F478142

General Info

Members Datasets Scaffolds Average Seq Length
734 237 734 492

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1000273|Ga0209676_100027381
Length 519
Sequence VSAAGAQRAGNEGHSSTILTGTTLLLAGVVLAVSNFMVVLDTTIANVSVAHIAGGLGISSSEGTWVITSYAVAEAICVPLTGWLSRRLGTVKLFAGGMLGFGIFSFLCGTATSLTMLIAFRIGQGICGGPLMALSQTLLLRVFPKDKHAMTMGIWAMTTLTAPIFGPILGGTISDSWGWHWIFFINVPVAAICAFTAWTVLRKAETEKVSEPVDGFGLVLLVLWVGALQLMLDLGREHDWFSADIIIQLAIIAIVGFASFLIWELTADKPVVDLRPFRHRGFTVSVIALVFAYGTFFASLVVIPQWLQGAMGYTATWAGYATAFNGVAAVLMAPIVAKRMTEVDPRRLVFIGVLWLAGTSLLRVFWWNSGSDFWTLALPQLIQGAGMPFFFVPLTTIALGAVDEEETASAAGVMNFLRTMAGAVAVAISTTLWYDGAQEKRDGLSGVLHGTQAAIDGMMAKGYSLEQARLIVSQMVDKEATALATGQTFVWAAFVFAAAASIIWLAPRPTRAVDTSSVH

