga0207669_100503602 | 491 |
| 538 | 3300025938 | Ga0207704_10001207 | Ga0207704_100012076 | 491 |
| 539 | 3300025940 | Ga0207691_10000070 | Ga0207691_1000007021 | 491 |
| 540 | 3300025940 | Ga0207691_10034316 | Ga0207691_100343163 | 491 |
| 541 | 3300025941 | Ga0207711_10002610 | Ga0207711_1000261010 | 491 |
| 542 | 3300025941 | Ga0207711_10012993 | Ga0207711_100129936 | 491 |
| 543 | 3300025942 | Ga0207689_10000123 | Ga0207689_100001233 | 491 |
| 544 | 3300025942 | Ga0207689_10017657 | Ga0207689_100176574 | 491 |
| 545 | 3300025945 | Ga0207679_10002516 | Ga0207679_100025169 | 491 |
| 546 | 3300025945 | Ga0207679_10017882 | Ga0207679_100178823 | 491 |
| 547 | 3300025949 | Ga0207667_10011731 | Ga0207667_100117317 | 491 |
| 548 | 3300025960 | Ga0207651_10000332 | Ga0207651_1000033210 | 491 |
| 549 | 3300025961 | Ga0207712_10000873 | Ga0207712_1000087315 | 491 |
| 550 | 3300025972 | Ga0207668_10067676 | Ga0207668_100676762 | 491 |
| 551 | 3300025981 | Ga0207640_10035086 | Ga0207640_100350863 | 491 |
| 552 | 3300025986 | Ga0207658_10048397 | Ga0207658_100483974 | 491 |
| 553 | 3300025986 | Ga0207658_10052764 | Ga0207658_100527642 | 491 |
| 554 | 3300026035 | Ga0207703_10005654 | Ga0207703_100056545 | 491 |
| 555 | 3300026041 | Ga0207639_10052430 | Ga0207639_100524305 | 491 |
| 556 | 3300026078 | Ga0207702_10005307 | Ga0207702_100053076 | 491 |
| 557 | 3300026088 | Ga0207641_10002327 | Ga0207641_100023277 | 491 |
| 558 | 3300026088 | Ga0207641_10012433 | Ga0207641_100124336 | 491 |
| 559 | 3300026089 | Ga0207648_10000317 | Ga0207648_1000031736 | 491 |
| 560 | 3300026095 | Ga0207676_10001136 | Ga0207676_1000113614 | 491 |
| 561 | 3300026095 | Ga0207676_10010624 | Ga0207676_100106244 | 491 |
| 562 | 3300026116 | Ga0207674_10000937 | Ga0207674_1000093719 | 491 |
| 563 | 3300026116 | Ga0207674_10001303 | Ga0207674_1000130323 | 491 |
| 564 | 3300026116 | Ga0207674_10008395 | Ga0207674_100083956 | 491 |
| 565 | 3300026118 | Ga0207675_100022045 | Ga0207675_1000220456 | 491 |
| 566 | 3300028379 | Ga0268266_10021182 | Ga0268266_100211822 | 491 |
| 567 | 3300028379 | Ga0268266_10024362 | Ga0268266_100243622 | 491 |
| 568 | 3300028380 | Ga0268265_10008194 | Ga0268265_100081944 | 491 |
| 569 | 3300028381 | Ga0268264_10000567 | Ga0268264_1000056721 | 491 |
| 570 | 3300028381 | Ga0268264_10002173 | Ga0268264_100021737 | 491 |
| 571 | 3300037418 | Ga0395900_0004869 | Ga0395900_0004869_1420_2958 | 491 |
| 572 | 3300042004 | Ga0439445_0002579 | Ga0439445_0002579_1380_2918 | 491 |
| 573 | 3300042439 | Ga0439464_0000713 | Ga0439464_0000713_4675_6210 | 491 |
| 574 | 3300044694 | Ga0466963_0000815 | Ga0466963_0000815_4000_5535 | 491 |
| 575 | 3300044842 | Ga0466957_0001952 | Ga0466957_0001952_5138_6673 | 491 |
| 576 | 3300045976 | Ga0466967_0002752 | Ga0466967_0002752_4140_5675 | 491 |
| 577 | 3300050510 | nmdc:mga06r32_19192_c1 | nmdc:mga06r32_19192_c1_4549_6090 | 491 |
| 578 | 3300005331 | Ga0070670_100006640 | Ga0070670_10000664013 | 492 |
| 579 | 3300005331 | Ga0070670_100129327 | Ga0070670_1001293271 | 492 |
| 580 | 3300005353 | Ga0070669_100014681 | Ga0070669_1000146812 | 492 |
| 581 | 3300005455 | Ga0070663_100048258 | Ga0070663_1000482582 | 492 |
