F478116

General Info

Members Datasets Scaffolds Average Seq Length
734 264 1468 148

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10104004|Ga0065707_101040041
Length 148
Sequence MADTYVPLISSGTAGPLGVLHLPRLWQKVSLEARGKLAPGYPGIGKGYDMMTISALGLNADAVKKFITDNKPTYPQFEAWVKGQPGVKLDKATLYKHNASIRGYIHDDATRKGILGANAISDESSVNPGAVDLNNLDDWYEFHQAALK

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.72
Rhizosphere 90.19
Stem 0
Stem Tuber 0
Unclassified 40.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10104004 3300005295 Bacteria 2719
2 CNXas_1000035 3300000545 Bacteria 28845
3 JGI25406J46586_10070767 3300003203 Unclassified 1095
4 Ga0058859_11725447 3300004798 Bacteria 767
5 Ga0058859_11823994 3300004798 Unclassified 568
6 Ga0058860_12116340 3300004801 Unclassified 670
7 Ga0058860_12213048 3300004801 Unclassified 565
8 Ga0065704_10213269 3300005289 Unclassified 1101
9 Ga0065712_10011743 3300005290 Bacteria 2968
10 Ga0065712_10023244 3300005290 Bacteria 1576
11 Ga0065712_10074607 3300005290 Bacteria 4020
12 Ga0065712_10076749 3300005290 Bacteria 3608
13 Ga0065712_10221278 3300005290 Unclassified 1026
14 Ga0065712_10258147 3300005290 Unclassified 943
15 Ga0065712_10284088 3300005290 Bacteria 890
16 Ga0065715_10018433 3300005293 Bacteria 2493
17 Ga0065715_10071293 3300005293 Unclassified 712
18 Ga0065715_10089033 3300005293 Bacteria 16097
19 Ga0065715_10091980 3300005293 Bacteria 5418
20 Ga0065715_10143173 3300005293 Bacteria 1824
21 Ga0065715_10182570 3300005293 Unclassified 1464
22 Ga0065715_10446061 3300005293 Bacteria 831
23 Ga0065707_10173538 3300005295 Unclassified 1467
24 Ga0070676_10007840 3300005328 Bacteria 5740
25 Ga0070676_10007972 3300005328 Bacteria 5694
26 Ga0070676_10036383 3300005328 Bacteria 2836
27 Ga0070676_10039256 3300005328 Unclassified 2737
28 Ga0070683_100198825 3300005329 Bacteria 1904
29 Ga0070683_100355238 3300005329 Bacteria 1395
30 Ga0070683_101233650 3300005329 Bacteria 719
31 Ga0070690_100105700 3300005330 Bacteria 1872
32 Ga0070690_100377813 3300005330 Bacteria 1035
33 Ga0070690_100446466 3300005330 Unclassified 958
34 Ga0070690_100497503 3300005330 Unclassified 911
35 Ga0070670_100144986 3300005331 Bacteria 2054
36 Ga0070670_101115416 3300005331 Unclassified 720
37 Ga0070677_10042336 3300005333 Bacteria 1803
38 Ga0070666_10060833 3300005335 Bacteria 2556
39 Ga0070666_10086266 3300005335 Bacteria 2150
40 Ga0070666_10136513 3300005335 Bacteria 1706
41 Ga0070666_10366201 3300005335 Unclassified 1033
42 Ga0070682_101009204 3300005337 Unclassified 691
43 Ga0068868_100004179 3300005338 Bacteria 10094
44 Ga0068868_100120666 3300005338 Unclassified 2138
45 Ga0068868_100382936 3300005338 Bacteria 1211
46 Ga0068868_101145931 3300005338 Unclassified 717
47 Ga0068868_101233475 3300005338 Bacteria 692
48 Ga0068868_102346136 3300005338 Unclassified 509
49 Ga0070689_100003430 3300005340 Bacteria 10547
50 Ga0070689_100114699 3300005340 Bacteria 2147
51 Ga0070689_100304978 3300005340 Bacteria 1326
52 Ga0070689_100402962 3300005340 Unclassified 1157
53 Ga0070689_100508652 3300005340 Unclassified 1033
54 Ga0070689_100703925 3300005340 Bacteria 882
55 Ga0070689_100846614 3300005340 Unclassified 806
56 Ga0070691_10119166 3300005341 Unclassified 1327
57 Ga0070687_100120145 3300005343 Unclassified 1502
58 Ga0070687_100146024 3300005343 Unclassified 1383
59 Ga0070687_100262742 3300005343 Bacteria 1078
60 Ga0070687_101089357 3300005343 Unclassified 584
61 Ga0070661_100007794 3300005344 Bacteria 7391
62 Ga0070661_100619270 3300005344 Unclassified 876
63 Ga0070661_100969873 3300005344 Unclassified 704
64 Ga0070668_100009102 3300005347 Bacteria 7375
65 Ga0070668_100057268 3300005347 Bacteria 3011
66 Ga0070668_100071733 3300005347 Bacteria 2698
67 Ga0070668_100097880 3300005347 Bacteria 2321
68 Ga0070669_100004185 3300005353 Bacteria 10457
69 Ga0070669_100026882 3300005353 Bacteria 4140
70 Ga0070669_100029948 3300005353 Bacteria 3925
71 Ga0070669_100030435 3300005353 Bacteria 3895
72 Ga0070669_100037558 3300005353 Bacteria 3513
73 Ga0070669_100239763 3300005353 Unclassified 1440
74 Ga0070669_100246446 3300005353 Bacteria 1421
75 Ga0070669_100712675 3300005353 Bacteria 848
76 Ga0070669_100880330 3300005353 Unclassified 764
77 Ga0070675_100013126 3300005354 Bacteria 6509
78 Ga0070675_100029234 3300005354 Bacteria 4443
79 Ga0070675_100045309 3300005354 Bacteria 3599
80 Ga0070675_100052409 3300005354 Bacteria 3354
81 Ga0070675_100054300 3300005354 Bacteria 3296
82 Ga0070675_100054706 3300005354 Bacteria 3284
83 Ga0070675_100062835 3300005354 Bacteria 3069
84 Ga0070675_100066348 3300005354 Bacteria 2985
85 Ga0070675_100084269 3300005354 Unclassified 2654
86 Ga0070675_100295895 3300005354 Bacteria 1425
87 Ga0070675_100551765 3300005354 Bacteria 1042
88 Ga0070675_100626995 3300005354 Unclassified 976
89 Ga0070671_100005632 3300005355 Bacteria 9969
90 Ga0070671_100007851 3300005355 Bacteria 8530
91 Ga0070671_100012342 3300005355 Bacteria 6879
92 Ga0070671_100051625 3300005355 Bacteria 3420
93 Ga0070671_100107751 3300005355 Bacteria 2339
94 Ga0070671_100223398 3300005355 Bacteria 1598
95 Ga0070671_100535086 3300005355 Unclassified 1010
96 Ga0070674_100001540 3300005356 Bacteria 12324
97 Ga0070674_100018937 3300005356 Bacteria 4364
98 Ga0070674_100070468 3300005356 Bacteria 2470
99 Ga0070674_100828964 3300005356 Bacteria 801
100 Ga0070673_100007445 3300005364 Bacteria 7220
101 Ga0070673_100007726 3300005364 Bacteria 7116
102 Ga0070673_100283871 3300005364 Bacteria 1453
103 Ga0070673_101106465 3300005364 Unclassified 740
104 Ga0070673_101869047 3300005364 Unclassified 569
105 Ga0070673_101895839 3300005364 Unclassified 565
106 Ga0070688_100022457 3300005365 Bacteria 3698
107 Ga0070688_100063772 3300005365 Unclassified 2337
108 Ga0070688_100127076 3300005365 Bacteria 1715
109 Ga0070688_100242841 3300005365 Unclassified 1279
110 Ga0070688_100249159 3300005365 Bacteria 1264
111 Ga0070688_100633744 3300005365 Bacteria 821
112 Ga0070688_100761139 3300005365 Unclassified 755
113 Ga0070659_100280889 3300005366 Unclassified 1385
114 Ga0070659_100784721 3300005366 Unclassified 828
115 Ga0070667_100025411 3300005367 Bacteria 4924
116 Ga0070667_100030186 3300005367 Bacteria 4520
117 Ga0070667_100155127 3300005367 Unclassified 2013
118 Ga0070667_100229623 3300005367 Bacteria 1654
119 Ga0070667_100944112 3300005367 Bacteria 804
120 Ga0070667_102051101 3300005367 Unclassified 539
121 Ga0070709_10096259 3300005434 Bacteria 1962
122 Ga0070709_10390072 3300005434 Bacteria 1037
123 Ga0070709_10822462 3300005434 Bacteria 730
124 Ga0070714_101004597 3300005435 Unclassified 812
125 Ga0070714_101680289 3300005435 Unclassified 620
126 Ga0070713_100052026 3300005436 Bacteria 3390
127 Ga0070713_100475835 3300005436 Unclassified 1176
128 Ga0070713_100873617 3300005436 Unclassified 864
129 Ga0070713_101505169 3300005436 Bacteria 653
130 Ga0070710_10134620 3300005437 Bacteria 1510
131 Ga0070710_10821190 3300005437 Unclassified 665
132 Ga0070710_10894578 3300005437 Unclassified 640