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 2.45
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001268 3300001904 Bacteria 4640
2 JGI24736J21556_1002566 3300001904 Bacteria 3200
3 JGI24741J21665_1008183 3300001915 Bacteria 1985
4 JGI24740J21852_10000395 3300001979 Bacteria 18718
5 JGI24740J21852_10023866 3300001979 Bacteria 2082
6 JGI24740J21852_10025113 3300001979 Bacteria 2013
7 JGI24739J22299_10001257 3300001989 Bacteria 9505
8 JGI24739J22299_10015261 3300001989 Bacteria 2790
9 JGI24739J22299_10018892 3300001989 Bacteria 2472
10 JGI24737J22298_10000051 3300001990 Bacteria 34099
11 JGI24737J22298_10000165 3300001990 Bacteria 21156
12 JGI24737J22298_10004914 3300001990 Bacteria 4634
13 JGI24743J22301_10004952 3300001991 Bacteria 2197
14 JGI24735J21928_10002842 3300002067 Bacteria 5972
15 JGI24750J21931_1000372 3300002070 Bacteria 7592
16 JGI24748J21848_1000049 3300002074 Bacteria 56032
17 JGI24738J21930_10000027 3300002075 Bacteria 27178
18 JGI24738J21930_10004118 3300002075 Bacteria 3589
19 JGI24749J21850_1000068 3300002076 Bacteria 18789
20 JGI24744J21845_10002683 3300002077 Bacteria 3628
21 JGI24034J26672_10000033 3300002239 Bacteria 88341
22 JGI24751J29686_10000400 3300002459 Bacteria 14104
23 JGI24751J29686_10003332 3300002459 Bacteria 3239
24 rootH2_10040129 3300003320 Bacteria 3170
25 Ga0055531_10000021 3300003794 Bacteria 167213
26 Ga0065707_10082133 3300005295 Bacteria 21190
27 Ga0065707_10089113 3300005295 Bacteria 4466
28 Ga0065707_10096768 3300005295 Bacteria 3235
29 Ga0070658_10004633 3300005327 Bacteria 11178
30 Ga0070658_10033056 3300005327 Bacteria 4160
31 Ga0070658_10052651 3300005327 Bacteria 3302
32 Ga0070658_10055565 3300005327 Bacteria 3216
33 Ga0070658_10112571 3300005327 Bacteria 2256
34 Ga0070658_10131856 3300005327 Bacteria 2083
35 Ga0070676_10004834 3300005328 Bacteria 7128
36 Ga0070676_10043886 3300005328 Bacteria 2600
37 Ga0070683_100020582 3300005329 Bacteria 5871
38 Ga0070683_100206723 3300005329 Bacteria 1865
39 Ga0070690_100000014 3300005330 Bacteria 87494
40 Ga0070690_100013207 3300005330 Bacteria 4876
41 Ga0070670_100000047 3300005331 Bacteria 136625
42 Ga0070670_100006640 3300005331 Bacteria 9806
43 Ga0070670_100012044 3300005331 Bacteria 7399
44 Ga0070670_100117212 3300005331 Bacteria 2297
45 Ga0070670_100129327 3300005331 Bacteria 2180
46 Ga0070677_10000829 3300005333 Bacteria 10143
47 Ga0068869_100001996 3300005334 Bacteria 12259
48 Ga0070666_10000027 3300005335 Bacteria 151010
49 Ga0070666_10024010 3300005335 Bacteria 3970
50 Ga0070666_10053109 3300005335 Bacteria 2732
51 Ga0070666_10057578 3300005335 Bacteria 2626
52 Ga0070666_10059332 3300005335 Bacteria 2588
53 Ga0070680_100007272 3300005336 Bacteria 8438
54 Ga0070682_100016005 3300005337 Bacteria 4355
55 Ga0070682_100103904 3300005337 Bacteria 1881
56 Ga0068868_100020578 3300005338 Bacteria 4960
57 Ga0068868_100032545 3300005338 Bacteria 4012
58 Ga0070660_100000767 3300005339 Bacteria 21303
59 Ga0070660_100021183 3300005339 Bacteria 4790
60 Ga0070660_100023164 3300005339 Bacteria 4599
61 Ga0070660_100038535 3300005339 Bacteria 3629
62 Ga0070660_100075152 3300005339 Bacteria 2645
63 Ga0070689_100001657 3300005340 Bacteria 14241
64 Ga0070689_100050373 3300005340 Bacteria 3217
65 Ga0070691_10003231 3300005341 Bacteria 7305
66 Ga0070661_100006327 3300005344 Bacteria 8169
67 Ga0070661_100007808 3300005344 Bacteria 7385
68 Ga0070661_100014597 3300005344 Bacteria 5538
69 Ga0070661_100024568 3300005344 Bacteria 4322
70 Ga0070661_100032766 3300005344 Bacteria 3762
71 Ga0070661_100043650 3300005344 Bacteria 3275
72 Ga0070668_100006365 3300005347 Bacteria 8747
73 Ga0070668_100018826 3300005347 Bacteria 5187
74 Ga0070668_100033901 3300005347 Bacteria 3890
75 Ga0070668_100072193 3300005347 Bacteria 2689
76 Ga0070668_100123140 3300005347 Bacteria 2075
77 Ga0070669_100000099 3300005353 Bacteria 85328
78 Ga0070669_100000162 3300005353 Bacteria 58781
79 Ga0070669_100000699 3300005353 Bacteria 24602
80 Ga0070669_100005466 3300005353 Bacteria 9170
81 Ga0070669_100014681 3300005353 Bacteria 5575
82 Ga0070675_100003584 3300005354 Bacteria 11805
83 Ga0070675_100012015 3300005354 Bacteria 6788
84 Ga0070675_100149121 3300005354 Bacteria 2004
85 Ga0070671_100003886 3300005355 Bacteria 11743
86 Ga0070671_100007605 3300005355 Bacteria 8666
87 Ga0070671_100018586 3300005355 Bacteria 5647
88 Ga0070671_100018748 3300005355 Bacteria 5624
89 Ga0070671_100022038 3300005355 Bacteria 5204
90 Ga0070671_100022628 3300005355 Bacteria 5134
91 Ga0070671_100107298 3300005355 Bacteria 2345
92 Ga0070674_100003989 3300005356 Bacteria 8364
93 Ga0070674_100028068 3300005356 Bacteria 3694
94 Ga0070673_100003743 3300005364 Bacteria 9537
95 Ga0070673_100009898 3300005364 Bacteria 6423
96 Ga0070673_100072205 3300005364 Bacteria 2775
97 Ga0070659_100000753 3300005366 Bacteria 23494
98 Ga0070659_100027561 3300005366 Bacteria 4379
99 Ga0070659_100030220 3300005366 Bacteria 4191
100 Ga0070659_100036766 3300005366 Bacteria 3817
101 Ga0070659_100044578 3300005366 Bacteria 3473
102 Ga0070659_100051876 3300005366 Bacteria 3225
103 Ga0070667_100001558 3300005367 Bacteria 20556
104 Ga0070667_100001726 3300005367 Bacteria 19526
105 Ga0070667_100004197 3300005367 Bacteria 12165
106 Ga0070667_100006262 3300005367 Bacteria 9895
107 Ga0070667_100026747 3300005367 Bacteria 4800
108 Ga0070714_100041839 3300005435 Bacteria 3868
109 Ga0070714_100096013 3300005435 Bacteria 2604
110 Ga0070694_100041086 3300005444 Bacteria 3083
111 Ga0070663_100007411 3300005455 Bacteria 6676
112 Ga0070663_100048258 3300005455 Bacteria 3018
113 Ga0070663_100066749 3300005455 Bacteria 2607
114 Ga0070663_100083195 3300005455 Bacteria 2356
115 Ga0070678_100013659 3300005456 Bacteria 5101
116 Ga0070662_100002248 3300005457 Bacteria 11841
117 Ga0070662_100032902 3300005457 Bacteria 3648
118 Ga0070662_100034495 3300005457 Bacteria 3568
119 Ga0070662_100115658 3300005457 Bacteria 2049
120 Ga0068867_100011915 3300005459 Bacteria 6142
121 Ga0070685_10000101 3300005466 Bacteria 54043
122 Ga0068853_100006221 3300005539 Bacteria 9456
123 Ga0068853_100007344 3300005539 Bacteria 8818
124 Ga0068853_100036633 3300005539 Bacteria 4173
125 Ga0068853_100094723 3300005539 Bacteria 2631
126 Ga0070672_100000234 3300005543 Bacteria 31015
127 Ga0070672_100001207 3300005543 Bacteria 15822
128 Ga0070672_100155391 3300005543 Bacteria 1894
129 Ga0070686_100000010 3300005544 Bacteria 192116
130 Ga0070665_100000254 3300005548 Bacteria 88587
131 Ga0070665_100003744 3300005548 Bacteria 16104
132 Ga0070665_100011289 3300005548 Bacteria 9034
133 Ga0070665_100016958 3300005548 Bacteria 7303
134 Ga0070665_100018536 3300005548 Bacteria 6975
135 Ga0070665_100030502 3300005548 Bacteria 5424
136 Ga0070665_100097864 3300005548 Bacteria 2939
137 Ga0070665_100177255 3300005548 Bacteria 2132
138 Ga0068855_100001164 3300005563 Bacteria 32603
139 Ga0068855_100001723 3300005563 Bacteria 27344
140 Ga0068855_100003156 3300005563 Bacteria 20171
141 Ga0068855_100056306 3300005563 Bacteria 4614
142 Ga0070664_100002457 3300005564 Bacteria 14923
143 Ga0070664_100002747 3300005564 Bacteria 14203
144 Ga0070664_100007368 3300005564 Bacteria 8872
145 Ga0070664_100007907 3300005564 Bacteria 8589
146 Ga0070664_100040646 3300005564 Bacteria 3921
147 Ga0068857_100003650 3300005577 Bacteria 12902
148 Ga0068857_100004327 3300005577 Bacteria 11979
149 Ga0068857_100005444 3300005577 Bacteria 10855
150 Ga0068857_100007919 3300005577 Bacteria 9169
151 Ga0068857_100013071 3300005577 Bacteria 7233
152 Ga0068857_100037783 3300005577 Bacteria 4278
153 Ga0068857_100064545 3300005577 Bacteria 3256
154 Ga0068857_100084161 3300005577 Bacteria 2842
155 Ga0068854_100000061 3300005578 Bacteria 78663
156 Ga0068854_100001151 3300005578 Bacteria 15907
157 Ga0068854_100004904 3300005578 Bacteria 8442
158 Ga0068854_100005672 3300005578 Bacteria 7888
159 Ga0068854_100010327 3300005578 Bacteria 6050
160 Ga0068854_100025690 3300005578 Bacteria 4041
161 Ga0068854_100027723 3300005578 Bacteria 3907
162 Ga0068854_100076804 3300005578 Bacteria 2456
163 Ga0068856_100000449 3300005614 Bacteria 45445
164 Ga0068856_100004411 3300005614 Bacteria 14026
165 Ga0068856_100046595 3300005614 Bacteria 4270
166 Ga0068856_100058084 3300005614 Bacteria 3821
167 Ga0068856_100090626 3300005614 Bacteria 3041
168 Ga0068852_100000847 3300005616 Bacteria 20320
169 Ga0068852_100001197 3300005616 Bacteria 17227
170 Ga0068852_100013939 3300005616 Bacteria 6165
171 Ga0068852_100024513 3300005616 Bacteria 4877
172 Ga0068859_100000324 3300005617 Bacteria 47483
173 Ga0068859_100003001 3300005617 Bacteria 17114
174 Ga0068859_100011614 3300005617 Bacteria 8858
175 Ga0068859_100024123 3300005617 Bacteria 6104
176 Ga0068859_100024318 3300005617 Bacteria 6079
177 Ga0068859_100025027 3300005617 Bacteria 5992
178 Ga0068859_100037329 3300005617 Bacteria 4876
179 Ga0068859_100069451 3300005617 Bacteria 3558
180 Ga0068859_100086978 3300005617 Bacteria 3172
181 Ga0068859_100101242 3300005617 Bacteria 2938
182 Ga0068864_100000051 3300005618 Bacteria 136621
183 Ga0068864_100000743 3300005618 Bacteria 27310
184 Ga0068864_100002131 3300005618 Bacteria 16369
185 Ga0068864_100002488 3300005618 Bacteria 15223
186 Ga0068864_100007461 3300005618 Bacteria 9008
187 Ga0068864_100024966 3300005618 Bacteria 5029
188 Ga0068864_100118777 3300005618 Bacteria 2361
189 Ga0068861_100011286 3300005719 Bacteria 6204
190 Ga0068861_100023488 3300005719 Bacteria 4448
191 Ga0068861_100066733 3300005719 Bacteria 2774
192 Ga0068861_100072992 3300005719 Bacteria 2664
193 Ga0068851_10014735 3300005834 Bacteria 3716
194 Ga0068851_10019078 3300005834 Bacteria 3313
195 Ga0068851_10022284 3300005834 Bacteria 3083
196 Ga0068863_100000214 3300005841 Bacteria 62106
197 Ga0068863_100006673 3300005841 Bacteria 11329
198 Ga0068863_100007339 3300005841 Bacteria 10790
199 Ga0068863_100069572 3300005841 Bacteria 3328
200 Ga0068858_100001674 3300005842 Bacteria 22661
201 Ga0068858_100006175 3300005842 Bacteria 11685
202 Ga0068858_100006917 3300005842 Bacteria 11021
203 Ga0068858_100007137 3300005842 Bacteria 10853
204 Ga0068858_100007575 3300005842 Bacteria 10488
205 Ga0068858_100024881 3300005842 Bacteria 5574
206 Ga0068858_100037115 3300005842 Bacteria 4517
207 Ga0068858_100038487 3300005842 Bacteria 4436
208 Ga0068858_100040082 3300005842 Bacteria 4343
209 Ga0068858_100051634 3300005842 Bacteria 3804
210 Ga0068860_100000080 3300005843 Bacteria 170152
211 Ga0068860_100000353 3300005843 Bacteria 61803
212 Ga0068860_100009742 3300005843 Bacteria 9538
213 Ga0068860_100011757 3300005843 Bacteria 8626
214 Ga0068860_100014764 3300005843 Bacteria 7639
215 Ga0068860_100032025 3300005843 Bacteria 5055
216 Ga0068860_100059152 3300005843 Bacteria 3644
217 Ga0068860_100107896 3300005843 Bacteria 2661
218 Ga0068860_100222950 3300005843 Bacteria 1831
219 Ga0068862_100000036 3300005844 Bacteria 173453
220 Ga0068862_100000198 3300005844 Bacteria 66534
221 Ga0068862_100000357 3300005844 Bacteria 49510
222 Ga0068862_100018625 3300005844 Bacteria 5784
223 Ga0068862_100023491 3300005844 Bacteria 5167
224 Ga0068862_100028554 3300005844 Bacteria 4699
225 Ga0068862_100035008 3300005844 Bacteria 4250
226 Ga0068862_100048188 3300005844 Bacteria 3638
227 Ga0068862_100076145 3300005844 Bacteria 2904
228 Ga0081455_10000564 3300005937 Bacteria 48268
229 Ga0081455_10004231 3300005937 Bacteria 16183
230 Ga0081455_10065401 3300005937 Bacteria 3041
231 Ga0081539_10058522 3300005985 Bacteria 2126
232 Ga0075366_10007553 3300006195 Bacteria 6013
233 Ga0097621_100020152 3300006237 Bacteria 5135
234 Ga0097621_100034584 3300006237 Bacteria 4032
235 Ga0097621_100120820 3300006237 Bacteria 2222
236 Ga0097621_100123826 3300006237 Bacteria 2195
237 Ga0075370_10004706 3300006353 Bacteria 6665
238 Ga0075370_10007682 3300006353 Bacteria 5506
239 Ga0068871_100057229 3300006358 Bacteria 3171
240 Ga0075431_100123846 3300006847 Bacteria 2667