| 582 | 3300005455 | Ga0070663_100066749 | Ga0070663_1000667492 | 492 |
| 583 | 3300005564 | Ga0070664_100007368 | Ga0070664_1000073682 | 492 |
| 584 | 3300005577 | Ga0068857_100013071 | Ga0068857_1000130716 | 492 |
| 585 | 3300005617 | Ga0068859_100003001 | Ga0068859_1000030018 | 492 |
| 586 | 3300005719 | Ga0068861_100066733 | Ga0068861_1000667333 | 492 |
| 587 | 3300005842 | Ga0068858_100037115 | Ga0068858_1000371152 | 492 |
| 588 | 3300005844 | Ga0068862_100048188 | Ga0068862_1000481885 | 492 |
| 589 | 3300006931 | Ga0097620_100003001 | Ga0097620_1000030017 | 492 |
| 590 | 3300009553 | Ga0105249_10011234 | Ga0105249_100112342 | 492 |
| 591 | 3300025315 | Ga0207697_10002531 | Ga0207697_100025317 | 492 |
| 592 | 3300025907 | Ga0207645_10008012 | Ga0207645_100080123 | 492 |
| 593 | 3300025923 | Ga0207681_10001989 | Ga0207681_100019896 | 492 |
| 594 | 3300025925 | Ga0207650_10099346 | Ga0207650_100993464 | 492 |
| 595 | 3300025933 | Ga0207706_10019005 | Ga0207706_100190055 | 492 |
| 596 | 3300025933 | Ga0207706_10046960 | Ga0207706_100469602 | 492 |
| 597 | 3300025972 | Ga0207668_10002284 | Ga0207668_100022844 | 492 |
| 598 | 3300025981 | Ga0207640_10099237 | Ga0207640_100992372 | 492 |
| 599 | 3300026067 | Ga0207678_10014684 | Ga0207678_100146846 | 492 |
| 600 | 3300026067 | Ga0207678_10090619 | Ga0207678_100906192 | 492 |
| 601 | 3300026095 | Ga0207676_10160767 | Ga0207676_101607672 | 492 |
| 602 | 3300026116 | Ga0207674_10012673 | Ga0207674_100126739 | 492 |
| 603 | 3300026118 | Ga0207675_100098758 | Ga0207675_1000987583 | 492 |
| 604 | 3300028380 | Ga0268265_10010028 | Ga0268265_100100288 | 492 |
| 605 | 3300037312 | Ga0395899_0013362 | Ga0395899_0013362_2901_4436 | 492 |
| 606 | 3300037418 | Ga0395900_0043596 | Ga0395900_0043596_2104_3639 | 492 |
| 607 | 3300037471 | Ga0395905_0000104 | Ga0395905_0000104_43696_45231 | 492 |
| 608 | 3300042005 | Ga0439448_0001144 | Ga0439448_0001144_1685_3220 | 492 |
| 609 | 3300044901 | Ga0466960_0044746 | Ga0466960_0044746_167_1702 | 492 |
| 610 | 3300005842 | Ga0068858_100051634 | Ga0068858_1000516342 | 494 |
| 611 | 3300049744 | Ga0501083_0044244 | Ga0501083_0044244_1167_2699 | 494 |
| 612 | 3300053087 | Ga0500643_000006 | Ga0500643_000006_188576_190108 | 494 |
| 613 | 3300053139 | Ga0500568_0005404 | Ga0500568_0005404_1009_2541 | 494 |
| 614 | 3300013297 | Ga0157378_10000018 | Ga0157378_1000001870 | 498 |
| 615 | 3300049571 | Ga0501034_0200126 | Ga0501034_0200126_295_1869 | 498 |
| 616 | 3300001904 | JGI24736J21556_1002566 | JGI24736J21556_10025664 | 500 |
| 617 | 3300001979 | JGI24740J21852_10025113 | JGI24740J21852_100251132 | 500 |
| 618 | 3300001989 | JGI24739J22299_10001257 | JGI24739J22299_100012574 | 500 |
| 619 | 3300001989 | JGI24739J22299_10015261 | JGI24739J22299_100152612 | 500 |
| 620 | 3300005295 | Ga0065707_10089113 | Ga0065707_100891134 | 500 |
| 621 | 3300005327 | Ga0070658_10004633 | Ga0070658_100046334 | 500 |
| 622 | 3300005457 | Ga0070662_100034495 | Ga0070662_1000344952 | 500 |
| 623 | 3300005564 | Ga0070664_100007907 | Ga0070664_1000079074 | 500 |
| 624 | 3300005577 | Ga0068857_100037783 | Ga0068857_1000377833 | 500 |
| 625 | 3300005578 | Ga0068854_100004904 | Ga0068854_1000049048 | 500 |