133 Ga0070701_10046646 3300005438 Bacteria 2228
134 Ga0070701_10197116 3300005438 Unclassified 1188
135 Ga0070711_100013511 3300005439 Bacteria 5126
136 Ga0070711_100113978 3300005439 Bacteria 1989
137 Ga0070711_100116825 3300005439 Bacteria 1966
138 Ga0070711_100450364 3300005439 Unclassified 1054
139 Ga0070711_101297823 3300005439 Bacteria 631
140 Ga0070705_100036402 3300005440 Bacteria 2767
141 Ga0070705_100078310 3300005440 Unclassified 2021
142 Ga0070705_100279866 3300005440 Unclassified 1185
143 Ga0070694_100067438 3300005444 Bacteria 2456
144 Ga0070694_100736308 3300005444 Unclassified 804
145 Ga0070708_100044889 3300005445 Unclassified 3890
146 Ga0070708_100052277 3300005445 Bacteria 3623
147 Ga0070708_100059499 3300005445 Bacteria 3406
148 Ga0070708_100424089 3300005445 Bacteria 1255
149 Ga0070708_100442394 3300005445 Unclassified 1226
150 Ga0070708_100461248 3300005445 Bacteria 1199
151 Ga0070708_100524792 3300005445 Bacteria 1117
152 Ga0070708_101230762 3300005445 Unclassified 700
153 Ga0070663_100212697 3300005455 Bacteria 1515
154 Ga0070663_100312114 3300005455 Bacteria 1262
155 Ga0070663_101184005 3300005455 Unclassified 671
156 Ga0070678_100006233 3300005456 Bacteria 6977
157 Ga0070678_100177757 3300005456 Bacteria 1739
158 Ga0070678_100241188 3300005456 Unclassified 1511
159 Ga0070678_100740815 3300005456 Bacteria 888
160 Ga0070678_100919617 3300005456 Unclassified 800
161 Ga0070662_100110904 3300005457 Unclassified 2090
162 Ga0070662_100421756 3300005457 Unclassified 1104
163 Ga0070681_10398028 3300005458 Unclassified 1288
164 Ga0068867_100054744 3300005459 Bacteria 2947
165 Ga0068867_100116101 3300005459 Unclassified 2062
166 Ga0068867_100584533 3300005459 Unclassified 972
167 Ga0070685_10021980 3300005466 Bacteria 3471
168 Ga0070685_10213200 3300005466 Bacteria 1261
169 Ga0070685_11300438 3300005466 Unclassified 555
170 Ga0070706_100001379 3300005467 Bacteria 25801
171 Ga0070706_100008961 3300005467 Bacteria 9318
172 Ga0070706_100061580 3300005467 Bacteria 3465
173 Ga0070706_100137959 3300005467 Bacteria 2276
174 Ga0070706_100149860 3300005467 Bacteria 2177
175 Ga0070706_100177366 3300005467 Bacteria 1989
176 Ga0070706_100232172 3300005467 Unclassified 1722
177 Ga0070706_100317705 3300005467 Bacteria 1452
178 Ga0070706_100427444 3300005467 Bacteria 1233
179 Ga0070707_100004173 3300005468 Bacteria 13536
180 Ga0070707_100068799 3300005468 Unclassified 3408
181 Ga0070707_100080983 3300005468 Bacteria 3134
182 Ga0070707_100119221 3300005468 Unclassified 2561
183 Ga0070707_100128719 3300005468 Bacteria 2461
184 Ga0070707_100136522 3300005468 Bacteria 2386
185 Ga0070707_100169482 3300005468 Bacteria 2128
186 Ga0070707_100193064 3300005468 Bacteria 1986
187 Ga0070707_100590556 3300005468 Unclassified 1073
188 Ga0070707_100768724 3300005468 Unclassified 927
189 Ga0070707_101344248 3300005468 Bacteria 681
190 Ga0070698_100002085 3300005471 Bacteria 22202
191 Ga0070698_100034756 3300005471 Bacteria 5215
192 Ga0070698_100375645 3300005471 Bacteria 1354
193 Ga0070699_100210729 3300005518 Bacteria 1730
194 Ga0070699_100542791 3300005518 Unclassified 1058
195 Ga0070699_101713296 3300005518 Unclassified 576
196 Ga0070679_100053130 3300005530 Unclassified 4033
197 Ga0070679_100697245 3300005530 Unclassified 958
198 Ga0070684_100588381 3300005535 Unclassified 1034
199 Ga0070697_100009582 3300005536 Bacteria 7564
200 Ga0070697_100092469 3300005536 Bacteria 2503
201 Ga0070697_100202969 3300005536 Unclassified 1685
202 Ga0070697_100305620 3300005536 Unclassified 1368
203 Ga0070697_100373876 3300005536 Unclassified 1233
204 Ga0070697_100505840 3300005536 Bacteria 1057
205 Ga0070697_100770321 3300005536 Unclassified 851
206 Ga0070697_101445788 3300005536 Unclassified 614
207 Ga0070672_100001416 3300005543 Bacteria 14815
208 Ga0070672_100005924 3300005543 Bacteria 8155
209 Ga0070672_100031846 3300005543 Unclassified 3974
210 Ga0070672_100273430 3300005543 Bacteria 1427
211 Ga0070672_100389517 3300005543 Unclassified 1193
212 Ga0070672_100674051 3300005543 Unclassified 904
213 Ga0070672_100758606 3300005543 Unclassified 852
214 Ga0070686_100087881 3300005544 Unclassified 2073
215 Ga0070686_100109931 3300005544 Unclassified 1876
216 Ga0070695_100091611 3300005545 Unclassified 2031
217 Ga0070696_101691643 3300005546 Unclassified 545
218 Ga0070693_100110272 3300005547 Unclassified 1692
219 Ga0070665_100011639 3300005548 Bacteria 8892
220 Ga0070665_100068808 3300005548 Bacteria 3549
221 Ga0070704_100341485 3300005549 Bacteria 1261
222 Ga0070704_100349166 3300005549 Bacteria 1248
223 Ga0070704_100722282 3300005549 Bacteria 885
224 Ga0068855_100234275 3300005563 Bacteria 2054
225 Ga0070664_100026517 3300005564 Bacteria 4807
226 Ga0068857_100074607 3300005577 Bacteria 3023
227 Ga0068856_100647365 3300005614 Unclassified 1077
228 Ga0070702_100370539 3300005615 Bacteria 1015
229 Ga0068852_101079466 3300005616 Bacteria 823
230 Ga0068859_100124696 3300005617 Bacteria 2644
231 Ga0068859_100832985 3300005617 Unclassified 1009
232 Ga0068859_100973854 3300005617 Bacteria 931
233 Ga0068864_100177739 3300005618 Bacteria 1944
234 Ga0068864_100596889 3300005618 Bacteria 1071
235 Ga0068863_100045679 3300005841 Unclassified 4157
236 Ga0068863_100551481 3300005841 Bacteria 1138
237 Ga0068863_100760737 3300005841 Bacteria 965
238 Ga0068858_100366301 3300005842 Bacteria 1382
239 Ga0068860_100057008 3300005843 Bacteria 3713
240 Ga0068860_100161412 3300005843 Bacteria 2161
241 Ga0068862_100022542 3300005844 Bacteria 5269
242 Ga0068862_101240529 3300005844 Unclassified 745
243 Ga0081455_10001048 3300005937 Bacteria 34800
244 Ga0081455_10004623 3300005937 Bacteria 15365
245 Ga0081455_10099970 3300005937 Unclassified 2332
246 Ga0081455_10160367 3300005937 Bacteria 1725
247 Ga0081538_10179140 3300005981 Unclassified 910
248 Ga0081539_10009376 3300005985 Bacteria 8197
249 Ga0081539_10014820 3300005985 Bacteria 5726
250 Ga0081539_10135056 3300005985 Unclassified 1207
251 Ga0070717_10047925 3300006028 Bacteria 3503
252 Ga0070717_10080586 3300006028 Bacteria 2732
253 Ga0070717_10194342 3300006028 Bacteria 1774
254 Ga0070717_10273511 3300006028 Unclassified 1496
255 Ga0070717_10834533 3300006028 Bacteria 839
256 Ga0070717_10931669 3300006028 Unclassified 791
257 Ga0070716_100052165 3300006173 Bacteria 2328
258 Ga0070716_100122568 3300006173 Unclassified 1630
259 Ga0070716_100252653 3300006173 Bacteria 1202
260 Ga0070716_100260848 3300006173 Unclassified 1185
261 Ga0070712_100021497 3300006175 Bacteria 4238
262 Ga0070712_100028477 3300006175 Bacteria 3737
263 Ga0070712_100036388 3300006175 Unclassified 3349
264 Ga0070712_100862023 3300006175 Unclassified 779
265 Ga0097621_100057075 3300006237 Unclassified 3191
266 Ga0097621_100073802 3300006237 Bacteria 2825
267 Ga0097621_100086798 3300006237 Unclassified 2612
268 Ga0097621_100854047 3300006237 Unclassified 846
269 Ga0097621_101418993 3300006237 Bacteria 658
270 Ga0097621_101468897 3300006237 Bacteria 646