241 Ga0068865_100000434 3300006881 Bacteria 23266
242 Ga0068865_100011662 3300006881 Bacteria 5506
243 Ga0068865_100028784 3300006881 Bacteria 3680
244 Ga0097620_100000324 3300006931 Bacteria 47483
245 Ga0097620_100003001 3300006931 Bacteria 17114
246 Ga0097620_100011614 3300006931 Bacteria 8858
247 Ga0097620_100024122 3300006931 Bacteria 6104
248 Ga0097620_100024317 3300006931 Bacteria 6079
249 Ga0097620_100025028 3300006931 Bacteria 5992
250 Ga0097620_100037328 3300006931 Bacteria 4876
251 Ga0097620_100069449 3300006931 Bacteria 3558
252 Ga0097620_100086981 3300006931 Bacteria 3172
253 Ga0097620_100101251 3300006931 Bacteria 2938
254 Ga0105251_10043986 3300009011 Bacteria 2160
255 Ga0105240_10003880 3300009093 Bacteria 23090
256 Ga0105240_10066649 3300009093 Bacteria 4465
257 Ga0105240_10102679 3300009093 Bacteria 3474
258 Ga0105240_10184912 3300009093 Bacteria 2455
259 Ga0105240_10188228 3300009093 Bacteria 2429
260 Ga0105240_10200736 3300009093 Bacteria 2337
261 Ga0105240_10205940 3300009093 Bacteria 2303
262 Ga0105245_10000424 3300009098 Bacteria 39397
263 Ga0105245_10048655 3300009098 Bacteria 3793
264 Ga0105245_10222158 3300009098 Bacteria 1823
265 Ga0105247_10030004 3300009101 Bacteria 3297
266 Ga0105243_10031215 3300009148 Bacteria 4107
267 Ga0105241_10166782 3300009174 Bacteria 1815
268 Ga0105242_10083959 3300009176 Bacteria 2668
269 Ga0105248_10000123 3300009177 Bacteria 89301
270 Ga0105248_10000159 3300009177 Bacteria 78504
271 Ga0105248_10000407 3300009177 Bacteria 49981
272 Ga0105248_10024980 3300009177 Bacteria 6640
273 Ga0105248_10031334 3300009177 Bacteria 5943
274 Ga0105248_10105654 3300009177 Bacteria 3175
275 Ga0105248_10119460 3300009177 Bacteria 2973
276 Ga0105237_10003982 3300009545 Bacteria 17262
277 Ga0105237_10018540 3300009545 Bacteria 7202
278 Ga0105237_10144916 3300009545 Bacteria 2370
279 Ga0105237_10159970 3300009545 Bacteria 2250
280 Ga0105237_10225391 3300009545 Bacteria 1875
281 Ga0105238_10018232 3300009551 Bacteria 7139
282 Ga0105238_10052066 3300009551 Bacteria 4116
283 Ga0105238_10053533 3300009551 Bacteria 4055
284 Ga0105238_10069566 3300009551 Bacteria 3520
285 Ga0105238_10096252 3300009551 Bacteria 2946
286 Ga0105238_10145698 3300009551 Bacteria 2345
287 Ga0105249_10000015 3300009553 Bacteria 282138
288 Ga0105249_10000064 3300009553 Bacteria 151646
289 Ga0105249_10011234 3300009553 Bacteria 7862
290 Ga0105249_10019672 3300009553 Bacteria 6026
291 Ga0105239_10002388 3300010375 Bacteria 23941
292 Ga0105239_10019413 3300010375 Bacteria 7505
293 Ga0105239_10051754 3300010375 Bacteria 4502
294 Ga0105239_10114796 3300010375 Bacteria 2987
295 Ga0105239_10153247 3300010375 Bacteria 2573
296 Ga0105239_10265085 3300010375 Bacteria 1931
297 Ga0105246_10003940 3300011119 Bacteria 8995
298 Ga0157373_10012675 3300013100 Bacteria 6197
299 Ga0157371_10003598 3300013102 Bacteria 13964
300 Ga0157371_10013675 3300013102 Bacteria 6157
301 Ga0157370_10005586 3300013104 Bacteria 14085
302 Ga0157370_10014806 3300013104 Bacteria 7959
303 Ga0157370_10027355 3300013104 Bacteria 5624
304 Ga0157370_10030792 3300013104 Bacteria 5255
305 Ga0157370_10054688 3300013104 Bacteria 3805
306 Ga0157370_10092659 3300013104 Bacteria 2836
307 Ga0157370_10232362 3300013104 Bacteria 1706
308 Ga0157369_10000385 3300013105 Bacteria 58590
309 Ga0157369_10012084 3300013105 Bacteria 9804
310 Ga0157369_10016507 3300013105 Bacteria 8303
311 Ga0157369_10034107 3300013105 Bacteria 5588
312 Ga0157378_10000018 3300013297 Bacteria 134075
313 Ga0157378_10006264 3300013297 Bacteria 10415
314 Ga0157378_10022160 3300013297 Bacteria 5590
315 Ga0157378_10083214 3300013297 Bacteria 2895
316 Ga0163162_10002274 3300013306 Bacteria 18032
317 Ga0163162_10013200 3300013306 Bacteria 8067
318 Ga0163162_10058690 3300013306 Bacteria 3878
319 Ga0163162_10187894 3300013306 Bacteria 2193
320 Ga0157372_10061043 3300013307 Bacteria 4220
321 Ga0157372_10068118 3300013307 Bacteria 4002
322 Ga0157372_10099151 3300013307 Bacteria 3323
323 Ga0157372_10180763 3300013307 Bacteria 2442
324 Ga0157372_10188569 3300013307 Bacteria 2388
325 Ga0157375_10064297 3300013308 Bacteria 3653
326 Ga0157375_10081028 3300013308 Bacteria 3285
327 Ga0163163_10000265 3300014325 Bacteria 52453
328 Ga0163163_10013362 3300014325 Bacteria 7515
329 Ga0163163_10103722 3300014325 Bacteria 2868
330 Ga0157380_10000332 3300014326 Bacteria 28459
331 Ga0157379_10001201 3300014968 Bacteria 21082
332 Ga0157379_10015227 3300014968 Bacteria 6744
333 Ga0157376_10044100 3300014969 Bacteria 3664
334 Ga0163161_10000110 3300017792 Bacteria 78102
335 Ga0207672_1000729 3300025223 Bacteria 3662
336 Ga0209759_1011916 3300025256 Bacteria 2438
337 Ga0209676_1000273 3300025292 Bacteria 107724
338 Ga0209676_1009644 3300025292 Bacteria 4137
339 Ga0209025_1020025 3300025294 Bacteria 3683
340 Ga0209051_1004538 3300025303 Bacteria 8511
341 Ga0209051_1009617 3300025303 Bacteria 4964
342 Ga0209257_1000032 3300025304 Bacteria 680354
343 Ga0209257_1000458 3300025304 Bacteria 75709
344 Ga0207697_10002358 3300025315 Bacteria 9839
345 Ga0207697_10002531 3300025315 Bacteria 9422
346 Ga0207656_10019188 3300025321 Bacteria 2703
347 Ga0207682_10003777 3300025893 Bacteria 6502
348 Ga0207710_10014589 3300025900 Bacteria 3316
349 Ga0207688_10000018 3300025901 Bacteria 51641
350 Ga0207688_10024275 3300025901 Bacteria 3324
351 Ga0207688_10026512 3300025901 Bacteria 3187
352 Ga0207680_10000009 3300025903 Bacteria 464571
353 Ga0207680_10012998 3300025903 Bacteria 4259
354 Ga0207647_10000232 3300025904 Bacteria 46114
355 Ga0207647_10000333 3300025904 Bacteria 38836
356 Ga0207647_10001648 3300025904 Bacteria 17173
357 Ga0207647_10013372 3300025904 Bacteria 5693
358 Ga0207647_10014933 3300025904 Bacteria 5336
359 Ga0207647_10021572 3300025904 Bacteria 4298
360 Ga0207647_10024185 3300025904 Bacteria 4007
361 Ga0207647_10033137 3300025904 Bacteria 3311
362 Ga0207647_10056231 3300025904 Bacteria 2414
363 Ga0207645_10008012 3300025907 Bacteria 7410
364 Ga0207645_10082577 3300025907 Bacteria 2060
365 Ga0207643_10055164 3300025908 Bacteria 2259
366 Ga0207705_10000059 3300025909 Bacteria 155683
367 Ga0207705_10001692 3300025909 Bacteria 17538
368 Ga0207705_10016137 3300025909 Bacteria 5360
369 Ga0207705_10089454 3300025909 Bacteria 2253
370 Ga0207654_10008896 3300025911 Bacteria 5093
371 Ga0207654_10027098 3300025911 Bacteria 3112
372 Ga0207654_10079171 3300025911 Bacteria 1974
373 Ga0207695_10011197 3300025913 Bacteria 10882
374 Ga0207695_10021396 3300025913 Bacteria 7378
375 Ga0207695_10048837 3300025913 Bacteria 4466
376 Ga0207671_10000841 3300025914 Bacteria 38929
377 Ga0207671_10033115 3300025914 Bacteria 3846
378 Ga0207671_10071063 3300025914 Bacteria 2596
379 Ga0207657_10003142 3300025919 Bacteria 17669
380 Ga0207657_10004185 3300025919 Bacteria 15290
381 Ga0207657_10008595 3300025919 Bacteria 10342
382 Ga0207657_10008817 3300025919 Bacteria 10202
383 Ga0207657_10009428 3300025919 Bacteria 9811
384 Ga0207657_10030517 3300025919 Bacteria 4892
385 Ga0207657_10051528 3300025919 Bacteria 3578
386 Ga0207657_10066083 3300025919 Bacteria 3080
387 Ga0207649_10004902 3300025920 Bacteria 7238
388 Ga0207649_10008761 3300025920 Bacteria 5523
389 Ga0207649_10017197 3300025920 Bacteria 4097
390 Ga0207649_10030987 3300025920 Bacteria 3174
391 Ga0207681_10000003 3300025923 Bacteria 713245
392 Ga0207681_10001180 3300025923 Bacteria 16821
393 Ga0207681_10001989 3300025923 Bacteria 13129
394 Ga0207694_10002118 3300025924 Bacteria 16344
395 Ga0207694_10005478 3300025924 Bacteria 9751
396 Ga0207694_10023373 3300025924 Bacteria 4692
397 Ga0207694_10038326 3300025924 Bacteria 3685
398 Ga0207694_10103667 3300025924 Bacteria 2256
399 Ga0207650_10000038 3300025925 Bacteria 206081
400 Ga0207650_10014405 3300025925 Bacteria 5497
401 Ga0207650_10032714 3300025925 Bacteria 3763
402 Ga0207650_10099346 3300025925 Bacteria 2237
403 Ga0207659_10007405 3300025926 Bacteria 6746
404 Ga0207687_10012203 3300025927 Bacteria 5619
405 Ga0207664_10033267 3300025929 Bacteria 3959
406 Ga0207644_10000512 3300025931 Bacteria 25021
407 Ga0207644_10007430 3300025931 Bacteria 7142
408 Ga0207644_10013409 3300025931 Bacteria 5462
409 Ga0207644_10016807 3300025931 Bacteria 4928
410 Ga0207644_10041587 3300025931 Bacteria 3252
411 Ga0207690_10014349 3300025932 Bacteria 4786
412 Ga0207706_10000171 3300025933 Bacteria 72122
413 Ga0207706_10002226 3300025933 Bacteria 18934
414 Ga0207706_10002480 3300025933 Bacteria 17985
415 Ga0207706_10006168 3300025933 Bacteria 11130
416 Ga0207706_10019005 3300025933 Bacteria 6181
417 Ga0207706_10046960 3300025933 Bacteria 3822
418 Ga0207706_10111062 3300025933 Bacteria 2412
419 Ga0207686_10071119 3300025934 Bacteria 2238
420 Ga0207709_10028961 3300025935 Bacteria 3206
421 Ga0207709_10054348 3300025935 Bacteria 2469
422 Ga0207670_10022219 3300025936 Bacteria 3929
423 Ga0207669_10050360 3300025937 Bacteria 2489
424 Ga0207704_10001207 3300025938 Bacteria 11520
425 Ga0207704_10067513 3300025938 Bacteria 2250
426 Ga0207691_10000070 3300025940 Bacteria 84000
427 Ga0207691_10000442 3300025940 Bacteria 41154
428 Ga0207691_10012078 3300025940 Bacteria 8282
429 Ga0207691_10034316 3300025940 Bacteria 4718
430 Ga0207711_10000100 3300025941 Bacteria 91024
431 Ga0207711_10000607 3300025941 Bacteria 36172
432 Ga0207711_10002610 3300025941 Bacteria 16002
433 Ga0207711_10009352 3300025941 Bacteria 8184
434 Ga0207711_10012993 3300025941 Bacteria 6918
435 Ga0207711_10059979 3300025941 Bacteria 3277
436 Ga0207711_10086011 3300025941 Bacteria 2756
437 Ga0207689_10000123 3300025942 Bacteria 64762
438 Ga0207689_10008724 3300025942 Bacteria 8822
439 Ga0207689_10017657 3300025942 Bacteria 6030
440 Ga0207679_10002516 3300025945 Bacteria 11298
441 Ga0207679_10017882 3300025945 Bacteria 4739
442 Ga0207679_10132261 3300025945 Bacteria 2003
443 Ga0207667_10000017 3300025949 Bacteria 390654
444 Ga0207667_10000503 3300025949 Bacteria 51606
445 Ga0207667_10011731 3300025949 Bacteria 10164
446 Ga0207667_10021710 3300025949 Bacteria 7112
447 Ga0207667_10030020 3300025949 Bacteria 5887
448 Ga0207667_10048962 3300025949 Bacteria 4466
449 Ga0207667_10094862 3300025949 Bacteria 3080
450 Ga0207651_10000332 3300025960 Bacteria 20079
451 Ga0207651_10033606 3300025960 Bacteria 3310
452 Ga0207651_10081205 3300025960 Bacteria 2336
453 Ga0207712_10000023 3300025961 Bacteria 282081
454 Ga0207712_10000044 3300025961 Bacteria 171240
455 Ga0207712_10000873 3300025961 Bacteria 21920
456 Ga0207668_10002284 3300025972 Bacteria 11190
457 Ga0207668_10006304 3300025972 Bacteria 7012
458 Ga0207668_10067676 3300025972 Bacteria 2536
459 Ga0207640_10002840 3300025981 Bacteria 9291
460 Ga0207640_10006873 3300025981 Bacteria 6257
461 Ga0207640_10034778 3300025981 Bacteria 3147
462 Ga0207640_10035086 3300025981 Bacteria 3136
463 Ga0207640_10048529 3300025981 Bacteria 2745
464 Ga0207640_10070849 3300025981 Bacteria 2346
465 Ga0207640_10099237 3300025981 Bacteria 2038
466 Ga0207640_10113553 3300025981 Bacteria 1925
467 Ga0207658_10000592 3300025986 Bacteria 32483
468 Ga0207658_10001131 3300025986 Bacteria 21482
469 Ga0207658_10001592 3300025986 Bacteria 17502
470 Ga0207658_10048397 3300025986 Bacteria 3117
471 Ga0207658_10052764 3300025986 Bacteria 3001
472 Ga0207677_10016237 3300026023 Bacteria 4403
473 Ga0207677_10070670 3300026023 Bacteria 2461
474 Ga0207703_10001186 3300026035 Bacteria 24509
475 Ga0207703_10002719 3300026035 Bacteria 15153
476 Ga0207703_10005654 3300026035 Bacteria 10038
477 Ga0207703_10006383 3300026035 Bacteria 9425
478 Ga0207703_10007545 3300026035 Bacteria 8625
479 Ga0207703_10017446 3300026035 Bacteria 5603
480 Ga0207639_10002215 3300026041 Bacteria 13090
481 Ga0207639_10021938 3300026041 Bacteria 4593
482 Ga0207639_10052430 3300026041 Bacteria 3109
483 Ga0207639_10085102 3300026041 Bacteria 2514
484 Ga0207639_10090113 3300026041 Bacteria 2452
485 Ga0207639_10121859 3300026041 Bacteria 2144