| 626 | 3300005616 | Ga0068852_100024513 | Ga0068852_1000245134 | 500 |
| 627 | 3300005834 | Ga0068851_10014735 | Ga0068851_100147354 | 500 |
| 628 | 3300005842 | Ga0068858_100001674 | Ga0068858_1000016742 | 500 |
| 629 | 3300006353 | Ga0075370_10007682 | Ga0075370_100076822 | 500 |
| 630 | 3300013104 | Ga0157370_10030792 | Ga0157370_100307925 | 500 |
| 631 | 3300025292 | Ga0209676_1000273 | Ga0209676_100027381 | 500 |
| 632 | 3300025304 | Ga0209257_1000458 | Ga0209257_100045822 | 500 |
| 633 | 3300025321 | Ga0207656_10019188 | Ga0207656_100191881 | 500 |
| 634 | 3300025904 | Ga0207647_10014933 | Ga0207647_100149335 | 500 |
| 635 | 3300025909 | Ga0207705_10016137 | Ga0207705_100161374 | 500 |
| 636 | 3300025911 | Ga0207654_10008896 | Ga0207654_100088964 | 500 |
| 637 | 3300025914 | Ga0207671_10000841 | Ga0207671_1000084119 | 500 |
| 638 | 3300025924 | Ga0207694_10002118 | Ga0207694_1000211813 | 500 |
| 639 | 3300025981 | Ga0207640_10034778 | Ga0207640_100347784 | 500 |
| 640 | 3300025981 | Ga0207640_10048529 | Ga0207640_100485291 | 500 |
| 641 | 3300026035 | Ga0207703_10006383 | Ga0207703_100063832 | 500 |
| 642 | 3300026041 | Ga0207639_10090113 | Ga0207639_100901132 | 500 |
| 643 | 3300026078 | Ga0207702_10003048 | Ga0207702_100030485 | 500 |
| 644 | 3300026142 | Ga0207698_10003405 | Ga0207698_100034052 | 500 |
| 645 | 3300026142 | Ga0207698_10005663 | Ga0207698_100056632 | 500 |
| 646 | 3300031548 | Ga0307408_100006789 | Ga0307408_1000067895 | 500 |
| 647 | 3300031731 | Ga0307405_10002100 | Ga0307405_100021006 | 500 |
| 648 | 3300031901 | Ga0307406_10002601 | Ga0307406_100026014 | 500 |
| 649 | 3300031911 | Ga0307412_10002490 | Ga0307412_100024906 | 500 |
| 650 | 3300032002 | Ga0307416_100013524 | Ga0307416_1000135242 | 500 |
| 651 | 3300046660 | Ga0495625_0014697 | Ga0495625_0014697_3948_5507 | 500 |
| 652 | 3300050496 | nmdc:mga07m45_3124_c1 | nmdc:mga07m45_3124_c1_978_2525 | 500 |
| 653 | 3300053087 | Ga0500643_000232 | Ga0500643_000232_27234_28769 | 500 |
| 654 | 3300053156 | Ga0500622_0000165 | Ga0500622_0000165_64982_66529 | 500 |
| 655 | 3300005347 | Ga0070668_100123140 | Ga0070668_1001231403 | 501 |
| 656 | 3300005455 | Ga0070663_100083195 | Ga0070663_1000831952 | 501 |
| 657 | 3300005578 | Ga0068854_100005672 | Ga0068854_1000056724 | 501 |
| 658 | 3300009093 | Ga0105240_10102679 | Ga0105240_101026792 | 501 |
| 659 | 3300013105 | Ga0157369_10000385 | Ga0157369_1000038556 | 501 |
| 660 | 3300013307 | Ga0157372_10099151 | Ga0157372_100991512 | 501 |
| 661 | 3300025893 | Ga0207682_10003777 | Ga0207682_100037773 | 501 |
| 662 | 3300025942 | Ga0207689_10008724 | Ga0207689_100087245 | 501 |
| 663 | 3300025945 | Ga0207679_10132261 | Ga0207679_101322611 | 501 |
| 664 | 3300025949 | Ga0207667_10021710 | Ga0207667_100217103 | 501 |
| 665 | 3300025981 | Ga0207640_10002840 | Ga0207640_100028404 | 501 |
| 666 | 3300026041 | Ga0207639_10085102 | Ga0207639_100851023 | 501 |
| 667 | 3300026078 | Ga0207702_10008058 | Ga0207702_100080586 | 501 |
| 668 | 3300037312 | Ga0395899_0068026 | Ga0395899_0068026_282_1817 | 501 |
| 669 | 3300037418 | Ga0395900_0164563 | Ga0395900_0164563_668_2203 | 501 |