271 Ga0068871_100033180 3300006358 Bacteria 4085
272 Ga0068871_100193347 3300006358 Bacteria 1754
273 Ga0068871_101003072 3300006358 Unclassified 777
274 Ga0068871_102195904 3300006358 Unclassified 526
275 Ga0075431_100743738 3300006847 Unclassified 956
276 Ga0075433_10404793 3300006852 Unclassified 1204
277 Ga0075433_10723016 3300006852 Unclassified 871
278 Ga0075433_10741960 3300006852 Bacteria 859
279 Ga0075433_10968922 3300006852 Unclassified 741
280 Ga0075433_11121625 3300006852 Bacteria 684
281 Ga0075434_100289902 3300006871 Bacteria 1657
282 Ga0075434_100310626 3300006871 Bacteria 1597
283 Ga0075429_100058520 3300006880 Bacteria 3356
284 Ga0068865_100037254 3300006881 Bacteria 3283
285 Ga0068865_100177918 3300006881 Bacteria 1636
286 Ga0068865_100571969 3300006881 Unclassified 952
287 Ga0068865_101443306 3300006881 Unclassified 615
288 Ga0075436_101128411 3300006914 Bacteria 591
289 Ga0097620_100124696 3300006931 Bacteria 2644
290 Ga0097620_100833041 3300006931 Unclassified 1009
291 Ga0097620_100973835 3300006931 Bacteria 931
292 Ga0075435_100504874 3300007076 Bacteria 1046
293 Ga0099794_10265086 3300007265 Bacteria 887
294 Ga0099795_10021719 3300007788 Bacteria 2109
295 Ga0105240_10043073 3300009093 Bacteria 5747
296 Ga0111539_10066481 3300009094 Bacteria 4258
297 Ga0111539_10319593 3300009094 Bacteria 1807
298 Ga0111539_11114347 3300009094 Bacteria 917
299 Ga0105245_10207079 3300009098 Bacteria 1886
300 Ga0105245_10289148 3300009098 Unclassified 1605
301 Ga0105245_10380507 3300009098 Bacteria 1405
302 Ga0105245_11774330 3300009098 Bacteria 670
303 Ga0105247_10273730 3300009101 Bacteria 1162
304 Ga0105247_11484187 3300009101 Unclassified 552
305 Ga0114129_10688962 3300009147 Bacteria 1315
306 Ga0114129_12263741 3300009147 Unclassified 653
307 Ga0105243_10952531 3300009148 Unclassified 858
308 Ga0105243_11653380 3300009148 Bacteria 668
309 Ga0105242_10016354 3300009176 Bacteria 5769
310 Ga0105242_10724793 3300009176 Bacteria 976
311 Ga0105248_11770627 3300009177 Unclassified 700
312 Ga0105237_12540584 3300009545 Unclassified 523
313 Ga0105249_10104362 3300009553 Unclassified 2671
314 Ga0105249_10134123 3300009553 Unclassified 2367
315 Ga0105249_10563502 3300009553 Unclassified 1191
316 Ga0099796_10062601 3300010159 Unclassified 1323
317 Ga0099796_10207333 3300010159 Unclassified 798
318 Ga0105239_10750927 3300010375 Bacteria 1117
319 Ga0105239_11064124 3300010375 Bacteria 931
320 Ga0105246_10271503 3300011119 Bacteria 1356
321 Ga0105246_10564931 3300011119 Unclassified 977
322 Ga0105246_10733122 3300011119 Bacteria 870
323 Ga0157327_1005016 3300012512 Bacteria 1053
324 Ga0157373_10300110 3300013100 Unclassified 1140
325 Ga0157371_10217836 3300013102 Unclassified 1371
326 Ga0157371_10578900 3300013102 Unclassified 834
327 Ga0157369_10081997 3300013105 Bacteria 3451
328 Ga0157374_10027527 3300013296 Bacteria 5131
329 Ga0157374_10067256 3300013296 Unclassified 3368
330 Ga0157374_10562934 3300013296 Unclassified 1148
331 Ga0157374_10917111 3300013296 Unclassified 894
332 Ga0157374_10921598 3300013296 Bacteria 892
333 Ga0157374_10925173 3300013296 Bacteria 890
334 Ga0157378_10093098 3300013297 Unclassified 2743
335 Ga0157378_10139516 3300013297 Unclassified 2250
336 Ga0157378_10231231 3300013297 Unclassified 1762
337 Ga0157378_10265578 3300013297 Bacteria 1648
338 Ga0157378_10512278 3300013297 Unclassified 1200
339 Ga0157378_10525354 3300013297 Bacteria 1185
340 Ga0163162_10008441 3300013306 Bacteria 10047
341 Ga0163162_10074734 3300013306 Bacteria 3448
342 Ga0163162_10323815 3300013306 Bacteria 1674
343 Ga0163162_11126350 3300013306 Unclassified 889
344 Ga0157372_10046221 3300013307 Bacteria 4832
345 Ga0157375_10626787 3300013308 Bacteria 1233
346 Ga0157375_10858176 3300013308 Bacteria 1054
347 Ga0157375_11192922 3300013308 Bacteria 893
348 Ga0157375_11420124 3300013308 Unclassified 818
349 Ga0157375_12321708 3300013308 Unclassified 640
350 Ga0163163_10043723 3300014325 Bacteria 4393
351 Ga0163163_10346127 3300014325 Bacteria 1542
352 Ga0157377_10337997 3300014745 Unclassified 1006
353 Ga0157377_11106241 3300014745 Unclassified 607
354 Ga0157379_10306299 3300014968 Bacteria 1448
355 Ga0157376_10010573 3300014969 Bacteria 6756
356 Ga0157376_10012911 3300014969 Bacteria 6216
357 Ga0157376_10398107 3300014969 Bacteria 1331
358 Ga0163161_10077875 3300017792 Bacteria 2436
359 Ga0163161_10279342 3300017792 Bacteria 1309
360 Ga0213876_10280791 3300021384 Unclassified 885
361 Ga0207666_1002170 3300025271 Bacteria 2353
362 Ga0207673_1018121 3300025290 Unclassified 942
363 Ga0207673_1025647 3300025290 Unclassified 807
364 Ga0207697_10000679 3300025315 Bacteria 19342
365 Ga0207697_10002209 3300025315 Bacteria 10176
366 Ga0207697_10003835 3300025315 Bacteria 7341
367 Ga0207697_10007607 3300025315 Bacteria 4812
368 Ga0207697_10008729 3300025315 Bacteria 4414
369 Ga0207697_10059771 3300025315 Unclassified 1584
370 Ga0207697_10229031 3300025315 Unclassified 820
371 Ga0207697_10263055 3300025315 Bacteria 764
372 Ga0207653_10039455 3300025885 Unclassified 1546
373 Ga0207692_10028743 3300025898 Bacteria 2634
374 Ga0207692_10071243 3300025898 Bacteria 1832
375 Ga0207692_10616299 3300025898 Unclassified 699
376 Ga0207688_10086497 3300025901 Bacteria 1796
377 Ga0207680_10307906 3300025903 Unclassified 1105
378 Ga0207647_10352918 3300025904 Bacteria 833
379 Ga0207685_10034904 3300025905 Unclassified 1831
380 Ga0207685_10059346 3300025905 Unclassified 1509
381 Ga0207699_10001758 3300025906 Bacteria 10233
382 Ga0207699_10272267 3300025906 Unclassified 1174
383 Ga0207645_10005310 3300025907 Bacteria 9371
384 Ga0207645_10011337 3300025907 Bacteria 6091
385 Ga0207645_10064096 3300025907 Bacteria 2348
386 Ga0207645_10104846 3300025907 Bacteria 1826
387 Ga0207645_10186339 3300025907 Unclassified 1363
388 Ga0207684_10000086 3300025910 Bacteria 173807
389 Ga0207684_10060040 3300025910 Bacteria 3229
390 Ga0207684_10069614 3300025910 Bacteria 2990
391 Ga0207684_10099654 3300025910 Bacteria 2482
392 Ga0207684_10099827 3300025910 Bacteria 2480
393 Ga0207684_10158096 3300025910 Bacteria 1951
394 Ga0207684_10321476 3300025910 Bacteria 1334
395 Ga0207684_10674918 3300025910 Unclassified 879
396 Ga0207684_10743898 3300025910 Bacteria 831
397 Ga0207684_10777291 3300025910 Unclassified 810
398 Ga0207684_10863660 3300025910 Bacteria 762
399 Ga0207684_10987010 3300025910 Unclassified 705
400 Ga0207684_11061225 3300025910 Unclassified 676
401 Ga0207695_10120664 3300025913 Bacteria 2590
402 Ga0207693_10003406 3300025915 Bacteria 13576
403 Ga0207693_10015874 3300025915 Bacteria 6029
404 Ga0207693_10059210 3300025915 Unclassified 3000
405 Ga0207693_10162126 3300025915 Bacteria 1759
406 Ga0207693_10380183 3300025915 Bacteria 1104
407 Ga0207663_10001152 3300025916 Bacteria 12202
408 Ga0207663_10045470 3300025916 Bacteria 2701
409 Ga0207663_10223817 3300025916 Unclassified 1370
410 Ga0207663_10591190 3300025916 Unclassified 871
411 Ga0207663_10645075 3300025916 Unclassified 835
