F478052

General Info

Members Datasets Scaffolds Average Seq Length
732 451 1464 373

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0075330|Ga0496115_0075330_878_2185
Length 414
Sequence LRVNRNVDGHGAVDNHRNVYDDRDLDVFHFLLTRLTGDGDSMRRKIIIAAVSFVIIAGGVGAFASMRATVAEHDVPIYLTGVGTVIAYNTVVVHSQIQGQLVSINFTEGQAVHTGDLLAQIDPRPYQAQVEQLTANRDRDQAQLTNAIANLNRYTPLEQKGYATPQLLQTQQAQVSQLQNAIKSDQALIDAANVQLSYTRLTSPIDGIAGIRQLDIGNIIHPTDANGLVVVTQIHPISLIFTLPETELPQIQQQQEKTKAPLTVIAYSQDNKIELDQGVLGLVNNEILQTTGSIQLKANSPNKTNRLWPGELVNARLLVDTRHNGLTVPAGAVQQGPNGAYSYVIKPDSSVEVRPVKVAQTSEGQSLIDSGLQANEQVVVDGQYKLKPGAQVAVLHGKAAQEAAAQSAEQAPIP

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
274 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
282 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
283 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
284 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
287 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
288 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
289 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
294 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
295 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
296 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
297 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
298 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
299 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
300 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
301 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
302 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
303 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
304 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
305 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
306 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
307 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
308 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
309 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
310 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
311 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
312 2791355199
313 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
314 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
315 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
316 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
317 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
318 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
319 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
320 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
321 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
322 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
323 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
324 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
325 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
326 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
327 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
328 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
329 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
330 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
331 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
332 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
333 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
334 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
335 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
336 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
337 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
338 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
339 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
340 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
341 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
342 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
343 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
344 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
345 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
346 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
347 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
348 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
349 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
350 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
351 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
352 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
353 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
354 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
355 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
356 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
357 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
358 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
359 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
360 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
361 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
362 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
363 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
364 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
365 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
366 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
367 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
368 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
369 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
370 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
371 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
372 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
373 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
374 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
375 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
376 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
377 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
378 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