486 Ga0207678_10000198 3300026067 Bacteria 52573
487 Ga0207678_10014684 3300026067 Bacteria 6891
488 Ga0207678_10090619 3300026067 Bacteria 2613
489 Ga0207702_10000430 3300026078 Bacteria 48112
490 Ga0207702_10003048 3300026078 Bacteria 15571
491 Ga0207702_10005307 3300026078 Bacteria 11305
492 Ga0207702_10008058 3300026078 Bacteria 8912
493 Ga0207702_10017344 3300026078 Bacteria 5957
494 Ga0207702_10018151 3300026078 Bacteria 5821
495 Ga0207702_10020863 3300026078 Bacteria 5421
496 Ga0207702_10100994 3300026078 Bacteria 2546
497 Ga0207641_10000047 3300026088 Bacteria 179977
498 Ga0207641_10002327 3300026088 Bacteria 17629
499 Ga0207641_10003117 3300026088 Bacteria 14907
500 Ga0207641_10011082 3300026088 Bacteria 7394
501 Ga0207641_10012433 3300026088 Bacteria 6980
502 Ga0207641_10037126 3300026088 Bacteria 4068
503 Ga0207648_10000317 3300026089 Bacteria 52853
504 Ga0207648_10006135 3300026089 Bacteria 11982
505 Ga0207648_10027744 3300026089 Bacteria 5025
506 Ga0207648_10078277 3300026089 Bacteria 2884
507 Ga0207676_10000034 3300026095 Bacteria 206058
508 Ga0207676_10000378 3300026095 Bacteria 37895
509 Ga0207676_10001136 3300026095 Bacteria 20113
510 Ga0207676_10010624 3300026095 Bacteria 6563
511 Ga0207676_10048265 3300026095 Bacteria 3304
512 Ga0207676_10060871 3300026095 Bacteria 2988
513 Ga0207676_10160767 3300026095 Bacteria 1945
514 Ga0207674_10000937 3300026116 Bacteria 38029
515 Ga0207674_10001303 3300026116 Bacteria 32594
516 Ga0207674_10002718 3300026116 Bacteria 22070
517 Ga0207674_10006989 3300026116 Bacteria 13205
518 Ga0207674_10008395 3300026116 Bacteria 11939
519 Ga0207674_10012673 3300026116 Bacteria 9420
520 Ga0207674_10014814 3300026116 Bacteria 8600
521 Ga0207674_10031878 3300026116 Bacteria 5532
522 Ga0207674_10045622 3300026116 Bacteria 4507
523 Ga0207675_100003730 3300026118 Bacteria 14838
524 Ga0207675_100007062 3300026118 Bacteria 10611
525 Ga0207675_100021446 3300026118 Bacteria 6017
526 Ga0207675_100022045 3300026118 Bacteria 5929
527 Ga0207675_100038664 3300026118 Bacteria 4452
528 Ga0207675_100074463 3300026118 Bacteria 3177
529 Ga0207675_100098758 3300026118 Bacteria 2750
530 Ga0207683_10009217 3300026121 Bacteria 8411
531 Ga0207683_10207570 3300026121 Bacteria 1782
532 Ga0207698_10003405 3300026142 Bacteria 9573
533 Ga0207698_10005663 3300026142 Bacteria 7737
534 Ga0207698_10026840 3300026142 Bacteria 4079
535 Ga0207698_10057375 3300026142 Bacteria 3012
536 Ga0207698_10087331 3300026142 Bacteria 2540
537 Ga0268266_10000069 3300028379 Bacteria 239714
538 Ga0268266_10009139 3300028379 Bacteria 8747
539 Ga0268266_10021182 3300028379 Bacteria 5538
540 Ga0268266_10024362 3300028379 Bacteria 5147
541 Ga0268266_10039290 3300028379 Bacteria 4030
542 Ga0268265_10000021 3300028380 Bacteria 272292
543 Ga0268265_10000052 3300028380 Bacteria 174254
544 Ga0268265_10000197 3300028380 Bacteria 70306
545 Ga0268265_10004932 3300028380 Bacteria 9179
546 Ga0268265_10008194 3300028380 Bacteria 7059
547 Ga0268265_10010028 3300028380 Bacteria 6396
548 Ga0268265_10012793 3300028380 Bacteria 5697
549 Ga0268265_10015604 3300028380 Bacteria 5201
550 Ga0268265_10017401 3300028380 Bacteria 4959
551 Ga0268264_10000021 3300028381 Bacteria 481580
552 Ga0268264_10000131 3300028381 Bacteria 181459
553 Ga0268264_10000567 3300028381 Bacteria 45270
554 Ga0268264_10001814 3300028381 Bacteria 19523
555 Ga0268264_10002173 3300028381 Bacteria 17473
556 Ga0268264_10009033 3300028381 Bacteria 8270
557 Ga0268264_10023705 3300028381 Bacteria 5005
558 Ga0265327_10001003 3300031251 Bacteria 40039
559 Ga0307408_100006789 3300031548 Bacteria 7587
560 Ga0307508_10016531 3300031616 Bacteria 6718
561 Ga0307405_10002100 3300031731 Bacteria 8682
562 Ga0307406_10002601 3300031901 Bacteria 9832
563 Ga0307407_10058832 3300031903 Bacteria 2236
564 Ga0307412_10002490 3300031911 Bacteria 10252
565 Ga0307416_100013524 3300032002 Bacteria 5551
566 Ga0307415_100028341 3300032126 Bacteria 3561
567 Ga0373943_0011882 3300035170 Bacteria 3919
568 Ga0373942_0003470 3300035207 Bacteria 3703
569 Ga0373935_0016099 3300035692 Bacteria 4525
570 Ga0373927_0025861 3300035695 Bacteria 3837
571 Ga0395899_0000104 3300037312 Bacteria 147238
572 Ga0395899_0010084 3300037312 Bacteria 7243
573 Ga0395899_0013362 3300037312 Bacteria 6281
574 Ga0395899_0023792 3300037312 Bacteria 4635
575 Ga0395899_0030923 3300037312 Bacteria 4025
576 Ga0395899_0038373 3300037312 Bacteria 3588
577 Ga0395899_0039880 3300037312 Bacteria 3514
578 Ga0395899_0048079 3300037312 Bacteria 3175
579 Ga0395899_0064655 3300037312 Bacteria 2689
580 Ga0395899_0067646 3300037312 Bacteria 2621
581 Ga0395899_0068026 3300037312 Bacteria 2612
582 Ga0395899_0145899 3300037312 Bacteria 1681
583 Ga0395900_0000161 3300037418 Bacteria 110637
584 Ga0395900_0001979 3300037418 Bacteria 23128
585 Ga0395900_0002464 3300037418 Bacteria 20376
586 Ga0395900_0004869 3300037418 Bacteria 14150
587 Ga0395900_0033711 3300037418 Bacteria 5269
588 Ga0395900_0034176 3300037418 Bacteria 5235
589 Ga0395900_0037569 3300037418 Bacteria 4992
590 Ga0395900_0043596 3300037418 Bacteria 4624
591 Ga0395900_0056008 3300037418 Bacteria 4059
592 Ga0395900_0065428 3300037418 Bacteria 3735
593 Ga0395900_0066531 3300037418 Bacteria 3702
594 Ga0395900_0067047 3300037418 Bacteria 3688
595 Ga0395900_0090191 3300037418 Bacteria 3151
596 Ga0395900_0097049 3300037418 Bacteria 3028
597 Ga0395900_0134622 3300037418 Bacteria 2531
598 Ga0395900_0156766 3300037418 Bacteria 2325
599 Ga0395900_0164563 3300037418 Bacteria 2261
600 Ga0395898_0000169 3300037466 Bacteria 168667
601 Ga0395898_0006568 3300037466 Bacteria 12408
602 Ga0395898_0011480 3300037466 Bacteria 9199
603 Ga0395898_0024479 3300037466 Bacteria 6089
604 Ga0395898_0077624 3300037466 Bacteria 3206
605 Ga0395898_0080899 3300037466 Bacteria 3133
606 Ga0395898_0083517 3300037466 Bacteria 3078
607 Ga0395898_0090063 3300037466 Bacteria 2952
608 Ga0395898_0106979 3300037466 Bacteria 2682
609 Ga0395898_0129242 3300037466 Bacteria 2420
610 Ga0395898_0129678 3300037466 Bacteria 2415
611 Ga0395905_0000104 3300037471 Bacteria 141965
612 Ga0395905_0000120 3300037471 Bacteria 130865
613 Ga0395905_0002668 3300037471 Bacteria 19575
614 Ga0395905_0003971 3300037471 Bacteria 15563
615 Ga0395905_0011281 3300037471 Bacteria 8637
616 Ga0395905_0012663 3300037471 Bacteria 8115
617 Ga0395905_0023425 3300037471 Bacteria 5834
618 Ga0395905_0024005 3300037471 Bacteria 5757
619 Ga0395905_0025552 3300037471 Bacteria 5569
620 Ga0395905_0028768 3300037471 Bacteria 5236
621 Ga0395905_0037509 3300037471 Bacteria 4549
622 Ga0395905_0039312 3300037471 Bacteria 4438
623 Ga0395905_0040894 3300037471 Bacteria 4349
624 Ga0395905_0049225 3300037471 Bacteria 3949
625 Ga0395905_0077714 3300037471 Bacteria 3110
626 Ga0395905_0080011 3300037471 Bacteria 3063
627 Ga0395901_0000664 3300038443 Bacteria 39548
628 Ga0395901_0005588 3300038443 Bacteria 12729
629 Ga0395901_0014971 3300038443 Bacteria 7882
630 Ga0395901_0022137 3300038443 Bacteria 6512
631 Ga0395901_0024686 3300038443 Bacteria 6171
632 Ga0395901_0030692 3300038443 Bacteria 5538
633 Ga0395901_0059178 3300038443 Bacteria 3986
634 Ga0395901_0059393 3300038443 Bacteria 3978
635 Ga0395901_0062430 3300038443 Bacteria 3877
636 Ga0395901_0066271 3300038443 Bacteria 3761
637 Ga0395901_0077369 3300038443 Bacteria 3472
638 Ga0395901_0096271 3300038443 Bacteria 3102
639 Ga0395901_0123348 3300038443 Bacteria 2722
640 Ga0395901_0186020 3300038443 Bacteria 2178
641 Ga0436361_0200088 3300039447 Bacteria 5440
642 Ga0436361_0897280 3300039447 Bacteria 17229
643 Ga0439445_0002579 3300042004 Bacteria 4031
644 Ga0439448_0001144 3300042005 Bacteria 6711
645 Ga0439455_0000293 3300042012 Bacteria 6235
646 Ga0439458_0000011 3300042157 Bacteria 29034
647 Ga0439458_0000051 3300042157 Bacteria 19754
648 Ga0439458_0003106 3300042157 Bacteria 3949
649 Ga0439464_0000713 3300042439 Bacteria 7200
650 Ga0439464_0003431 3300042439 Bacteria 3997
651 Ga0451577_0039515 3300042876 Bacteria 4240
652 Ga0466969_0016598 3300044656 Bacteria 3851
653 Ga0466969_0048135 3300044656 Bacteria 2108
654 Ga0466972_0000786 3300044658 Bacteria 15066
655 Ga0466965_0031256 3300044683 Bacteria 2596
656 Ga0466966_0000052 3300044684 Bacteria 88472
657 Ga0466966_0002388 3300044684 Bacteria 12268
658 Ga0466961_0034809 3300044693 Bacteria 3233
659 Ga0466963_0000815 3300044694 Bacteria 15585
660 Ga0466963_0024046 3300044694 Bacteria 3875
661 Ga0466963_0038518 3300044694 Bacteria 3126
662 Ga0466963_0089749 3300044694 Bacteria 2091
663 Ga0466963_0103096 3300044694 Bacteria 1954
664 Ga0466964_0012472 3300044706 Bacteria 3215
665 Ga0466964_0024705 3300044706 Bacteria 2342
666 Ga0466971_0005602 3300044719 Bacteria 5460
667 Ga0466971_0012210 3300044719 Bacteria 3763
668 Ga0466968_0037164 3300044735 Bacteria 2042
669 Ga0466970_0018763 3300044765 Bacteria 3583
670 Ga0466970_0076593 3300044765 Bacteria 1802
671 Ga0466957_0001952 3300044842 Bacteria 10954
672 Ga0466957_0009863 3300044842 Bacteria 5461
673 Ga0466960_0003591 3300044901 Bacteria 5983
674 Ga0466960_0044746 3300044901 Bacteria 2111
675 Ga0466960_0045153 3300044901 Bacteria 2103
676 Ga0466960_0071728 3300044901 Bacteria 1726
677 Ga0451576_0004130 3300045051 Bacteria 19149
678 Ga0466958_0000611 3300045836 Bacteria 15263
679 Ga0466958_0007378 3300045836 Bacteria 6044
680 Ga0466958_0071292 3300045836 Bacteria 2127
681 Ga0466967_0002752 3300045976 Bacteria 11116
682 Ga0466967_0003933 3300045976 Bacteria 9871
683 Ga0466967_0044109 3300045976 Bacteria 3865
684 Ga0466967_0072847 3300045976 Bacteria 3080
685 Ga0495590_0002741 3300046457 Bacteria 7272
686 Ga0495638_0001102 3300046460 Bacteria 26299
687 Ga0495638_0009092 3300046460 Bacteria 6994
688 Ga0495625_0002352 3300046660 Bacteria 20624
689 Ga0495625_0014697 3300046660 Bacteria 6235
690 Ga0495669_0012674 3300046684 Bacteria 3590
691 Ga0495670_0000005 3300046691 Bacteria 289725
692 Ga0495687_000125 3300047443 Bacteria 118053
693 Ga0495686_0000063 3300047472 Bacteria 228575
694 Ga0495686_0001670 3300047472 Bacteria 23070
695 Ga0496100_0012996 3300048903 Bacteria 4791
696 Ga0496101_0002179 3300048904 Bacteria 11959
697 Ga0496101_0062635 3300048904 Bacteria 2705
698 Ga0496102_0016769 3300048905 Bacteria 6406
699 Ga0496102_0019775 3300048905 Bacteria 5935
700 Ga0496103_0000748 3300048906 Bacteria 23924
701 Ga0496104_0038950 3300048907 Bacteria 4449
702 Ga0496104_0067365 3300048907 Bacteria 3401
703 Ga0496105_0024060 3300048908 Bacteria 4947
704 Ga0496106_0067082 3300048909 Bacteria 2734
705 Ga0496107_0005708 3300048910 Bacteria 8521
706 Ga0496108_0015736 3300048911 Bacteria 6168
707 Ga0496109_0009291 3300048912 Bacteria 8377
708 Ga0496110_0003818 3300048913 Bacteria 11611
709 Ga0496110_0015846 3300048913 Bacteria 6285
710 Ga0496111_0020538 3300048914 Bacteria 4598
711 Ga0496112_0066085 3300048915 Bacteria 3568
712 Ga0496112_0215668 3300048915 Bacteria 1876
713 Ga0496116_0026563 3300048919 Bacteria 4232
714 Ga0496121_0001925 3300048924 Bacteria 33163
715 Ga0496125_0111856 3300048928 Bacteria 1975
716 Ga0495678_042987 3300049459 Bacteria 1798
717 Ga0501034_0200126 3300049571 Bacteria 1956
718 Ga0501083_0044244 3300049744 Bacteria 3014
719 nmdc:mga07m45_3124_c1 3300050496 Bacteria 7932
720 nmdc:mga07m45_4755_c1 3300050496 Bacteria 6674
721 nmdc:mga07m45_505_c1 3300050496 Bacteria 16509
722 nmdc:mga06r32_19192_c1 3300050510 Bacteria 6274
723 nmdc:mga0n895_395853_c1 3300050512 Bacteria 1397
724 Ga0500643_000006 3300053087 Bacteria 479605
725 Ga0500643_000232 3300053087 Bacteria 51502
726 Ga0500592_000718 3300053116 Bacteria 5439
727 Ga0500595_020074 3300053119 Bacteria 2412
728 Ga0500568_0005404 3300053139 Bacteria 6605
729 Ga0500622_0000165 3300053156 Bacteria 70459
730 Ga0500622_0005497 3300053156 Bacteria 7600
731 Ga0500645_002746 3300053730 Bacteria 7633
732 Ga0501084_0116813 3300054114 Bacteria 2243
733 Ga0466962_0000727 3300061719 Bacteria 14741
734 Ga0466962_0035764 3300061719 Bacteria 2376