412 Ga0207660_10077368 3300025917 Bacteria 2435
413 Ga0207660_11059918 3300025917 Unclassified 661
414 Ga0207662_10061868 3300025918 Unclassified 2248
415 Ga0207662_10373834 3300025918 Bacteria 962
416 Ga0207662_10591055 3300025918 Unclassified 772
417 Ga0207657_10093577 3300025919 Bacteria 2503
418 Ga0207657_10140116 3300025919 Bacteria 1977
419 Ga0207649_10530413 3300025920 Unclassified 899
420 Ga0207649_11197824 3300025920 Unclassified 600
421 Ga0207652_11185675 3300025921 Unclassified 665
422 Ga0207646_10001262 3300025922 Bacteria 31705
423 Ga0207646_10024073 3300025922 Bacteria 5582
424 Ga0207646_10075993 3300025922 Bacteria 3001
425 Ga0207646_10108924 3300025922 Bacteria 2486
426 Ga0207646_10228812 3300025922 Bacteria 1680
427 Ga0207646_10272148 3300025922 Bacteria 1531
428 Ga0207646_10295745 3300025922 Bacteria 1463
429 Ga0207646_10355530 3300025922 Unclassified 1323
430 Ga0207646_10396560 3300025922 Unclassified 1246
431 Ga0207646_11024139 3300025922 Unclassified 729
432 Ga0207646_11152318 3300025922 Bacteria 681
433 Ga0207681_10015904 3300025923 Unclassified 4697
434 Ga0207681_10017170 3300025923 Bacteria 4540
435 Ga0207681_10066286 3300025923 Bacteria 2499
436 Ga0207681_10145273 3300025923 Unclassified 1771
437 Ga0207681_10258583 3300025923 Bacteria 1362
438 Ga0207681_10285198 3300025923 Unclassified 1302
439 Ga0207681_10375441 3300025923 Unclassified 1143
440 Ga0207681_10609008 3300025923 Unclassified 903
441 Ga0207650_10033526 3300025925 Bacteria 3720
442 Ga0207650_10056815 3300025925 Bacteria 2909
443 Ga0207650_10252921 3300025925 Bacteria 1427
444 Ga0207659_10015262 3300025926 Bacteria 4972
445 Ga0207659_10053831 3300025926 Bacteria 2872
446 Ga0207659_10141267 3300025926 Unclassified 1869
447 Ga0207659_10182336 3300025926 Bacteria 1664
448 Ga0207659_10387454 3300025926 Unclassified 1166
449 Ga0207659_10495172 3300025926 Bacteria 1034
450 Ga0207659_10529735 3300025926 Unclassified 1000
451 Ga0207659_10555543 3300025926 Unclassified 976
452 Ga0207687_10295408 3300025927 Bacteria 1303
453 Ga0207687_10573008 3300025927 Unclassified 949
454 Ga0207700_10300875 3300025928 Unclassified 1385
455 Ga0207700_10401299 3300025928 Bacteria 1202
456 Ga0207700_10780115 3300025928 Bacteria 854
457 Ga0207664_10043897 3300025929 Bacteria 3499
458 Ga0207664_10530882 3300025929 Bacteria 1055
459 Ga0207644_10049703 3300025931 Bacteria 3003
460 Ga0207644_10064299 3300025931 Bacteria 2666
461 Ga0207644_10095941 3300025931 Unclassified 2218
462 Ga0207644_10225276 3300025931 Unclassified 1488
463 Ga0207644_10564493 3300025931 Bacteria 943
464 Ga0207644_10605168 3300025931 Unclassified 910
465 Ga0207644_10881616 3300025931 Unclassified 750
466 Ga0207690_10680525 3300025932 Unclassified 845
467 Ga0207706_10033865 3300025933 Bacteria 4547
468 Ga0207706_10044828 3300025933 Bacteria 3918
469 Ga0207706_10137721 3300025933 Unclassified 2147
470 Ga0207706_10150702 3300025933 Unclassified 2045
471 Ga0207706_10542343 3300025933 Unclassified 1002
472 Ga0207686_10079339 3300025934 Bacteria 2137
473 Ga0207686_10206736 3300025934 Unclassified 1409
474 Ga0207686_10825820 3300025934 Unclassified 744
475 Ga0207670_10006062 3300025936 Bacteria 6681
476 Ga0207670_10006434 3300025936 Bacteria 6510
477 Ga0207670_10061632 3300025936 Bacteria 2560
478 Ga0207670_10133522 3300025936 Bacteria 1822
479 Ga0207670_10236143 3300025936 Bacteria 1406
480 Ga0207670_10261007 3300025936 Bacteria 1343
481 Ga0207670_10270083 3300025936 Bacteria 1321
482 Ga0207670_10598137 3300025936 Unclassified 905
483 Ga0207670_10631377 3300025936 Bacteria 882
484 Ga0207669_10275910 3300025937 Bacteria 1265
485 Ga0207669_10339427 3300025937 Bacteria 1156
486 Ga0207669_11622771 3300025937 Unclassified 552
487 Ga0207704_10027035 3300025938 Bacteria 3158
488 Ga0207704_10453332 3300025938 Unclassified 1024
489 Ga0207704_11381021 3300025938 Unclassified 603
490 Ga0207665_10010731 3300025939 Bacteria 6016
491 Ga0207665_10276800 3300025939 Unclassified 1248
492 Ga0207665_10326852 3300025939 Unclassified 1152
493 Ga0207665_10501938 3300025939 Unclassified 937
494 Ga0207665_10625596 3300025939 Unclassified 842
495 Ga0207665_10948200 3300025939 Unclassified 684
496 Ga0207691_10000719 3300025940 Bacteria 32701
497 Ga0207691_10017195 3300025940 Bacteria 6861
498 Ga0207691_10022592 3300025940 Bacteria 5931
499 Ga0207691_10340691 3300025940 Bacteria 1283
500 Ga0207691_10575501 3300025940 Unclassified 954
501 Ga0207661_10812323 3300025944 Bacteria 861
502 Ga0207661_11155706 3300025944 Unclassified 713
503 Ga0207679_10330122 3300025945 Bacteria 1323
504 Ga0207667_10255974 3300025949 Unclassified 1791
505 Ga0207667_11567322 3300025949 Unclassified 628
506 Ga0207651_10141423 3300025960 Bacteria 1859
507 Ga0207651_10234966 3300025960 Bacteria 1491
508 Ga0207651_10270840 3300025960 Bacteria 1398
509 Ga0207651_10887358 3300025960 Unclassified 794
510 Ga0207712_10237321 3300025961 Unclassified 1467
511 Ga0207712_10247045 3300025961 Unclassified 1440
512 Ga0207712_10827353 3300025961 Bacteria 815
513 Ga0207668_10004172 3300025972 Bacteria 8477
514 Ga0207668_10022371 3300025972 Unclassified 4046
515 Ga0207668_10028962 3300025972 Unclassified 3626
516 Ga0207668_10080632 3300025972 Bacteria 2358
517 Ga0207668_10088370 3300025972 Unclassified 2269
518 Ga0207668_10234263 3300025972 Bacteria 1482
519 Ga0207658_10039238 3300025986 Bacteria 3416
520 Ga0207658_10055995 3300025986 Bacteria 2924
521 Ga0207658_10198406 3300025986 Unclassified 1673
522 Ga0207658_10798520 3300025986 Bacteria 857
523 Ga0207677_10047616 3300026023 Bacteria 2880
524 Ga0207677_10097845 3300026023 Unclassified 2151
525 Ga0207677_10115832 3300026023 Bacteria 2005
526 Ga0207677_10427377 3300026023 Bacteria 1130
527 Ga0207703_10129061 3300026035 Bacteria 2181
528 Ga0207678_10121629 3300026067 Bacteria 2228
529 Ga0207678_10820324 3300026067 Bacteria 821
530 Ga0207678_10905300 3300026067 Bacteria 780
531 Ga0207708_10180915 3300026075 Bacteria 1674
532 Ga0207702_10633269 3300026078 Unclassified 1051
533 Ga0207641_10471529 3300026088 Bacteria 1216
534 Ga0207641_10649116 3300026088 Bacteria 1036
535 Ga0207641_10850645 3300026088 Unclassified 904
536 Ga0207648_10011257 3300026089 Bacteria 8435
537 Ga0207676_10148207 3300026095 Bacteria 2018
538 Ga0207676_10586878 3300026095 Unclassified 1069
539 Ga0207676_10832364 3300026095 Unclassified 902
540 Ga0207676_11851641 3300026095 Unclassified 602
541 Ga0207675_100959478 3300026118 Unclassified 873
542 Ga0207675_101092890 3300026118 Unclassified 817
543 Ga0207683_10009248 3300026121 Bacteria 8396
544 Ga0207683_10026693 3300026121 Bacteria 4987
545 Ga0207683_10053716 3300026121 Bacteria 3533
546 Ga0207683_10058487 3300026121 Bacteria 3385
547 Ga0207428_10331386 3300027907 Bacteria 1122
548 Ga0268266_10038125 3300028379 Bacteria 4092
549 Ga0268266_10076790 3300028379 Bacteria 2903
550 Ga0268266_10189271 3300028379 Bacteria 1878
551 Ga0268265_10141945 3300028380 Unclassified 2012
552 Ga0268264_10166746 3300028381 Bacteria 1989
553 Ga0268264_10232775 3300028381 Unclassified 1702
554 Ga0373926_0226927 3300035083 Bacteria 721
555 Ga0373952_0081981 3300035092 Bacteria 825
556 Ga0373923_0512113 3300035111 Unclassified 586
557 Ga0373954_0392244 3300035118 Unclassified 686
558 Ga0373956_0194164 3300035119 Bacteria 962
559 Ga0373943_0412008 3300035170 Bacteria 781
560 Ga0373946_0029543 3300035171 Unclassified 2183
561 Ga0373946_0098734 3300035171 Unclassified 1306
562 Ga0373946_0426427 3300035171 Unclassified 673
563 Ga0373955_0112259 3300035172 Bacteria 1577
564 Ga0373955_0121016 3300035172 Bacteria 1522
565 Ga0373962_0407579 3300035242 Unclassified 501
566 Ga0373931_1033868 3300035691 Unclassified 557
567 Ga0373935_0245296 3300035692 Bacteria 1252
568 Ga0373927_0257101 3300035695 Unclassified 1148
569 Ga0373927_0726599 3300035695 Unclassified 656
570 Ga0373947_0050404 3300035725 Bacteria 2503
571 Ga0373947_0144704 3300035725 Bacteria 1527
572 Ga0373947_0496927 3300035725 Bacteria 829
573 Ga0373947_0622079 3300035725 Unclassified 736
574 Ga0373947_0787880 3300035725 Bacteria 649
575 Ga0373937_0153373 3300036401 Unclassified 2159
576 Ga0373937_0457271 3300036401 Unclassified 1212
577 Ga0373937_0495282 3300036401 Bacteria 1161
578 Ga0373937_0495709 3300036401 Bacteria 1160
579 Ga0373925_0084161 3300037068 Bacteria 2424
580 Ga0373925_0086125 3300037068 Bacteria 2396
581 Ga0373925_0129868 3300037068 Bacteria 1964
582 Ga0373925_0271909 3300037068 Bacteria 1363
583 Ga0373925_0798246 3300037068 Unclassified 778
584 Ga0395899_0022997 3300037312 Bacteria 4723
585 Ga0395900_0143341 3300037418 Bacteria 2445
586 Ga0395898_0112819 3300037466 Bacteria 2605
587 Ga0395898_0944862 3300037466 Bacteria 799
588 Ga0395905_0239129 3300037471 Bacteria 1697
589 Ga0395905_0359391 3300037471 Unclassified 1349
590 Ga0395905_1537376 3300037471 Unclassified 570
591 Ga0395901_0023615 3300038443 Bacteria 6304
592 Ga0395901_0082500 3300038443 Unclassified 3359
593 Ga0395901_0154196 3300038443 Bacteria 2413
594 Ga0436365_1851055 3300039437 Bacteria 1105
595 Ga0451793_0313413 3300041452 Unclassified 557
596 Ga0451802_1059119 3300041460 Unclassified 775
597 Ga0451802_1261066 3300041460 Unclassified 713
598 Ga0451835_0470488 3300041492 Bacteria 942
599 Ga0451839_0788197 3300041496 Bacteria 942
600 Ga0439448_0307403 3300042005 Unclassified 563
601 Ga0439460_0231489 3300042461 Bacteria 635
602 Ga0439440_0069391 3300042993 Unclassified 915
603 Ga0451576_0015248 3300045051 Bacteria 8521
604 Ga0451576_0124222 3300045051 Bacteria 2689
605 Ga0451576_1318490 3300045051 Unclassified 752
606 Ga0451576_1955606 3300045051 Bacteria 604
607 Ga0495592_0063225 3300046454 Bacteria 2715
608 Ga0495641_0447586 3300046461 Bacteria 588
609 Ga0495651_0123049 3300046462 Bacteria 1903
610 Ga0495580_0304747 3300046472 Bacteria 1084
611 Ga0495605_0447230 3300046474 Unclassified 533
612 Ga0495584_0062242 3300046491 Unclassified 1876
613 Ga0495585_0269736 3300046492 Unclassified 844
614 Ga0495594_0700133 3300046499 Unclassified 573
615 Ga0495618_0310774 3300046514 Bacteria 978
616 Ga0495628_0028925 3300046516 Bacteria 4498
617 Ga0495630_0042529 3300046517 Bacteria 3393
618 Ga0495642_0032398 3300046528 Bacteria 2097
619 Ga0495652_0244626 3300046529 Bacteria 1333
620 Ga0495665_0463095 3300046531 Unclassified 640
621 Ga0495640_0100239 3300046533 Unclassified 1902
622 Ga0495640_0532037 3300046533 Unclassified 713
623 Ga0495587_0039334 3300046536 Unclassified 2831
624 Ga0495587_0325429 3300046536 Unclassified 858
625 Ga0495587_0684561 3300046536 Unclassified 562
626 Ga0495598_0005784 3300046537 Unclassified 2762
627 Ga0495598_0073344 3300046537 Unclassified 1083
628 Ga0495645_0009376 3300046543 Bacteria 6843
629 Ga0495635_0083948 3300046663 Bacteria 2180
630 Ga0495635_0174903 3300046663 Bacteria 1460
631 Ga0495588_0135711 3300046674 Bacteria 1299
632 Ga0495588_0709579 3300046674 Unclassified 526
633 Ga0495657_0607753 3300046675 Unclassified 632
634 Ga0495657_0673079 3300046675 Unclassified 596
635 Ga0495623_0271524 3300046679 Unclassified 947
636 Ga0495646_0136394 3300046680 Bacteria 1376
637 Ga0495647_0320418 3300046681 Bacteria 702
638 Ga0495658_0014481 3300046683 Unclassified 4032
639 Ga0495669_0187601 3300046684 Unclassified 986
640 Ga0495613_0118516 3300046689 Bacteria 1903
641 Ga0495624_0460270 3300046690 Unclassified 762
642 Ga0495581_0828596 3300047315 Unclassified 530
643 Ga0495604_0123689 3300047317 Bacteria 1869
644 Ga0495674_0200532 3300047319 Bacteria 1655
645 Ga0495674_0532536 3300047319 Bacteria 937
646 Ga0495680_0299560 3300047322 Bacteria 1129
647 Ga0495675_0234940 3300047444 Bacteria 1105
648 Ga0495684_0011399 3300047471 Bacteria 6864
649 Ga0495684_0022939 3300047471 Bacteria 4802
650 Ga0495614_0327924 3300048089 Unclassified 711
651 Ga0495615_0240630 3300048090 Unclassified 571
652 Ga0496100_0004939 3300048903 Bacteria 7127
653 Ga0496100_0093464 3300048903 Unclassified 2058
654 Ga0496100_0165659 3300048903 Bacteria 1588
655 Ga0496101_0794728 3300048904 Unclassified 746
656 Ga0496102_0017119 3300048905 Bacteria 6345
657 Ga0496102_0222460 3300048905 Bacteria 1780
658 Ga0496102_0732935 3300048905 Unclassified 911
659 Ga0496102_0899922 3300048905 Unclassified 807
660 Ga0496103_0027269 3300048906 Bacteria 3460
661 Ga0496104_0121066 3300048907 Unclassified 2513
662 Ga0496104_0276491 3300048907 Bacteria 1592
663 Ga0496104_0311461 3300048907 Bacteria 1487
664 Ga0496104_0336327 3300048907 Bacteria 1423
665 Ga0496104_0405945 3300048907 Unclassified 1275
666 Ga0496104_0944262 3300048907 Bacteria 767
667 Ga0496105_0041527 3300048908 Bacteria 3792
668 Ga0496105_0045742 3300048908 Bacteria 3612
669 Ga0496105_0396660 3300048908 Unclassified 1096
670 Ga0496106_0001558 3300048909 Bacteria 17279
671 Ga0496106_0200791 3300048909 Bacteria 1587
672 Ga0496106_0409360 3300048909 Bacteria 1090
673 Ga0496106_1067156 3300048909 Unclassified 634
674 Ga0496107_0000630 3300048910 Bacteria 19818
675 Ga0496107_0274678 3300048910 Bacteria 1254
676 Ga0496108_0024958 3300048911 Unclassified 4924
677 Ga0496108_0188361 3300048911 Unclassified 1788
678 Ga0496108_0573397 3300048911 Unclassified 984
679 Ga0496108_0597035 3300048911 Bacteria 962
680 Ga0496108_0823119 3300048911 Bacteria 800
681 Ga0496108_0886935 3300048911 Unclassified 766
682 Ga0496109_0111804 3300048912 Bacteria 2540
683 Ga0496109_0120243 3300048912 Unclassified 2447
684 Ga0496109_0135211 3300048912 Bacteria 2303
685 Ga0496109_0135291 3300048912 Unclassified 2302
686 Ga0496109_0201599 3300048912 Bacteria 1871
687 Ga0496109_0259525 3300048912 Bacteria 1637
688 Ga0496109_0348984 3300048912 Bacteria 1398
689 Ga0496109_0661114 3300048912 Unclassified 982
690 Ga0496109_0825492 3300048912 Unclassified 865
691 Ga0496111_0090272 3300048914 Bacteria 2245
692 Ga0496111_0232015 3300048914 Bacteria 1371
693 Ga0496111_0271903 3300048914 Unclassified 1257
694 Ga0496112_0027130 3300048915 Bacteria 5520
695 Ga0496112_0111909 3300048915 Unclassified 2700
696 Ga0496112_0165726 3300048915 Bacteria 2176