379 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
380 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
381 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
382 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
383 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
384 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
385 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
386 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
387 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
388 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
389 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
390 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
391 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
392 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
393 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
394 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
395 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
396 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
397 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
398 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
399 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
400 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
401 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
402 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
403 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
404 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
405 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
406 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
407 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
408 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
409 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
410 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
411 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
412 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
413 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
414 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
415 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
416 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
417 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
418 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
419 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
420 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
421 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
422 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
423 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
424 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
425 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
426 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
427 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
428 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
429 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
430 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
431 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
432 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
433 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
434 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
435 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
436 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
437 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
438 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
439 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
440 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
441 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
442 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
443 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
444 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
445 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
446 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
447 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
448 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
449 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
450 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
451 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.92
Metatranscriptomes 0.14
Isolates 23.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.89
Nodule 18.72
Rhizoplane 3.69
Rhizosphere 53.83
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0075330 3300048918 Bacteria 2741
2 CNAas_1001604 3300000532 Bacteria 1846
3 JGI25153J46596_10000288 3300003215 Bacteria 38391
4 JGI25153J46596_10000483 3300003215 Bacteria 25554
5 JGI25153J46596_10000912 3300003215 Bacteria 17961
6 JGI25153J46596_10001506 3300003215 Bacteria 13886
7 JGI25153J46596_10001586 3300003215 Bacteria 13473
8 JGI25153J46596_10001963 3300003215 Bacteria 12198
9 JGI25160J50197_1000413 3300003354 Bacteria 27195
10 JGI25160J50197_1001806 3300003354 Bacteria 10328
11 JGI25404J52841_10000205 3300003659 Bacteria 7120
12 JGI25404J52841_10010408 3300003659 Bacteria 2000
13 JGI25404J52841_10013508 3300003659 Bacteria 1771
14 Ga0055539_1005156 3300003752 Bacteria 1707
15 Ga0055531_10012320 3300003794 Bacteria 4035
16 Ga0065165_1000342 3300005262 Bacteria 76302
17 Ga0065165_1006645 3300005262 Bacteria 5975
18 Ga0065704_10140706 3300005289 Bacteria 1521
19 Ga0065715_10001703 3300005293 Bacteria 5952
20 Ga0065707_10016994 3300005295 Bacteria 1797
21 Ga0070658_10018856 3300005327 Bacteria 5527
22 Ga0068869_100003558 3300005334 Bacteria 9557
23 Ga0068869_100042182 3300005334 Bacteria 3270
24 Ga0070682_100031621 3300005337 Bacteria 3202
25 Ga0070682_100110139 3300005337 Bacteria 1834
26 Ga0068868_100089122 3300005338 Bacteria 2483
27 Ga0070689_100070251 3300005340 Bacteria 2733
28 Ga0070691_10018531 3300005341 Bacteria 3210
29 Ga0070668_100020486 3300005347 Bacteria 4991
30 Ga0070668_100023188 3300005347 Bacteria 4693
31 Ga0070668_100053069 3300005347 Bacteria 3126
32 Ga0070668_100112145 3300005347 Bacteria 2171
33 Ga0070669_100001434 3300005353 Bacteria 17247
34 Ga0070675_100307231 3300005354 Bacteria 1398
35 Ga0070671_100057356 3300005355 Bacteria 3240
36 Ga0070674_100141676 3300005356 Bacteria 1805
37 Ga0070673_100373731 3300005364 Bacteria 1269
38 Ga0070659_100156725 3300005366 Bacteria 1860
39 Ga0070667_100009511 3300005367 Bacteria 8060
40 Ga0070667_100351286 3300005367 Bacteria 1335
41 Ga0070709_10033314 3300005434 Bacteria 3114
42 Ga0070714_100033979 3300005435 Bacteria 4269
43 Ga0070714_100092937 3300005435 Bacteria 2645
44 Ga0070713_100150664 3300005436 Bacteria 2069
45 Ga0070713_100175591 3300005436 Bacteria 1922
46 Ga0070710_10002899 3300005437 Bacteria 8165
47 Ga0070710_10055637 3300005437 Bacteria 2236
48 Ga0070710_10096668 3300005437 Bacteria 1751
49 Ga0070711_100008672 3300005439 Bacteria 6239
50 Ga0070711_100038316 3300005439 Bacteria 3223
51 Ga0070711_100043821 3300005439 Bacteria 3033
52 Ga0070711_100074234 3300005439 Bacteria 2405
53 Ga0070711_100096189 3300005439 Bacteria 2145
54 Ga0070711_100288852 3300005439 Bacteria 1300
55 Ga0070700_100047395 3300005441 Bacteria 2659
56 Ga0070694_100012064 3300005444 Bacteria 5366
57 Ga0070663_100003069 3300005455 Bacteria 9550
58 Ga0070663_100006379 3300005455 Bacteria 7088
59 Ga0070663_100025905 3300005455 Bacteria 3964
60 Ga0070663_100144252 3300005455 Bacteria 1820
61 Ga0070678_100080606 3300005456 Bacteria 2465
62 Ga0070678_100207550 3300005456 Bacteria 1621
63 Ga0070662_100029456 3300005457 Bacteria 3831
64 Ga0068867_100125340 3300005459 Bacteria 1990
65 Ga0070706_100093913 3300005467 Bacteria 2783
66 Ga0070698_100000373 3300005471 Bacteria 46692
67 Ga0070698_100094727 3300005471 Bacteria 2964
68 Ga0070699_100011652 3300005518 Bacteria 7589
69 Ga0070699_100018770 3300005518 Bacteria 5940
70 Ga0070699_100182703 3300005518 Bacteria 1861
71 Ga0070699_100389103 3300005518 Bacteria 1260
72 Ga0070697_100013409 3300005536 Bacteria 6429
73 Ga0070697_100069049 3300005536 Bacteria 2894
74 Ga0070697_100154624 3300005536 Bacteria 1935
75 Ga0070697_100345431 3300005536 Bacteria 1285
76 Ga0068853_100215198 3300005539 Bacteria 1753
77 Ga0068853_100223636 3300005539 Bacteria 1720
78 Ga0070696_100025911 3300005546 Bacteria 3988
79 Ga0070665_100002914 3300005548 Bacteria 18491
80 Ga0070665_100006487 3300005548 Bacteria 11901
81 Ga0070665_100024100 3300005548 Bacteria 6128
82 Ga0070665_100179991 3300005548 Bacteria 2115
83 Ga0070665_100182195 3300005548 Bacteria 2101
84 Ga0070704_100020603 3300005549 Bacteria 4256
85 Ga0068855_100070455 3300005563 Bacteria 4067
86 Ga0068856_100018995 3300005614 Bacteria 6669
87 Ga0068852_100130956 3300005616 Bacteria 2310
88 Ga0068864_100091296 3300005618 Bacteria 2686
89 Ga0068864_100190673 3300005618 Bacteria 1879
90 Ga0068861_100002985 3300005719 Bacteria 11163
91 Ga0068863_100178915 3300005841 Bacteria 2036
92 Ga0068860_100029070 3300005843 Bacteria 5317
93 Ga0068862_100029695 3300005844 Bacteria 4607
94 Ga0068862_100149351 3300005844 Bacteria 2079
95 Ga0068862_100188168 3300005844 Bacteria 1856
96 Ga0081455_10000165 3300005937 Bacteria 81987
97 Ga0081455_10000715 3300005937 Bacteria 43119
98 Ga0081455_10010592 3300005937 Bacteria 9331
99 Ga0081455_10043485 3300005937 Bacteria 3928
100 Ga0081455_10074473 3300005937 Bacteria 2804
101 Ga0081540_1000002 3300005983 Bacteria 251149
102 Ga0081540_1000021 3300005983 Bacteria 161624
103 Ga0081540_1000787 3300005983 Bacteria 29106
104 Ga0081540_1001470 3300005983 Bacteria 20340
105 Ga0081540_1002212 3300005983 Bacteria 16044
106 Ga0081540_1002285 3300005983 Bacteria 15735
107 Ga0081540_1002452 3300005983 Bacteria 15103
108 Ga0081540_1003224 3300005983 Bacteria 13002
109 Ga0081540_1003472 3300005983 Bacteria 12439
110 Ga0081540_1006015 3300005983 Bacteria 8929
111 Ga0081540_1011193 3300005983 Bacteria 6017
112 Ga0081540_1016727 3300005983 Bacteria 4573
113 Ga0081540_1025480 3300005983 Bacteria 3401
114 Ga0081540_1044147 3300005983 Bacteria 2278
115 Ga0081540_1067943 3300005983 Bacteria 1662
116 Ga0070717_10001164 3300006028 Bacteria 17767
117 Ga0070717_10024876 3300006028 Bacteria 4757
118 Ga0070717_10165456 3300006028 Bacteria 1921
119 Ga0070717_10198724 3300006028 Bacteria 1755
120 Ga0075365_10002250 3300006038 Bacteria 9352
121 Ga0075365_10005374 3300006038 Bacteria 6901
122 Ga0075365_10038349 3300006038 Bacteria 3114
123 Ga0075365_10122771 3300006038 Bacteria 1793
124 Ga0075365_10137808 3300006038 Bacteria 1692
125 Ga0075363_100005934 3300006048 Bacteria 5505
126 Ga0075363_100123712 3300006048 Bacteria 1446
127 Ga0075364_10045672 3300006051 Bacteria 2851
128 Ga0075364_10067396 3300006051 Bacteria 2352
129 Ga0070715_10035799 3300006163 Bacteria 2044
130 Ga0070716_100059836 3300006173 Bacteria 2197
131 Ga0070716_100126585 3300006173 Bacteria 1608
132 Ga0070712_100009376 3300006175 Bacteria 6166
133 Ga0070712_100010060 3300006175 Bacteria 5961
134 Ga0070712_100020675 3300006175 Bacteria 4310
135 Ga0070712_100048398 3300006175 Bacteria 2947
136 Ga0070712_100056649 3300006175 Bacteria 2750
137 Ga0075362_10001097 3300006177 Bacteria 8406
138 Ga0075362_10087247 3300006177 Bacteria 1445
139 Ga0075367_10001540 3300006178 Bacteria 9968
140 Ga0075367_10001959 3300006178 Bacteria 9156
141 Ga0075369_10000106 3300006186 Bacteria 22440
142 Ga0075369_10040648 3300006186 Bacteria 1988
143 Ga0075366_10004804 3300006195 Bacteria 7288
144 Ga0075366_10109445 3300006195 Bacteria 1661
145 Ga0075370_10003315 3300006353 Bacteria 7647
146 Ga0075370_10007764 3300006353 Bacteria 5480
147 Ga0075370_10024530 3300006353 Bacteria 3332
148 Ga0075370_10026246 3300006353 Bacteria 3226
149 Ga0075370_10045416 3300006353 Bacteria 2485
150 Ga0075428_100001568 3300006844 Bacteria 24492
151 Ga0075428_100064438 3300006844 Bacteria 4013
152 Ga0075428_100064532 3300006844 Bacteria 4010
153 Ga0075428_100072013 3300006844 Bacteria 3777
154 Ga0075430_100009419 3300006846 Bacteria 8253
155 Ga0075430_100011000 3300006846 Bacteria 7666
156 Ga0075430_100014903 3300006846 Bacteria 6621
157 Ga0075430_100040472 3300006846 Bacteria 3945
158 Ga0075431_100000110 3300006847 Bacteria 52121
159 Ga0075431_100064670 3300006847 Bacteria 3777
160 Ga0075431_100085094 3300006847 Bacteria 3264
161 Ga0075431_100145708 3300006847 Bacteria 2440
162 Ga0075433_10001538 3300006852 Bacteria 17045
163 Ga0075434_100002679 3300006871 Bacteria 15731
164 Ga0075434_100013294 3300006871 Bacteria 7828
165 Ga0075434_100290929 3300006871 Bacteria 1654
166 Ga0075429_100010965 3300006880 Bacteria 7842
167 Ga0075429_100046476 3300006880 Bacteria 3777
168 Ga0075436_100000863 3300006914 Bacteria 20151
169 Ga0075436_100249452 3300006914 Bacteria 1264
170 Ga0075435_100103087 3300007076 Bacteria 2366
171 Ga0075435_100208044 3300007076 Bacteria 1659
172 Ga0099794_10000628 3300007265 Bacteria 11768
173 Ga0099794_10010403 3300007265 Bacteria 3949
174 Ga0099794_10016490 3300007265 Bacteria 3276
175 Ga0111539_10000570 3300009094 Bacteria 47255
176 Ga0111539_10073473 3300009094 Bacteria 4032
177 Ga0111539_10143480 3300009094 Bacteria 2795
178 Ga0111539_10278953 3300009094 Bacteria 1945
179 Ga0111539_10300573 3300009094 Bacteria 1868
180 Ga0105245_10130209 3300009098 Bacteria 2359
181 Ga0105247_10019784 3300009101 Bacteria 4043
182 Ga0105247_10047000 3300009101 Bacteria 2650
183 Ga0105247_10222243 3300009101 Bacteria 1279
184 Ga0114129_10000766 3300009147 Bacteria 41029
185 Ga0114129_10045330 3300009147 Bacteria 6182
186 Ga0114129_10167269 3300009147 Bacteria 3000
187 Ga0114129_10200337 3300009147 Bacteria 2705
188 Ga0114129_10257021 3300009147 Bacteria 2343
189 Ga0105243_10007473 3300009148 Bacteria 8398
190 Ga0105243_10018111 3300009148 Bacteria 5330
191 Ga0105241_10034717 3300009174 Bacteria 3791
192 Ga0105241_10064231 3300009174 Bacteria 2833
193 Ga0105242_10266828 3300009176 Bacteria 1549
194 Ga0105248_10311580 3300009177 Bacteria 1773
195 Ga0105248_10425602 3300009177 Bacteria 1495
196 Ga0105237_10248843 3300009545 Bacteria 1779
197 Ga0105238_10076600 3300009551 Bacteria 3336
198 Ga0105249_10021556 3300009553 Bacteria 5769
199 Ga0105249_10457758 3300009553 Bacteria 1315
200 Ga0099796_10005417 3300010159 Bacteria 3185
201 Ga0099796_10019757 3300010159 Bacteria 2048
202 Ga0099796_10032891 3300010159 Bacteria 1703
203 Ga0105239_10023240 3300010375 Bacteria 6830
204 Ga0105239_10060470 3300010375 Bacteria 4158
205 Ga0105246_10128980 3300011119 Bacteria 1886
206 Ga0105246_10213564 3300011119 Bacteria 1507
207 Ga0157374_10124771 3300013296 Bacteria 2488
208 Ga0157374_10251751 3300013296 Bacteria 1738
209 Ga0157378_10146495 3300013297 Bacteria 2197
210 Ga0163162_10031551 3300013306 Bacteria 5256
211 Ga0163162_10151128 3300013306 Bacteria 2440
212 Ga0163162_10171322 3300013306 Bacteria 2295
213 Ga0163162_10352472 3300013306 Bacteria 1604
214 Ga0157375_10356457 3300013308 Bacteria 1629
215 Ga0157375_10377689 3300013308 Bacteria 1584
216 Ga0163163_10015404 3300014325 Bacteria 7069
217 Ga0157376_10135314 3300014969 Bacteria 2204
218 Ga0163161_10046964 3300017792 Bacteria 3117
219 Ga0163161_10052806 3300017792 Bacteria 2946
220 Ga0213876_10035942 3300021384 Bacteria 2613
221 Ga0213871_10005103 3300021441 Bacteria 2683
222 Ga0209563_101772 3300025230 Bacteria 5425
223 Ga0209677_101975 3300025253 Bacteria 8152
224 Ga0209677_102808 3300025253 Bacteria 6165
225 Ga0209148_1012845 3300025254 Bacteria 1520
226 Ga0209233_1002127 3300025261 Bacteria 7466
227 Ga0209233_1004746 3300025261 Bacteria 4586
228 Ga0209455_1012420 3300025272 Bacteria 2040
229 Ga0209564_1003588 3300025295 Bacteria 10355
230 Ga0209564_1007333 3300025295 Bacteria 5719
231 Ga0209758_1000024 3300025297 Bacteria 591966
232 Ga0209758_1000139 3300025297 Bacteria 175148
233 Ga0209758_1000209 3300025297 Bacteria 128038
234 Ga0209758_1003797 3300025297 Bacteria 13306
235 Ga0209758_1006334 3300025297 Bacteria 8576
236 Ga0209758_1007918 3300025297 Bacteria 7053
237 Ga0209758_1008134 3300025297 Bacteria 6894
238 Ga0209758_1029049 3300025297 Bacteria 2323
239 Ga0209256_1006206 3300025299 Bacteria 6443
240 Ga0209256_1021882 3300025299 Bacteria 1950
241 Ga0207426_1000237 3300025302 Bacteria 124707
242 Ga0207426_1002648 3300025302 Bacteria 11036
243 Ga0209257_1000416 3300025304 Bacteria 82474
244 Ga0207692_10003561 3300025898 Bacteria 6093
245 Ga0207692_10020640 3300025898 Bacteria 3001
246 Ga0207692_10078585 3300025898 Bacteria 1758
247 Ga0207647_10057719 3300025904 Bacteria 2379
248 Ga0207699_10004084 3300025906 Bacteria 6984
249 Ga0207699_10006269 3300025906 Bacteria 5746
250 Ga0207699_10007551 3300025906 Bacteria 5321
251 Ga0207699_10057284 3300025906 Bacteria 2326
252 Ga0207645_10151084 3300025907 Bacteria 1516
253 Ga0207643_10073125 3300025908 Bacteria 1976
254 Ga0207705_10029754 3300025909 Bacteria 3893
255 Ga0207684_10105805 3300025910 Bacteria 2407
256 Ga0207684_10182359 3300025910 Bacteria 1810
257 Ga0207693_10003198 3300025915 Bacteria 14054
258 Ga0207693_10004819 3300025915 Bacteria 11344
259 Ga0207693_10016822 3300025915 Bacteria 5837
260 Ga0207693_10021983 3300025915 Bacteria 5071
261 Ga0207693_10030609 3300025915 Bacteria 4252
262 Ga0207693_10121953 3300025915 Bacteria 2047
263 Ga0207663_10007150 3300025916 Bacteria 5769
264 Ga0207663_10011977 3300025916 Bacteria 4674
265 Ga0207663_10023870 3300025916 Bacteria 3517
266 Ga0207663_10026736 3300025916 Bacteria 3353
267 Ga0207663_10039546 3300025916 Bacteria 2858
268 Ga0207657_10210886 3300025919 Bacteria 1559
269 Ga0207646_10225703 3300025922 Bacteria 1692
270 Ga0207687_10003095 3300025927 Bacteria 11284
271 Ga0207700_10043818 3300025928 Bacteria 3290
272 Ga0207700_10065195 3300025928 Bacteria 2778
273 Ga0207700_10098429 3300025928 Bacteria 2327
274 Ga0207664_10007583 3300025929 Bacteria 7526
275 Ga0207664_10019667 3300025929 Bacteria 4996
276 Ga0207644_10145448 3300025931 Bacteria 1830
277 Ga0207706_10001722 3300025933 Bacteria 21565
278 Ga0207709_10090925 3300025935 Bacteria 1995
279 Ga0207709_10095924 3300025935 Bacteria 1950
280 Ga0207709_10102744 3300025935 Bacteria 1893
281 Ga0207670_10105169 3300025936 Bacteria 2023
282 Ga0207665_10000779 3300025939 Bacteria 21462
283 Ga0207665_10007372 3300025939 Bacteria 7270
284 Ga0207665_10018743 3300025939 Bacteria 4548
285 Ga0207665_10089786 3300025939 Bacteria 2129
286 Ga0207691_10241364 3300025940 Bacteria 1562
287 Ga0207711_10029434 3300025941 Bacteria 4632
288 Ga0207689_10009304 3300025942 Bacteria 8495
289 Ga0207679_10220388 3300025945 Bacteria 1596
290 Ga0207667_10284840 3300025949 Bacteria 1688
291 Ga0207712_10015694 3300025961 Bacteria 4891
292 Ga0207712_10017511 3300025961 Bacteria 4654
293 Ga0207668_10001369 3300025972 Bacteria 14371
294 Ga0207668_10014288 3300025972 Bacteria 4913
295 Ga0207668_10017270 3300025972 Bacteria 4516
296 Ga0207668_10038101 3300025972 Bacteria 3223
297 Ga0207668_10051323 3300025972 Bacteria 2848
298 Ga0207639_10140765 3300026041 Bacteria 2009
299 Ga0207678_10002397 3300026067 Bacteria 17029
300 Ga0207678_10003316 3300026067 Bacteria 14518
301 Ga0207678_10014230 3300026067 Bacteria 6994
302 Ga0207678_10147298 3300026067 Bacteria 2009
303 Ga0207708_10061683 3300026075 Bacteria 2863
304 Ga0207641_10051008 3300026088 Bacteria 3503
305 Ga0207676_10079181 3300026095 Bacteria 2664
306 Ga0207674_10068585 3300026116 Bacteria 3569
307 Ga0207675_100010951 3300026118 Bacteria 8495
308 Ga0207675_100094094 3300026118 Bacteria 2819
309 Ga0207683_10211671 3300026121 Bacteria 1765
310 Ga0209179_1000450 3300027512 Bacteria 4162
311 Ga0209588_1000521 3300027671 Bacteria 9849
312 Ga0207428_10002129 3300027907 Bacteria 19919
313 Ga0207428_10007040 3300027907 Bacteria 10295
314 Ga0207428_10011549 3300027907 Bacteria 7799
315 Ga0268266_10001022 3300028379 Bacteria 35236
316 Ga0268266_10005075 3300028379 Bacteria 12419
317 Ga0268266_10050761 3300028379 Bacteria 3558
318 Ga0268265_10012713 3300028380 Bacteria 5712
319 Ga0268265_10016290 3300028380 Bacteria 5102
320 Ga0268264_10011779 3300028381 Bacteria 7211
321 Ga0268264_10156706 3300028381 Bacteria 2047
322 Ga0265334_10011662 3300028573 Bacteria 3696
323 Ga0265760_10022120 3300031090 Bacteria 1841
324 Ga0307509_10152254 3300031507 Bacteria 2226
325 Ga0307509_10174701 3300031507 Bacteria 2022
326 Ga0307409_100033655 3300031995 Bacteria 3732
327 Ga0307409_100041610 3300031995 Bacteria 3433
328 Ga0307411_10027550 3300032005 Bacteria 3440
329 Ga0307411_10092584 3300032005 Bacteria 2114
330 Ga0307415_100062558 3300032126 Bacteria 2582
331 Ga0307510_10014098 3300033180 Bacteria 9465
332 Ga0307510_10061641 3300033180 Bacteria 3842
333 Ga0373934_0015153 3300035086 Bacteria 2922
334 Ga0373954_0001354 3300035118 Bacteria 9877
335 Ga0373956_0006917 3300035119 Bacteria 4556
336 Ga0373943_0046526 3300035170 Bacteria 2118
337 Ga0373955_0001045 3300035172 Bacteria 11768
338 Ga0373924_0003482 3300035410 Bacteria 5420
339 Ga0373927_0017396 3300035695 Bacteria 4731
340 Ga0373927_0059883 3300035695 Bacteria 2463
341 Ga0373933_0001089 3300035724 Bacteria 16221
342 Ga0373947_0041692 3300035725 Bacteria 2738
343 Ga0373937_0006280 3300036401 Bacteria 10247
344 Ga0373925_0097765 3300037068 Bacteria 2252
345 Ga0373925_0189165 3300037068 Bacteria 1633
346 Ga0436365_0999537 3300039437 Bacteria 4812
347 Ga0436360_0435591 3300039438 Bacteria 2276
348 Ga0436361_0426039 3300039447 Bacteria 2325
349 Ga0436361_0714685 3300039447 Bacteria 6869
350 Ga0436361_0961182 3300039447 Bacteria 2513
351 Ga0466959_0083273 3300045049 Bacteria 2304
352 Ga0495592_0008630 3300046454 Bacteria 7648
353 Ga0495603_0021639 3300046455 Bacteria 3895
354 Ga0495590_0050120 3300046457 Bacteria 1457
355 Ga0495629_0008997 3300046459 Bacteria 7328
356 Ga0495629_0058992 3300046459 Bacteria 2683
357 Ga0495638_0002575 3300046460 Bacteria 14674
358 Ga0495638_0010632 3300046460 Bacteria 6374
359 Ga0495651_0033585 3300046462 Bacteria 4001
360 Ga0495653_0013015 3300046463 Bacteria 6786
361 Ga0495653_0077153 3300046463 Unclassified 2475
362 Ga0495605_0023824 3300046474 Bacteria 3213
363 Ga0495639_0103180 3300046475 Bacteria 1348
364 Ga0495662_0008323 3300046476 Bacteria 5100
365 Ga0495664_0011428 3300046477 Bacteria 5006
366 Ga0495584_0018523 3300046491 Bacteria 3539
367 Ga0495585_0021409 3300046492 Bacteria 3712
368 Ga0495606_0011605 3300046507 Bacteria 7163
369 Ga0495608_0002629 3300046511 Bacteria 12898
370 Ga0495628_0057941 3300046516 Bacteria 3047
371 Ga0495630_0057520 3300046517 Bacteria 2914
372 Ga0495631_0050058 3300046518 Bacteria 1828
373 Ga0495632_0042259 3300046519 Bacteria 2285
374 Ga0495637_0046525 3300046520 Bacteria 1835
375 Ga0495637_0077350 3300046520 Bacteria 1332
376 Ga0495643_0026380 3300046522 Bacteria 3279
377 Ga0495648_0002795 3300046524 Bacteria 15731
378 Ga0495648_0008057 3300046524 Bacteria 8336
379 Ga0495648_0009873 3300046524 Bacteria 7335
380 Ga0495640_0015625 3300046533 Bacteria 5705
381 Ga0495587_0036423 3300046536 Bacteria 2959
382 Ga0495609_0066868 3300046538 Bacteria 1583
383 Ga0495621_0003718 3300046539 Bacteria 4225
384 Ga0495645_0002685 3300046543 Bacteria 12074
385 Ga0495622_0038526 3300046557 Bacteria 2226
386 Ga0495667_0013388 3300046559 Bacteria 5552
387 Ga0495656_0047775 3300046615 Bacteria 1816
388 Ga0495668_0034892 3300046616 Bacteria 2820
389 Ga0495634_0010658 3300046642 Bacteria 6729
390 Ga0495634_0020002 3300046642 Bacteria 4750
391 Ga0495634_0181157 3300046642 Bacteria 1319
392 Ga0495611_0006627 3300046648 Bacteria 4932
393 Ga0495625_0074786 3300046660 Bacteria 2372
394 Ga0495625_0110434 3300046660 Bacteria 1880
395 Ga0495625_0145442 3300046660 Bacteria 1596
396 Ga0495635_0002628 3300046663 Bacteria 12288
397 Ga0495635_0108406 3300046663 Bacteria 1897
398 Ga0495659_0037244 3300046664 Bacteria 1722
399 Ga0495659_0041900 3300046664 Bacteria 1637
400 Ga0495588_0010521 3300046674 Bacteria 4304
401 Ga0495657_0038615 3300046675 Bacteria 3284
402 Ga0495599_0001303 3300046678 Bacteria 14181
403 Ga0495646_0015281 3300046680 Bacteria 4874
404 Ga0495669_0004419 3300046684 Bacteria 5807
405 Ga0495669_0103791 3300046684 Bacteria 1322
406 Ga0495624_0062665 3300046690 Bacteria 2326
407 Ga0495670_0141359 3300046691 Bacteria 1259
408 Ga0495671_0130530 3300046692 Bacteria 1225
409 Ga0495649_0093385 3300046694 Bacteria 1602
410 Ga0495600_0004004 3300046809 Bacteria 8757
411 Ga0495604_0029571 3300047317 Bacteria 4358
412 Ga0495604_0053329 3300047317 Bacteria 3126
413 Ga0495674_0120296 3300047319 Bacteria 2219
414 Ga0495672_0065522 3300047320 Bacteria 2076
415 Ga0495676_0106458 3300047321 Bacteria 2066
416 Ga0495680_0002436 3300047322 Bacteria 19039
417 Ga0495683_0063856 3300047323 Bacteria 1819
418 Ga0495675_0055280 3300047444 Bacteria 2517
419 Ga0495673_0025002 3300047469 Bacteria 2874
420 Ga0495673_0099165 3300047469 Bacteria 1180
421 Ga0495684_0003077 3300047471 Bacteria 13110
422 Ga0495684_0003990 3300047471 Bacteria 11511
423 Ga0495686_0053148 3300047472 Bacteria 2539
424 Ga0495686_0077384 3300047472 Bacteria 2037
425 Ga0495686_0090192 3300047472 Bacteria 1862
426 Ga0495686_0120278 3300047472 Bacteria 1566
427 Ga0495593_0002110 3300047673 Bacteria 11877
428 Ga0495602_0099140 3300048088 Bacteria 2396
429 Ga0496101_0013290 3300048904 Bacteria 5514
430 Ga0496101_0016299 3300048904 Bacteria 5016
431 Ga0496102_0098305 3300048905 Bacteria 2716
432 Ga0496104_0059661 3300048907 Bacteria 3612
433 Ga0496104_0066176 3300048907 Bacteria 3431
434 Ga0496105_0006689 3300048908 Bacteria 8873
435 Ga0496105_0011260 3300048908 Bacteria 7060
436 Ga0496106_0030102 3300048909 Bacteria 4047
437 Ga0496106_0135656 3300048909 Bacteria 1933
438 Ga0496107_0111704 3300048910 Bacteria 2009
439 Ga0496108_0240300 3300048911 Bacteria 1575
440 Ga0496109_0124509 3300048912 Bacteria 2403
441 Ga0496110_0016254 3300048913 Bacteria 6210
442 Ga0496110_0183101 3300048913 Bacteria 1902
443 Ga0496110_0282219 3300048913 Bacteria 1512
444 Ga0496111_0031450 3300048914 Bacteria 3781
445 Ga0496112_0097976 3300048915 Bacteria 2902
446 Ga0496112_0168225 3300048915 Bacteria 2158
447 Ga0496112_0182165 3300048915 Bacteria 2064
448 Ga0496112_0219713 3300048915 Bacteria 1856
449 Ga0496113_0085819 3300048916 Bacteria 2418
450 Ga0496114_0027824 3300048917 Bacteria 4634
451 Ga0496114_0107054 3300048917 Bacteria 2393
452 Ga0496114_0143490 3300048917 Bacteria 2069
453 Ga0496115_0035644 3300048918 Bacteria 3937
454 Ga0496115_0179133 3300048918 Bacteria 1752
455 Ga0496117_0055679 3300048920 Bacteria 2761
456 Ga0496118_0015721 3300048921 Bacteria 6987
457 Ga0496119_0090890 3300048922 Bacteria 1735
458 Ga0496121_0000178 3300048924 Bacteria 141429
459 Ga0496121_0000868 3300048924 Bacteria 54616
460 Ga0496121_0001346 3300048924 Bacteria 41986
461 Ga0496121_0007484 3300048924 Bacteria 13190
462 Ga0496121_0036811 3300048924 Bacteria 4355
463 Ga0496121_0077900 3300048924 Bacteria 2638
464 Ga0496121_0103860 3300048924 Bacteria 2185
465 Ga0496121_0104292 3300048924 Bacteria 2179
466 Ga0496121_0104972 3300048924 Bacteria 2169
467 Ga0496122_0043294 3300048925 Bacteria 3529
468 Ga0496126_0002980 3300048929 Bacteria 21982
469 Ga0496126_0013853 3300048929 Bacteria 8180
470 Ga0496126_0017979 3300048929 Bacteria 7028
471 Ga0496126_0040784 3300048929 Bacteria 4302
472 Ga0496126_0045621 3300048929 Bacteria 4026
473 Ga0496126_0087272 3300048929 Bacteria 2749
474 Ga0496126_0106425 3300048929 Bacteria 2448
475 Ga0495682_0016089 3300049460 Bacteria 2829
476 nmdc:mga03683_32382_c1 3300050489 Bacteria 2103
477 nmdc:mga03683_672_c1 3300050489 Bacteria 7052
478 nmdc:mga03683_90323_c1 3300050489 Bacteria 1334
479 nmdc:mga03n38_2843_c1 3300050490 Bacteria 5449
480 nmdc:mga03n38_3844_c1 3300050490 Bacteria 4884
481 nmdc:mga00v17_27330_c1 3300050491 Bacteria 3330
482 nmdc:mga00v17_38782_c1 3300050491 Bacteria 2850
483 nmdc:mga00v17_86617_c1 3300050491 Bacteria 1963
484 nmdc:mga0yw44_104964_c1 3300050492 Bacteria 1804
485 nmdc:mga0yw44_125676_c1 3300050492 Bacteria 1656
486 nmdc:mga0yw44_405_c1 3300050492 Bacteria 15044
487 nmdc:mga0k408_1338_c1 3300050493 Bacteria 2214
488 nmdc:mga06z11_2034_c1 3300050494 Bacteria 7665
489 nmdc:mga06z11_38_c1 3300050494 Bacteria 54827
490 nmdc:mga06z11_5543_c1 3300050494 Bacteria 5074
491 nmdc:mga07m45_106_c1 3300050496 Bacteria 28440
492 nmdc:mga07m45_10894_c1 3300050496 Bacteria 4761
493 nmdc:mga07m45_38426_c1 3300050496 Bacteria 2671
494 nmdc:mga07m45_40886_c1 3300050496 Bacteria 2595
495 nmdc:mga07m45_8693_c1 3300050496 Bacteria 5231
496 nmdc:mga05p37_12561_c1 3300050507 Bacteria 10112
497 nmdc:mga05p37_160_c1 3300050507 Bacteria 64997
498 nmdc:mga09592_15829_c1 3300050508 Bacteria 6163
499 nmdc:mga09592_2214_c1 3300050508 Bacteria 15651
500 nmdc:mga0qj67_1410_c1 3300050509 Bacteria 16811
501 nmdc:mga0qj67_15607_c1 3300050509 Bacteria 5751
502 nmdc:mga0qj67_2560_c1 3300050509 Bacteria 12991
503 nmdc:mga0qj67_7961_c1 3300050509 Bacteria 7834
504 nmdc:mga06r32_237637_c1 3300050510 Bacteria 1810
505 nmdc:mga06r32_27771_c1 3300050510 Bacteria 5291
506 nmdc:mga06r32_289_c1 3300050510 Bacteria 41773
507 nmdc:mga06r32_9691_c1 3300050510 Bacteria 8703
508 nmdc:mga08y16_16366_c1 3300050511 Bacteria 7797
509 nmdc:mga08y16_326_c1 3300050511 Bacteria 43249
510 nmdc:mga08y16_45923_c1 3300050511 Bacteria 4575
511 nmdc:mga0n895_10230_c1 3300050512 Bacteria 8264
512 nmdc:mga0n895_107985_c1 3300050512 Bacteria 2797
513 nmdc:mga0n895_11454_c1 3300050512 Bacteria 7912
514 nmdc:mga0n895_607_c1 3300050512 Bacteria 24823
515 nmdc:mga0rr50_13607_c1 3300050513 Bacteria 5304
516 nmdc:mga0rr50_18914_c1 3300050513 Bacteria 4639
517 nmdc:mga0rr50_314058_c1 3300050513 Unclassified 1313
518 nmdc:mga08x19_297048_c1 3300050514 Bacteria 1121
519 nmdc:mga0a205_699_c1 3300050515 Bacteria 26913
520 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
521 nmdc:mga0sz30_906_c1 3300050516 Bacteria 10657
522 Ga0495601_0015061 3300053077 Bacteria 4670
523 Ga0495601_0077875 3300053077 Unclassified 2123
524 Ga0500635_0014361 3300053080 Bacteria 2319
525 Ga0495595_0000180 3300053084 Bacteria 25223
526 Ga0495619_0023652 3300053085 Bacteria 3940
527 Ga0500643_000097 3300053087 Bacteria 92120
528 Ga0500647_0026590 3300053091 Bacteria 2730
529 Ga0500651_0000964 3300053093 Bacteria 14147
530 Ga0500566_0000009 3300053094 Bacteria 131668
531 Ga0500566_0000029 3300053094 Bacteria 75384
532 Ga0500640_018844 3300053095 Bacteria 2949
533 Ga0500641_0027513 3300053096 Bacteria 2214
534 Ga0500555_003423 3300053103 Bacteria 4523
535 Ga0500556_0001943 3300053104 Bacteria 7309
536 Ga0500572_000142 3300053111 Bacteria 24469
537 Ga0500595_002504 3300053119 Bacteria 9073
538 Ga0500595_004564 3300053119 Bacteria 6183
539 Ga0500595_014813 3300053119 Bacteria 2947
540 Ga0500608_005239 3300053122 Bacteria 5127
541 Ga0500608_081297 3300053122 Bacteria 1528
542 Ga0500614_002205 3300053123 Bacteria 4415
543 Ga0500603_000016 3300053150 Bacteria 56563
544 Ga0500604_0018905 3300053151 Bacteria 1925
545 Ga0500620_003225 3300053155 Bacteria 3452
546 Ga0500622_0047979 3300053156 Bacteria 2204
547 Ga0500630_000034 3300053159 Bacteria 38552
548 Ga0500634_0079014 3300053161 Bacteria 1701
549 Ga0500638_088424 3300053162 Bacteria 1462
550 Ga0500639_000017 3300053163 Bacteria 114464
551 Ga0500636_0000420 3300053177 Bacteria 23339
552 Ga0500637_0022250 3300053178 Bacteria 3452
553 Ga0500637_0033234 3300053178 Bacteria 2880
554 Ga0500645_030151 3300053730 Bacteria 1634
555 Ga0500609_000642 3300053731 Bacteria 5318
556 Ga0500601_000149 3300053737 Bacteria 14513
557 2508693909 2508501042 Bacteria 8719808
558 2509146952 2508501128 Bacteria 8613869
559 2509148442 2508501128 Bacteria 8613869
560 2509150864 2508501128 Bacteria 8613869
561 2509153951 2508501128 Bacteria 8613869
562 2513642441 2513237094 Bacteria 8789602
563 2513642489 2513237094 Bacteria 8789602
564 2513651984 2513237095 Bacteria 8976980
565 2513671552 2513237098 Bacteria 9902361
566 2513677478 2513237098 Bacteria 9902361
567 2513693841 2513237101 Bacteria 7952346
568 2513702779 2513237102 Bacteria 7703324
569 2513892949 2513237141 Bacteria 8496279
570 2517101018 2517093001 Bacteria 9002274
571 2524442555 2524023205 Bacteria 8918781
572 2524464859 2524023210 Bacteria 9029266
573 2524466205 2524023210 Bacteria 9029266
574 2524533864 2524023228 Bacteria 10118060
575 2643983712 2643221595 Bacteria 6565519
576 2644157395 2643221627 Bacteria 6761570
577 2723843365 2721755755 Bacteria 8322773
578 2745075520 2744054633 Bacteria 8678936
579 2792750404 2791355123 Bacteria 8049106
580 2793077910
581 2818239168 2816332527 Bacteria 8933356
582 2824604854 2824600985 Bacteria 8488197
583 2824611394 2824609381 Bacteria 8672835
584 2824620251 2824617872 Bacteria 8814715
585 2824629516 2824626560 Bacteria 8813858
586 2824635836 2824635225 Bacteria 8785348
587 2824646138 2824644064 Bacteria 8743947
588 2824656081 2824653114 Bacteria 8493680
589 2824663183 2824661429 Bacteria 9877870
590 2824707712 2824704595 Bacteria 9667483
591 2824716664 2824714736 Bacteria 8717648
592 2824726621 2824723954 Bacteria 8758240
593 2824757901 2824753945 Bacteria 9787441
594 2824766967 2824763712 Bacteria 9792355
595 2824774638 2824773399 Bacteria 8360218
596 2841961241 2841957949 Bacteria 8652217
597 2849078859 2849076700 Bacteria 7039503
598 2857512505 2857509624 Bacteria 7472071
599 2869168125 2869162929 Bacteria 6399702
600 2874611723 2874604998 Bacteria 7834745
601 2874617371 2874612657 Bacteria 8252029
602 2874632527 2874628541 Bacteria 8630250
603 2874633799 2874628541 Bacteria 8630250
604 2876764494 2876761206 Bacteria 10111113
605 2876771849 2876771140 Bacteria 8287509
606 2876816600 2876808645 Bacteria 8824342
607 2876826547 2876818435 Bacteria 8274608
608 2879075701 2879074833 Bacteria 8279565
609 2879104213 2879099564 Bacteria 10442239
610 2879114964 2879110137 Bacteria 8907982
611 2879150421 2879142872 Bacteria 8267021
612 2881368275 2881364244 Bacteria 7710352
613 2881672310 2881665667 Bacteria 8175609
614 2885369745 2885366525 Bacteria 8326213
615 2885384803 2885383462 Bacteria 9473874
616 2885389665 2885383462 Bacteria 9473874
617 2888379199 2888378607 Bacteria 9652610
618 2888389491 2888388044 Bacteria 7304136
619 2889037681 2889033259 Bacteria 9099371
620 2903771331 2903768456 Bacteria 9749579
621 2903773874 2903768456 Bacteria 9749579
622 2904697107 2904690495 Bacteria 9412302
623 2904712495 2904711408 Bacteria 9771557
624 2906627622 2906626472 Bacteria 8826946
625 2906629563 2906626472 Bacteria 8826946
626 2908762624 2908756301 Bacteria 8864324
627 2922387800 2922386360 Bacteria 7017218
628 2929620790 2929615660 Bacteria 9193770
629 2929626684 2929624759 Bacteria 9339455
630 2932784450 2932784394 Bacteria 9704911
631 2932801850 2932801729 Bacteria 7987968
632 2932809433 2932809354 Bacteria 9135765
633 2932818824 2932818245 Bacteria 9955613
634 2932826056 2932818245 Bacteria 9955613
635 2932828220 2932828146 Bacteria 9745859
636 2933582705 2933577622 Bacteria 9116884
637 2935610163 2935608549 Bacteria 8203142
638 2935617194 2935616580 Bacteria 9032984
639 2935636355 2935630451 Bacteria 8169952
640 2935639325 2935638405 Bacteria 10015038
641 2935650307 2935648319 Bacteria 8801166
642 2935658454 2935656913 Bacteria 8965014
643 2935665824 2935665750 Bacteria 9571747
644 2935675470 2935675223 Bacteria 9928132
645 2935685519 2935684952 Bacteria 9590419
646 2935698768 2935694250 Bacteria 9291695
647 2935704332 2935703347 Bacteria 10242284
648 2935714072 2935713505 Bacteria 9608509
649 2935724691 2935722832 Bacteria 9608746
650 2935732951 2935732158 Bacteria 9706831
651 2935733617 2935732158 Bacteria 9706831
652 2935742330 2935741537 Bacteria 9707219
653 2935742996 2935741537 Bacteria 9707219
654 2935751484 2935750917 Bacteria 9590372
655 2935765744 2935760218 Bacteria 9817913
656 2935773849 2935769743 Bacteria 7878163
657 2935776866 2935769743 Bacteria 7878163
658 2935778342 2935777560 Bacteria 8077691
659 2935788715 2935785616 Bacteria 7962367
660 2935792876 2935785616 Bacteria 7962367
661 2935795659 2935793552 Bacteria 8012592