| 670 | 3300044656 | Ga0466969_0048135 | Ga0466969_0048135_216_1751 | 501 |
| 671 | 3300044684 | Ga0466966_0000052 | Ga0466966_0000052_14706_16241 | 501 |
| 672 | 3300044693 | Ga0466961_0034809 | Ga0466961_0034809_519_2054 | 501 |
| 673 | 3300044694 | Ga0466963_0024046 | Ga0466963_0024046_447_1982 | 501 |
| 674 | 3300044719 | Ga0466971_0012210 | Ga0466971_0012210_978_2513 | 501 |
| 675 | 3300044765 | Ga0466970_0076593 | Ga0466970_0076593_212_1747 | 501 |
| 676 | 3300045836 | Ga0466958_0000611 | Ga0466958_0000611_10747_12282 | 501 |
| 677 | 3300005327 | Ga0070658_10033056 | Ga0070658_100330563 | 502 |
| 678 | 3300005335 | Ga0070666_10053109 | Ga0070666_100531092 | 502 |
| 679 | 3300005338 | Ga0068868_100020578 | Ga0068868_1000205783 | 502 |
| 680 | 3300005355 | Ga0070671_100022038 | Ga0070671_1000220383 | 502 |
| 681 | 3300005364 | Ga0070673_100009898 | Ga0070673_1000098985 | 502 |
| 682 | 3300005364 | Ga0070673_100072205 | Ga0070673_1000722052 | 502 |
| 683 | 3300005367 | Ga0070667_100026747 | Ga0070667_1000267473 | 502 |
| 684 | 3300005457 | Ga0070662_100032902 | Ga0070662_1000329022 | 502 |
| 685 | 3300005459 | Ga0068867_100011915 | Ga0068867_1000119152 | 502 |
| 686 | 3300005617 | Ga0068859_100086978 | Ga0068859_1000869783 | 502 |
| 687 | 3300005834 | Ga0068851_10022284 | Ga0068851_100222843 | 502 |
| 688 | 3300005842 | Ga0068858_100024881 | Ga0068858_1000248816 | 502 |
| 689 | 3300006237 | Ga0097621_100034584 | Ga0097621_1000345843 | 502 |
| 690 | 3300006881 | Ga0068865_100028784 | Ga0068865_1000287843 | 502 |
| 691 | 3300006931 | Ga0097620_100086981 | Ga0097620_1000869812 | 502 |
| 692 | 3300009098 | Ga0105245_10222158 | Ga0105245_102221582 | 502 |
| 693 | 3300009177 | Ga0105248_10119460 | Ga0105248_101194603 | 502 |
| 694 | 3300010375 | Ga0105239_10265085 | Ga0105239_102650851 | 502 |
| 695 | 3300013297 | Ga0157378_10022160 | Ga0157378_100221605 | 502 |
| 696 | 3300014969 | Ga0157376_10044100 | Ga0157376_100441004 | 502 |
| 697 | 3300025919 | Ga0207657_10009428 | Ga0207657_100094288 | 502 |
| 698 | 3300025919 | Ga0207657_10030517 | Ga0207657_100305174 | 502 |
| 699 | 3300025931 | Ga0207644_10016807 | Ga0207644_100168074 | 502 |
| 700 | 3300025933 | Ga0207706_10002480 | Ga0207706_1000248011 | 502 |
| 701 | 3300025938 | Ga0207704_10067513 | Ga0207704_100675131 | 502 |
| 702 | 3300025940 | Ga0207691_10012078 | Ga0207691_100120788 | 502 |
| 703 | 3300025941 | Ga0207711_10086011 | Ga0207711_100860112 | 502 |
| 704 | 3300025960 | Ga0207651_10033606 | Ga0207651_100336063 | 502 |
| 705 | 3300026023 | Ga0207677_10016237 | Ga0207677_100162372 | 502 |
| 706 | 3300026035 | Ga0207703_10017446 | Ga0207703_100174462 | 502 |
| 707 | 3300026089 | Ga0207648_10078277 | Ga0207648_100782772 | 502 |
| 708 | 3300048903 | Ga0496100_0012996 | Ga0496100_0012996_2394_3938 | 502 |
| 709 | 3300048904 | Ga0496101_0002179 | Ga0496101_0002179_4635_6179 | 502 |
| 710 | 3300048905 | Ga0496102_0016769 | Ga0496102_0016769_2132_3676 | 502 |
| 711 | 3300048908 | Ga0496105_0024060 | Ga0496105_0024060_854_2398 | 502 |
| 712 | 3300048912 | Ga0496109_0009291 | Ga0496109_0009291_5741_7285 | 502 |
| 713 | 3300001904 | JGI24736J21556_1001268 | JGI24736J21556_10012682 | 504 |