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10131856 Ga0070658_101318561 352
2 3300050512 nmdc:mga0n895_395853_c1 nmdc:mga0n895_395853_c1_15_1181 385
3 3300037312 Ga0395899_0145899 Ga0395899_0145899_361_1644 406
4 3300037466 Ga0395898_0024479 Ga0395898_0024479_3038_4579 412
5 3300048915 Ga0496112_0066085 Ga0496112_0066085_2286_3554 412
6 3300037312 Ga0395899_0039880 Ga0395899_0039880_1463_2998 414
7 3300037418 Ga0395900_0037569 Ga0395900_0037569_853_2388 414
8 3300038443 Ga0395901_0096271 Ga0395901_0096271_1075_2610 414
9 3300038443 Ga0395901_0062430 Ga0395901_0062430_393_1931 417
10 3300001979 JGI24740J21852_10000395 JGI24740J21852_1000039516 419
11 3300001989 JGI24739J22299_10018892 JGI24739J22299_100188922 419
12 3300001991 JGI24743J22301_10004952 JGI24743J22301_100049521 419
13 3300002075 JGI24738J21930_10004118 JGI24738J21930_100041183 419
14 3300005329 Ga0070683_100020582 Ga0070683_1000205822 419
15 3300005336 Ga0070680_100007272 Ga0070680_1000072726 419
16 3300005337 Ga0070682_100016005 Ga0070682_1000160053 419
17 3300005337 Ga0070682_100103904 Ga0070682_1001039042 419
18 3300005339 Ga0070660_100075152 Ga0070660_1000751522 419
19 3300005341 Ga0070691_10003231 Ga0070691_100032315 419
20 3300005344 Ga0070661_100024568 Ga0070661_1000245682 419
21 3300005355 Ga0070671_100107298 Ga0070671_1001072982 419
22 3300005366 Ga0070659_100051876 Ga0070659_1000518763 419
23 3300005455 Ga0070663_100007411 Ga0070663_1000074115 419
24 3300005539 Ga0068853_100036633 Ga0068853_1000366334 419
25 3300005548 Ga0070665_100016958 Ga0070665_1000169582 419
26 3300005564 Ga0070664_100002457 Ga0070664_1000024574 419
27 3300005577 Ga0068857_100007919 Ga0068857_1000079193 419
28 3300005578 Ga0068854_100001151 Ga0068854_1000011512 419
29 3300005834 Ga0068851_10019078 Ga0068851_100190782 419
30 3300009093 Ga0105240_10184912 Ga0105240_101849122 419
31 3300009545 Ga0105237_10159970 Ga0105237_101599702 419
32 3300009551 Ga0105238_10096252 Ga0105238_100962522 419
33 3300013104 Ga0157370_10232362 Ga0157370_102323622 419
34 3300013307 Ga0157372_10068118 Ga0157372_100681183 419
35 3300013307 Ga0157372_10188569 Ga0157372_101885692 419
36 3300025904 Ga0207647_10001648 Ga0207647_100016485 419
37 3300025904 Ga0207647_10033137 Ga0207647_100331372 419
38 3300025919 Ga0207657_10004185 Ga0207657_100041853 419
39 3300025919 Ga0207657_10008817 Ga0207657_100088177 419
40 3300025933 Ga0207706_10006168 Ga0207706_100061688 419
41 3300025949 Ga0207667_10094862 Ga0207667_100948623 419
42 3300025981 Ga0207640_10070849 Ga0207640_100708492 419
43 3300026067 Ga0207678_10000198 Ga0207678_1000019853 419
44 3300026116 Ga0207674_10006989 Ga0207674_100069899 419
45 3300028379 Ga0268266_10039290 Ga0268266_100392902 419
46 3300037466 Ga0395898_0083517 Ga0395898_0083517_580_2121 419
47 3300044706 Ga0466964_0012472 Ga0466964_0012472_1111_2457 421
48 3300038443 Ga0395901_0066271 Ga0395901_0066271_1474_3009 423
49 3300049459 Ga0495678_042987 Ga0495678_042987_17_1360 424
50 3300044901 Ga0466960_0071728 Ga0466960_0071728_64_1599 429
51 3300038443 Ga0395901_0059178 Ga0395901_0059178_672_2177 433
52 3300013104 Ga0157370_10005586 Ga0157370_100055862 435
53 3300037312 Ga0395899_0048079 Ga0395899_0048079_425_1960 435
54 3300037418 Ga0395900_0033711 Ga0395900_0033711_3310_4845 435
55 3300037466 Ga0395898_0011480 Ga0395898_0011480_4355_5890 435
56 3300037471 Ga0395905_0037509 Ga0395905_0037509_2590_4125 435
57 3300038443 Ga0395901_0024686 Ga0395901_0024686_3421_4956 435
58 3300044765 Ga0466970_0018763 Ga0466970_0018763_169_1710 435
59 3300037471 Ga0395905_0028768 Ga0395905_0028768_199_1734 437
60 3300045836 Ga0466958_0071292 Ga0466958_0071292_346_1878 438
61 3300037418 Ga0395900_0156766 Ga0395900_0156766_282_1823 439
62 3300037466 Ga0395898_0080899 Ga0395898_0080899_1006_2547 439
63 3300048913 Ga0496110_0015846 Ga0496110_0015846_26_1354 441
64 3300037418 Ga0395900_0056008 Ga0395900_0056008_309_1844 442
65 3300037471 Ga0395905_0012663 Ga0395905_0012663_6256_7797 442
66 3300031251 Ga0265327_10001003 Ga0265327_1000100341 443
67 3300037312 Ga0395899_0030923 Ga0395899_0030923_2458_3987 443
68 3300037418 Ga0395900_0066531 Ga0395900_0066531_204_1733 443
69 3300037466 Ga0395898_0129678 Ga0395898_0129678_204_1733 443
70 3300038443 Ga0395901_0186020 Ga0395901_0186020_204_1733 443
71 3300045836 Ga0466958_0007378 Ga0466958_0007378_1145_2686 443
72 3300037471 Ga0395905_0049225 Ga0395905_0049225_2572_3936 444
73 3300037471 Ga0395905_0080011 Ga0395905_0080011_320_1825 448
74 3300045976 Ga0466967_0072847 Ga0466967_0072847_209_1750 448
75 3300026116 Ga0207674_10045622 Ga0207674_100456222 449
76 3300037418 Ga0395900_0034176 Ga0395900_0034176_108_1643 449
77 3300042157 Ga0439458_0000011 Ga0439458_0000011_7415_8953 451
78 3300037471 Ga0395905_0040894 Ga0395905_0040894_235_1773 452
79 3300046691 Ga0495670_0000005 Ga0495670_0000005_34449_35984 453
80 3300026121 Ga0207683_10207570 Ga0207683_102075701 456
81 3300053119 Ga0500595_020074 Ga0500595_020074_175_1710 456
82 3300035207 Ga0373942_0003470 Ga0373942_0003470_838_2385 457
83 3300037418 Ga0395900_0065428 Ga0395900_0065428_1840_3378 457
84 3300037471 Ga0395905_0003971 Ga0395905_0003971_13746_15284 457
85 3300038443 Ga0395901_0077369 Ga0395901_0077369_1201_2739 457
86 3300005548 Ga0070665_100018536 Ga0070665_1000185365 458
87 3300037466 Ga0395898_0129242 Ga0395898_0129242_448_1983 458
88 3300037471 Ga0395905_0025552 Ga0395905_0025552_3378_4916 458
89 3300005614 Ga0068856_100004411 Ga0068856_10000441117 460
90 3300013105 Ga0157369_10016507 Ga0157369_1001650710 460
91 3300026078 Ga0207702_10018151 Ga0207702_100181512 460
92 3300037418 Ga0395900_0067047 Ga0395900_0067047_1587_3128 460
93 3300037471 Ga0395905_0023425 Ga0395905_0023425_586_2127 460
94 3300037471 Ga0395905_0039312 Ga0395905_0039312_2851_4389 460
95 3300009545 Ga0105237_10225391 Ga0105237_102253912 461
96 3300037418 Ga0395900_0002464 Ga0395900_0002464_5057_6598 461
97 3300037466 Ga0395898_0090063 Ga0395898_0090063_619_2160 461
98 3300037471 Ga0395905_0002668 Ga0395905_0002668_6087_7628 461
99 3300038443 Ga0395901_0123348 Ga0395901_0123348_794_2335 461
100 3300005435 Ga0070714_100041839 Ga0070714_1000418393 462
101 3300025929 Ga0207664_10033267 Ga0207664_100332671 462
102 3300044694 Ga0466963_0089749 Ga0466963_0089749_511_2052 462
103 3300005457 Ga0070662_100115658 Ga0070662_1001156581 463
104 3300044694 Ga0466963_0038518 Ga0466963_0038518_1380_2921 463
105 3300005366 Ga0070659_100044578 Ga0070659_1000445781 464
106 3300006881 Ga0068865_100011662 Ga0068865_1000116622 464
107 3300044735 Ga0466968_0037164 Ga0466968_0037164_13_1539 465
108 3300044658 Ga0466972_0000786 Ga0466972_0000786_6424_7959 467
109 3300044901 Ga0466960_0003591 Ga0466960_0003591_1929_3464 467
110 3300006237 Ga0097621_100123826 Ga0097621_1001238263 468
111 3300054114 Ga0501084_0116813 Ga0501084_0116813_718_2214 468
112 3300005842 Ga0068858_100040082 Ga0068858_1000400825 469
113 3300005985 Ga0081539_10058522 Ga0081539_100585222 469
114 3300026035 Ga0207703_10007545 Ga0207703_100075456 469
115 3300026118 Ga0207675_100074463 Ga0207675_1000744633 469
116 3300042876 Ga0451577_0039515 Ga0451577_0039515_1618_3147 469
117 3300045051 Ga0451576_0004130 Ga0451576_0004130_9622_11151 469
118 3300048924 Ga0496121_0001925 Ga0496121_0001925_28897_30456 469
119 3300005844 Ga0068862_100028554 Ga0068862_1000285542 470
120 3300013104 Ga0157370_10092659 Ga0157370_100926591 470
121 3300028380 Ga0268265_10015604 Ga0268265_100156044 470
122 3300013306 Ga0163162_10187894 Ga0163162_101878942 471
123 3300037312 Ga0395899_0010084 Ga0395899_0010084_4285_5823 471
124 3300037418 Ga0395900_0001979 Ga0395900_0001979_13580_15118 471
125 3300037471 Ga0395905_0011281 Ga0395905_0011281_6258_7796 471
126 3300038443 Ga0395901_0005588 Ga0395901_0005588_4217_5755 471
127 3300039447 Ga0436361_0200088 Ga0436361_0200088_342_1820 471
128 3300005327 Ga0070658_10112571 Ga0070658_101125712 472
129 3300005331 Ga0070670_100117212 Ga0070670_1001172122 472
130 3300005347 Ga0070668_100033901 Ga0070668_1000339012 472
131 3300005617 Ga0068859_100069451 Ga0068859_1000694513 472
132 3300005843 Ga0068860_100032025 Ga0068860_1000320257 472
133 3300006931 Ga0097620_100069449 Ga0097620_1000694493 472
134 3300044694 Ga0466963_0103096 Ga0466963_0103096_69_1607 472
135 3300044719 Ga0466971_0005602 Ga0466971_0005602_550_2088 472
136 3300044842 Ga0466957_0009863 Ga0466957_0009863_966_2501 472
137 3300045976 Ga0466967_0003933 Ga0466967_0003933_1946_3484 472
138 3300061719 Ga0466962_0000727 Ga0466962_0000727_12336_13874 472
139 3300002067 JGI24735J21928_10002842 JGI24735J21928_100028422 473
140 3300005327 Ga0070658_10052651 Ga0070658_100526512 473
141 3300005339 Ga0070660_100023164 Ga0070660_1000231645 473
142 3300005344 Ga0070661_100032766 Ga0070661_1000327665 473
143 3300005366 Ga0070659_100027561 Ga0070659_1000275615 473
144 3300005539 Ga0068853_100007344 Ga0068853_1000073447 473
145 3300005577 Ga0068857_100084161 Ga0068857_1000841611 473
146 3300005842 Ga0068858_100006175 Ga0068858_1000061758 473
147 3300009093 Ga0105240_10003880 Ga0105240_100038807 473
148 3300009545 Ga0105237_10003982 Ga0105237_100039827 473
149 3300010375 Ga0105239_10002388 Ga0105239_1000238823 473
150 3300013297 Ga0157378_10083214 Ga0157378_100832142 473
151 3300014325 Ga0163163_10013362 Ga0163163_100133625 473
152 3300025904 Ga0207647_10024185 Ga0207647_100241853 473
153 3300025909 Ga0207705_10089454 Ga0207705_100894542 473
154 3300025913 Ga0207695_10011197 Ga0207695_100111971 473
155 3300025914 Ga0207671_10071063 Ga0207671_100710632 473
156 3300025919 Ga0207657_10008595 Ga0207657_1000859510 473
157 3300025924 Ga0207694_10005478 Ga0207694_100054788 473
158 3300026041 Ga0207639_10002215 Ga0207639_1000221512 473
159 3300026116 Ga0207674_10014814 Ga0207674_100148147 473
160 3300042157 Ga0439458_0000051 Ga0439458_0000051_17983_19524 473
161 3300048928 Ga0496125_0111856 Ga0496125_0111856_148_1734 473
162 3300053156 Ga0500622_0005497 Ga0500622_0005497_4319_5812 473
163 3300005937 Ga0081455_10004231 Ga0081455_100042317 474
164 3300045976 Ga0466967_0044109 Ga0466967_0044109_1904_3439 474
165 3300046460 Ga0495638_0009092 Ga0495638_0009092_2944_4467 474
166 3300046660 Ga0495625_0002352 Ga0495625_0002352_5769_7292 474
167 3300025256 Ga0209759_1011916 Ga0209759_10119162 475
168 3300025292 Ga0209676_1009644 Ga0209676_10096442 475
169 3300025294 Ga0209025_1020025 Ga0209025_10200251 475
170 3300046457 Ga0495590_0002741 Ga0495590_0002741_402_1943 475
171 3300005295 Ga0065707_10096768 Ga0065707_100967683 476
172 3300005328 Ga0070676_10043886 Ga0070676_100438862 476
173 3300009098 Ga0105245_10048655 Ga0105245_100486552 476
174 3300009176 Ga0105242_10083959 Ga0105242_100839593 476
175 3300025907 Ga0207645_10082577 Ga0207645_100825772 476
176 3300025927 Ga0207687_10012203 Ga0207687_100122035 476
177 3300025934 Ga0207686_10071119 Ga0207686_100711192 476
178 3300025935 Ga0207709_10054348 Ga0207709_100543482 476
179 3300026089 Ga0207648_10006135 Ga0207648_100061357 476
180 3300037312 Ga0395899_0000104 Ga0395899_0000104_125903_127408 476
181 3300037312 Ga0395899_0038373 Ga0395899_0038373_1065_2603 476
182 3300037418 Ga0395900_0000161 Ga0395900_0000161_52007_53512 476
183 3300037418 Ga0395900_0097049 Ga0395900_0097049_891_2429 476
184 3300037418 Ga0395900_0134622 Ga0395900_0134622_454_1995 476
185 3300037466 Ga0395898_0000169 Ga0395898_0000169_138839_140344 476
186 3300037471 Ga0395905_0000120 Ga0395905_0000120_52195_53700 476
187 3300038443 Ga0395901_0000664 Ga0395901_0000664_21756_23261 476
188 3300009101 Ga0105247_10030004 Ga0105247_100300042 477
189 3300025900 Ga0207710_10014589 Ga0207710_100145894 477
190 3300025904 Ga0207647_10021572 Ga0207647_100215722 477
191 3300028381 Ga0268264_10009033 Ga0268264_100090339 477
192 3300047472 Ga0495686_0000063 Ga0495686_0000063_172071_173603 477
193 3300005539 Ga0068853_100094723 Ga0068853_1000947232 478
194 3300005618 Ga0068864_100024966 Ga0068864_1000249661 478
195 3300006237 Ga0097621_100020152 Ga0097621_1000201524 478
196 3300006358 Ga0068871_100057229 Ga0068871_1000572294 478
197 3300009545 Ga0105237_10144916 Ga0105237_101449163 478
198 3300009551 Ga0105238_10018232 Ga0105238_100182324 478
199 3300013307 Ga0157372_10061043 Ga0157372_100610432 478
200 3300025911 Ga0207654_10079171 Ga0207654_100791712 478
201 3300026041 Ga0207639_10121859 Ga0207639_101218592 478
202 3300026095 Ga0207676_10048265 Ga0207676_100482652 478
203 3300026095 Ga0207676_10060871 Ga0207676_100608712 478
204 3300028381 Ga0268264_10023705 Ga0268264_100237053 478
205 3300031616 Ga0307508_10016531 Ga0307508_100165312 478
206 3300005578 Ga0068854_100027723 Ga0068854_1000277233 479
207 3300001990 JGI24737J22298_10004914 JGI24737J22298_100049142 480
208 3300002077 JGI24744J21845_10002683 JGI24744J21845_100026832 480
209 3300005335 Ga0070666_10024010 Ga0070666_100240102 480
210 3300005354 Ga0070675_100149121 Ga0070675_1001491212 480
211 3300005548 Ga0070665_100177255 Ga0070665_1001772552 480
212 3300005563 Ga0068855_100001164 Ga0068855_1000011645 480
213 3300005577 Ga0068857_100005444 Ga0068857_1000054447 480
214 3300005578 Ga0068854_100025690 Ga0068854_1000256906 480
215 3300005844 Ga0068862_100000198 Ga0068862_10000019867 480
216 3300009093 Ga0105240_10188228 Ga0105240_101882283 480
217 3300009177 Ga0105248_10024980 Ga0105248_100249803 480
218 3300009545 Ga0105237_10018540 Ga0105237_100185406 480
219 3300009553 Ga0105249_10000015 Ga0105249_10000015277 480
220 3300010375 Ga0105239_10114796 Ga0105239_101147964 480
221 3300025901 Ga0207688_10024275 Ga0207688_100242752 480
222 3300025904 Ga0207647_10056231 Ga0207647_100562312 480
223 3300025914 Ga0207671_10033115 Ga0207671_100331154 480
224 3300025941 Ga0207711_10009352 Ga0207711_100093525 480
225 3300025949 Ga0207667_10000017 Ga0207667_10000017266 480
226 3300025961 Ga0207712_10000023 Ga0207712_100000238 480
227 3300025981 Ga0207640_10006873 Ga0207640_100068733 480
228 3300026088 Ga0207641_10037126 Ga0207641_100371263 480
229 3300026089 Ga0207648_10027744 Ga0207648_100277442 480
230 3300026116 Ga0207674_10002718 Ga0207674_1000271812 480
231 3300028380 Ga0268265_10000021 Ga0268265_10000021238 480
232 3300005327 Ga0070658_10055565 Ga0070658_100555653 481
233 3300005614 Ga0068856_100000449 Ga0068856_1000004492 481
234 3300025911 Ga0207654_10027098 Ga0207654_100270982 481
235 3300025949 Ga0207667_10030020 Ga0207667_100300202 481
236 3300026078 Ga0207702_10000430 Ga0207702_100004302 481
237 3300037471 Ga0395905_0024005 Ga0395905_0024005_1775_3280 481
238 3300048904 Ga0496101_0062635 Ga0496101_0062635_493_1998 481
239 3300048905 Ga0496102_0019775 Ga0496102_0019775_1826_3331 481
240 3300048907 Ga0496104_0038950 Ga0496104_0038950_1816_3321 481
241 3300048909 Ga0496106_0067082 Ga0496106_0067082_740_2245 481
242 3300048910 Ga0496107_0005708 Ga0496107_0005708_4770_6275 481
243 3300048911 Ga0496108_0015736 Ga0496108_0015736_2058_3563 481
244 3300048913 Ga0496110_0003818 Ga0496110_0003818_3533_5038 481
245 3300048914 Ga0496111_0020538 Ga0496111_0020538_1165_2670 481
246 3300048915 Ga0496112_0215668 Ga0496112_0215668_417_1865 481
247 3300002070 JGI24750J21931_1000372 JGI24750J21931_10003726 482
248 3300005330 Ga0070690_100000014 Ga0070690_10000001458 482
249 3300005335 Ga0070666_10000027 Ga0070666_1000002717 482
250 3300005339 Ga0070660_100038535 Ga0070660_1000385353 482
251 3300005344 Ga0070661_100014597 Ga0070661_1000145973 482
252 3300005366 Ga0070659_100036766 Ga0070659_1000367663 482
253 3300005367 Ga0070667_100006262 Ga0070667_1000062628 482
254 3300005544 Ga0070686_100000010 Ga0070686_100000010152 482
255 3300005563 Ga0068855_100001723 Ga0068855_1000017234 482
256 3300005578 Ga0068854_100010327 Ga0068854_1000103275 482
257 3300005614 Ga0068856_100046595 Ga0068856_1000465953 482
258 3300005614 Ga0068856_100058084 Ga0068856_1000580844 482
259 3300005616 Ga0068852_100013939 Ga0068852_1000139395 482
260 3300005618 Ga0068864_100007461 Ga0068864_1000074612 482
261 3300005719 Ga0068861_100072992 Ga0068861_1000729922 482
262 3300005841 Ga0068863_100069572 Ga0068863_1000695722 482
263 3300005843 Ga0068860_100000080 Ga0068860_100000080151 482
264 3300005937 Ga0081455_10000564 Ga0081455_100005648 482
265 3300009093 Ga0105240_10066649 Ga0105240_100666492 482
266 3300009174 Ga0105241_10166782 Ga0105241_101667822 482
267 3300009551 Ga0105238_10145698 Ga0105238_101456982 482
268 3300009553 Ga0105249_10000064 Ga0105249_1000006418 482
269 3300013100 Ga0157373_10012675 Ga0157373_100126753 482
270 3300013102 Ga0157371_10013675 Ga0157371_100136755 482
271 3300013104 Ga0157370_10027355 Ga0157370_100273553 482
272 3300013105 Ga0157369_10034107 Ga0157369_100341073 482
273 3300013307 Ga0157372_10180763 Ga0157372_101807633 482
274 3300017792 Ga0163161_10000110 Ga0163161_1000011017 482
275 3300025903 Ga0207680_10000009 Ga0207680_10000009154 482
276 3300025913 Ga0207695_10021396 Ga0207695_100213962 482
277 3300025919 Ga0207657_10051528 Ga0207657_100515283 482
278 3300025920 Ga0207649_10017197 Ga0207649_100171973 482
279 3300025924 Ga0207694_10103667 Ga0207694_101036672 482
280 3300025949 Ga0207667_10000503 Ga0207667_1000050348 482
281 3300025961 Ga0207712_10000044 Ga0207712_10000044151 482
282 3300025986 Ga0207658_10001131 Ga0207658_1000113110 482
283 3300026035 Ga0207703_10002719 Ga0207703_100027198 482
284 3300026078 Ga0207702_10017344 Ga0207702_100173443 482
285 3300026078 Ga0207702_10100994 Ga0207702_101009943 482
286 3300026088 Ga0207641_10011082 Ga0207641_100110828 482
287 3300026142 Ga0207698_10026840 Ga0207698_100268403 482
288 3300028381 Ga0268264_10000131 Ga0268264_10000131151 482
289 3300037312 Ga0395899_0067646 Ga0395899_0067646_204_1736 482
290 3300037418 Ga0395900_0090191 Ga0395900_0090191_1562_3094 482
291 3300037466 Ga0395898_0077624 Ga0395898_0077624_1257_2789 482
292 3300037471 Ga0395905_0077714 Ga0395905_0077714_1145_2671 482
293 3300038443 Ga0395901_0030692 Ga0395901_0030692_2770_4302 482
294 3300047472 Ga0495686_0001670 Ga0495686_0001670_6850_8382 482
295 3300005616 Ga0068852_100001197 Ga0068852_10000119720 483
296 3300005937 Ga0081455_10065401 Ga0081455_100654012 483
297 3300013105 Ga0157369_10012084 Ga0157369_100120843 483
298 3300013306 Ga0163162_10058690 Ga0163162_100586903 483
299 3300025924 Ga0207694_10023373 Ga0207694_100233732 483
300 3300026142 Ga0207698_10087331 Ga0207698_100873312 483
301 3300044656 Ga0466969_0016598 Ga0466969_0016598_2030_3568 483
302 3300044706 Ga0466964_0024705 Ga0466964_0024705_53_1591 483
303 3300048919 Ga0496116_0026563 Ga0496116_0026563_642_2177 483
304 3300061719 Ga0466962_0035764 Ga0466962_0035764_126_1664 483
305 3300002074 JGI24748J21848_1000049 JGI24748J21848_100004957 484
306 3300002076 JGI24749J21850_1000068 JGI24749J21850_10000687 484
307 3300002239 JGI24034J26672_10000033 JGI24034J26672_1000003331 484
308 3300002459 JGI24751J29686_10000400 JGI24751J29686_100004007 484
309 3300002459 JGI24751J29686_10003332 JGI24751J29686_100033321 484
310 3300005295 Ga0065707_10082133 Ga0065707_100821334 484
311 3300005331 Ga0070670_100000047 Ga0070670_10000004723 484
312 3300005340 Ga0070689_100001657 Ga0070689_1000016578 484
313 3300005340 Ga0070689_100050373 Ga0070689_1000503732 484
314 3300005347 Ga0070668_100018826 Ga0070668_1000188262 484
315 3300005353 Ga0070669_100000099 Ga0070669_1000000997 484
316 3300005353 Ga0070669_100000162 Ga0070669_10000016220 484
317 3300005355 Ga0070671_100022628 Ga0070671_1000226285 484
318 3300005466 Ga0070685_10000101 Ga0070685_1000010145 484
319 3300005548 Ga0070665_100000254 Ga0070665_10000025426 484
320 3300005617 Ga0068859_100011614 Ga0068859_1000116149 484
321 3300005617 Ga0068859_100024123 Ga0068859_1000241234 484
322 3300005618 Ga0068864_100000051 Ga0068864_10000005122 484
323 3300005719 Ga0068861_100011286 Ga0068861_1000112864 484
324 3300005841 Ga0068863_100000214 Ga0068863_10000021431 484
325 3300005842 Ga0068858_100007575 Ga0068858_1000075759 484
326 3300005844 Ga0068862_100000036 Ga0068862_10000003623 484
327 3300005844 Ga0068862_100000357 Ga0068862_1000003579 484
328 3300005844 Ga0068862_100018625 Ga0068862_1000186252 484
329 3300006931 Ga0097620_100011614 Ga0097620_1000116149 484
330 3300006931 Ga0097620_100024122 Ga0097620_1000241225 484
331 3300009177 Ga0105248_10000407 Ga0105248_100004079 484
332 3300014326 Ga0157380_10000332 Ga0157380_100003322 484
333 3300014968 Ga0157379_10015227 Ga0157379_100152275 484
334 3300025223 Ga0207672_1000729 Ga0207672_10007292 484
335 3300025923 Ga0207681_10000003 Ga0207681_10000003627 484
336 3300025925 Ga0207650_10000038 Ga0207650_1000003873 484
337 3300025931 Ga0207644_10013409 Ga0207644_100134095 484
338 3300025936 Ga0207670_10022219 Ga0207670_100222192 484
339 3300025941 Ga0207711_10000607 Ga0207711_1000060722 484
340 3300025941 Ga0207711_10059979 Ga0207711_100599794 484
341 3300025972 Ga0207668_10006304 Ga0207668_100063043 484
342 3300025986 Ga0207658_10001592 Ga0207658_1000159210 484
343 3300026041 Ga0207639_10021938 Ga0207639_100219384 484
344 3300026088 Ga0207641_10000047 Ga0207641_1000004734 484
345 3300026095 Ga0207676_10000034 Ga0207676_10000034110 484
346 3300026118 Ga0207675_100003730 Ga0207675_1000037308 484
347 3300026118 Ga0207675_100007062 Ga0207675_10000706210 484
348 3300026118 Ga0207675_100021446 Ga0207675_1000214462 484
349 3300028379 Ga0268266_10000069 Ga0268266_10000069154 484
350 3300028380 Ga0268265_10000052 Ga0268265_1000005222 484
351 3300028380 Ga0268265_10000197 Ga0268265_1000019756 484
352 3300028380 Ga0268265_10004932 Ga0268265_100049327 484
353 3300037466 Ga0395898_0106979 Ga0395898_0106979_456_1991 484
354 3300038443 Ga0395901_0022137 Ga0395901_0022137_2959_4494 484
355 3300044683 Ga0466965_0031256 Ga0466965_0031256_431_1969 484
356 3300044684 Ga0466966_0002388 Ga0466966_0002388_3485_5029 484
357 3300044901 Ga0466960_0045153 Ga0466960_0045153_55_1593 484
358 3300046460 Ga0495638_0001102 Ga0495638_0001102_3600_5141 484
359 3300048906 Ga0496103_0000748 Ga0496103_0000748_7135_8670 484
360 3300048907 Ga0496104_0067365 Ga0496104_0067365_1263_2798 484
361 3300050496 nmdc:mga07m45_4755_c1 nmdc:mga07m45_4755_c1_4526_6061 484
362 3300053116 Ga0500592_000718 Ga0500592_000718_3407_4942 484
363 3300003794 Ga0055531_10000021 Ga0055531_1000002185 485
364 3300005578 Ga0068854_100076804 Ga0068854_1000768042 485
365 3300009177 Ga0105248_10105654 Ga0105248_101056542 485
366 3300009551 Ga0105238_10069566 Ga0105238_100695662 485
367 3300013104 Ga0157370_10014806 Ga0157370_100148068 485
368 3300014325 Ga0163163_10103722 Ga0163163_101037222 485
369 3300025303 Ga0209051_1009617 Ga0209051_10096173 485
370 3300025304 Ga0209257_1000032 Ga0209257_1000032434 485
371 3300025981 Ga0207640_10113553 Ga0207640_101135532 485
372 3300035170 Ga0373943_0011882 Ga0373943_0011882_239_1729 485
373 3300035692 Ga0373935_0016099 Ga0373935_0016099_900_2390 485
374 3300035695 Ga0373927_0025861 Ga0373927_0025861_2225_3715 485
375 3300042012 Ga0439455_0000293 Ga0439455_0000293_4603_6138 485
376 3300042157 Ga0439458_0003106 Ga0439458_0003106_2376_3911 485
377 3300003320 rootH2_10040129 rootH2_100401295 486
378 3300025933 Ga0207706_10111062 Ga0207706_101110622 486
379 3300039447 Ga0436361_0897280 Ga0436361_0897280_11817_13346 486
380 3300046684 Ga0495669_0012674 Ga0495669_0012674_1171_2706 486
381 3300053730 Ga0500645_002746 Ga0500645_002746_2341_3876 486
382 3300005355 Ga0070671_100007605 Ga0070671_1000076057 487
383 3300005367 Ga0070667_100001726 Ga0070667_10000172613 487
384 3300005548 Ga0070665_100003744 Ga0070665_10000374415 487
385 3300005617 Ga0068859_100000324 Ga0068859_1000003243 487
386 3300005618 Ga0068864_100000743 Ga0068864_1000007438 487
387 3300005841 Ga0068863_100007339 Ga0068863_1000073398 487
388 3300005842 Ga0068858_100006917 Ga0068858_1000069178 487
389 3300005843 Ga0068860_100000353 Ga0068860_10000035312 487
390 3300005843 Ga0068860_100011757 Ga0068860_1000117573 487
391 3300005843 Ga0068860_100107896 Ga0068860_1001078962 487
392 3300005844 Ga0068862_100076145 Ga0068862_1000761452 487
393 3300006195 Ga0075366_10007553 Ga0075366_100075535 487
394 3300006353 Ga0075370_10004706 Ga0075370_100047063 487
395 3300006931 Ga0097620_100000324 Ga0097620_1000003243 487
396 3300009177 Ga0105248_10000123 Ga0105248_1000012376 487
397 3300013306 Ga0163162_10002274 Ga0163162_1000227410 487
398 3300013308 Ga0157375_10081028 Ga0157375_100810283 487
399 3300014325 Ga0163163_10000265 Ga0163163_1000026534 487
400 3300025303 Ga0209051_1004538 Ga0209051_10045385 487
401 3300025931 Ga0207644_10041587 Ga0207644_100415872 487
402 3300025941 Ga0207711_10000100 Ga0207711_1000010078 487
403 3300025960 Ga0207651_10081205 Ga0207651_100812052 487
404 3300025986 Ga0207658_10000592 Ga0207658_1000059214 487
405 3300026023 Ga0207677_10070670 Ga0207677_100706702 487
406 3300026035 Ga0207703_10001186 Ga0207703_1000118626 487
407 3300026088 Ga0207641_10003117 Ga0207641_100031172 487
408 3300026095 Ga0207676_10000378 Ga0207676_100003783 487
409 3300028379 Ga0268266_10009139 Ga0268266_100091393 487
410 3300028380 Ga0268265_10017401 Ga0268265_100174011 487
411 3300028381 Ga0268264_10000021 Ga0268264_1000002152 487
412 3300028381 Ga0268264_10001814 Ga0268264_1000181417 487
413 3300047443 Ga0495687_000125 Ga0495687_000125_29387_30931 487
414 3300050496 nmdc:mga07m45_505_c1 nmdc:mga07m45_505_c1_3926_5470 487
415 3300005548 Ga0070665_100011289 Ga0070665_1000112893 488
416 3300005719 Ga0068861_100023488 Ga0068861_1000234882 488
417 3300026118 Ga0207675_100038664 Ga0207675_1000386644 488
418 3300037312 Ga0395899_0064655 Ga0395899_0064655_315_1856 488
419 3300037466 Ga0395898_0006568 Ga0395898_0006568_10416_11957 488
420 3300038443 Ga0395901_0014971 Ga0395901_0014971_5274_6815 488
421 3300005328 Ga0070676_10004834 Ga0070676_100048343 490
422 3300005333 Ga0070677_10000829 Ga0070677_100008296 490
423 3300005347 Ga0070668_100006365 Ga0070668_1000063658 490
424 3300005353 Ga0070669_100005466 Ga0070669_10000546610 490
425 3300005354 Ga0070675_100003584 Ga0070675_10000358411 490
426 3300005355 Ga0070671_100018586 Ga0070671_1000185863 490
427 3300005356 Ga0070674_100003989 Ga0070674_1000039895 490
428 3300005456 Ga0070678_100013659 Ga0070678_1000136597 490
429 3300005543 Ga0070672_100001207 Ga0070672_1000012076 490
430 3300005617 Ga0068859_100101242 Ga0068859_1001012422 490
431 3300006931 Ga0097620_100101251 Ga0097620_1001012512 490
432 3300025925 Ga0207650_10014405 Ga0207650_100144052 490
433 3300025926 Ga0207659_10007405 Ga0207659_100074055 490
434 3300025940 Ga0207691_10000442 Ga0207691_1000044230 490
435 3300026116 Ga0207674_10031878 Ga0207674_100318788 490
436 3300026121 Ga0207683_10009217 Ga0207683_100092173 490
437 3300028380 Ga0268265_10012793 Ga0268265_100127932 490
438 3300031903 Ga0307407_10058832 Ga0307407_100588323 490
439 3300032126 Ga0307415_100028341 Ga0307415_1000283414 490
440 3300042439 Ga0439464_0003431 Ga0439464_0003431_2289_3824 490
441 3300001990 JGI24737J22298_10000051 JGI24737J22298_1000005125 491
442 3300001990 JGI24737J22298_10000165 JGI24737J22298_100001655 491
443 3300002075 JGI24738J21930_10000027 JGI24738J21930_1000002720 491
444 3300005330 Ga0070690_100013207 Ga0070690_1000132072 491
445 3300005331 Ga0070670_100012044 Ga0070670_1000120446 491
446 3300005334 Ga0068869_100001996 Ga0068869_1000019966 491
447 3300005335 Ga0070666_10057578 Ga0070666_100575782 491
448 3300005335 Ga0070666_10059332 Ga0070666_100593322 491
449 3300005338 Ga0068868_100032545 Ga0068868_1000325453 491
450 3300005339 Ga0070660_100000767 Ga0070660_10000076715 491
451 3300005344 Ga0070661_100007808 Ga0070661_1000078084 491
452 3300005344 Ga0070661_100043650 Ga0070661_1000436503 491
453 3300005347 Ga0070668_100072193 Ga0070668_1000721934 491
454 3300005353 Ga0070669_100000699 Ga0070669_10000069914 491
455 3300005354 Ga0070675_100012015 Ga0070675_1000120152 491
456 3300005355 Ga0070671_100003886 Ga0070671_1000038864 491
457 3300005355 Ga0070671_100018748 Ga0070671_1000187482 491
458 3300005356 Ga0070674_100028068 Ga0070674_1000280683 491
459 3300005364 Ga0070673_100003743 Ga0070673_1000037439 491
460 3300005366 Ga0070659_100000753 Ga0070659_10000075317 491
461 3300005366 Ga0070659_100030220 Ga0070659_1000302204 491
462 3300005367 Ga0070667_100001558 Ga0070667_1000015587 491
463 3300005367 Ga0070667_100004197 Ga0070667_1000041974 491
464 3300005444 Ga0070694_100041086 Ga0070694_1000410862 491
465 3300005457 Ga0070662_100002248 Ga0070662_1000022483 491
466 3300005539 Ga0068853_100006221 Ga0068853_1000062217 491
467 3300005543 Ga0070672_100000234 Ga0070672_10000023410 491
468 3300005543 Ga0070672_100155391 Ga0070672_1001553912 491
469 3300005548 Ga0070665_100030502 Ga0070665_1000305026 491
470 3300005548 Ga0070665_100097864 Ga0070665_1000978644 491
471 3300005563 Ga0068855_100003156 Ga0068855_10000315614 491
472 3300005563 Ga0068855_100056306 Ga0068855_1000563063 491
473 3300005564 Ga0070664_100002747 Ga0070664_1000027474 491
474 3300005564 Ga0070664_100040646 Ga0070664_1000406461 491
475 3300005577 Ga0068857_100003650 Ga0068857_1000036506 491
476 3300005577 Ga0068857_100004327 Ga0068857_1000043276 491
477 3300005577 Ga0068857_100064545 Ga0068857_1000645453 491
478 3300005578 Ga0068854_100000061 Ga0068854_10000006126 491
479 3300005614 Ga0068856_100090626 Ga0068856_1000906262 491
480 3300005616 Ga0068852_100000847 Ga0068852_1000008473 491
481 3300005617 Ga0068859_100024318 Ga0068859_1000243183 491
482 3300005617 Ga0068859_100025027 Ga0068859_1000250277 491
483 3300005617 Ga0068859_100037329 Ga0068859_1000373293 491
484 3300005618 Ga0068864_100002131 Ga0068864_1000021313 491
485 3300005618 Ga0068864_100002488 Ga0068864_1000024889 491
486 3300005618 Ga0068864_100118777 Ga0068864_1001187772 491
487 3300005841 Ga0068863_100006673 Ga0068863_1000066734 491
488 3300005842 Ga0068858_100007137 Ga0068858_1000071372 491
489 3300005842 Ga0068858_100038487 Ga0068858_1000384872 491
490 3300005843 Ga0068860_100009742 Ga0068860_1000097424 491
491 3300005843 Ga0068860_100014764 Ga0068860_1000147643 491
492 3300005843 Ga0068860_100059152 Ga0068860_1000591524 491
493 3300005843 Ga0068860_100222950 Ga0068860_1002229502 491
494 3300005844 Ga0068862_100023491 Ga0068862_1000234914 491
495 3300005844 Ga0068862_100035008 Ga0068862_1000350083 491
496 3300006237 Ga0097621_100120820 Ga0097621_1001208202 491
497 3300006847 Ga0075431_100123846 Ga0075431_1001238462 491
498 3300006881 Ga0068865_100000434 Ga0068865_1000004348 491
499 3300006931 Ga0097620_100024317 Ga0097620_1000243175 491
500 3300006931 Ga0097620_100025028 Ga0097620_1000250282 491
501 3300006931 Ga0097620_100037328 Ga0097620_1000373283 491
502 3300009011 Ga0105251_10043986 Ga0105251_100439863 491
503 3300009093 Ga0105240_10200736 Ga0105240_102007362 491
504 3300009098 Ga0105245_10000424 Ga0105245_1000042422 491
505 3300009148 Ga0105243_10031215 Ga0105243_100312153 491
506 3300009177 Ga0105248_10000159 Ga0105248_1000015918 491
507 3300009177 Ga0105248_10031334 Ga0105248_100313346 491
508 3300009551 Ga0105238_10053533 Ga0105238_100535336 491
509 3300009553 Ga0105249_10019672 Ga0105249_100196724 491
510 3300010375 Ga0105239_10019413 Ga0105239_100194133 491
511 3300010375 Ga0105239_10051754 Ga0105239_100517543 491
512 3300011119 Ga0105246_10003940 Ga0105246_100039407 491
513 3300013102 Ga0157371_10003598 Ga0157371_100035988 491
514 3300013297 Ga0157378_10006264 Ga0157378_100062645 491
515 3300013306 Ga0163162_10013200 Ga0163162_100132006 491
516 3300013308 Ga0157375_10064297 Ga0157375_100642973 491
517 3300014968 Ga0157379_10001201 Ga0157379_100012015 491
518 3300025315 Ga0207697_10002358 Ga0207697_100023587 491
519 3300025901 Ga0207688_10000018 Ga0207688_1000001831 491
520 3300025901 Ga0207688_10026512 Ga0207688_100265126 491
521 3300025903 Ga0207680_10012998 Ga0207680_100129983 491
522 3300025904 Ga0207647_10000232 Ga0207647_1000023230 491
523 3300025904 Ga0207647_10000333 Ga0207647_1000033319 491
524 3300025908 Ga0207643_10055164 Ga0207643_100551643 491
525 3300025919 Ga0207657_10003142 Ga0207657_1000314211 491
526 3300025919 Ga0207657_10066083 Ga0207657_100660834 491
527 3300025920 Ga0207649_10008761 Ga0207649_100087614 491
528 3300025920 Ga0207649_10030987 Ga0207649_100309873 491
529 3300025923 Ga0207681_10001180 Ga0207681_100011807 491
530 3300025925 Ga0207650_10032714 Ga0207650_100327142 491
531 3300025931 Ga0207644_10000512 Ga0207644_1000051215 491
532 3300025931 Ga0207644_10007430 Ga0207644_100074303 491
533 3300025932 Ga0207690_10014349 Ga0207690_100143494 491
534 3300025933 Ga0207706_10000171 Ga0207706_1000017121 491
535 3300025933 Ga0207706_10002226 Ga0207706_1000222612 491
536 3300025935 Ga0207709_10028961 Ga0207709_100289613 491
537 3300025937 Ga0207669_10050360 Ga0207669_100503602 491
538 3300025938 Ga0207704_10001207 Ga0207704_100012076 491
539 3300025940 Ga0207691_10000070 Ga0207691_1000007021 491
540 3300025940 Ga0207691_10034316 Ga0207691_100343163 491
541 3300025941 Ga0207711_10002610 Ga0207711_1000261010 491
542 3300025941 Ga0207711_10012993 Ga0207711_100129936 491
543 3300025942 Ga0207689_10000123 Ga0207689_100001233 491
544 3300025942 Ga0207689_10017657 Ga0207689_100176574 491
545 3300025945 Ga0207679_10002516 Ga0207679_100025169 491
546 3300025945 Ga0207679_10017882 Ga0207679_100178823 491
547 3300025949 Ga0207667_10011731 Ga0207667_100117317 491
548 3300025960 Ga0207651_10000332 Ga0207651_1000033210 491
549 3300025961 Ga0207712_10000873 Ga0207712_1000087315 491
550 3300025972 Ga0207668_10067676 Ga0207668_100676762 491
551 3300025981 Ga0207640_10035086 Ga0207640_100350863 491
552 3300025986 Ga0207658_10048397 Ga0207658_100483974 491
553 3300025986 Ga0207658_10052764 Ga0207658_100527642 491
554 3300026035 Ga0207703_10005654 Ga0207703_100056545 491
555 3300026041 Ga0207639_10052430 Ga0207639_100524305 491
556 3300026078 Ga0207702_10005307 Ga0207702_100053076 491
557 3300026088 Ga0207641_10002327 Ga0207641_100023277 491
558 3300026088 Ga0207641_10012433 Ga0207641_100124336 491
559 3300026089 Ga0207648_10000317 Ga0207648_1000031736 491
560 3300026095 Ga0207676_10001136 Ga0207676_1000113614 491
561 3300026095 Ga0207676_10010624 Ga0207676_100106244 491
562 3300026116 Ga0207674_10000937 Ga0207674_1000093719 491
563 3300026116 Ga0207674_10001303 Ga0207674_1000130323 491
564 3300026116 Ga0207674_10008395 Ga0207674_100083956 491
565 3300026118 Ga0207675_100022045 Ga0207675_1000220456 491
566 3300028379 Ga0268266_10021182 Ga0268266_100211822 491
567 3300028379 Ga0268266_10024362 Ga0268266_100243622 491
568 3300028380 Ga0268265_10008194 Ga0268265_100081944 491
569 3300028381 Ga0268264_10000567 Ga0268264_1000056721 491
570 3300028381 Ga0268264_10002173 Ga0268264_100021737 491
571 3300037418 Ga0395900_0004869 Ga0395900_0004869_1420_2958 491
572 3300042004 Ga0439445_0002579 Ga0439445_0002579_1380_2918 491
573 3300042439 Ga0439464_0000713 Ga0439464_0000713_4675_6210 491
574 3300044694 Ga0466963_0000815 Ga0466963_0000815_4000_5535 491
575 3300044842 Ga0466957_0001952 Ga0466957_0001952_5138_6673 491
576 3300045976 Ga0466967_0002752 Ga0466967_0002752_4140_5675 491
577 3300050510 nmdc:mga06r32_19192_c1 nmdc:mga06r32_19192_c1_4549_6090 491
578 3300005331 Ga0070670_100006640 Ga0070670_10000664013 492
579 3300005331 Ga0070670_100129327 Ga0070670_1001293271 492
580 3300005353 Ga0070669_100014681 Ga0070669_1000146812 492
581 3300005455 Ga0070663_100048258 Ga0070663_1000482582 492
582 3300005455 Ga0070663_100066749 Ga0070663_1000667492 492
583 3300005564 Ga0070664_100007368 Ga0070664_1000073682 492
584 3300005577 Ga0068857_100013071 Ga0068857_1000130716 492
585 3300005617 Ga0068859_100003001 Ga0068859_1000030018 492
586 3300005719 Ga0068861_100066733 Ga0068861_1000667333 492
587 3300005842 Ga0068858_100037115 Ga0068858_1000371152 492
588 3300005844 Ga0068862_100048188 Ga0068862_1000481885 492
589 3300006931 Ga0097620_100003001 Ga0097620_1000030017 492
590 3300009553 Ga0105249_10011234 Ga0105249_100112342 492
591 3300025315 Ga0207697_10002531 Ga0207697_100025317 492
592 3300025907 Ga0207645_10008012 Ga0207645_100080123 492
593 3300025923 Ga0207681_10001989 Ga0207681_100019896 492
594 3300025925 Ga0207650_10099346 Ga0207650_100993464 492
595 3300025933 Ga0207706_10019005 Ga0207706_100190055 492
596 3300025933 Ga0207706_10046960 Ga0207706_100469602 492
597 3300025972 Ga0207668_10002284 Ga0207668_100022844 492
598 3300025981 Ga0207640_10099237 Ga0207640_100992372 492
599 3300026067 Ga0207678_10014684 Ga0207678_100146846 492
600 3300026067 Ga0207678_10090619 Ga0207678_100906192 492
601 3300026095 Ga0207676_10160767 Ga0207676_101607672 492
602 3300026116 Ga0207674_10012673 Ga0207674_100126739 492
603 3300026118 Ga0207675_100098758 Ga0207675_1000987583 492
604 3300028380 Ga0268265_10010028 Ga0268265_100100288 492
605 3300037312 Ga0395899_0013362 Ga0395899_0013362_2901_4436 492
606 3300037418 Ga0395900_0043596 Ga0395900_0043596_2104_3639 492
607 3300037471 Ga0395905_0000104 Ga0395905_0000104_43696_45231 492
608 3300042005 Ga0439448_0001144 Ga0439448_0001144_1685_3220 492
609 3300044901 Ga0466960_0044746 Ga0466960_0044746_167_1702 492
610 3300005842 Ga0068858_100051634 Ga0068858_1000516342 494
611 3300049744 Ga0501083_0044244 Ga0501083_0044244_1167_2699 494
612 3300053087 Ga0500643_000006 Ga0500643_000006_188576_190108 494
613 3300053139 Ga0500568_0005404 Ga0500568_0005404_1009_2541 494
614 3300013297 Ga0157378_10000018 Ga0157378_1000001870 498
615 3300049571 Ga0501034_0200126 Ga0501034_0200126_295_1869 498
616 3300001904 JGI24736J21556_1002566 JGI24736J21556_10025664 500
617 3300001979 JGI24740J21852_10025113 JGI24740J21852_100251132 500
618 3300001989 JGI24739J22299_10001257 JGI24739J22299_100012574 500
619 3300001989 JGI24739J22299_10015261 JGI24739J22299_100152612 500
620 3300005295 Ga0065707_10089113 Ga0065707_100891134 500
621 3300005327 Ga0070658_10004633 Ga0070658_100046334 500
622 3300005457 Ga0070662_100034495 Ga0070662_1000344952 500
623 3300005564 Ga0070664_100007907 Ga0070664_1000079074 500
624 3300005577 Ga0068857_100037783 Ga0068857_1000377833 500
625 3300005578 Ga0068854_100004904 Ga0068854_1000049048 500
626 3300005616 Ga0068852_100024513 Ga0068852_1000245134 500
627 3300005834 Ga0068851_10014735 Ga0068851_100147354 500
628 3300005842 Ga0068858_100001674 Ga0068858_1000016742 500
629 3300006353 Ga0075370_10007682 Ga0075370_100076822 500
630 3300013104 Ga0157370_10030792 Ga0157370_100307925 500
631 3300025292 Ga0209676_1000273 Ga0209676_100027381 500
632 3300025304 Ga0209257_1000458 Ga0209257_100045822 500
633 3300025321 Ga0207656_10019188 Ga0207656_100191881 500
634 3300025904 Ga0207647_10014933 Ga0207647_100149335 500
635 3300025909 Ga0207705_10016137 Ga0207705_100161374 500
636 3300025911 Ga0207654_10008896 Ga0207654_100088964 500
637 3300025914 Ga0207671_10000841 Ga0207671_1000084119 500
638 3300025924 Ga0207694_10002118 Ga0207694_1000211813 500
639 3300025981 Ga0207640_10034778 Ga0207640_100347784 500
640 3300025981 Ga0207640_10048529 Ga0207640_100485291 500
641 3300026035 Ga0207703_10006383 Ga0207703_100063832 500
642 3300026041 Ga0207639_10090113 Ga0207639_100901132 500
643 3300026078 Ga0207702_10003048 Ga0207702_100030485 500
644 3300026142 Ga0207698_10003405 Ga0207698_100034052 500
645 3300026142 Ga0207698_10005663 Ga0207698_100056632 500
646 3300031548 Ga0307408_100006789 Ga0307408_1000067895 500
647 3300031731 Ga0307405_10002100 Ga0307405_100021006 500
648 3300031901 Ga0307406_10002601 Ga0307406_100026014 500
649 3300031911 Ga0307412_10002490 Ga0307412_100024906 500
650 3300032002 Ga0307416_100013524 Ga0307416_1000135242 500
651 3300046660 Ga0495625_0014697 Ga0495625_0014697_3948_5507 500
652 3300050496 nmdc:mga07m45_3124_c1 nmdc:mga07m45_3124_c1_978_2525 500
653 3300053087 Ga0500643_000232 Ga0500643_000232_27234_28769 500
654 3300053156 Ga0500622_0000165 Ga0500622_0000165_64982_66529 500
655 3300005347 Ga0070668_100123140 Ga0070668_1001231403 501
656 3300005455 Ga0070663_100083195 Ga0070663_1000831952 501
657 3300005578 Ga0068854_100005672 Ga0068854_1000056724 501
658 3300009093 Ga0105240_10102679 Ga0105240_101026792 501
659 3300013105 Ga0157369_10000385 Ga0157369_1000038556 501
660 3300013307 Ga0157372_10099151 Ga0157372_100991512 501
661 3300025893 Ga0207682_10003777 Ga0207682_100037773 501
662 3300025942 Ga0207689_10008724 Ga0207689_100087245 501
663 3300025945 Ga0207679_10132261 Ga0207679_101322611 501
664 3300025949 Ga0207667_10021710 Ga0207667_100217103 501
665 3300025981 Ga0207640_10002840 Ga0207640_100028404 501
666 3300026041 Ga0207639_10085102 Ga0207639_100851023 501
667 3300026078 Ga0207702_10008058 Ga0207702_100080586 501
668 3300037312 Ga0395899_0068026 Ga0395899_0068026_282_1817 501
669 3300037418 Ga0395900_0164563 Ga0395900_0164563_668_2203 501
670 3300044656 Ga0466969_0048135 Ga0466969_0048135_216_1751 501
671 3300044684 Ga0466966_0000052 Ga0466966_0000052_14706_16241 501
672 3300044693 Ga0466961_0034809 Ga0466961_0034809_519_2054 501
673 3300044694 Ga0466963_0024046 Ga0466963_0024046_447_1982 501
674 3300044719 Ga0466971_0012210 Ga0466971_0012210_978_2513 501
675 3300044765 Ga0466970_0076593 Ga0466970_0076593_212_1747 501
676 3300045836 Ga0466958_0000611 Ga0466958_0000611_10747_12282 501
677 3300005327 Ga0070658_10033056 Ga0070658_100330563 502
678 3300005335 Ga0070666_10053109 Ga0070666_100531092 502
679 3300005338 Ga0068868_100020578 Ga0068868_1000205783 502
680 3300005355 Ga0070671_100022038 Ga0070671_1000220383 502
681 3300005364 Ga0070673_100009898 Ga0070673_1000098985 502
682 3300005364 Ga0070673_100072205 Ga0070673_1000722052 502
683 3300005367 Ga0070667_100026747 Ga0070667_1000267473 502
684 3300005457 Ga0070662_100032902 Ga0070662_1000329022 502
685 3300005459 Ga0068867_100011915 Ga0068867_1000119152 502
686 3300005617 Ga0068859_100086978 Ga0068859_1000869783 502
687 3300005834 Ga0068851_10022284 Ga0068851_100222843 502
688 3300005842 Ga0068858_100024881 Ga0068858_1000248816 502
689 3300006237 Ga0097621_100034584 Ga0097621_1000345843 502
690 3300006881 Ga0068865_100028784 Ga0068865_1000287843 502
691 3300006931 Ga0097620_100086981 Ga0097620_1000869812 502
692 3300009098 Ga0105245_10222158 Ga0105245_102221582 502
693 3300009177 Ga0105248_10119460 Ga0105248_101194603 502
694 3300010375 Ga0105239_10265085 Ga0105239_102650851 502
695 3300013297 Ga0157378_10022160 Ga0157378_100221605 502
696 3300014969 Ga0157376_10044100 Ga0157376_100441004 502
697 3300025919 Ga0207657_10009428 Ga0207657_100094288 502
698 3300025919 Ga0207657_10030517 Ga0207657_100305174 502
699 3300025931 Ga0207644_10016807 Ga0207644_100168074 502
700 3300025933 Ga0207706_10002480 Ga0207706_1000248011 502
701 3300025938 Ga0207704_10067513 Ga0207704_100675131 502
702 3300025940 Ga0207691_10012078 Ga0207691_100120788 502
703 3300025941 Ga0207711_10086011 Ga0207711_100860112 502
704 3300025960 Ga0207651_10033606 Ga0207651_100336063 502
705 3300026023 Ga0207677_10016237 Ga0207677_100162372 502
706 3300026035 Ga0207703_10017446 Ga0207703_100174462 502
707 3300026089 Ga0207648_10078277 Ga0207648_100782772 502
708 3300048903 Ga0496100_0012996 Ga0496100_0012996_2394_3938 502
709 3300048904 Ga0496101_0002179 Ga0496101_0002179_4635_6179 502
710 3300048905 Ga0496102_0016769 Ga0496102_0016769_2132_3676 502
711 3300048908 Ga0496105_0024060 Ga0496105_0024060_854_2398 502
712 3300048912 Ga0496109_0009291 Ga0496109_0009291_5741_7285 502
713 3300001904 JGI24736J21556_1001268 JGI24736J21556_10012682 504
714 3300001915 JGI24741J21665_1008183 JGI24741J21665_10081831 504
715 3300001979 JGI24740J21852_10023866 JGI24740J21852_100238662 504
716 3300005329 Ga0070683_100206723 Ga0070683_1002067231 504
717 3300005339 Ga0070660_100021183 Ga0070660_1000211832 504
718 3300005344 Ga0070661_100006327 Ga0070661_1000063274 504
719 3300005435 Ga0070714_100096013 Ga0070714_1000960132 504
720 3300009093 Ga0105240_10205940 Ga0105240_102059402 504
721 3300009551 Ga0105238_10052066 Ga0105238_100520662 504
722 3300010375 Ga0105239_10153247 Ga0105239_101532472 504
723 3300013104 Ga0157370_10054688 Ga0157370_100546882 504
724 3300025904 Ga0207647_10013372 Ga0207647_100133722 504
725 3300025909 Ga0207705_10000059 Ga0207705_1000005931 504
726 3300025909 Ga0207705_10001692 Ga0207705_1000169213 504
727 3300025913 Ga0207695_10048837 Ga0207695_100488373 504
728 3300025920 Ga0207649_10004902 Ga0207649_100049022 504
729 3300025924 Ga0207694_10038326 Ga0207694_100383262 504
730 3300025949 Ga0207667_10048962 Ga0207667_100489623 504
731 3300026078 Ga0207702_10020863 Ga0207702_100208632 504
732 3300026142 Ga0207698_10057375 Ga0207698_100573752 504
733 3300037312 Ga0395899_0023792 Ga0395899_0023792_2355_3899 504
734 3300038443 Ga0395901_0059393 Ga0395901_0059393_962_2506 504

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

31

426

0.91

PF00083

Sugar_tr

Sugar (and other) transporter

16

202

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8297 26 494
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8 26 488
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7887 24 491
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.787 24 491
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7784 26 494
ID Description Score Start End Superfamily
af_P0AEJ0_15_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9543 18 214 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9455 26 199 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9298 26 216 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9247 18 213 1.20.1250.20
af_Q2G2W1_141_346_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9211 26 213 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9361 18 155 GO:0005886
GO:0022857
AF-A0A7X7SSR9-F1-model_v4 MFS transporter 0.9286 26 183 GO:0016020
GO:0022857
AF-A0A2E6BHY6-F1-model_v4 MFS transporter 0.9246 26 153 GO:0005886
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9105 18 155 GO:0005886
GO:0022857
AF-A0A524MXG0-F1-model_v4 MFS transporter 0.9039 264 492 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
72.87 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map