697 Ga0496112_0177221 3300048915 Bacteria 2096
698 Ga0496112_0205998 3300048915 Bacteria 1925
699 Ga0496112_1302651 3300048915 Unclassified 642
700 Ga0496113_0020424 3300048916 Unclassified 4656
701 Ga0496113_0169308 3300048916 Unclassified 1730
702 Ga0496113_0304211 3300048916 Bacteria 1277
703 Ga0496113_0430406 3300048916 Bacteria 1060
704 Ga0496113_0737339 3300048916 Unclassified 785
705 Ga0496114_0198559 3300048917 Bacteria 1756
706 Ga0496114_0382433 3300048917 Bacteria 1246
707 Ga0496115_0002070 3300048918 Bacteria 14366
708 Ga0496115_0042120 3300048918 Bacteria 3637
709 Ga0496115_0190412 3300048918 Unclassified 1695
710 Ga0496115_0221199 3300048918 Bacteria 1562
711 Ga0496115_0635437 3300048918 Unclassified 845
712 Ga0496115_1134479 3300048918 Unclassified 591
713 Ga0501067_0389276 3300049583 Unclassified 777
714 nmdc:mga05p37_233270_c1 3300050507 Bacteria 2216
715 nmdc:mga09592_46929_c1 3300050508 Bacteria 3639
716 nmdc:mga08y16_355579_c1 3300050511 Bacteria 1504
717 nmdc:mga08y16_71757_c1 3300050511 Bacteria 3608
718 nmdc:mga0n895_1192551_c1 3300050512 Unclassified 735
719 nmdc:mga0n895_125120_c1 3300050512 Bacteria 2594
720 nmdc:mga0n895_1410734_c1 3300050512 Unclassified 665
721 nmdc:mga0n895_246676_c1 3300050512 Bacteria 1812
722 nmdc:mga0n895_510072_c1 3300050512 Bacteria 1211
723 nmdc:mga0n895_591662_c1 3300050512 Unclassified 1112
724 nmdc:mga0n895_680142_c1 3300050512 Bacteria 1026
725 nmdc:mga0rr50_1163825_c1 3300050513 Bacteria 655
726 nmdc:mga0rr50_723767_c1 3300050513 Unclassified 849
727 nmdc:mga0a205_396327_c1 3300050515 Unclassified 1244
728 nmdc:mga0a205_687306_c1 3300050515 Bacteria 873
729 nmdc:mga0a205_776820_c1 3300050515 Bacteria 806
730 Ga0495601_0039602 3300053077 Bacteria 2952
731 Ga0495601_0060690 3300053077 Unclassified 2399
732 Ga0495612_0036635 3300053078 Bacteria 1991
733 Ga0495655_0261648 3300053083 Unclassified 584
734 Ga0495595_0078890 3300053084 Bacteria 1566
735 Ga0065707_10104004
736 CNXas_1000035
737 JGI25406J46586_10070767
738 Ga0058859_11725447
739 Ga0058859_11823994
740 Ga0058860_12116340
741 Ga0058860_12213048
742 Ga0065704_10213269
743 Ga0065712_10011743
744 Ga0065712_10023244
745 Ga0065712_10074607
746 Ga0065712_10076749
747 Ga0065712_10221278
748 Ga0065712_10258147
749 Ga0065712_10284088
750 Ga0065715_10018433
751 Ga0065715_10071293
752 Ga0065715_10089033
753 Ga0065715_10091980
754 Ga0065715_10143173
755 Ga0065715_10182570
756 Ga0065715_10446061
757 Ga0065707_10173538
758 Ga0070676_10007840
759 Ga0070676_10007972
760 Ga0070676_10036383
761 Ga0070676_10039256
762 Ga0070683_100198825
763 Ga0070683_100355238
764 Ga0070683_101233650
765 Ga0070690_100105700
766 Ga0070690_100377813
767 Ga0070690_100446466
768 Ga0070690_100497503
769 Ga0070670_100144986
770 Ga0070670_101115416
771 Ga0070677_10042336
772 Ga0070666_10060833
773 Ga0070666_10086266
774 Ga0070666_10136513
775 Ga0070666_10366201
776 Ga0070682_101009204
777 Ga0068868_100004179
778 Ga0068868_100120666
779 Ga0068868_100382936
780 Ga0068868_101145931
781 Ga0068868_101233475
782 Ga0068868_102346136
783 Ga0070689_100003430
784 Ga0070689_100114699
785 Ga0070689_100304978
786 Ga0070689_100402962
787 Ga0070689_100508652
788 Ga0070689_100703925
789 Ga0070689_100846614
790 Ga0070691_10119166
791 Ga0070687_100120145
792 Ga0070687_100146024
793 Ga0070687_100262742
794 Ga0070687_101089357
795 Ga0070661_100007794
796 Ga0070661_100619270
797 Ga0070661_100969873
798 Ga0070668_100009102
799 Ga0070668_100057268
800 Ga0070668_100071733
801 Ga0070668_100097880
802 Ga0070669_100004185
803 Ga0070669_100026882
804 Ga0070669_100029948
805 Ga0070669_100030435
806 Ga0070669_100037558
807 Ga0070669_100239763
808 Ga0070669_100246446
809 Ga0070669_100712675
810 Ga0070669_100880330
811 Ga0070675_100013126
812 Ga0070675_100029234
813 Ga0070675_100045309
814 Ga0070675_100052409
815 Ga0070675_100054300
816 Ga0070675_100054706
817 Ga0070675_100062835
818 Ga0070675_100066348
819 Ga0070675_100084269
820 Ga0070675_100295895
821 Ga0070675_100551765
822 Ga0070675_100626995
823 Ga0070671_100005632
824 Ga0070671_100007851
825 Ga0070671_100012342
826 Ga0070671_100051625
827 Ga0070671_100107751
828 Ga0070671_100223398
829 Ga0070671_100535086
830 Ga0070674_100001540
831 Ga0070674_100018937
832 Ga0070674_100070468
833 Ga0070674_100828964
834 Ga0070673_100007445
835 Ga0070673_100007726
836 Ga0070673_100283871
837 Ga0070673_101106465
838 Ga0070673_101869047
839 Ga0070673_101895839
840 Ga0070688_100022457
841 Ga0070688_100063772
842 Ga0070688_100127076
843 Ga0070688_100242841
844 Ga0070688_100249159
845 Ga0070688_100633744
846 Ga0070688_100761139
847 Ga0070659_100280889
848 Ga0070659_100784721
849 Ga0070667_100025411
850 Ga0070667_100030186
851 Ga0070667_100155127
852 Ga0070667_100229623
853 Ga0070667_100944112
854 Ga0070667_102051101
855 Ga0070709_10096259
856 Ga0070709_10390072
857 Ga0070709_10822462
858 Ga0070714_101004597
859 Ga0070714_101680289
860 Ga0070713_100052026
861 Ga0070713_100475835
862 Ga0070713_100873617
863 Ga0070713_101505169
864 Ga0070710_10134620
865 Ga0070710_10821190
866 Ga0070710_10894578
867 Ga0070701_10046646
868 Ga0070701_10197116
869 Ga0070711_100013511
870 Ga0070711_100113978
871 Ga0070711_100116825
872 Ga0070711_100450364
873 Ga0070711_101297823
874 Ga0070705_100036402
875 Ga0070705_100078310
876 Ga0070705_100279866
877 Ga0070694_100067438
878 Ga0070694_100736308
879 Ga0070708_100044889
880 Ga0070708_100052277
881 Ga0070708_100059499
882 Ga0070708_100424089
883 Ga0070708_100442394
884 Ga0070708_100461248
885 Ga0070708_100524792
886 Ga0070708_101230762
887 Ga0070663_100212697
888 Ga0070663_100312114
889 Ga0070663_101184005
890 Ga0070678_100006233
891 Ga0070678_100177757
892 Ga0070678_100241188
893 Ga0070678_100740815
894 Ga0070678_100919617
895 Ga0070662_100110904
896 Ga0070662_100421756
897 Ga0070681_10398028
898 Ga0068867_100054744
899 Ga0068867_100116101
900 Ga0068867_100584533
901 Ga0070685_10021980
902 Ga0070685_10213200
903 Ga0070685_11300438
904 Ga0070706_100001379
905 Ga0070706_100008961
906 Ga0070706_100061580
907 Ga0070706_100137959
908 Ga0070706_100149860
909 Ga0070706_100177366
910 Ga0070706_100232172
911 Ga0070706_100317705
912 Ga0070706_100427444
913 Ga0070707_100004173
914 Ga0070707_100068799
915 Ga0070707_100080983
916 Ga0070707_100119221
917 Ga0070707_100128719
918 Ga0070707_100136522
919 Ga0070707_100169482
920 Ga0070707_100193064
921 Ga0070707_100590556
922 Ga0070707_100768724
923 Ga0070707_101344248
924 Ga0070698_100002085
925 Ga0070698_100034756
926 Ga0070698_100375645
927 Ga0070699_100210729
928 Ga0070699_100542791
929 Ga0070699_101713296
930 Ga0070679_100053130
931 Ga0070679_100697245
932 Ga0070684_100588381
933 Ga0070697_100009582
934 Ga0070697_100092469
935 Ga0070697_100202969
936 Ga0070697_100305620
937 Ga0070697_100373876
938 Ga0070697_100505840
939 Ga0070697_100770321
940 Ga0070697_101445788
941 Ga0070672_100001416
942 Ga0070672_100005924
943 Ga0070672_100031846
944 Ga0070672_100273430
945 Ga0070672_100389517
946 Ga0070672_100674051
947 Ga0070672_100758606
948 Ga0070686_100087881
949 Ga0070686_100109931
950 Ga0070695_100091611
951 Ga0070696_101691643
952 Ga0070693_100110272
953 Ga0070665_100011639
954 Ga0070665_100068808
955 Ga0070704_100341485
956 Ga0070704_100349166
957 Ga0070704_100722282
958 Ga0068855_100234275
959 Ga0070664_100026517
960 Ga0068857_100074607
961 Ga0068856_100647365
962 Ga0070702_100370539
963 Ga0068852_101079466
964 Ga0068859_100124696
965 Ga0068859_100832985
966 Ga0068859_100973854
967 Ga0068864_100177739
968 Ga0068864_100596889
969 Ga0068863_100045679
970 Ga0068863_100551481
971 Ga0068863_100760737
972 Ga0068858_100366301
973 Ga0068860_100057008
974 Ga0068860_100161412
975 Ga0068862_100022542
976 Ga0068862_101240529
977 Ga0081455_10001048
978 Ga0081455_10004623
979 Ga0081455_10099970
980 Ga0081455_10160367
981 Ga0081538_10179140
982 Ga0081539_10009376
983 Ga0081539_10014820
984 Ga0081539_10135056
985 Ga0070717_10047925
986 Ga0070717_10080586
987 Ga0070717_10194342
988 Ga0070717_10273511
989 Ga0070717_10834533
990 Ga0070717_10931669
991 Ga0070716_100052165
992 Ga0070716_100122568
993 Ga0070716_100252653
994 Ga0070716_100260848
995 Ga0070712_100021497
996 Ga0070712_100028477
997 Ga0070712_100036388
998 Ga0070712_100862023
999 Ga0097621_100057075
1000 Ga0097621_100073802
1001 Ga0097621_100086798
1002 Ga0097621_100854047
1003 Ga0097621_101418993
1004 Ga0097621_101468897
1005 Ga0068871_100033180
1006 Ga0068871_100193347
1007 Ga0068871_101003072
1008 Ga0068871_102195904
1009 Ga0075431_100743738
1010 Ga0075433_10404793
1011 Ga0075433_10723016
1012 Ga0075433_10741960
1013 Ga0075433_10968922
1014 Ga0075433_11121625
1015 Ga0075434_100289902
1016 Ga0075434_100310626
1017 Ga0075429_100058520
1018 Ga0068865_100037254
1019 Ga0068865_100177918
1020 Ga0068865_100571969
1021 Ga0068865_101443306
1022 Ga0075436_101128411
1023 Ga0097620_100124696
1024 Ga0097620_100833041
1025 Ga0097620_100973835
1026 Ga0075435_100504874
1027 Ga0099794_10265086
1028 Ga0099795_10021719
1029 Ga0105240_10043073
1030 Ga0111539_10066481
1031 Ga0111539_10319593
1032 Ga0111539_11114347
1033 Ga0105245_10207079
1034 Ga0105245_10289148
1035 Ga0105245_10380507
1036 Ga0105245_11774330
1037 Ga0105247_10273730
1038 Ga0105247_11484187
1039 Ga0114129_10688962
1040 Ga0114129_12263741
1041 Ga0105243_10952531
1042 Ga0105243_11653380
1043 Ga0105242_10016354
1044 Ga0105242_10724793
1045 Ga0105248_11770627
1046 Ga0105237_12540584
1047 Ga0105249_10104362
1048 Ga0105249_10134123
1049 Ga0105249_10563502
1050 Ga0099796_10062601
1051 Ga0099796_10207333
1052 Ga0105239_10750927
1053 Ga0105239_11064124
1054 Ga0105246_10271503
1055 Ga0105246_10564931
1056 Ga0105246_10733122
1057 Ga0157327_1005016
1058 Ga0157373_10300110
1059 Ga0157371_10217836
1060 Ga0157371_10578900
1061 Ga0157369_10081997
1062 Ga0157374_10027527
1063 Ga0157374_10067256
1064 Ga0157374_10562934
1065 Ga0157374_10917111
1066 Ga0157374_10921598
1067 Ga0157374_10925173
1068 Ga0157378_10093098
1069 Ga0157378_10139516
1070 Ga0157378_10231231
1071 Ga0157378_10265578
1072 Ga0157378_10512278
1073 Ga0157378_10525354
1074 Ga0163162_10008441
1075 Ga0163162_10074734
1076 Ga0163162_10323815
1077 Ga0163162_11126350
1078 Ga0157372_10046221
1079 Ga0157375_10626787
1080 Ga0157375_10858176
1081 Ga0157375_11192922
1082 Ga0157375_11420124
1083 Ga0157375_12321708
1084 Ga0163163_10043723
1085 Ga0163163_10346127
1086 Ga0157377_10337997
1087 Ga0157377_11106241
1088 Ga0157379_10306299
1089 Ga0157376_10010573
1090 Ga0157376_10012911
1091 Ga0157376_10398107
1092 Ga0163161_10077875
1093 Ga0163161_10279342
1094 Ga0213876_10280791
1095 Ga0207666_1002170
1096 Ga0207673_1018121
1097 Ga0207673_1025647
1098 Ga0207697_10000679
1099 Ga0207697_10002209
1100 Ga0207697_10003835
1101 Ga0207697_10007607
1102 Ga0207697_10008729
1103 Ga0207697_10059771
1104 Ga0207697_10229031
1105 Ga0207697_10263055
1106 Ga0207653_10039455
1107 Ga0207692_10028743
1108 Ga0207692_10071243
1109 Ga0207692_10616299
1110 Ga0207688_10086497
1111 Ga0207680_10307906
1112 Ga0207647_10352918
1113 Ga0207685_10034904
1114 Ga0207685_10059346
1115 Ga0207699_10001758
1116 Ga0207699_10272267
1117 Ga0207645_10005310
1118 Ga0207645_10011337
1119 Ga0207645_10064096
1120 Ga0207645_10104846
1121 Ga0207645_10186339
1122 Ga0207684_10000086
1123 Ga0207684_10060040
1124 Ga0207684_10069614
1125 Ga0207684_10099654
1126 Ga0207684_10099827
1127 Ga0207684_10158096
1128 Ga0207684_10321476
1129 Ga0207684_10674918
1130 Ga0207684_10743898
1131 Ga0207684_10777291
1132 Ga0207684_10863660
1133 Ga0207684_10987010
1134 Ga0207684_11061225
1135 Ga0207695_10120664
1136 Ga0207693_10003406
1137 Ga0207693_10015874
1138 Ga0207693_10059210
1139 Ga0207693_10162126
1140 Ga0207693_10380183
1141 Ga0207663_10001152
1142 Ga0207663_10045470
1143 Ga0207663_10223817
1144 Ga0207663_10591190
1145 Ga0207663_10645075
1146 Ga0207660_10077368
1147 Ga0207660_11059918
1148 Ga0207662_10061868
1149 Ga0207662_10373834
1150 Ga0207662_10591055
1151 Ga0207657_10093577
1152 Ga0207657_10140116
1153 Ga0207649_10530413
1154 Ga0207649_11197824
1155 Ga0207652_11185675
1156 Ga0207646_10001262
1157 Ga0207646_10024073
1158 Ga0207646_10075993
1159 Ga0207646_10108924
1160 Ga0207646_10228812
1161 Ga0207646_10272148
1162 Ga0207646_10295745
1163 Ga0207646_10355530
1164 Ga0207646_10396560
1165 Ga0207646_11024139
1166 Ga0207646_11152318
1167 Ga0207681_10015904
1168 Ga0207681_10017170
1169 Ga0207681_10066286
1170 Ga0207681_10145273
1171 Ga0207681_10258583
1172 Ga0207681_10285198
1173 Ga0207681_10375441
1174 Ga0207681_10609008
1175 Ga0207650_10033526
1176 Ga0207650_10056815
1177 Ga0207650_10252921
1178 Ga0207659_10015262
1179 Ga0207659_10053831
1180 Ga0207659_10141267
1181 Ga0207659_10182336
1182 Ga0207659_10387454
1183 Ga0207659_10495172
1184 Ga0207659_10529735
1185 Ga0207659_10555543
1186 Ga0207687_10295408
1187 Ga0207687_10573008
1188 Ga0207700_10300875
1189 Ga0207700_10401299
1190 Ga0207700_10780115
1191 Ga0207664_10043897
1192 Ga0207664_10530882
1193 Ga0207644_10049703
1194 Ga0207644_10064299
1195 Ga0207644_10095941
1196 Ga0207644_10225276
1197 Ga0207644_10564493
1198 Ga0207644_10605168
1199 Ga0207644_10881616
1200 Ga0207690_10680525
1201 Ga0207706_10033865
1202 Ga0207706_10044828
1203 Ga0207706_10137721
1204 Ga0207706_10150702
1205 Ga0207706_10542343
1206 Ga0207686_10079339
1207 Ga0207686_10206736
1208 Ga0207686_10825820
1209 Ga0207670_10006062
1210 Ga0207670_10006434
1211 Ga0207670_10061632
1212 Ga0207670_10133522
1213 Ga0207670_10236143
1214 Ga0207670_10261007
1215 Ga0207670_10270083
1216 Ga0207670_10598137
1217 Ga0207670_10631377
1218 Ga0207669_10275910
1219 Ga0207669_10339427
1220 Ga0207669_11622771
1221 Ga0207704_10027035
1222 Ga0207704_10453332
1223 Ga0207704_11381021
1224 Ga0207665_10010731
1225 Ga0207665_10276800
1226 Ga0207665_10326852
1227 Ga0207665_10501938
1228 Ga0207665_10625596
1229 Ga0207665_10948200
1230 Ga0207691_10000719
1231 Ga0207691_10017195
1232 Ga0207691_10022592
1233 Ga0207691_10340691
1234 Ga0207691_10575501
1235 Ga0207661_10812323
1236 Ga0207661_11155706
1237 Ga0207679_10330122
1238 Ga0207667_10255974
1239 Ga0207667_11567322
1240 Ga0207651_10141423
1241 Ga0207651_10234966
1242 Ga0207651_10270840
1243 Ga0207651_10887358
1244 Ga0207712_10237321
1245 Ga0207712_10247045
1246 Ga0207712_10827353
1247 Ga0207668_10004172
1248 Ga0207668_10022371
1249 Ga0207668_10028962
1250 Ga0207668_10080632
1251 Ga0207668_10088370
1252 Ga0207668_10234263
1253 Ga0207658_10039238
1254 Ga0207658_10055995
1255 Ga0207658_10198406
1256 Ga0207658_10798520
1257 Ga0207677_10047616
1258 Ga0207677_10097845
1259 Ga0207677_10115832
1260 Ga0207677_10427377
1261 Ga0207703_10129061
1262 Ga0207678_10121629
1263 Ga0207678_10820324
1264 Ga0207678_10905300
1265 Ga0207708_10180915
1266 Ga0207702_10633269
1267 Ga0207641_10471529
1268 Ga0207641_10649116
1269 Ga0207641_10850645
1270 Ga0207648_10011257
1271 Ga0207676_10148207
1272 Ga0207676_10586878
1273 Ga0207676_10832364
1274 Ga0207676_11851641
1275 Ga0207675_100959478
1276 Ga0207675_101092890
1277 Ga0207683_10009248
1278 Ga0207683_10026693
1279 Ga0207683_10053716
1280 Ga0207683_10058487
1281 Ga0207428_10331386
1282 Ga0268266_10038125
1283 Ga0268266_10076790
1284 Ga0268266_10189271
1285 Ga0268265_10141945
1286 Ga0268264_10166746
1287 Ga0268264_10232775
1288 Ga0373926_0226927
1289 Ga0373952_0081981
1290 Ga0373923_0512113
1291 Ga0373954_0392244
1292 Ga0373956_0194164
1293 Ga0373943_0412008
1294 Ga0373946_0029543
1295 Ga0373946_0098734
1296 Ga0373946_0426427
1297 Ga0373955_0112259
1298 Ga0373955_0121016
1299 Ga0373962_0407579
1300 Ga0373931_1033868
1301 Ga0373935_0245296
1302 Ga0373927_0257101
1303 Ga0373927_0726599
1304 Ga0373947_0050404
1305 Ga0373947_0144704
1306 Ga0373947_0496927
1307 Ga0373947_0622079
1308 Ga0373947_0787880
1309 Ga0373937_0153373
1310 Ga0373937_0457271
1311 Ga0373937_0495282
1312 Ga0373937_0495709
1313 Ga0373925_0084161
1314 Ga0373925_0086125
1315 Ga0373925_0129868
1316 Ga0373925_0271909
1317 Ga0373925_0798246
1318 Ga0395899_0022997
1319 Ga0395900_0143341
1320 Ga0395898_0112819
1321 Ga0395898_0944862
1322 Ga0395905_0239129
1323 Ga0395905_0359391
1324 Ga0395905_1537376
1325 Ga0395901_0023615
1326 Ga0395901_0082500
1327 Ga0395901_0154196
1328 Ga0436365_1851055
1329 Ga0451793_0313413
1330 Ga0451802_1059119
1331 Ga0451802_1261066
1332 Ga0451835_0470488
1333 Ga0451839_0788197
1334 Ga0439448_0307403
1335 Ga0439460_0231489
1336 Ga0439440_0069391
1337 Ga0451576_0015248
1338 Ga0451576_0124222
1339 Ga0451576_1318490
1340 Ga0451576_1955606
1341 Ga0495592_0063225
1342 Ga0495641_0447586
1343 Ga0495651_0123049
1344 Ga0495580_0304747
1345 Ga0495605_0447230
1346 Ga0495584_0062242
1347 Ga0495585_0269736
1348 Ga0495594_0700133
1349 Ga0495618_0310774
1350 Ga0495628_0028925
1351 Ga0495630_0042529
1352 Ga0495642_0032398
1353 Ga0495652_0244626
1354 Ga0495665_0463095
1355 Ga0495640_0100239
1356 Ga0495640_0532037
1357 Ga0495587_0039334
1358 Ga0495587_0325429
1359 Ga0495587_0684561
1360 Ga0495598_0005784
1361 Ga0495598_0073344
1362 Ga0495645_0009376
1363 Ga0495635_0083948
1364 Ga0495635_0174903
1365 Ga0495588_0135711
1366 Ga0495588_0709579
1367 Ga0495657_0607753
1368 Ga0495657_0673079
1369 Ga0495623_0271524
1370 Ga0495646_0136394
1371 Ga0495647_0320418
1372 Ga0495658_0014481
1373 Ga0495669_0187601
1374 Ga0495613_0118516
1375 Ga0495624_0460270
1376 Ga0495581_0828596
1377 Ga0495604_0123689
1378 Ga0495674_0200532
1379 Ga0495674_0532536
1380 Ga0495680_0299560
1381 Ga0495675_0234940
1382 Ga0495684_0011399
1383 Ga0495684_0022939
1384 Ga0495614_0327924
1385 Ga0495615_0240630
1386 Ga0496100_0004939
1387 Ga0496100_0093464
1388 Ga0496100_0165659
1389 Ga0496101_0794728
1390 Ga0496102_0017119
1391 Ga0496102_0222460
1392 Ga0496102_0732935
1393 Ga0496102_0899922
1394 Ga0496103_0027269
1395 Ga0496104_0121066
1396 Ga0496104_0276491
1397 Ga0496104_0311461
1398 Ga0496104_0336327
1399 Ga0496104_0405945
1400 Ga0496104_0944262
1401 Ga0496105_0041527
1402 Ga0496105_0045742
1403 Ga0496105_0396660
1404 Ga0496106_0001558
1405 Ga0496106_0200791
1406 Ga0496106_0409360
1407 Ga0496106_1067156
1408 Ga0496107_0000630
1409 Ga0496107_0274678
1410 Ga0496108_0024958
1411 Ga0496108_0188361
1412 Ga0496108_0573397
1413 Ga0496108_0597035
1414 Ga0496108_0823119
1415 Ga0496108_0886935
1416 Ga0496109_0111804
1417 Ga0496109_0120243
1418 Ga0496109_0135211
1419 Ga0496109_0135291
1420 Ga0496109_0201599
1421 Ga0496109_0259525
1422 Ga0496109_0348984
1423 Ga0496109_0661114
1424 Ga0496109_0825492
1425 Ga0496111_0090272
1426 Ga0496111_0232015
1427 Ga0496111_0271903
1428 Ga0496112_0027130
1429 Ga0496112_0111909
1430 Ga0496112_0165726
1431 Ga0496112_0177221
1432 Ga0496112_0205998
1433 Ga0496112_1302651
1434 Ga0496113_0020424
1435 Ga0496113_0169308
1436 Ga0496113_0304211
1437 Ga0496113_0430406
1438 Ga0496113_0737339
1439 Ga0496114_0198559
1440 Ga0496114_0382433
1441 Ga0496115_0002070
1442 Ga0496115_0042120
1443 Ga0496115_0190412
1444 Ga0496115_0221199
1445 Ga0496115_0635437
1446 Ga0496115_1134479
1447 Ga0501067_0389276
1448 nmdc:mga05p37_233270_c1
1449 nmdc:mga09592_46929_c1
1450 nmdc:mga08y16_355579_c1
1451 nmdc:mga08y16_71757_c1
1452 nmdc:mga0n895_1192551_c1
1453 nmdc:mga0n895_125120_c1
1454 nmdc:mga0n895_1410734_c1
1455 nmdc:mga0n895_246676_c1
1456 nmdc:mga0n895_510072_c1
1457 nmdc:mga0n895_591662_c1
1458 nmdc:mga0n895_680142_c1
1459 nmdc:mga0rr50_1163825_c1
1460 nmdc:mga0rr50_723767_c1
1461 nmdc:mga0a205_396327_c1
1462 nmdc:mga0a205_687306_c1
1463 nmdc:mga0a205_776820_c1
1464 Ga0495601_0039602
1465 Ga0495601_0060690
1466 Ga0495612_0036635
1467 Ga0495655_0261648
1468 Ga0495595_0078890

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3omd-assembly2.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.6212 3 140
3omd-assembly2.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.5714 3 140
1wxp-assembly1.cif.gz_A solution structure of the death domain of nuclear matrix protein p84 0.3527 13 128
2ib1-assembly1.cif.gz_A solution structure of p45 death domain 0.343 19 125
2ib1-assembly1.cif.gz_A solution structure of p45 death domain 0.3362 19 125
ID Description Score Start End Superfamily
1f5sA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Phosphoserine phosphatase; domain 2 0.531 44 99 1.10.150.210
1f5sA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Phosphoserine phosphatase; domain 2 0.4956 44 99 1.10.150.210
af_E7FE32_509_638_1.10.472.80 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Ypt/Rab-GAP domain of gyp1p, domain 3 0.4952 48 100 1.10.472.80
4d8oA04 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.489 15 106 1.10.533.10
4d8oA04 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.4844 15 106 1.10.533.10
ID Description Score Start End GO Terms
AF-A0A2V5X2K0-F1-model_v4 DUF5069 domain-containing protein 0.959 1 97
AF-A0A2V5X2K0-F1-model_v4 DUF5069 domain-containing protein 0.9402 1 97
AF-A0A836U914-F1-model_v4 DUF5069 domain-containing protein 0.9205 3 72
AF-A0A832ESU0-F1-model_v4 DUF5069 domain-containing protein 0.9129 1 83
AF-A0A836U914-F1-model_v4 DUF5069 domain-containing protein 0.8966 3 72

Map