| 714 | 3300001915 | JGI24741J21665_1008183 | JGI24741J21665_10081831 | 504 |
| 715 | 3300001979 | JGI24740J21852_10023866 | JGI24740J21852_100238662 | 504 |
| 716 | 3300005329 | Ga0070683_100206723 | Ga0070683_1002067231 | 504 |
| 717 | 3300005339 | Ga0070660_100021183 | Ga0070660_1000211832 | 504 |
| 718 | 3300005344 | Ga0070661_100006327 | Ga0070661_1000063274 | 504 |
| 719 | 3300005435 | Ga0070714_100096013 | Ga0070714_1000960132 | 504 |
| 720 | 3300009093 | Ga0105240_10205940 | Ga0105240_102059402 | 504 |
| 721 | 3300009551 | Ga0105238_10052066 | Ga0105238_100520662 | 504 |
| 722 | 3300010375 | Ga0105239_10153247 | Ga0105239_101532472 | 504 |
| 723 | 3300013104 | Ga0157370_10054688 | Ga0157370_100546882 | 504 |
| 724 | 3300025904 | Ga0207647_10013372 | Ga0207647_100133722 | 504 |
| 725 | 3300025909 | Ga0207705_10000059 | Ga0207705_1000005931 | 504 |
| 726 | 3300025909 | Ga0207705_10001692 | Ga0207705_1000169213 | 504 |
| 727 | 3300025913 | Ga0207695_10048837 | Ga0207695_100488373 | 504 |
| 728 | 3300025920 | Ga0207649_10004902 | Ga0207649_100049022 | 504 |
| 729 | 3300025924 | Ga0207694_10038326 | Ga0207694_100383262 | 504 |
| 730 | 3300025949 | Ga0207667_10048962 | Ga0207667_100489623 | 504 |
| 731 | 3300026078 | Ga0207702_10020863 | Ga0207702_100208632 | 504 |
| 732 | 3300026142 | Ga0207698_10057375 | Ga0207698_100573752 | 504 |
| 733 | 3300037312 | Ga0395899_0023792 | Ga0395899_0023792_2355_3899 | 504 |
| 734 | 3300038443 | Ga0395901_0059393 | Ga0395901_0059393_962_2506 | 504 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y58-assembly1.cif.gz_A | cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus | 0.8297 | 26 | 494 |
| 8pnl-assembly1.cif.gz_A | outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody | 0.8 | 26 | 488 |
| 7d5q-assembly1.cif.gz_A | structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.7887 | 24 | 491 |
| 7d5q-assembly1.cif.gz_A | structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.787 | 24 | 491 |
| 7y58-assembly1.cif.gz_A | cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus | 0.7784 | 26 | 494 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEJ0_15_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9543 | 18 | 214 | 1.20.1250.20 |
| af_P9WG87_21_208_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9455 | 26 | 199 | 1.20.1250.20 |
| af_P36554_12_217_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9298 | 26 | 216 | 1.20.1250.20 |
| af_P9WG91_8_214_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9247 | 18 | 213 | 1.20.1250.20 |
| af_Q2G2W1_141_346_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9211 | 26 | 213 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1U0X0-F1-model_v4 | MFS transporter | 0.9361 | 18 | 155 |
GO:0005886
GO:0022857 |
| AF-A0A7X7SSR9-F1-model_v4 | MFS transporter | 0.9286 | 26 | 183 |
GO:0016020
GO:0022857 |
| AF-A0A2E6BHY6-F1-model_v4 | MFS transporter | 0.9246 | 26 | 153 |
GO:0005886
GO:0022857 |
| AF-A0A3S1U0X0-F1-model_v4 | MFS transporter | 0.9105 | 18 | 155 |
GO:0005886
GO:0022857 |
| AF-A0A524MXG0-F1-model_v4 | MFS transporter | 0.9039 | 264 | 492 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar