F478116
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 264 | 1468 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10104004|Ga0065707_101040041 |
| Length | 148 |
| Sequence | MADTYVPLISSGTAGPLGVLHLPRLWQKVSLEARGKLAPGYPGIGKGYDMMTISALGLNADAVKKFITDNKPTYPQFEAWVKGQPGVKLDKATLYKHNASIRGYIHDDATRKGILGANAISDESSVNPGAVDLNNLDDWYEFHQAALK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 198 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 201 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.72 |
| Rhizosphere | 90.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 40.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10104004 | 3300005295 | Bacteria | 2719 |
| 2 | CNXas_1000035 | 3300000545 | Bacteria | 28845 |
| 3 | JGI25406J46586_10070767 | 3300003203 | Unclassified | 1095 |
| 4 | Ga0058859_11725447 | 3300004798 | Bacteria | 767 |
| 5 | Ga0058859_11823994 | 3300004798 | Unclassified | 568 |
| 6 | Ga0058860_12116340 | 3300004801 | Unclassified | 670 |
| 7 | Ga0058860_12213048 | 3300004801 | Unclassified | 565 |
| 8 | Ga0065704_10213269 | 3300005289 | Unclassified | 1101 |
| 9 | Ga0065712_10011743 | 3300005290 | Bacteria | 2968 |
| 10 | Ga0065712_10023244 | 3300005290 | Bacteria | 1576 |
| 11 | Ga0065712_10074607 | 3300005290 | Bacteria | 4020 |
| 12 | Ga0065712_10076749 | 3300005290 | Bacteria | 3608 |
| 13 | Ga0065712_10221278 | 3300005290 | Unclassified | 1026 |
| 14 | Ga0065712_10258147 | 3300005290 | Unclassified | 943 |
| 15 | Ga0065712_10284088 | 3300005290 | Bacteria | 890 |
| 16 | Ga0065715_10018433 | 3300005293 | Bacteria | 2493 |
| 17 | Ga0065715_10071293 | 3300005293 | Unclassified | 712 |
| 18 | Ga0065715_10089033 | 3300005293 | Bacteria | 16097 |
| 19 | Ga0065715_10091980 | 3300005293 | Bacteria | 5418 |
| 20 | Ga0065715_10143173 | 3300005293 | Bacteria | 1824 |
| 21 | Ga0065715_10182570 | 3300005293 | Unclassified | 1464 |
| 22 | Ga0065715_10446061 | 3300005293 | Bacteria | 831 |
| 23 | Ga0065707_10173538 | 3300005295 | Unclassified | 1467 |
| 24 | Ga0070676_10007840 | 3300005328 | Bacteria | 5740 |
| 25 | Ga0070676_10007972 | 3300005328 | Bacteria | 5694 |
| 26 | Ga0070676_10036383 | 3300005328 | Bacteria | 2836 |
| 27 | Ga0070676_10039256 | 3300005328 | Unclassified | 2737 |
| 28 | Ga0070683_100198825 | 3300005329 | Bacteria | 1904 |
| 29 | Ga0070683_100355238 | 3300005329 | Bacteria | 1395 |
| 30 | Ga0070683_101233650 | 3300005329 | Bacteria | 719 |
| 31 | Ga0070690_100105700 | 3300005330 | Bacteria | 1872 |
| 32 | Ga0070690_100377813 | 3300005330 | Bacteria | 1035 |
| 33 | Ga0070690_100446466 | 3300005330 | Unclassified | 958 |
| 34 | Ga0070690_100497503 | 3300005330 | Unclassified | 911 |
| 35 | Ga0070670_100144986 | 3300005331 | Bacteria | 2054 |
| 36 | Ga0070670_101115416 | 3300005331 | Unclassified | 720 |
| 37 | Ga0070677_10042336 | 3300005333 | Bacteria | 1803 |
| 38 | Ga0070666_10060833 | 3300005335 | Bacteria | 2556 |
| 39 | Ga0070666_10086266 | 3300005335 | Bacteria | 2150 |
| 40 | Ga0070666_10136513 | 3300005335 | Bacteria | 1706 |
| 41 | Ga0070666_10366201 | 3300005335 | Unclassified | 1033 |
| 42 | Ga0070682_101009204 | 3300005337 | Unclassified | 691 |
| 43 | Ga0068868_100004179 | 3300005338 | Bacteria | 10094 |
| 44 | Ga0068868_100120666 | 3300005338 | Unclassified | 2138 |
| 45 | Ga0068868_100382936 | 3300005338 | Bacteria | 1211 |
| 46 | Ga0068868_101145931 | 3300005338 | Unclassified | 717 |
| 47 | Ga0068868_101233475 | 3300005338 | Bacteria | 692 |
| 48 | Ga0068868_102346136 | 3300005338 | Unclassified | 509 |
| 49 | Ga0070689_100003430 | 3300005340 | Bacteria | 10547 |
| 50 | Ga0070689_100114699 | 3300005340 | Bacteria | 2147 |
| 51 | Ga0070689_100304978 | 3300005340 | Bacteria | 1326 |
| 52 | Ga0070689_100402962 | 3300005340 | Unclassified | 1157 |
| 53 | Ga0070689_100508652 | 3300005340 | Unclassified | 1033 |
| 54 | Ga0070689_100703925 | 3300005340 | Bacteria | 882 |
| 55 | Ga0070689_100846614 | 3300005340 | Unclassified | 806 |
| 56 | Ga0070691_10119166 | 3300005341 | Unclassified | 1327 |
| 57 | Ga0070687_100120145 | 3300005343 | Unclassified | 1502 |
| 58 | Ga0070687_100146024 | 3300005343 | Unclassified | 1383 |
| 59 | Ga0070687_100262742 | 3300005343 | Bacteria | 1078 |
| 60 | Ga0070687_101089357 | 3300005343 | Unclassified | 584 |
| 61 | Ga0070661_100007794 | 3300005344 | Bacteria | 7391 |
| 62 | Ga0070661_100619270 | 3300005344 | Unclassified | 876 |
| 63 | Ga0070661_100969873 | 3300005344 | Unclassified | 704 |
| 64 | Ga0070668_100009102 | 3300005347 | Bacteria | 7375 |
| 65 | Ga0070668_100057268 | 3300005347 | Bacteria | 3011 |
| 66 | Ga0070668_100071733 | 3300005347 | Bacteria | 2698 |
| 67 | Ga0070668_100097880 | 3300005347 | Bacteria | 2321 |
| 68 | Ga0070669_100004185 | 3300005353 | Bacteria | 10457 |
| 69 | Ga0070669_100026882 | 3300005353 | Bacteria | 4140 |
| 70 | Ga0070669_100029948 | 3300005353 | Bacteria | 3925 |
| 71 | Ga0070669_100030435 | 3300005353 | Bacteria | 3895 |
| 72 | Ga0070669_100037558 | 3300005353 | Bacteria | 3513 |
| 73 | Ga0070669_100239763 | 3300005353 | Unclassified | 1440 |
| 74 | Ga0070669_100246446 | 3300005353 | Bacteria | 1421 |
| 75 | Ga0070669_100712675 | 3300005353 | Bacteria | 848 |
| 76 | Ga0070669_100880330 | 3300005353 | Unclassified | 764 |
| 77 | Ga0070675_100013126 | 3300005354 | Bacteria | 6509 |
| 78 | Ga0070675_100029234 | 3300005354 | Bacteria | 4443 |
| 79 | Ga0070675_100045309 | 3300005354 | Bacteria | 3599 |
| 80 | Ga0070675_100052409 | 3300005354 | Bacteria | 3354 |
| 81 | Ga0070675_100054300 | 3300005354 | Bacteria | 3296 |
| 82 | Ga0070675_100054706 | 3300005354 | Bacteria | 3284 |
| 83 | Ga0070675_100062835 | 3300005354 | Bacteria | 3069 |
| 84 | Ga0070675_100066348 | 3300005354 | Bacteria | 2985 |
| 85 | Ga0070675_100084269 | 3300005354 | Unclassified | 2654 |
| 86 | Ga0070675_100295895 | 3300005354 | Bacteria | 1425 |
| 87 | Ga0070675_100551765 | 3300005354 | Bacteria | 1042 |
| 88 | Ga0070675_100626995 | 3300005354 | Unclassified | 976 |
| 89 | Ga0070671_100005632 | 3300005355 | Bacteria | 9969 |
| 90 | Ga0070671_100007851 | 3300005355 | Bacteria | 8530 |
| 91 | Ga0070671_100012342 | 3300005355 | Bacteria | 6879 |
| 92 | Ga0070671_100051625 | 3300005355 | Bacteria | 3420 |
| 93 | Ga0070671_100107751 | 3300005355 | Bacteria | 2339 |
| 94 | Ga0070671_100223398 | 3300005355 | Bacteria | 1598 |
| 95 | Ga0070671_100535086 | 3300005355 | Unclassified | 1010 |
| 96 | Ga0070674_100001540 | 3300005356 | Bacteria | 12324 |
| 97 | Ga0070674_100018937 | 3300005356 | Bacteria | 4364 |
| 98 | Ga0070674_100070468 | 3300005356 | Bacteria | 2470 |
| 99 | Ga0070674_100828964 | 3300005356 | Bacteria | 801 |
| 100 | Ga0070673_100007445 | 3300005364 | Bacteria | 7220 |
| 101 | Ga0070673_100007726 | 3300005364 | Bacteria | 7116 |
| 102 | Ga0070673_100283871 | 3300005364 | Bacteria | 1453 |
| 103 | Ga0070673_101106465 | 3300005364 | Unclassified | 740 |
| 104 | Ga0070673_101869047 | 3300005364 | Unclassified | 569 |
| 105 | Ga0070673_101895839 | 3300005364 | Unclassified | 565 |
| 106 | Ga0070688_100022457 | 3300005365 | Bacteria | 3698 |
| 107 | Ga0070688_100063772 | 3300005365 | Unclassified | 2337 |
| 108 | Ga0070688_100127076 | 3300005365 | Bacteria | 1715 |
| 109 | Ga0070688_100242841 | 3300005365 | Unclassified | 1279 |
| 110 | Ga0070688_100249159 | 3300005365 | Bacteria | 1264 |
| 111 | Ga0070688_100633744 | 3300005365 | Bacteria | 821 |
| 112 | Ga0070688_100761139 | 3300005365 | Unclassified | 755 |
| 113 | Ga0070659_100280889 | 3300005366 | Unclassified | 1385 |
| 114 | Ga0070659_100784721 | 3300005366 | Unclassified | 828 |
| 115 | Ga0070667_100025411 | 3300005367 | Bacteria | 4924 |
| 116 | Ga0070667_100030186 | 3300005367 | Bacteria | 4520 |
| 117 | Ga0070667_100155127 | 3300005367 | Unclassified | 2013 |
| 118 | Ga0070667_100229623 | 3300005367 | Bacteria | 1654 |
| 119 | Ga0070667_100944112 | 3300005367 | Bacteria | 804 |
| 120 | Ga0070667_102051101 | 3300005367 | Unclassified | 539 |
| 121 | Ga0070709_10096259 | 3300005434 | Bacteria | 1962 |
| 122 | Ga0070709_10390072 | 3300005434 | Bacteria | 1037 |
| 123 | Ga0070709_10822462 | 3300005434 | Bacteria | 730 |
| 124 | Ga0070714_101004597 | 3300005435 | Unclassified | 812 |
| 125 | Ga0070714_101680289 | 3300005435 | Unclassified | 620 |
| 126 | Ga0070713_100052026 | 3300005436 | Bacteria | 3390 |
| 127 | Ga0070713_100475835 | 3300005436 | Unclassified | 1176 |
| 128 | Ga0070713_100873617 | 3300005436 | Unclassified | 864 |
| 129 | Ga0070713_101505169 | 3300005436 | Bacteria | 653 |
| 130 | Ga0070710_10134620 | 3300005437 | Bacteria | 1510 |
| 131 | Ga0070710_10821190 | 3300005437 | Unclassified | 665 |
| 132 | Ga0070710_10894578 | 3300005437 | Unclassified | 640 |
| 133 | Ga0070701_10046646 | 3300005438 | Bacteria | 2228 |
| 134 | Ga0070701_10197116 | 3300005438 | Unclassified | 1188 |
| 135 | Ga0070711_100013511 | 3300005439 | Bacteria | 5126 |
| 136 | Ga0070711_100113978 | 3300005439 | Bacteria | 1989 |
| 137 | Ga0070711_100116825 | 3300005439 | Bacteria | 1966 |
| 138 | Ga0070711_100450364 | 3300005439 | Unclassified | 1054 |
| 139 | Ga0070711_101297823 | 3300005439 | Bacteria | 631 |
| 140 | Ga0070705_100036402 | 3300005440 | Bacteria | 2767 |
| 141 | Ga0070705_100078310 | 3300005440 | Unclassified | 2021 |
| 142 | Ga0070705_100279866 | 3300005440 | Unclassified | 1185 |
| 143 | Ga0070694_100067438 | 3300005444 | Bacteria | 2456 |
| 144 | Ga0070694_100736308 | 3300005444 | Unclassified | 804 |
| 145 | Ga0070708_100044889 | 3300005445 | Unclassified | 3890 |
| 146 | Ga0070708_100052277 | 3300005445 | Bacteria | 3623 |
| 147 | Ga0070708_100059499 | 3300005445 | Bacteria | 3406 |
| 148 | Ga0070708_100424089 | 3300005445 | Bacteria | 1255 |
| 149 | Ga0070708_100442394 | 3300005445 | Unclassified | 1226 |
| 150 | Ga0070708_100461248 | 3300005445 | Bacteria | 1199 |
| 151 | Ga0070708_100524792 | 3300005445 | Bacteria | 1117 |
| 152 | Ga0070708_101230762 | 3300005445 | Unclassified | 700 |
| 153 | Ga0070663_100212697 | 3300005455 | Bacteria | 1515 |
| 154 | Ga0070663_100312114 | 3300005455 | Bacteria | 1262 |
| 155 | Ga0070663_101184005 | 3300005455 | Unclassified | 671 |
| 156 | Ga0070678_100006233 | 3300005456 | Bacteria | 6977 |
| 157 | Ga0070678_100177757 | 3300005456 | Bacteria | 1739 |
| 158 | Ga0070678_100241188 | 3300005456 | Unclassified | 1511 |
| 159 | Ga0070678_100740815 | 3300005456 | Bacteria | 888 |
| 160 | Ga0070678_100919617 | 3300005456 | Unclassified | 800 |
| 161 | Ga0070662_100110904 | 3300005457 | Unclassified | 2090 |
| 162 | Ga0070662_100421756 | 3300005457 | Unclassified | 1104 |
| 163 | Ga0070681_10398028 | 3300005458 | Unclassified | 1288 |
| 164 | Ga0068867_100054744 | 3300005459 | Bacteria | 2947 |
| 165 | Ga0068867_100116101 | 3300005459 | Unclassified | 2062 |
| 166 | Ga0068867_100584533 | 3300005459 | Unclassified | 972 |
| 167 | Ga0070685_10021980 | 3300005466 | Bacteria | 3471 |
| 168 | Ga0070685_10213200 | 3300005466 | Bacteria | 1261 |
| 169 | Ga0070685_11300438 | 3300005466 | Unclassified | 555 |
| 170 | Ga0070706_100001379 | 3300005467 | Bacteria | 25801 |
| 171 | Ga0070706_100008961 | 3300005467 | Bacteria | 9318 |
| 172 | Ga0070706_100061580 | 3300005467 | Bacteria | 3465 |
| 173 | Ga0070706_100137959 | 3300005467 | Bacteria | 2276 |
| 174 | Ga0070706_100149860 | 3300005467 | Bacteria | 2177 |
| 175 | Ga0070706_100177366 | 3300005467 | Bacteria | 1989 |
| 176 | Ga0070706_100232172 | 3300005467 | Unclassified | 1722 |
| 177 | Ga0070706_100317705 | 3300005467 | Bacteria | 1452 |
| 178 | Ga0070706_100427444 | 3300005467 | Bacteria | 1233 |
| 179 | Ga0070707_100004173 | 3300005468 | Bacteria | 13536 |
| 180 | Ga0070707_100068799 | 3300005468 | Unclassified | 3408 |
| 181 | Ga0070707_100080983 | 3300005468 | Bacteria | 3134 |
| 182 | Ga0070707_100119221 | 3300005468 | Unclassified | 2561 |
| 183 | Ga0070707_100128719 | 3300005468 | Bacteria | 2461 |
| 184 | Ga0070707_100136522 | 3300005468 | Bacteria | 2386 |
| 185 | Ga0070707_100169482 | 3300005468 | Bacteria | 2128 |
| 186 | Ga0070707_100193064 | 3300005468 | Bacteria | 1986 |
| 187 | Ga0070707_100590556 | 3300005468 | Unclassified | 1073 |
| 188 | Ga0070707_100768724 | 3300005468 | Unclassified | 927 |
| 189 | Ga0070707_101344248 | 3300005468 | Bacteria | 681 |
| 190 | Ga0070698_100002085 | 3300005471 | Bacteria | 22202 |
| 191 | Ga0070698_100034756 | 3300005471 | Bacteria | 5215 |
| 192 | Ga0070698_100375645 | 3300005471 | Bacteria | 1354 |
| 193 | Ga0070699_100210729 | 3300005518 | Bacteria | 1730 |
| 194 | Ga0070699_100542791 | 3300005518 | Unclassified | 1058 |
| 195 | Ga0070699_101713296 | 3300005518 | Unclassified | 576 |
| 196 | Ga0070679_100053130 | 3300005530 | Unclassified | 4033 |
| 197 | Ga0070679_100697245 | 3300005530 | Unclassified | 958 |
| 198 | Ga0070684_100588381 | 3300005535 | Unclassified | 1034 |
| 199 | Ga0070697_100009582 | 3300005536 | Bacteria | 7564 |
| 200 | Ga0070697_100092469 | 3300005536 | Bacteria | 2503 |
| 201 | Ga0070697_100202969 | 3300005536 | Unclassified | 1685 |
| 202 | Ga0070697_100305620 | 3300005536 | Unclassified | 1368 |
| 203 | Ga0070697_100373876 | 3300005536 | Unclassified | 1233 |
| 204 | Ga0070697_100505840 | 3300005536 | Bacteria | 1057 |
| 205 | Ga0070697_100770321 | 3300005536 | Unclassified | 851 |
| 206 | Ga0070697_101445788 | 3300005536 | Unclassified | 614 |
| 207 | Ga0070672_100001416 | 3300005543 | Bacteria | 14815 |
| 208 | Ga0070672_100005924 | 3300005543 | Bacteria | 8155 |
| 209 | Ga0070672_100031846 | 3300005543 | Unclassified | 3974 |
| 210 | Ga0070672_100273430 | 3300005543 | Bacteria | 1427 |
| 211 | Ga0070672_100389517 | 3300005543 | Unclassified | 1193 |
| 212 | Ga0070672_100674051 | 3300005543 | Unclassified | 904 |
| 213 | Ga0070672_100758606 | 3300005543 | Unclassified | 852 |
| 214 | Ga0070686_100087881 | 3300005544 | Unclassified | 2073 |
| 215 | Ga0070686_100109931 | 3300005544 | Unclassified | 1876 |
| 216 | Ga0070695_100091611 | 3300005545 | Unclassified | 2031 |
| 217 | Ga0070696_101691643 | 3300005546 | Unclassified | 545 |
| 218 | Ga0070693_100110272 | 3300005547 | Unclassified | 1692 |
| 219 | Ga0070665_100011639 | 3300005548 | Bacteria | 8892 |
| 220 | Ga0070665_100068808 | 3300005548 | Bacteria | 3549 |
| 221 | Ga0070704_100341485 | 3300005549 | Bacteria | 1261 |
| 222 | Ga0070704_100349166 | 3300005549 | Bacteria | 1248 |
| 223 | Ga0070704_100722282 | 3300005549 | Bacteria | 885 |
| 224 | Ga0068855_100234275 | 3300005563 | Bacteria | 2054 |
| 225 | Ga0070664_100026517 | 3300005564 | Bacteria | 4807 |
| 226 | Ga0068857_100074607 | 3300005577 | Bacteria | 3023 |
| 227 | Ga0068856_100647365 | 3300005614 | Unclassified | 1077 |
| 228 | Ga0070702_100370539 | 3300005615 | Bacteria | 1015 |
| 229 | Ga0068852_101079466 | 3300005616 | Bacteria | 823 |
| 230 | Ga0068859_100124696 | 3300005617 | Bacteria | 2644 |
| 231 | Ga0068859_100832985 | 3300005617 | Unclassified | 1009 |
| 232 | Ga0068859_100973854 | 3300005617 | Bacteria | 931 |
| 233 | Ga0068864_100177739 | 3300005618 | Bacteria | 1944 |
| 234 | Ga0068864_100596889 | 3300005618 | Bacteria | 1071 |
| 235 | Ga0068863_100045679 | 3300005841 | Unclassified | 4157 |
| 236 | Ga0068863_100551481 | 3300005841 | Bacteria | 1138 |
| 237 | Ga0068863_100760737 | 3300005841 | Bacteria | 965 |
| 238 | Ga0068858_100366301 | 3300005842 | Bacteria | 1382 |
| 239 | Ga0068860_100057008 | 3300005843 | Bacteria | 3713 |
| 240 | Ga0068860_100161412 | 3300005843 | Bacteria | 2161 |
| 241 | Ga0068862_100022542 | 3300005844 | Bacteria | 5269 |
| 242 | Ga0068862_101240529 | 3300005844 | Unclassified | 745 |
| 243 | Ga0081455_10001048 | 3300005937 | Bacteria | 34800 |
| 244 | Ga0081455_10004623 | 3300005937 | Bacteria | 15365 |
| 245 | Ga0081455_10099970 | 3300005937 | Unclassified | 2332 |
| 246 | Ga0081455_10160367 | 3300005937 | Bacteria | 1725 |
| 247 | Ga0081538_10179140 | 3300005981 | Unclassified | 910 |
| 248 | Ga0081539_10009376 | 3300005985 | Bacteria | 8197 |
| 249 | Ga0081539_10014820 | 3300005985 | Bacteria | 5726 |
| 250 | Ga0081539_10135056 | 3300005985 | Unclassified | 1207 |
| 251 | Ga0070717_10047925 | 3300006028 | Bacteria | 3503 |
| 252 | Ga0070717_10080586 | 3300006028 | Bacteria | 2732 |
| 253 | Ga0070717_10194342 | 3300006028 | Bacteria | 1774 |
| 254 | Ga0070717_10273511 | 3300006028 | Unclassified | 1496 |
| 255 | Ga0070717_10834533 | 3300006028 | Bacteria | 839 |
| 256 | Ga0070717_10931669 | 3300006028 | Unclassified | 791 |
| 257 | Ga0070716_100052165 | 3300006173 | Bacteria | 2328 |
| 258 | Ga0070716_100122568 | 3300006173 | Unclassified | 1630 |
| 259 | Ga0070716_100252653 | 3300006173 | Bacteria | 1202 |
| 260 | Ga0070716_100260848 | 3300006173 | Unclassified | 1185 |
| 261 | Ga0070712_100021497 | 3300006175 | Bacteria | 4238 |
| 262 | Ga0070712_100028477 | 3300006175 | Bacteria | 3737 |
| 263 | Ga0070712_100036388 | 3300006175 | Unclassified | 3349 |
| 264 | Ga0070712_100862023 | 3300006175 | Unclassified | 779 |
| 265 | Ga0097621_100057075 | 3300006237 | Unclassified | 3191 |
| 266 | Ga0097621_100073802 | 3300006237 | Bacteria | 2825 |
| 267 | Ga0097621_100086798 | 3300006237 | Unclassified | 2612 |
| 268 | Ga0097621_100854047 | 3300006237 | Unclassified | 846 |
| 269 | Ga0097621_101418993 | 3300006237 | Bacteria | 658 |
| 270 | Ga0097621_101468897 | 3300006237 | Bacteria | 646 |
| 271 | Ga0068871_100033180 | 3300006358 | Bacteria | 4085 |
| 272 | Ga0068871_100193347 | 3300006358 | Bacteria | 1754 |
| 273 | Ga0068871_101003072 | 3300006358 | Unclassified | 777 |
| 274 | Ga0068871_102195904 | 3300006358 | Unclassified | 526 |
| 275 | Ga0075431_100743738 | 3300006847 | Unclassified | 956 |
| 276 | Ga0075433_10404793 | 3300006852 | Unclassified | 1204 |
| 277 | Ga0075433_10723016 | 3300006852 | Unclassified | 871 |
| 278 | Ga0075433_10741960 | 3300006852 | Bacteria | 859 |
| 279 | Ga0075433_10968922 | 3300006852 | Unclassified | 741 |
| 280 | Ga0075433_11121625 | 3300006852 | Bacteria | 684 |
| 281 | Ga0075434_100289902 | 3300006871 | Bacteria | 1657 |
| 282 | Ga0075434_100310626 | 3300006871 | Bacteria | 1597 |
| 283 | Ga0075429_100058520 | 3300006880 | Bacteria | 3356 |
| 284 | Ga0068865_100037254 | 3300006881 | Bacteria | 3283 |
| 285 | Ga0068865_100177918 | 3300006881 | Bacteria | 1636 |
| 286 | Ga0068865_100571969 | 3300006881 | Unclassified | 952 |
| 287 | Ga0068865_101443306 | 3300006881 | Unclassified | 615 |
| 288 | Ga0075436_101128411 | 3300006914 | Bacteria | 591 |
| 289 | Ga0097620_100124696 | 3300006931 | Bacteria | 2644 |
| 290 | Ga0097620_100833041 | 3300006931 | Unclassified | 1009 |
| 291 | Ga0097620_100973835 | 3300006931 | Bacteria | 931 |
| 292 | Ga0075435_100504874 | 3300007076 | Bacteria | 1046 |
| 293 | Ga0099794_10265086 | 3300007265 | Bacteria | 887 |
| 294 | Ga0099795_10021719 | 3300007788 | Bacteria | 2109 |
| 295 | Ga0105240_10043073 | 3300009093 | Bacteria | 5747 |
| 296 | Ga0111539_10066481 | 3300009094 | Bacteria | 4258 |
| 297 | Ga0111539_10319593 | 3300009094 | Bacteria | 1807 |
| 298 | Ga0111539_11114347 | 3300009094 | Bacteria | 917 |
| 299 | Ga0105245_10207079 | 3300009098 | Bacteria | 1886 |
| 300 | Ga0105245_10289148 | 3300009098 | Unclassified | 1605 |
| 301 | Ga0105245_10380507 | 3300009098 | Bacteria | 1405 |
| 302 | Ga0105245_11774330 | 3300009098 | Bacteria | 670 |
| 303 | Ga0105247_10273730 | 3300009101 | Bacteria | 1162 |
| 304 | Ga0105247_11484187 | 3300009101 | Unclassified | 552 |
| 305 | Ga0114129_10688962 | 3300009147 | Bacteria | 1315 |
| 306 | Ga0114129_12263741 | 3300009147 | Unclassified | 653 |
| 307 | Ga0105243_10952531 | 3300009148 | Unclassified | 858 |
| 308 | Ga0105243_11653380 | 3300009148 | Bacteria | 668 |
| 309 | Ga0105242_10016354 | 3300009176 | Bacteria | 5769 |
| 310 | Ga0105242_10724793 | 3300009176 | Bacteria | 976 |
| 311 | Ga0105248_11770627 | 3300009177 | Unclassified | 700 |
| 312 | Ga0105237_12540584 | 3300009545 | Unclassified | 523 |
| 313 | Ga0105249_10104362 | 3300009553 | Unclassified | 2671 |
| 314 | Ga0105249_10134123 | 3300009553 | Unclassified | 2367 |
| 315 | Ga0105249_10563502 | 3300009553 | Unclassified | 1191 |
| 316 | Ga0099796_10062601 | 3300010159 | Unclassified | 1323 |
| 317 | Ga0099796_10207333 | 3300010159 | Unclassified | 798 |
| 318 | Ga0105239_10750927 | 3300010375 | Bacteria | 1117 |
| 319 | Ga0105239_11064124 | 3300010375 | Bacteria | 931 |
| 320 | Ga0105246_10271503 | 3300011119 | Bacteria | 1356 |
| 321 | Ga0105246_10564931 | 3300011119 | Unclassified | 977 |
| 322 | Ga0105246_10733122 | 3300011119 | Bacteria | 870 |
| 323 | Ga0157327_1005016 | 3300012512 | Bacteria | 1053 |
| 324 | Ga0157373_10300110 | 3300013100 | Unclassified | 1140 |
| 325 | Ga0157371_10217836 | 3300013102 | Unclassified | 1371 |
| 326 | Ga0157371_10578900 | 3300013102 | Unclassified | 834 |
| 327 | Ga0157369_10081997 | 3300013105 | Bacteria | 3451 |
| 328 | Ga0157374_10027527 | 3300013296 | Bacteria | 5131 |
| 329 | Ga0157374_10067256 | 3300013296 | Unclassified | 3368 |
| 330 | Ga0157374_10562934 | 3300013296 | Unclassified | 1148 |
| 331 | Ga0157374_10917111 | 3300013296 | Unclassified | 894 |
| 332 | Ga0157374_10921598 | 3300013296 | Bacteria | 892 |
| 333 | Ga0157374_10925173 | 3300013296 | Bacteria | 890 |
| 334 | Ga0157378_10093098 | 3300013297 | Unclassified | 2743 |
| 335 | Ga0157378_10139516 | 3300013297 | Unclassified | 2250 |
| 336 | Ga0157378_10231231 | 3300013297 | Unclassified | 1762 |
| 337 | Ga0157378_10265578 | 3300013297 | Bacteria | 1648 |
| 338 | Ga0157378_10512278 | 3300013297 | Unclassified | 1200 |
| 339 | Ga0157378_10525354 | 3300013297 | Bacteria | 1185 |
| 340 | Ga0163162_10008441 | 3300013306 | Bacteria | 10047 |
| 341 | Ga0163162_10074734 | 3300013306 | Bacteria | 3448 |
| 342 | Ga0163162_10323815 | 3300013306 | Bacteria | 1674 |
| 343 | Ga0163162_11126350 | 3300013306 | Unclassified | 889 |
| 344 | Ga0157372_10046221 | 3300013307 | Bacteria | 4832 |
| 345 | Ga0157375_10626787 | 3300013308 | Bacteria | 1233 |
| 346 | Ga0157375_10858176 | 3300013308 | Bacteria | 1054 |
| 347 | Ga0157375_11192922 | 3300013308 | Bacteria | 893 |
| 348 | Ga0157375_11420124 | 3300013308 | Unclassified | 818 |
| 349 | Ga0157375_12321708 | 3300013308 | Unclassified | 640 |
| 350 | Ga0163163_10043723 | 3300014325 | Bacteria | 4393 |
| 351 | Ga0163163_10346127 | 3300014325 | Bacteria | 1542 |
| 352 | Ga0157377_10337997 | 3300014745 | Unclassified | 1006 |
| 353 | Ga0157377_11106241 | 3300014745 | Unclassified | 607 |
| 354 | Ga0157379_10306299 | 3300014968 | Bacteria | 1448 |
| 355 | Ga0157376_10010573 | 3300014969 | Bacteria | 6756 |
| 356 | Ga0157376_10012911 | 3300014969 | Bacteria | 6216 |
| 357 | Ga0157376_10398107 | 3300014969 | Bacteria | 1331 |
| 358 | Ga0163161_10077875 | 3300017792 | Bacteria | 2436 |
| 359 | Ga0163161_10279342 | 3300017792 | Bacteria | 1309 |
| 360 | Ga0213876_10280791 | 3300021384 | Unclassified | 885 |
| 361 | Ga0207666_1002170 | 3300025271 | Bacteria | 2353 |
| 362 | Ga0207673_1018121 | 3300025290 | Unclassified | 942 |
| 363 | Ga0207673_1025647 | 3300025290 | Unclassified | 807 |
| 364 | Ga0207697_10000679 | 3300025315 | Bacteria | 19342 |
| 365 | Ga0207697_10002209 | 3300025315 | Bacteria | 10176 |
| 366 | Ga0207697_10003835 | 3300025315 | Bacteria | 7341 |
| 367 | Ga0207697_10007607 | 3300025315 | Bacteria | 4812 |
| 368 | Ga0207697_10008729 | 3300025315 | Bacteria | 4414 |
| 369 | Ga0207697_10059771 | 3300025315 | Unclassified | 1584 |
| 370 | Ga0207697_10229031 | 3300025315 | Unclassified | 820 |
| 371 | Ga0207697_10263055 | 3300025315 | Bacteria | 764 |
| 372 | Ga0207653_10039455 | 3300025885 | Unclassified | 1546 |
| 373 | Ga0207692_10028743 | 3300025898 | Bacteria | 2634 |
| 374 | Ga0207692_10071243 | 3300025898 | Bacteria | 1832 |
| 375 | Ga0207692_10616299 | 3300025898 | Unclassified | 699 |
| 376 | Ga0207688_10086497 | 3300025901 | Bacteria | 1796 |
| 377 | Ga0207680_10307906 | 3300025903 | Unclassified | 1105 |
| 378 | Ga0207647_10352918 | 3300025904 | Bacteria | 833 |
| 379 | Ga0207685_10034904 | 3300025905 | Unclassified | 1831 |
| 380 | Ga0207685_10059346 | 3300025905 | Unclassified | 1509 |
| 381 | Ga0207699_10001758 | 3300025906 | Bacteria | 10233 |
| 382 | Ga0207699_10272267 | 3300025906 | Unclassified | 1174 |
| 383 | Ga0207645_10005310 | 3300025907 | Bacteria | 9371 |
| 384 | Ga0207645_10011337 | 3300025907 | Bacteria | 6091 |
| 385 | Ga0207645_10064096 | 3300025907 | Bacteria | 2348 |
| 386 | Ga0207645_10104846 | 3300025907 | Bacteria | 1826 |
| 387 | Ga0207645_10186339 | 3300025907 | Unclassified | 1363 |
| 388 | Ga0207684_10000086 | 3300025910 | Bacteria | 173807 |
| 389 | Ga0207684_10060040 | 3300025910 | Bacteria | 3229 |
| 390 | Ga0207684_10069614 | 3300025910 | Bacteria | 2990 |
| 391 | Ga0207684_10099654 | 3300025910 | Bacteria | 2482 |
| 392 | Ga0207684_10099827 | 3300025910 | Bacteria | 2480 |
| 393 | Ga0207684_10158096 | 3300025910 | Bacteria | 1951 |
| 394 | Ga0207684_10321476 | 3300025910 | Bacteria | 1334 |
| 395 | Ga0207684_10674918 | 3300025910 | Unclassified | 879 |
| 396 | Ga0207684_10743898 | 3300025910 | Bacteria | 831 |
| 397 | Ga0207684_10777291 | 3300025910 | Unclassified | 810 |
| 398 | Ga0207684_10863660 | 3300025910 | Bacteria | 762 |
| 399 | Ga0207684_10987010 | 3300025910 | Unclassified | 705 |
| 400 | Ga0207684_11061225 | 3300025910 | Unclassified | 676 |
| 401 | Ga0207695_10120664 | 3300025913 | Bacteria | 2590 |
| 402 | Ga0207693_10003406 | 3300025915 | Bacteria | 13576 |
| 403 | Ga0207693_10015874 | 3300025915 | Bacteria | 6029 |
| 404 | Ga0207693_10059210 | 3300025915 | Unclassified | 3000 |
| 405 | Ga0207693_10162126 | 3300025915 | Bacteria | 1759 |
| 406 | Ga0207693_10380183 | 3300025915 | Bacteria | 1104 |
| 407 | Ga0207663_10001152 | 3300025916 | Bacteria | 12202 |
| 408 | Ga0207663_10045470 | 3300025916 | Bacteria | 2701 |
| 409 | Ga0207663_10223817 | 3300025916 | Unclassified | 1370 |
| 410 | Ga0207663_10591190 | 3300025916 | Unclassified | 871 |
| 411 | Ga0207663_10645075 | 3300025916 | Unclassified | 835 |
| 412 | Ga0207660_10077368 | 3300025917 | Bacteria | 2435 |
| 413 | Ga0207660_11059918 | 3300025917 | Unclassified | 661 |
| 414 | Ga0207662_10061868 | 3300025918 | Unclassified | 2248 |
| 415 | Ga0207662_10373834 | 3300025918 | Bacteria | 962 |
| 416 | Ga0207662_10591055 | 3300025918 | Unclassified | 772 |
| 417 | Ga0207657_10093577 | 3300025919 | Bacteria | 2503 |
| 418 | Ga0207657_10140116 | 3300025919 | Bacteria | 1977 |
| 419 | Ga0207649_10530413 | 3300025920 | Unclassified | 899 |
| 420 | Ga0207649_11197824 | 3300025920 | Unclassified | 600 |
| 421 | Ga0207652_11185675 | 3300025921 | Unclassified | 665 |
| 422 | Ga0207646_10001262 | 3300025922 | Bacteria | 31705 |
| 423 | Ga0207646_10024073 | 3300025922 | Bacteria | 5582 |
| 424 | Ga0207646_10075993 | 3300025922 | Bacteria | 3001 |
| 425 | Ga0207646_10108924 | 3300025922 | Bacteria | 2486 |
| 426 | Ga0207646_10228812 | 3300025922 | Bacteria | 1680 |
| 427 | Ga0207646_10272148 | 3300025922 | Bacteria | 1531 |
| 428 | Ga0207646_10295745 | 3300025922 | Bacteria | 1463 |
| 429 | Ga0207646_10355530 | 3300025922 | Unclassified | 1323 |
| 430 | Ga0207646_10396560 | 3300025922 | Unclassified | 1246 |
| 431 | Ga0207646_11024139 | 3300025922 | Unclassified | 729 |
| 432 | Ga0207646_11152318 | 3300025922 | Bacteria | 681 |
| 433 | Ga0207681_10015904 | 3300025923 | Unclassified | 4697 |
| 434 | Ga0207681_10017170 | 3300025923 | Bacteria | 4540 |
| 435 | Ga0207681_10066286 | 3300025923 | Bacteria | 2499 |
| 436 | Ga0207681_10145273 | 3300025923 | Unclassified | 1771 |
| 437 | Ga0207681_10258583 | 3300025923 | Bacteria | 1362 |
| 438 | Ga0207681_10285198 | 3300025923 | Unclassified | 1302 |
| 439 | Ga0207681_10375441 | 3300025923 | Unclassified | 1143 |
| 440 | Ga0207681_10609008 | 3300025923 | Unclassified | 903 |
| 441 | Ga0207650_10033526 | 3300025925 | Bacteria | 3720 |
| 442 | Ga0207650_10056815 | 3300025925 | Bacteria | 2909 |
| 443 | Ga0207650_10252921 | 3300025925 | Bacteria | 1427 |
| 444 | Ga0207659_10015262 | 3300025926 | Bacteria | 4972 |
| 445 | Ga0207659_10053831 | 3300025926 | Bacteria | 2872 |
| 446 | Ga0207659_10141267 | 3300025926 | Unclassified | 1869 |
| 447 | Ga0207659_10182336 | 3300025926 | Bacteria | 1664 |
| 448 | Ga0207659_10387454 | 3300025926 | Unclassified | 1166 |
| 449 | Ga0207659_10495172 | 3300025926 | Bacteria | 1034 |
| 450 | Ga0207659_10529735 | 3300025926 | Unclassified | 1000 |
| 451 | Ga0207659_10555543 | 3300025926 | Unclassified | 976 |
| 452 | Ga0207687_10295408 | 3300025927 | Bacteria | 1303 |
| 453 | Ga0207687_10573008 | 3300025927 | Unclassified | 949 |
| 454 | Ga0207700_10300875 | 3300025928 | Unclassified | 1385 |
| 455 | Ga0207700_10401299 | 3300025928 | Bacteria | 1202 |
| 456 | Ga0207700_10780115 | 3300025928 | Bacteria | 854 |
| 457 | Ga0207664_10043897 | 3300025929 | Bacteria | 3499 |
| 458 | Ga0207664_10530882 | 3300025929 | Bacteria | 1055 |
| 459 | Ga0207644_10049703 | 3300025931 | Bacteria | 3003 |
| 460 | Ga0207644_10064299 | 3300025931 | Bacteria | 2666 |
| 461 | Ga0207644_10095941 | 3300025931 | Unclassified | 2218 |
| 462 | Ga0207644_10225276 | 3300025931 | Unclassified | 1488 |
| 463 | Ga0207644_10564493 | 3300025931 | Bacteria | 943 |
| 464 | Ga0207644_10605168 | 3300025931 | Unclassified | 910 |
| 465 | Ga0207644_10881616 | 3300025931 | Unclassified | 750 |
| 466 | Ga0207690_10680525 | 3300025932 | Unclassified | 845 |
| 467 | Ga0207706_10033865 | 3300025933 | Bacteria | 4547 |
| 468 | Ga0207706_10044828 | 3300025933 | Bacteria | 3918 |
| 469 | Ga0207706_10137721 | 3300025933 | Unclassified | 2147 |
| 470 | Ga0207706_10150702 | 3300025933 | Unclassified | 2045 |
| 471 | Ga0207706_10542343 | 3300025933 | Unclassified | 1002 |
| 472 | Ga0207686_10079339 | 3300025934 | Bacteria | 2137 |
| 473 | Ga0207686_10206736 | 3300025934 | Unclassified | 1409 |
| 474 | Ga0207686_10825820 | 3300025934 | Unclassified | 744 |
| 475 | Ga0207670_10006062 | 3300025936 | Bacteria | 6681 |
| 476 | Ga0207670_10006434 | 3300025936 | Bacteria | 6510 |
| 477 | Ga0207670_10061632 | 3300025936 | Bacteria | 2560 |
| 478 | Ga0207670_10133522 | 3300025936 | Bacteria | 1822 |
| 479 | Ga0207670_10236143 | 3300025936 | Bacteria | 1406 |
| 480 | Ga0207670_10261007 | 3300025936 | Bacteria | 1343 |
| 481 | Ga0207670_10270083 | 3300025936 | Bacteria | 1321 |
| 482 | Ga0207670_10598137 | 3300025936 | Unclassified | 905 |
| 483 | Ga0207670_10631377 | 3300025936 | Bacteria | 882 |
| 484 | Ga0207669_10275910 | 3300025937 | Bacteria | 1265 |
| 485 | Ga0207669_10339427 | 3300025937 | Bacteria | 1156 |
| 486 | Ga0207669_11622771 | 3300025937 | Unclassified | 552 |
| 487 | Ga0207704_10027035 | 3300025938 | Bacteria | 3158 |
| 488 | Ga0207704_10453332 | 3300025938 | Unclassified | 1024 |
| 489 | Ga0207704_11381021 | 3300025938 | Unclassified | 603 |
| 490 | Ga0207665_10010731 | 3300025939 | Bacteria | 6016 |
| 491 | Ga0207665_10276800 | 3300025939 | Unclassified | 1248 |
| 492 | Ga0207665_10326852 | 3300025939 | Unclassified | 1152 |
| 493 | Ga0207665_10501938 | 3300025939 | Unclassified | 937 |
| 494 | Ga0207665_10625596 | 3300025939 | Unclassified | 842 |
| 495 | Ga0207665_10948200 | 3300025939 | Unclassified | 684 |
| 496 | Ga0207691_10000719 | 3300025940 | Bacteria | 32701 |
| 497 | Ga0207691_10017195 | 3300025940 | Bacteria | 6861 |
| 498 | Ga0207691_10022592 | 3300025940 | Bacteria | 5931 |
| 499 | Ga0207691_10340691 | 3300025940 | Bacteria | 1283 |
| 500 | Ga0207691_10575501 | 3300025940 | Unclassified | 954 |
| 501 | Ga0207661_10812323 | 3300025944 | Bacteria | 861 |
| 502 | Ga0207661_11155706 | 3300025944 | Unclassified | 713 |
| 503 | Ga0207679_10330122 | 3300025945 | Bacteria | 1323 |
| 504 | Ga0207667_10255974 | 3300025949 | Unclassified | 1791 |
| 505 | Ga0207667_11567322 | 3300025949 | Unclassified | 628 |
| 506 | Ga0207651_10141423 | 3300025960 | Bacteria | 1859 |
| 507 | Ga0207651_10234966 | 3300025960 | Bacteria | 1491 |
| 508 | Ga0207651_10270840 | 3300025960 | Bacteria | 1398 |
| 509 | Ga0207651_10887358 | 3300025960 | Unclassified | 794 |
| 510 | Ga0207712_10237321 | 3300025961 | Unclassified | 1467 |
| 511 | Ga0207712_10247045 | 3300025961 | Unclassified | 1440 |
| 512 | Ga0207712_10827353 | 3300025961 | Bacteria | 815 |
| 513 | Ga0207668_10004172 | 3300025972 | Bacteria | 8477 |
| 514 | Ga0207668_10022371 | 3300025972 | Unclassified | 4046 |
| 515 | Ga0207668_10028962 | 3300025972 | Unclassified | 3626 |
| 516 | Ga0207668_10080632 | 3300025972 | Bacteria | 2358 |
| 517 | Ga0207668_10088370 | 3300025972 | Unclassified | 2269 |
| 518 | Ga0207668_10234263 | 3300025972 | Bacteria | 1482 |
| 519 | Ga0207658_10039238 | 3300025986 | Bacteria | 3416 |
| 520 | Ga0207658_10055995 | 3300025986 | Bacteria | 2924 |
| 521 | Ga0207658_10198406 | 3300025986 | Unclassified | 1673 |
| 522 | Ga0207658_10798520 | 3300025986 | Bacteria | 857 |
| 523 | Ga0207677_10047616 | 3300026023 | Bacteria | 2880 |
| 524 | Ga0207677_10097845 | 3300026023 | Unclassified | 2151 |
| 525 | Ga0207677_10115832 | 3300026023 | Bacteria | 2005 |
| 526 | Ga0207677_10427377 | 3300026023 | Bacteria | 1130 |
| 527 | Ga0207703_10129061 | 3300026035 | Bacteria | 2181 |
| 528 | Ga0207678_10121629 | 3300026067 | Bacteria | 2228 |
| 529 | Ga0207678_10820324 | 3300026067 | Bacteria | 821 |
| 530 | Ga0207678_10905300 | 3300026067 | Bacteria | 780 |
| 531 | Ga0207708_10180915 | 3300026075 | Bacteria | 1674 |
| 532 | Ga0207702_10633269 | 3300026078 | Unclassified | 1051 |
| 533 | Ga0207641_10471529 | 3300026088 | Bacteria | 1216 |
| 534 | Ga0207641_10649116 | 3300026088 | Bacteria | 1036 |
| 535 | Ga0207641_10850645 | 3300026088 | Unclassified | 904 |
| 536 | Ga0207648_10011257 | 3300026089 | Bacteria | 8435 |
| 537 | Ga0207676_10148207 | 3300026095 | Bacteria | 2018 |
| 538 | Ga0207676_10586878 | 3300026095 | Unclassified | 1069 |
| 539 | Ga0207676_10832364 | 3300026095 | Unclassified | 902 |
| 540 | Ga0207676_11851641 | 3300026095 | Unclassified | 602 |
| 541 | Ga0207675_100959478 | 3300026118 | Unclassified | 873 |
| 542 | Ga0207675_101092890 | 3300026118 | Unclassified | 817 |
| 543 | Ga0207683_10009248 | 3300026121 | Bacteria | 8396 |
| 544 | Ga0207683_10026693 | 3300026121 | Bacteria | 4987 |
| 545 | Ga0207683_10053716 | 3300026121 | Bacteria | 3533 |
| 546 | Ga0207683_10058487 | 3300026121 | Bacteria | 3385 |
| 547 | Ga0207428_10331386 | 3300027907 | Bacteria | 1122 |
| 548 | Ga0268266_10038125 | 3300028379 | Bacteria | 4092 |
| 549 | Ga0268266_10076790 | 3300028379 | Bacteria | 2903 |
| 550 | Ga0268266_10189271 | 3300028379 | Bacteria | 1878 |
| 551 | Ga0268265_10141945 | 3300028380 | Unclassified | 2012 |
| 552 | Ga0268264_10166746 | 3300028381 | Bacteria | 1989 |
| 553 | Ga0268264_10232775 | 3300028381 | Unclassified | 1702 |
| 554 | Ga0373926_0226927 | 3300035083 | Bacteria | 721 |
| 555 | Ga0373952_0081981 | 3300035092 | Bacteria | 825 |
| 556 | Ga0373923_0512113 | 3300035111 | Unclassified | 586 |
| 557 | Ga0373954_0392244 | 3300035118 | Unclassified | 686 |
| 558 | Ga0373956_0194164 | 3300035119 | Bacteria | 962 |
| 559 | Ga0373943_0412008 | 3300035170 | Bacteria | 781 |
| 560 | Ga0373946_0029543 | 3300035171 | Unclassified | 2183 |
| 561 | Ga0373946_0098734 | 3300035171 | Unclassified | 1306 |
| 562 | Ga0373946_0426427 | 3300035171 | Unclassified | 673 |
| 563 | Ga0373955_0112259 | 3300035172 | Bacteria | 1577 |
| 564 | Ga0373955_0121016 | 3300035172 | Bacteria | 1522 |
| 565 | Ga0373962_0407579 | 3300035242 | Unclassified | 501 |
| 566 | Ga0373931_1033868 | 3300035691 | Unclassified | 557 |
| 567 | Ga0373935_0245296 | 3300035692 | Bacteria | 1252 |
| 568 | Ga0373927_0257101 | 3300035695 | Unclassified | 1148 |
| 569 | Ga0373927_0726599 | 3300035695 | Unclassified | 656 |
| 570 | Ga0373947_0050404 | 3300035725 | Bacteria | 2503 |
| 571 | Ga0373947_0144704 | 3300035725 | Bacteria | 1527 |
| 572 | Ga0373947_0496927 | 3300035725 | Bacteria | 829 |
| 573 | Ga0373947_0622079 | 3300035725 | Unclassified | 736 |
| 574 | Ga0373947_0787880 | 3300035725 | Bacteria | 649 |
| 575 | Ga0373937_0153373 | 3300036401 | Unclassified | 2159 |
| 576 | Ga0373937_0457271 | 3300036401 | Unclassified | 1212 |
| 577 | Ga0373937_0495282 | 3300036401 | Bacteria | 1161 |
| 578 | Ga0373937_0495709 | 3300036401 | Bacteria | 1160 |
| 579 | Ga0373925_0084161 | 3300037068 | Bacteria | 2424 |
| 580 | Ga0373925_0086125 | 3300037068 | Bacteria | 2396 |
| 581 | Ga0373925_0129868 | 3300037068 | Bacteria | 1964 |
| 582 | Ga0373925_0271909 | 3300037068 | Bacteria | 1363 |
| 583 | Ga0373925_0798246 | 3300037068 | Unclassified | 778 |
| 584 | Ga0395899_0022997 | 3300037312 | Bacteria | 4723 |
| 585 | Ga0395900_0143341 | 3300037418 | Bacteria | 2445 |
| 586 | Ga0395898_0112819 | 3300037466 | Bacteria | 2605 |
| 587 | Ga0395898_0944862 | 3300037466 | Bacteria | 799 |
| 588 | Ga0395905_0239129 | 3300037471 | Bacteria | 1697 |
| 589 | Ga0395905_0359391 | 3300037471 | Unclassified | 1349 |
| 590 | Ga0395905_1537376 | 3300037471 | Unclassified | 570 |
| 591 | Ga0395901_0023615 | 3300038443 | Bacteria | 6304 |
| 592 | Ga0395901_0082500 | 3300038443 | Unclassified | 3359 |
| 593 | Ga0395901_0154196 | 3300038443 | Bacteria | 2413 |
| 594 | Ga0436365_1851055 | 3300039437 | Bacteria | 1105 |
| 595 | Ga0451793_0313413 | 3300041452 | Unclassified | 557 |
| 596 | Ga0451802_1059119 | 3300041460 | Unclassified | 775 |
| 597 | Ga0451802_1261066 | 3300041460 | Unclassified | 713 |
| 598 | Ga0451835_0470488 | 3300041492 | Bacteria | 942 |
| 599 | Ga0451839_0788197 | 3300041496 | Bacteria | 942 |
| 600 | Ga0439448_0307403 | 3300042005 | Unclassified | 563 |
| 601 | Ga0439460_0231489 | 3300042461 | Bacteria | 635 |
| 602 | Ga0439440_0069391 | 3300042993 | Unclassified | 915 |
| 603 | Ga0451576_0015248 | 3300045051 | Bacteria | 8521 |
| 604 | Ga0451576_0124222 | 3300045051 | Bacteria | 2689 |
| 605 | Ga0451576_1318490 | 3300045051 | Unclassified | 752 |
| 606 | Ga0451576_1955606 | 3300045051 | Bacteria | 604 |
| 607 | Ga0495592_0063225 | 3300046454 | Bacteria | 2715 |
| 608 | Ga0495641_0447586 | 3300046461 | Bacteria | 588 |
| 609 | Ga0495651_0123049 | 3300046462 | Bacteria | 1903 |
| 610 | Ga0495580_0304747 | 3300046472 | Bacteria | 1084 |
| 611 | Ga0495605_0447230 | 3300046474 | Unclassified | 533 |
| 612 | Ga0495584_0062242 | 3300046491 | Unclassified | 1876 |
| 613 | Ga0495585_0269736 | 3300046492 | Unclassified | 844 |
| 614 | Ga0495594_0700133 | 3300046499 | Unclassified | 573 |
| 615 | Ga0495618_0310774 | 3300046514 | Bacteria | 978 |
| 616 | Ga0495628_0028925 | 3300046516 | Bacteria | 4498 |
| 617 | Ga0495630_0042529 | 3300046517 | Bacteria | 3393 |
| 618 | Ga0495642_0032398 | 3300046528 | Bacteria | 2097 |
| 619 | Ga0495652_0244626 | 3300046529 | Bacteria | 1333 |
| 620 | Ga0495665_0463095 | 3300046531 | Unclassified | 640 |
| 621 | Ga0495640_0100239 | 3300046533 | Unclassified | 1902 |
| 622 | Ga0495640_0532037 | 3300046533 | Unclassified | 713 |
| 623 | Ga0495587_0039334 | 3300046536 | Unclassified | 2831 |
| 624 | Ga0495587_0325429 | 3300046536 | Unclassified | 858 |
| 625 | Ga0495587_0684561 | 3300046536 | Unclassified | 562 |
| 626 | Ga0495598_0005784 | 3300046537 | Unclassified | 2762 |
| 627 | Ga0495598_0073344 | 3300046537 | Unclassified | 1083 |
| 628 | Ga0495645_0009376 | 3300046543 | Bacteria | 6843 |
| 629 | Ga0495635_0083948 | 3300046663 | Bacteria | 2180 |
| 630 | Ga0495635_0174903 | 3300046663 | Bacteria | 1460 |
| 631 | Ga0495588_0135711 | 3300046674 | Bacteria | 1299 |
| 632 | Ga0495588_0709579 | 3300046674 | Unclassified | 526 |
| 633 | Ga0495657_0607753 | 3300046675 | Unclassified | 632 |
| 634 | Ga0495657_0673079 | 3300046675 | Unclassified | 596 |
| 635 | Ga0495623_0271524 | 3300046679 | Unclassified | 947 |
| 636 | Ga0495646_0136394 | 3300046680 | Bacteria | 1376 |
| 637 | Ga0495647_0320418 | 3300046681 | Bacteria | 702 |
| 638 | Ga0495658_0014481 | 3300046683 | Unclassified | 4032 |
| 639 | Ga0495669_0187601 | 3300046684 | Unclassified | 986 |
| 640 | Ga0495613_0118516 | 3300046689 | Bacteria | 1903 |
| 641 | Ga0495624_0460270 | 3300046690 | Unclassified | 762 |
| 642 | Ga0495581_0828596 | 3300047315 | Unclassified | 530 |
| 643 | Ga0495604_0123689 | 3300047317 | Bacteria | 1869 |
| 644 | Ga0495674_0200532 | 3300047319 | Bacteria | 1655 |
| 645 | Ga0495674_0532536 | 3300047319 | Bacteria | 937 |
| 646 | Ga0495680_0299560 | 3300047322 | Bacteria | 1129 |
| 647 | Ga0495675_0234940 | 3300047444 | Bacteria | 1105 |
| 648 | Ga0495684_0011399 | 3300047471 | Bacteria | 6864 |
| 649 | Ga0495684_0022939 | 3300047471 | Bacteria | 4802 |
| 650 | Ga0495614_0327924 | 3300048089 | Unclassified | 711 |
| 651 | Ga0495615_0240630 | 3300048090 | Unclassified | 571 |
| 652 | Ga0496100_0004939 | 3300048903 | Bacteria | 7127 |
| 653 | Ga0496100_0093464 | 3300048903 | Unclassified | 2058 |
| 654 | Ga0496100_0165659 | 3300048903 | Bacteria | 1588 |
| 655 | Ga0496101_0794728 | 3300048904 | Unclassified | 746 |
| 656 | Ga0496102_0017119 | 3300048905 | Bacteria | 6345 |
| 657 | Ga0496102_0222460 | 3300048905 | Bacteria | 1780 |
| 658 | Ga0496102_0732935 | 3300048905 | Unclassified | 911 |
| 659 | Ga0496102_0899922 | 3300048905 | Unclassified | 807 |
| 660 | Ga0496103_0027269 | 3300048906 | Bacteria | 3460 |
| 661 | Ga0496104_0121066 | 3300048907 | Unclassified | 2513 |
| 662 | Ga0496104_0276491 | 3300048907 | Bacteria | 1592 |
| 663 | Ga0496104_0311461 | 3300048907 | Bacteria | 1487 |
| 664 | Ga0496104_0336327 | 3300048907 | Bacteria | 1423 |
| 665 | Ga0496104_0405945 | 3300048907 | Unclassified | 1275 |
| 666 | Ga0496104_0944262 | 3300048907 | Bacteria | 767 |
| 667 | Ga0496105_0041527 | 3300048908 | Bacteria | 3792 |
| 668 | Ga0496105_0045742 | 3300048908 | Bacteria | 3612 |
| 669 | Ga0496105_0396660 | 3300048908 | Unclassified | 1096 |
| 670 | Ga0496106_0001558 | 3300048909 | Bacteria | 17279 |
| 671 | Ga0496106_0200791 | 3300048909 | Bacteria | 1587 |
| 672 | Ga0496106_0409360 | 3300048909 | Bacteria | 1090 |
| 673 | Ga0496106_1067156 | 3300048909 | Unclassified | 634 |
| 674 | Ga0496107_0000630 | 3300048910 | Bacteria | 19818 |
| 675 | Ga0496107_0274678 | 3300048910 | Bacteria | 1254 |
| 676 | Ga0496108_0024958 | 3300048911 | Unclassified | 4924 |
| 677 | Ga0496108_0188361 | 3300048911 | Unclassified | 1788 |
| 678 | Ga0496108_0573397 | 3300048911 | Unclassified | 984 |
| 679 | Ga0496108_0597035 | 3300048911 | Bacteria | 962 |
| 680 | Ga0496108_0823119 | 3300048911 | Bacteria | 800 |
| 681 | Ga0496108_0886935 | 3300048911 | Unclassified | 766 |
| 682 | Ga0496109_0111804 | 3300048912 | Bacteria | 2540 |
| 683 | Ga0496109_0120243 | 3300048912 | Unclassified | 2447 |
| 684 | Ga0496109_0135211 | 3300048912 | Bacteria | 2303 |
| 685 | Ga0496109_0135291 | 3300048912 | Unclassified | 2302 |
| 686 | Ga0496109_0201599 | 3300048912 | Bacteria | 1871 |
| 687 | Ga0496109_0259525 | 3300048912 | Bacteria | 1637 |
| 688 | Ga0496109_0348984 | 3300048912 | Bacteria | 1398 |
| 689 | Ga0496109_0661114 | 3300048912 | Unclassified | 982 |
| 690 | Ga0496109_0825492 | 3300048912 | Unclassified | 865 |
| 691 | Ga0496111_0090272 | 3300048914 | Bacteria | 2245 |
| 692 | Ga0496111_0232015 | 3300048914 | Bacteria | 1371 |
| 693 | Ga0496111_0271903 | 3300048914 | Unclassified | 1257 |
| 694 | Ga0496112_0027130 | 3300048915 | Bacteria | 5520 |
| 695 | Ga0496112_0111909 | 3300048915 | Unclassified | 2700 |
| 696 | Ga0496112_0165726 | 3300048915 | Bacteria | 2176 |
| 697 | Ga0496112_0177221 | 3300048915 | Bacteria | 2096 |
| 698 | Ga0496112_0205998 | 3300048915 | Bacteria | 1925 |
| 699 | Ga0496112_1302651 | 3300048915 | Unclassified | 642 |
| 700 | Ga0496113_0020424 | 3300048916 | Unclassified | 4656 |
| 701 | Ga0496113_0169308 | 3300048916 | Unclassified | 1730 |
| 702 | Ga0496113_0304211 | 3300048916 | Bacteria | 1277 |
| 703 | Ga0496113_0430406 | 3300048916 | Bacteria | 1060 |
| 704 | Ga0496113_0737339 | 3300048916 | Unclassified | 785 |
| 705 | Ga0496114_0198559 | 3300048917 | Bacteria | 1756 |
| 706 | Ga0496114_0382433 | 3300048917 | Bacteria | 1246 |
| 707 | Ga0496115_0002070 | 3300048918 | Bacteria | 14366 |
| 708 | Ga0496115_0042120 | 3300048918 | Bacteria | 3637 |
| 709 | Ga0496115_0190412 | 3300048918 | Unclassified | 1695 |
| 710 | Ga0496115_0221199 | 3300048918 | Bacteria | 1562 |
| 711 | Ga0496115_0635437 | 3300048918 | Unclassified | 845 |
| 712 | Ga0496115_1134479 | 3300048918 | Unclassified | 591 |
| 713 | Ga0501067_0389276 | 3300049583 | Unclassified | 777 |
| 714 | nmdc:mga05p37_233270_c1 | 3300050507 | Bacteria | 2216 |
| 715 | nmdc:mga09592_46929_c1 | 3300050508 | Bacteria | 3639 |
| 716 | nmdc:mga08y16_355579_c1 | 3300050511 | Bacteria | 1504 |
| 717 | nmdc:mga08y16_71757_c1 | 3300050511 | Bacteria | 3608 |
| 718 | nmdc:mga0n895_1192551_c1 | 3300050512 | Unclassified | 735 |
| 719 | nmdc:mga0n895_125120_c1 | 3300050512 | Bacteria | 2594 |
| 720 | nmdc:mga0n895_1410734_c1 | 3300050512 | Unclassified | 665 |
| 721 | nmdc:mga0n895_246676_c1 | 3300050512 | Bacteria | 1812 |
| 722 | nmdc:mga0n895_510072_c1 | 3300050512 | Bacteria | 1211 |
| 723 | nmdc:mga0n895_591662_c1 | 3300050512 | Unclassified | 1112 |
| 724 | nmdc:mga0n895_680142_c1 | 3300050512 | Bacteria | 1026 |
| 725 | nmdc:mga0rr50_1163825_c1 | 3300050513 | Bacteria | 655 |
| 726 | nmdc:mga0rr50_723767_c1 | 3300050513 | Unclassified | 849 |
| 727 | nmdc:mga0a205_396327_c1 | 3300050515 | Unclassified | 1244 |
| 728 | nmdc:mga0a205_687306_c1 | 3300050515 | Bacteria | 873 |
| 729 | nmdc:mga0a205_776820_c1 | 3300050515 | Bacteria | 806 |
| 730 | Ga0495601_0039602 | 3300053077 | Bacteria | 2952 |
| 731 | Ga0495601_0060690 | 3300053077 | Unclassified | 2399 |
| 732 | Ga0495612_0036635 | 3300053078 | Bacteria | 1991 |
| 733 | Ga0495655_0261648 | 3300053083 | Unclassified | 584 |
| 734 | Ga0495595_0078890 | 3300053084 | Bacteria | 1566 |
| 735 | Ga0065707_10104004 | |||
| 736 | CNXas_1000035 | |||
| 737 | JGI25406J46586_10070767 | |||
| 738 | Ga0058859_11725447 | |||
| 739 | Ga0058859_11823994 | |||
| 740 | Ga0058860_12116340 | |||
| 741 | Ga0058860_12213048 | |||
| 742 | Ga0065704_10213269 | |||
| 743 | Ga0065712_10011743 | |||
| 744 | Ga0065712_10023244 | |||
| 745 | Ga0065712_10074607 | |||
| 746 | Ga0065712_10076749 | |||
| 747 | Ga0065712_10221278 | |||
| 748 | Ga0065712_10258147 | |||
| 749 | Ga0065712_10284088 | |||
| 750 | Ga0065715_10018433 | |||
| 751 | Ga0065715_10071293 | |||
| 752 | Ga0065715_10089033 | |||
| 753 | Ga0065715_10091980 | |||
| 754 | Ga0065715_10143173 | |||
| 755 | Ga0065715_10182570 | |||
| 756 | Ga0065715_10446061 | |||
| 757 | Ga0065707_10173538 | |||
| 758 | Ga0070676_10007840 | |||
| 759 | Ga0070676_10007972 | |||
| 760 | Ga0070676_10036383 | |||
| 761 | Ga0070676_10039256 | |||
| 762 | Ga0070683_100198825 | |||
| 763 | Ga0070683_100355238 | |||
| 764 | Ga0070683_101233650 | |||
| 765 | Ga0070690_100105700 | |||
| 766 | Ga0070690_100377813 | |||
| 767 | Ga0070690_100446466 | |||
| 768 | Ga0070690_100497503 | |||
| 769 | Ga0070670_100144986 | |||
| 770 | Ga0070670_101115416 | |||
| 771 | Ga0070677_10042336 | |||
| 772 | Ga0070666_10060833 | |||
| 773 | Ga0070666_10086266 | |||
| 774 | Ga0070666_10136513 | |||
| 775 | Ga0070666_10366201 | |||
| 776 | Ga0070682_101009204 | |||
| 777 | Ga0068868_100004179 | |||
| 778 | Ga0068868_100120666 | |||
| 779 | Ga0068868_100382936 | |||
| 780 | Ga0068868_101145931 | |||
| 781 | Ga0068868_101233475 | |||
| 782 | Ga0068868_102346136 | |||
| 783 | Ga0070689_100003430 | |||
| 784 | Ga0070689_100114699 | |||
| 785 | Ga0070689_100304978 | |||
| 786 | Ga0070689_100402962 | |||
| 787 | Ga0070689_100508652 | |||
| 788 | Ga0070689_100703925 | |||
| 789 | Ga0070689_100846614 | |||
| 790 | Ga0070691_10119166 | |||
| 791 | Ga0070687_100120145 | |||
| 792 | Ga0070687_100146024 | |||
| 793 | Ga0070687_100262742 | |||
| 794 | Ga0070687_101089357 | |||
| 795 | Ga0070661_100007794 | |||
| 796 | Ga0070661_100619270 | |||
| 797 | Ga0070661_100969873 | |||
| 798 | Ga0070668_100009102 | |||
| 799 | Ga0070668_100057268 | |||
| 800 | Ga0070668_100071733 | |||
| 801 | Ga0070668_100097880 | |||
| 802 | Ga0070669_100004185 | |||
| 803 | Ga0070669_100026882 | |||
| 804 | Ga0070669_100029948 | |||
| 805 | Ga0070669_100030435 | |||
| 806 | Ga0070669_100037558 | |||
| 807 | Ga0070669_100239763 | |||
| 808 | Ga0070669_100246446 | |||
| 809 | Ga0070669_100712675 | |||
| 810 | Ga0070669_100880330 | |||
| 811 | Ga0070675_100013126 | |||
| 812 | Ga0070675_100029234 | |||
| 813 | Ga0070675_100045309 | |||
| 814 | Ga0070675_100052409 | |||
| 815 | Ga0070675_100054300 | |||
| 816 | Ga0070675_100054706 | |||
| 817 | Ga0070675_100062835 | |||
| 818 | Ga0070675_100066348 | |||
| 819 | Ga0070675_100084269 | |||
| 820 | Ga0070675_100295895 | |||
| 821 | Ga0070675_100551765 | |||
| 822 | Ga0070675_100626995 | |||
| 823 | Ga0070671_100005632 | |||
| 824 | Ga0070671_100007851 | |||
| 825 | Ga0070671_100012342 | |||
| 826 | Ga0070671_100051625 | |||
| 827 | Ga0070671_100107751 | |||
| 828 | Ga0070671_100223398 | |||
| 829 | Ga0070671_100535086 | |||
| 830 | Ga0070674_100001540 | |||
| 831 | Ga0070674_100018937 | |||
| 832 | Ga0070674_100070468 | |||
| 833 | Ga0070674_100828964 | |||
| 834 | Ga0070673_100007445 | |||
| 835 | Ga0070673_100007726 | |||
| 836 | Ga0070673_100283871 | |||
| 837 | Ga0070673_101106465 | |||
| 838 | Ga0070673_101869047 | |||
| 839 | Ga0070673_101895839 | |||
| 840 | Ga0070688_100022457 | |||
| 841 | Ga0070688_100063772 | |||
| 842 | Ga0070688_100127076 | |||
| 843 | Ga0070688_100242841 | |||
| 844 | Ga0070688_100249159 | |||
| 845 | Ga0070688_100633744 | |||
| 846 | Ga0070688_100761139 | |||
| 847 | Ga0070659_100280889 | |||
| 848 | Ga0070659_100784721 | |||
| 849 | Ga0070667_100025411 | |||
| 850 | Ga0070667_100030186 | |||
| 851 | Ga0070667_100155127 | |||
| 852 | Ga0070667_100229623 | |||
| 853 | Ga0070667_100944112 | |||
| 854 | Ga0070667_102051101 | |||
| 855 | Ga0070709_10096259 | |||
| 856 | Ga0070709_10390072 | |||
| 857 | Ga0070709_10822462 | |||
| 858 | Ga0070714_101004597 | |||
| 859 | Ga0070714_101680289 | |||
| 860 | Ga0070713_100052026 | |||
| 861 | Ga0070713_100475835 | |||
| 862 | Ga0070713_100873617 | |||
| 863 | Ga0070713_101505169 | |||
| 864 | Ga0070710_10134620 | |||
| 865 | Ga0070710_10821190 | |||
| 866 | Ga0070710_10894578 | |||
| 867 | Ga0070701_10046646 | |||
| 868 | Ga0070701_10197116 | |||
| 869 | Ga0070711_100013511 | |||
| 870 | Ga0070711_100113978 | |||
| 871 | Ga0070711_100116825 | |||
| 872 | Ga0070711_100450364 | |||
| 873 | Ga0070711_101297823 | |||
| 874 | Ga0070705_100036402 | |||
| 875 | Ga0070705_100078310 | |||
| 876 | Ga0070705_100279866 | |||
| 877 | Ga0070694_100067438 | |||
| 878 | Ga0070694_100736308 | |||
| 879 | Ga0070708_100044889 | |||
| 880 | Ga0070708_100052277 | |||
| 881 | Ga0070708_100059499 | |||
| 882 | Ga0070708_100424089 | |||
| 883 | Ga0070708_100442394 | |||
| 884 | Ga0070708_100461248 | |||
| 885 | Ga0070708_100524792 | |||
| 886 | Ga0070708_101230762 | |||
| 887 | Ga0070663_100212697 | |||
| 888 | Ga0070663_100312114 | |||
| 889 | Ga0070663_101184005 | |||
| 890 | Ga0070678_100006233 | |||
| 891 | Ga0070678_100177757 | |||
| 892 | Ga0070678_100241188 | |||
| 893 | Ga0070678_100740815 | |||
| 894 | Ga0070678_100919617 | |||
| 895 | Ga0070662_100110904 | |||
| 896 | Ga0070662_100421756 | |||
| 897 | Ga0070681_10398028 | |||
| 898 | Ga0068867_100054744 | |||
| 899 | Ga0068867_100116101 | |||
| 900 | Ga0068867_100584533 | |||
| 901 | Ga0070685_10021980 | |||
| 902 | Ga0070685_10213200 | |||
| 903 | Ga0070685_11300438 | |||
| 904 | Ga0070706_100001379 | |||
| 905 | Ga0070706_100008961 | |||
| 906 | Ga0070706_100061580 | |||
| 907 | Ga0070706_100137959 | |||
| 908 | Ga0070706_100149860 | |||
| 909 | Ga0070706_100177366 | |||
| 910 | Ga0070706_100232172 | |||
| 911 | Ga0070706_100317705 | |||
| 912 | Ga0070706_100427444 | |||
| 913 | Ga0070707_100004173 | |||
| 914 | Ga0070707_100068799 | |||
| 915 | Ga0070707_100080983 | |||
| 916 | Ga0070707_100119221 | |||
| 917 | Ga0070707_100128719 | |||
| 918 | Ga0070707_100136522 | |||
| 919 | Ga0070707_100169482 | |||
| 920 | Ga0070707_100193064 | |||
| 921 | Ga0070707_100590556 | |||
| 922 | Ga0070707_100768724 | |||
| 923 | Ga0070707_101344248 | |||
| 924 | Ga0070698_100002085 | |||
| 925 | Ga0070698_100034756 | |||
| 926 | Ga0070698_100375645 | |||
| 927 | Ga0070699_100210729 | |||
| 928 | Ga0070699_100542791 | |||
| 929 | Ga0070699_101713296 | |||
| 930 | Ga0070679_100053130 | |||
| 931 | Ga0070679_100697245 | |||
| 932 | Ga0070684_100588381 | |||
| 933 | Ga0070697_100009582 | |||
| 934 | Ga0070697_100092469 | |||
| 935 | Ga0070697_100202969 | |||
| 936 | Ga0070697_100305620 | |||
| 937 | Ga0070697_100373876 | |||
| 938 | Ga0070697_100505840 | |||
| 939 | Ga0070697_100770321 | |||
| 940 | Ga0070697_101445788 | |||
| 941 | Ga0070672_100001416 | |||
| 942 | Ga0070672_100005924 | |||
| 943 | Ga0070672_100031846 | |||
| 944 | Ga0070672_100273430 | |||
| 945 | Ga0070672_100389517 | |||
| 946 | Ga0070672_100674051 | |||
| 947 | Ga0070672_100758606 | |||
| 948 | Ga0070686_100087881 | |||
| 949 | Ga0070686_100109931 | |||
| 950 | Ga0070695_100091611 | |||
| 951 | Ga0070696_101691643 | |||
| 952 | Ga0070693_100110272 | |||
| 953 | Ga0070665_100011639 | |||
| 954 | Ga0070665_100068808 | |||
| 955 | Ga0070704_100341485 | |||
| 956 | Ga0070704_100349166 | |||
| 957 | Ga0070704_100722282 | |||
| 958 | Ga0068855_100234275 | |||
| 959 | Ga0070664_100026517 | |||
| 960 | Ga0068857_100074607 | |||
| 961 | Ga0068856_100647365 | |||
| 962 | Ga0070702_100370539 | |||
| 963 | Ga0068852_101079466 | |||
| 964 | Ga0068859_100124696 | |||
| 965 | Ga0068859_100832985 | |||
| 966 | Ga0068859_100973854 | |||
| 967 | Ga0068864_100177739 | |||
| 968 | Ga0068864_100596889 | |||
| 969 | Ga0068863_100045679 | |||
| 970 | Ga0068863_100551481 | |||
| 971 | Ga0068863_100760737 | |||
| 972 | Ga0068858_100366301 | |||
| 973 | Ga0068860_100057008 | |||
| 974 | Ga0068860_100161412 | |||
| 975 | Ga0068862_100022542 | |||
| 976 | Ga0068862_101240529 | |||
| 977 | Ga0081455_10001048 | |||
| 978 | Ga0081455_10004623 | |||
| 979 | Ga0081455_10099970 | |||
| 980 | Ga0081455_10160367 | |||
| 981 | Ga0081538_10179140 | |||
| 982 | Ga0081539_10009376 | |||
| 983 | Ga0081539_10014820 | |||
| 984 | Ga0081539_10135056 | |||
| 985 | Ga0070717_10047925 | |||
| 986 | Ga0070717_10080586 | |||
| 987 | Ga0070717_10194342 | |||
| 988 | Ga0070717_10273511 | |||
| 989 | Ga0070717_10834533 | |||
| 990 | Ga0070717_10931669 | |||
| 991 | Ga0070716_100052165 | |||
| 992 | Ga0070716_100122568 | |||
| 993 | Ga0070716_100252653 | |||
| 994 | Ga0070716_100260848 | |||
| 995 | Ga0070712_100021497 | |||
| 996 | Ga0070712_100028477 | |||
| 997 | Ga0070712_100036388 | |||
| 998 | Ga0070712_100862023 | |||
| 999 | Ga0097621_100057075 | |||
| 1000 | Ga0097621_100073802 | |||
| 1001 | Ga0097621_100086798 | |||
| 1002 | Ga0097621_100854047 | |||
| 1003 | Ga0097621_101418993 | |||
| 1004 | Ga0097621_101468897 | |||
| 1005 | Ga0068871_100033180 | |||
| 1006 | Ga0068871_100193347 | |||
| 1007 | Ga0068871_101003072 | |||
| 1008 | Ga0068871_102195904 | |||
| 1009 | Ga0075431_100743738 | |||
| 1010 | Ga0075433_10404793 | |||
| 1011 | Ga0075433_10723016 | |||
| 1012 | Ga0075433_10741960 | |||
| 1013 | Ga0075433_10968922 | |||
| 1014 | Ga0075433_11121625 | |||
| 1015 | Ga0075434_100289902 | |||
| 1016 | Ga0075434_100310626 | |||
| 1017 | Ga0075429_100058520 | |||
| 1018 | Ga0068865_100037254 | |||
| 1019 | Ga0068865_100177918 | |||
| 1020 | Ga0068865_100571969 | |||
| 1021 | Ga0068865_101443306 | |||
| 1022 | Ga0075436_101128411 | |||
| 1023 | Ga0097620_100124696 | |||
| 1024 | Ga0097620_100833041 | |||
| 1025 | Ga0097620_100973835 | |||
| 1026 | Ga0075435_100504874 | |||
| 1027 | Ga0099794_10265086 | |||
| 1028 | Ga0099795_10021719 | |||
| 1029 | Ga0105240_10043073 | |||
| 1030 | Ga0111539_10066481 | |||
| 1031 | Ga0111539_10319593 | |||
| 1032 | Ga0111539_11114347 | |||
| 1033 | Ga0105245_10207079 | |||
| 1034 | Ga0105245_10289148 | |||
| 1035 | Ga0105245_10380507 | |||
| 1036 | Ga0105245_11774330 | |||
| 1037 | Ga0105247_10273730 | |||
| 1038 | Ga0105247_11484187 | |||
| 1039 | Ga0114129_10688962 | |||
| 1040 | Ga0114129_12263741 | |||
| 1041 | Ga0105243_10952531 | |||
| 1042 | Ga0105243_11653380 | |||
| 1043 | Ga0105242_10016354 | |||
| 1044 | Ga0105242_10724793 | |||
| 1045 | Ga0105248_11770627 | |||
| 1046 | Ga0105237_12540584 | |||
| 1047 | Ga0105249_10104362 | |||
| 1048 | Ga0105249_10134123 | |||
| 1049 | Ga0105249_10563502 | |||
| 1050 | Ga0099796_10062601 | |||
| 1051 | Ga0099796_10207333 | |||
| 1052 | Ga0105239_10750927 | |||
| 1053 | Ga0105239_11064124 | |||
| 1054 | Ga0105246_10271503 | |||
| 1055 | Ga0105246_10564931 | |||
| 1056 | Ga0105246_10733122 | |||
| 1057 | Ga0157327_1005016 | |||
| 1058 | Ga0157373_10300110 | |||
| 1059 | Ga0157371_10217836 | |||
| 1060 | Ga0157371_10578900 | |||
| 1061 | Ga0157369_10081997 | |||
| 1062 | Ga0157374_10027527 | |||
| 1063 | Ga0157374_10067256 | |||
| 1064 | Ga0157374_10562934 | |||
| 1065 | Ga0157374_10917111 | |||
| 1066 | Ga0157374_10921598 | |||
| 1067 | Ga0157374_10925173 | |||
| 1068 | Ga0157378_10093098 | |||
| 1069 | Ga0157378_10139516 | |||
| 1070 | Ga0157378_10231231 | |||
| 1071 | Ga0157378_10265578 | |||
| 1072 | Ga0157378_10512278 | |||
| 1073 | Ga0157378_10525354 | |||
| 1074 | Ga0163162_10008441 | |||
| 1075 | Ga0163162_10074734 | |||
| 1076 | Ga0163162_10323815 | |||
| 1077 | Ga0163162_11126350 | |||
| 1078 | Ga0157372_10046221 | |||
| 1079 | Ga0157375_10626787 | |||
| 1080 | Ga0157375_10858176 | |||
| 1081 | Ga0157375_11192922 | |||
| 1082 | Ga0157375_11420124 | |||
| 1083 | Ga0157375_12321708 | |||
| 1084 | Ga0163163_10043723 | |||
| 1085 | Ga0163163_10346127 | |||
| 1086 | Ga0157377_10337997 | |||
| 1087 | Ga0157377_11106241 | |||
| 1088 | Ga0157379_10306299 | |||
| 1089 | Ga0157376_10010573 | |||
| 1090 | Ga0157376_10012911 | |||
| 1091 | Ga0157376_10398107 | |||
| 1092 | Ga0163161_10077875 | |||
| 1093 | Ga0163161_10279342 | |||
| 1094 | Ga0213876_10280791 | |||
| 1095 | Ga0207666_1002170 | |||
| 1096 | Ga0207673_1018121 | |||
| 1097 | Ga0207673_1025647 | |||
| 1098 | Ga0207697_10000679 | |||
| 1099 | Ga0207697_10002209 | |||
| 1100 | Ga0207697_10003835 | |||
| 1101 | Ga0207697_10007607 | |||
| 1102 | Ga0207697_10008729 | |||
| 1103 | Ga0207697_10059771 | |||
| 1104 | Ga0207697_10229031 | |||
| 1105 | Ga0207697_10263055 | |||
| 1106 | Ga0207653_10039455 | |||
| 1107 | Ga0207692_10028743 | |||
| 1108 | Ga0207692_10071243 | |||
| 1109 | Ga0207692_10616299 | |||
| 1110 | Ga0207688_10086497 | |||
| 1111 | Ga0207680_10307906 | |||
| 1112 | Ga0207647_10352918 | |||
| 1113 | Ga0207685_10034904 | |||
| 1114 | Ga0207685_10059346 | |||
| 1115 | Ga0207699_10001758 | |||
| 1116 | Ga0207699_10272267 | |||
| 1117 | Ga0207645_10005310 | |||
| 1118 | Ga0207645_10011337 | |||
| 1119 | Ga0207645_10064096 | |||
| 1120 | Ga0207645_10104846 | |||
| 1121 | Ga0207645_10186339 | |||
| 1122 | Ga0207684_10000086 | |||
| 1123 | Ga0207684_10060040 | |||
| 1124 | Ga0207684_10069614 | |||
| 1125 | Ga0207684_10099654 | |||
| 1126 | Ga0207684_10099827 | |||
| 1127 | Ga0207684_10158096 | |||
| 1128 | Ga0207684_10321476 | |||
| 1129 | Ga0207684_10674918 | |||
| 1130 | Ga0207684_10743898 | |||
| 1131 | Ga0207684_10777291 | |||
| 1132 | Ga0207684_10863660 | |||
| 1133 | Ga0207684_10987010 | |||
| 1134 | Ga0207684_11061225 | |||
| 1135 | Ga0207695_10120664 | |||
| 1136 | Ga0207693_10003406 | |||
| 1137 | Ga0207693_10015874 | |||
| 1138 | Ga0207693_10059210 | |||
| 1139 | Ga0207693_10162126 | |||
| 1140 | Ga0207693_10380183 | |||
| 1141 | Ga0207663_10001152 | |||
| 1142 | Ga0207663_10045470 | |||
| 1143 | Ga0207663_10223817 | |||
| 1144 | Ga0207663_10591190 | |||
| 1145 | Ga0207663_10645075 | |||
| 1146 | Ga0207660_10077368 | |||
| 1147 | Ga0207660_11059918 | |||
| 1148 | Ga0207662_10061868 | |||
| 1149 | Ga0207662_10373834 | |||
| 1150 | Ga0207662_10591055 | |||
| 1151 | Ga0207657_10093577 | |||
| 1152 | Ga0207657_10140116 | |||
| 1153 | Ga0207649_10530413 | |||
| 1154 | Ga0207649_11197824 | |||
| 1155 | Ga0207652_11185675 | |||
| 1156 | Ga0207646_10001262 | |||
| 1157 | Ga0207646_10024073 | |||
| 1158 | Ga0207646_10075993 | |||
| 1159 | Ga0207646_10108924 | |||
| 1160 | Ga0207646_10228812 | |||
| 1161 | Ga0207646_10272148 | |||
| 1162 | Ga0207646_10295745 | |||
| 1163 | Ga0207646_10355530 | |||
| 1164 | Ga0207646_10396560 | |||
| 1165 | Ga0207646_11024139 | |||
| 1166 | Ga0207646_11152318 | |||
| 1167 | Ga0207681_10015904 | |||
| 1168 | Ga0207681_10017170 | |||
| 1169 | Ga0207681_10066286 | |||
| 1170 | Ga0207681_10145273 | |||
| 1171 | Ga0207681_10258583 | |||
| 1172 | Ga0207681_10285198 | |||
| 1173 | Ga0207681_10375441 | |||
| 1174 | Ga0207681_10609008 | |||
| 1175 | Ga0207650_10033526 | |||
| 1176 | Ga0207650_10056815 | |||
| 1177 | Ga0207650_10252921 | |||
| 1178 | Ga0207659_10015262 | |||
| 1179 | Ga0207659_10053831 | |||
| 1180 | Ga0207659_10141267 | |||
| 1181 | Ga0207659_10182336 | |||
| 1182 | Ga0207659_10387454 | |||
| 1183 | Ga0207659_10495172 | |||
| 1184 | Ga0207659_10529735 | |||
| 1185 | Ga0207659_10555543 | |||
| 1186 | Ga0207687_10295408 | |||
| 1187 | Ga0207687_10573008 | |||
| 1188 | Ga0207700_10300875 | |||
| 1189 | Ga0207700_10401299 | |||
| 1190 | Ga0207700_10780115 | |||
| 1191 | Ga0207664_10043897 | |||
| 1192 | Ga0207664_10530882 | |||
| 1193 | Ga0207644_10049703 | |||
| 1194 | Ga0207644_10064299 | |||
| 1195 | Ga0207644_10095941 | |||
| 1196 | Ga0207644_10225276 | |||
| 1197 | Ga0207644_10564493 | |||
| 1198 | Ga0207644_10605168 | |||
| 1199 | Ga0207644_10881616 | |||
| 1200 | Ga0207690_10680525 | |||
| 1201 | Ga0207706_10033865 | |||
| 1202 | Ga0207706_10044828 | |||
| 1203 | Ga0207706_10137721 | |||
| 1204 | Ga0207706_10150702 | |||
| 1205 | Ga0207706_10542343 | |||
| 1206 | Ga0207686_10079339 | |||
| 1207 | Ga0207686_10206736 | |||
| 1208 | Ga0207686_10825820 | |||
| 1209 | Ga0207670_10006062 | |||
| 1210 | Ga0207670_10006434 | |||
| 1211 | Ga0207670_10061632 | |||
| 1212 | Ga0207670_10133522 | |||
| 1213 | Ga0207670_10236143 | |||
| 1214 | Ga0207670_10261007 | |||
| 1215 | Ga0207670_10270083 | |||
| 1216 | Ga0207670_10598137 | |||
| 1217 | Ga0207670_10631377 | |||
| 1218 | Ga0207669_10275910 | |||
| 1219 | Ga0207669_10339427 | |||
| 1220 | Ga0207669_11622771 | |||
| 1221 | Ga0207704_10027035 | |||
| 1222 | Ga0207704_10453332 | |||
| 1223 | Ga0207704_11381021 | |||
| 1224 | Ga0207665_10010731 | |||
| 1225 | Ga0207665_10276800 | |||
| 1226 | Ga0207665_10326852 | |||
| 1227 | Ga0207665_10501938 | |||
| 1228 | Ga0207665_10625596 | |||
| 1229 | Ga0207665_10948200 | |||
| 1230 | Ga0207691_10000719 | |||
| 1231 | Ga0207691_10017195 | |||
| 1232 | Ga0207691_10022592 | |||
| 1233 | Ga0207691_10340691 | |||
| 1234 | Ga0207691_10575501 | |||
| 1235 | Ga0207661_10812323 | |||
| 1236 | Ga0207661_11155706 | |||
| 1237 | Ga0207679_10330122 | |||
| 1238 | Ga0207667_10255974 | |||
| 1239 | Ga0207667_11567322 | |||
| 1240 | Ga0207651_10141423 | |||
| 1241 | Ga0207651_10234966 | |||
| 1242 | Ga0207651_10270840 | |||
| 1243 | Ga0207651_10887358 | |||
| 1244 | Ga0207712_10237321 | |||
| 1245 | Ga0207712_10247045 | |||
| 1246 | Ga0207712_10827353 | |||
| 1247 | Ga0207668_10004172 | |||
| 1248 | Ga0207668_10022371 | |||
| 1249 | Ga0207668_10028962 | |||
| 1250 | Ga0207668_10080632 | |||
| 1251 | Ga0207668_10088370 | |||
| 1252 | Ga0207668_10234263 | |||
| 1253 | Ga0207658_10039238 | |||
| 1254 | Ga0207658_10055995 | |||
| 1255 | Ga0207658_10198406 | |||
| 1256 | Ga0207658_10798520 | |||
| 1257 | Ga0207677_10047616 | |||
| 1258 | Ga0207677_10097845 | |||
| 1259 | Ga0207677_10115832 | |||
| 1260 | Ga0207677_10427377 | |||
| 1261 | Ga0207703_10129061 | |||
| 1262 | Ga0207678_10121629 | |||
| 1263 | Ga0207678_10820324 | |||
| 1264 | Ga0207678_10905300 | |||
| 1265 | Ga0207708_10180915 | |||
| 1266 | Ga0207702_10633269 | |||
| 1267 | Ga0207641_10471529 | |||
| 1268 | Ga0207641_10649116 | |||
| 1269 | Ga0207641_10850645 | |||
| 1270 | Ga0207648_10011257 | |||
| 1271 | Ga0207676_10148207 | |||
| 1272 | Ga0207676_10586878 | |||
| 1273 | Ga0207676_10832364 | |||
| 1274 | Ga0207676_11851641 | |||
| 1275 | Ga0207675_100959478 | |||
| 1276 | Ga0207675_101092890 | |||
| 1277 | Ga0207683_10009248 | |||
| 1278 | Ga0207683_10026693 | |||
| 1279 | Ga0207683_10053716 | |||
| 1280 | Ga0207683_10058487 | |||
| 1281 | Ga0207428_10331386 | |||
| 1282 | Ga0268266_10038125 | |||
| 1283 | Ga0268266_10076790 | |||
| 1284 | Ga0268266_10189271 | |||
| 1285 | Ga0268265_10141945 | |||
| 1286 | Ga0268264_10166746 | |||
| 1287 | Ga0268264_10232775 | |||
| 1288 | Ga0373926_0226927 | |||
| 1289 | Ga0373952_0081981 | |||
| 1290 | Ga0373923_0512113 | |||
| 1291 | Ga0373954_0392244 | |||
| 1292 | Ga0373956_0194164 | |||
| 1293 | Ga0373943_0412008 | |||
| 1294 | Ga0373946_0029543 | |||
| 1295 | Ga0373946_0098734 | |||
| 1296 | Ga0373946_0426427 | |||
| 1297 | Ga0373955_0112259 | |||
| 1298 | Ga0373955_0121016 | |||
| 1299 | Ga0373962_0407579 | |||
| 1300 | Ga0373931_1033868 | |||
| 1301 | Ga0373935_0245296 | |||
| 1302 | Ga0373927_0257101 | |||
| 1303 | Ga0373927_0726599 | |||
| 1304 | Ga0373947_0050404 | |||
| 1305 | Ga0373947_0144704 | |||
| 1306 | Ga0373947_0496927 | |||
| 1307 | Ga0373947_0622079 | |||
| 1308 | Ga0373947_0787880 | |||
| 1309 | Ga0373937_0153373 | |||
| 1310 | Ga0373937_0457271 | |||
| 1311 | Ga0373937_0495282 | |||
| 1312 | Ga0373937_0495709 | |||
| 1313 | Ga0373925_0084161 | |||
| 1314 | Ga0373925_0086125 | |||
| 1315 | Ga0373925_0129868 | |||
| 1316 | Ga0373925_0271909 | |||
| 1317 | Ga0373925_0798246 | |||
| 1318 | Ga0395899_0022997 | |||
| 1319 | Ga0395900_0143341 | |||
| 1320 | Ga0395898_0112819 | |||
| 1321 | Ga0395898_0944862 | |||
| 1322 | Ga0395905_0239129 | |||
| 1323 | Ga0395905_0359391 | |||
| 1324 | Ga0395905_1537376 | |||
| 1325 | Ga0395901_0023615 | |||
| 1326 | Ga0395901_0082500 | |||
| 1327 | Ga0395901_0154196 | |||
| 1328 | Ga0436365_1851055 | |||
| 1329 | Ga0451793_0313413 | |||
| 1330 | Ga0451802_1059119 | |||
| 1331 | Ga0451802_1261066 | |||
| 1332 | Ga0451835_0470488 | |||
| 1333 | Ga0451839_0788197 | |||
| 1334 | Ga0439448_0307403 | |||
| 1335 | Ga0439460_0231489 | |||
| 1336 | Ga0439440_0069391 | |||
| 1337 | Ga0451576_0015248 | |||
| 1338 | Ga0451576_0124222 | |||
| 1339 | Ga0451576_1318490 | |||
| 1340 | Ga0451576_1955606 | |||
| 1341 | Ga0495592_0063225 | |||
| 1342 | Ga0495641_0447586 | |||
| 1343 | Ga0495651_0123049 | |||
| 1344 | Ga0495580_0304747 | |||
| 1345 | Ga0495605_0447230 | |||
| 1346 | Ga0495584_0062242 | |||
| 1347 | Ga0495585_0269736 | |||
| 1348 | Ga0495594_0700133 | |||
| 1349 | Ga0495618_0310774 | |||
| 1350 | Ga0495628_0028925 | |||
| 1351 | Ga0495630_0042529 | |||
| 1352 | Ga0495642_0032398 | |||
| 1353 | Ga0495652_0244626 | |||
| 1354 | Ga0495665_0463095 | |||
| 1355 | Ga0495640_0100239 | |||
| 1356 | Ga0495640_0532037 | |||
| 1357 | Ga0495587_0039334 | |||
| 1358 | Ga0495587_0325429 | |||
| 1359 | Ga0495587_0684561 | |||
| 1360 | Ga0495598_0005784 | |||
| 1361 | Ga0495598_0073344 | |||
| 1362 | Ga0495645_0009376 | |||
| 1363 | Ga0495635_0083948 | |||
| 1364 | Ga0495635_0174903 | |||
| 1365 | Ga0495588_0135711 | |||
| 1366 | Ga0495588_0709579 | |||
| 1367 | Ga0495657_0607753 | |||
| 1368 | Ga0495657_0673079 | |||
| 1369 | Ga0495623_0271524 | |||
| 1370 | Ga0495646_0136394 | |||
| 1371 | Ga0495647_0320418 | |||
| 1372 | Ga0495658_0014481 | |||
| 1373 | Ga0495669_0187601 | |||
| 1374 | Ga0495613_0118516 | |||
| 1375 | Ga0495624_0460270 | |||
| 1376 | Ga0495581_0828596 | |||
| 1377 | Ga0495604_0123689 | |||
| 1378 | Ga0495674_0200532 | |||
| 1379 | Ga0495674_0532536 | |||
| 1380 | Ga0495680_0299560 | |||
| 1381 | Ga0495675_0234940 | |||
| 1382 | Ga0495684_0011399 | |||
| 1383 | Ga0495684_0022939 | |||
| 1384 | Ga0495614_0327924 | |||
| 1385 | Ga0495615_0240630 | |||
| 1386 | Ga0496100_0004939 | |||
| 1387 | Ga0496100_0093464 | |||
| 1388 | Ga0496100_0165659 | |||
| 1389 | Ga0496101_0794728 | |||
| 1390 | Ga0496102_0017119 | |||
| 1391 | Ga0496102_0222460 | |||
| 1392 | Ga0496102_0732935 | |||
| 1393 | Ga0496102_0899922 | |||
| 1394 | Ga0496103_0027269 | |||
| 1395 | Ga0496104_0121066 | |||
| 1396 | Ga0496104_0276491 | |||
| 1397 | Ga0496104_0311461 | |||
| 1398 | Ga0496104_0336327 | |||
| 1399 | Ga0496104_0405945 | |||
| 1400 | Ga0496104_0944262 | |||
| 1401 | Ga0496105_0041527 | |||
| 1402 | Ga0496105_0045742 | |||
| 1403 | Ga0496105_0396660 | |||
| 1404 | Ga0496106_0001558 | |||
| 1405 | Ga0496106_0200791 | |||
| 1406 | Ga0496106_0409360 | |||
| 1407 | Ga0496106_1067156 | |||
| 1408 | Ga0496107_0000630 | |||
| 1409 | Ga0496107_0274678 | |||
| 1410 | Ga0496108_0024958 | |||
| 1411 | Ga0496108_0188361 | |||
| 1412 | Ga0496108_0573397 | |||
| 1413 | Ga0496108_0597035 | |||
| 1414 | Ga0496108_0823119 | |||
| 1415 | Ga0496108_0886935 | |||
| 1416 | Ga0496109_0111804 | |||
| 1417 | Ga0496109_0120243 | |||
| 1418 | Ga0496109_0135211 | |||
| 1419 | Ga0496109_0135291 | |||
| 1420 | Ga0496109_0201599 | |||
| 1421 | Ga0496109_0259525 | |||
| 1422 | Ga0496109_0348984 | |||
| 1423 | Ga0496109_0661114 | |||
| 1424 | Ga0496109_0825492 | |||
| 1425 | Ga0496111_0090272 | |||
| 1426 | Ga0496111_0232015 | |||
| 1427 | Ga0496111_0271903 | |||
| 1428 | Ga0496112_0027130 | |||
| 1429 | Ga0496112_0111909 | |||
| 1430 | Ga0496112_0165726 | |||
| 1431 | Ga0496112_0177221 | |||
| 1432 | Ga0496112_0205998 | |||
| 1433 | Ga0496112_1302651 | |||
| 1434 | Ga0496113_0020424 | |||
| 1435 | Ga0496113_0169308 | |||
| 1436 | Ga0496113_0304211 | |||
| 1437 | Ga0496113_0430406 | |||
| 1438 | Ga0496113_0737339 | |||
| 1439 | Ga0496114_0198559 | |||
| 1440 | Ga0496114_0382433 | |||
| 1441 | Ga0496115_0002070 | |||
| 1442 | Ga0496115_0042120 | |||
| 1443 | Ga0496115_0190412 | |||
| 1444 | Ga0496115_0221199 | |||
| 1445 | Ga0496115_0635437 | |||
| 1446 | Ga0496115_1134479 | |||
| 1447 | Ga0501067_0389276 | |||
| 1448 | nmdc:mga05p37_233270_c1 | |||
| 1449 | nmdc:mga09592_46929_c1 | |||
| 1450 | nmdc:mga08y16_355579_c1 | |||
| 1451 | nmdc:mga08y16_71757_c1 | |||
| 1452 | nmdc:mga0n895_1192551_c1 | |||
| 1453 | nmdc:mga0n895_125120_c1 | |||
| 1454 | nmdc:mga0n895_1410734_c1 | |||
| 1455 | nmdc:mga0n895_246676_c1 | |||
| 1456 | nmdc:mga0n895_510072_c1 | |||
| 1457 | nmdc:mga0n895_591662_c1 | |||
| 1458 | nmdc:mga0n895_680142_c1 | |||
| 1459 | nmdc:mga0rr50_1163825_c1 | |||
| 1460 | nmdc:mga0rr50_723767_c1 | |||
| 1461 | nmdc:mga0a205_396327_c1 | |||
| 1462 | nmdc:mga0a205_687306_c1 | |||
| 1463 | nmdc:mga0a205_776820_c1 | |||
| 1464 | Ga0495601_0039602 | |||
| 1465 | Ga0495601_0060690 | |||
| 1466 | Ga0495612_0036635 | |||
| 1467 | Ga0495655_0261648 | |||
| 1468 | Ga0495595_0078890 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3omd-assembly2.cif.gz_B | crystal structure of unknown function protein from leptospirillum rubarum | 0.6212 | 3 | 140 |
| 3omd-assembly2.cif.gz_B | crystal structure of unknown function protein from leptospirillum rubarum | 0.5714 | 3 | 140 |
| 1wxp-assembly1.cif.gz_A | solution structure of the death domain of nuclear matrix protein p84 | 0.3527 | 13 | 128 |
| 2ib1-assembly1.cif.gz_A | solution structure of p45 death domain | 0.343 | 19 | 125 |
| 2ib1-assembly1.cif.gz_A | solution structure of p45 death domain | 0.3362 | 19 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1f5sA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Phosphoserine phosphatase; domain 2 | 0.531 | 44 | 99 | 1.10.150.210 |
| 1f5sA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Phosphoserine phosphatase; domain 2 | 0.4956 | 44 | 99 | 1.10.150.210 |
| af_E7FE32_509_638_1.10.472.80 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Ypt/Rab-GAP domain of gyp1p, domain 3 | 0.4952 | 48 | 100 | 1.10.472.80 |
| 4d8oA04 | Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas | 0.489 | 15 | 106 | 1.10.533.10 |
| 4d8oA04 | Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas | 0.4844 | 15 | 106 | 1.10.533.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5X2K0-F1-model_v4 | DUF5069 domain-containing protein | 0.959 | 1 | 97 |
|
| AF-A0A2V5X2K0-F1-model_v4 | DUF5069 domain-containing protein | 0.9402 | 1 | 97 |
|
| AF-A0A836U914-F1-model_v4 | DUF5069 domain-containing protein | 0.9205 | 3 | 72 |
|
| AF-A0A832ESU0-F1-model_v4 | DUF5069 domain-containing protein | 0.9129 | 1 | 83 |
|
| AF-A0A836U914-F1-model_v4 | DUF5069 domain-containing protein | 0.8966 | 3 | 72 |
|