662 2935800982 2935793552 Bacteria 8012592
663 2935802414 2935801545 Bacteria 9301974
664 2935811238 2935810662 Bacteria 9401221
665 2935823323 2935819856 Bacteria 8261050
666 2935828820 2935827899 Bacteria 10038562
667 2935840194 2935837841 Bacteria 9454360
668 2935855819 2935855204 Bacteria 9035059
669 2935866238 2935864058 Bacteria 9784707
670 2935877436 2935873716 Bacteria 9632195
671 2935916285 2935908558 Bacteria 8568796
672 2935923566 2935916978 Bacteria 9113783
673 2935933727 2935926038 Bacteria 8601059
674 2935942211 2935934488 Bacteria 8602579
675 2935950703 2935942939 Bacteria 8599779
676 2935959118 2935951376 Bacteria 8602333
677 2935961589 2935959822 Bacteria 7869783
678 2935975220 2935967501 Bacteria 8603075
679 2935986019 2935984226 Bacteria 8302647
680 2935992381 2935992306 Bacteria 9802711
681 2936002253 2936002035 Bacteria 9362176
682 2936013134 2936011229 Bacteria 8801034
683 2936021779 2936019824 Bacteria 8804134
684 2936030427 2936028420 Bacteria 8965941
685 2936037342 2936037263 Bacteria 9446081
686 2936047973 2936046547 Bacteria 8903709
687 2936057973 2936055302 Bacteria 8785755
688 2940557714 2940556831 Bacteria 9590747
689 2941512986 2941507105 Bacteria 8166816
690 2941520712 2941515067 Bacteria 8166720
691 2941528727 2941523033 Bacteria 8169134
692 2941537440 2941531003 Bacteria 7653939
693 2941540465 2941538514 Bacteria 9402094
694 2958065407 2958064165 Bacteria 7158582
695 3005712189 3005710791 Bacteria 7622528
696 8006966741 8006964411 Bacteria 8966052
697 8006993905 8006984368 Bacteria 9651211
698 8006994738 8006994254 Bacteria 8309700
699 8016521316 8016511872 Bacteria 9921665
700 8016529822 8016522445 Bacteria 8156687
701 8016535056 8016530956 Bacteria 8155261
702 8016548262 8016539877 Bacteria 8155419
703 8016553864 8016548790 Bacteria 8155074
704 8016562238 8016557553 Bacteria 8154380
705 8016573398 8016566248 Bacteria 8158151
706 8016577531 8016575299 Bacteria 8154085
707 8016588291 8016583857 Bacteria 10421953
708 8016600054 8016595262 Bacteria 8149947
709 8016610707 8016603502 Bacteria 8731218
710 8016614223 8016613128 Bacteria 8794220
711 8016624867 8016622563 Bacteria 7999408
712 8016626760 8016622563 Bacteria 7999408
713 8016631130 8016630954 Bacteria 9217207
714 8016638444 8016630954 Bacteria 9217207
715 8017064305 8017057580 Bacteria 10023680
716 8019534811 8019530166 Bacteria 8155624
717 8019544664 8019538911 Bacteria 7872763
718 8019551909 8019547302 Bacteria 7996444
719 8019553872 8019547302 Bacteria 7996444
720 8019559280 8019555841 Bacteria 9642137
721 8019566018 8019565922 Bacteria 9639779
722 8019591464 8019586578 Bacteria 10212056
723 8019599878 8019597564 Bacteria 10041141
724 8019618670 8019608314 Bacteria 10042931
725 8019625835 8019619141 Bacteria 9218857
726 8019638482 8019629233 Bacteria 8687553
727 8019639803 8019638758 Bacteria 9062356
728 8019667816 8019659431 Bacteria 8577854
729 8019691573 8019687851 Bacteria 8712826
730 8055745652 8055742211 Bacteria 9226248
731 8056680793 8056673599 Bacteria 7871253
732 8056683636 8056681323 Bacteria 8472857
733 Ga0496115_0075330
734 CNAas_1001604
735 JGI25153J46596_10000288
736 JGI25153J46596_10000483
737 JGI25153J46596_10000912
738 JGI25153J46596_10001506
739 JGI25153J46596_10001586
740 JGI25153J46596_10001963
741 JGI25160J50197_1000413
742 JGI25160J50197_1001806
743 JGI25404J52841_10000205
744 JGI25404J52841_10010408
745 JGI25404J52841_10013508
746 Ga0055539_1005156
747 Ga0055531_10012320
748 Ga0065165_1000342
749 Ga0065165_1006645
750 Ga0065704_10140706
751 Ga0065715_10001703
752 Ga0065707_10016994
753 Ga0070658_10018856
754 Ga0068869_100003558
755 Ga0068869_100042182
756 Ga0070682_100031621
757 Ga0070682_100110139
758 Ga0068868_100089122
759 Ga0070689_100070251
760 Ga0070691_10018531
761 Ga0070668_100020486
762 Ga0070668_100023188
763 Ga0070668_100053069
764 Ga0070668_100112145
765 Ga0070669_100001434
766 Ga0070675_100307231
767 Ga0070671_100057356
768 Ga0070674_100141676
769 Ga0070673_100373731
770 Ga0070659_100156725
771 Ga0070667_100009511
772 Ga0070667_100351286
773 Ga0070709_10033314
774 Ga0070714_100033979
775 Ga0070714_100092937
776 Ga0070713_100150664
777 Ga0070713_100175591
778 Ga0070710_10002899
779 Ga0070710_10055637
780 Ga0070710_10096668
781 Ga0070711_100008672
782 Ga0070711_100038316
783 Ga0070711_100043821
784 Ga0070711_100074234
785 Ga0070711_100096189
786 Ga0070711_100288852
787 Ga0070700_100047395
788 Ga0070694_100012064
789 Ga0070663_100003069
790 Ga0070663_100006379
791 Ga0070663_100025905
792 Ga0070663_100144252
793 Ga0070678_100080606
794 Ga0070678_100207550
795 Ga0070662_100029456
796 Ga0068867_100125340
797 Ga0070706_100093913
798 Ga0070698_100000373
799 Ga0070698_100094727
800 Ga0070699_100011652
801 Ga0070699_100018770
802 Ga0070699_100182703
803 Ga0070699_100389103
804 Ga0070697_100013409
805 Ga0070697_100069049
806 Ga0070697_100154624
807 Ga0070697_100345431
808 Ga0068853_100215198
809 Ga0068853_100223636
810 Ga0070696_100025911
811 Ga0070665_100002914
812 Ga0070665_100006487
813 Ga0070665_100024100
814 Ga0070665_100179991
815 Ga0070665_100182195
816 Ga0070704_100020603
817 Ga0068855_100070455
818 Ga0068856_100018995
819 Ga0068852_100130956
820 Ga0068864_100091296
821 Ga0068864_100190673
822 Ga0068861_100002985
823 Ga0068863_100178915
824 Ga0068860_100029070
825 Ga0068862_100029695
826 Ga0068862_100149351
827 Ga0068862_100188168
828 Ga0081455_10000165
829 Ga0081455_10000715
830 Ga0081455_10010592
831 Ga0081455_10043485
832 Ga0081455_10074473
833 Ga0081540_1000002
834 Ga0081540_1000021
835 Ga0081540_1000787
836 Ga0081540_1001470
837 Ga0081540_1002212
838 Ga0081540_1002285
839 Ga0081540_1002452
840 Ga0081540_1003224
841 Ga0081540_1003472
842 Ga0081540_1006015
843 Ga0081540_1011193
844 Ga0081540_1016727
845 Ga0081540_1025480
846 Ga0081540_1044147
847 Ga0081540_1067943
848 Ga0070717_10001164
849 Ga0070717_10024876
850 Ga0070717_10165456
851 Ga0070717_10198724
852 Ga0075365_10002250
853 Ga0075365_10005374
854 Ga0075365_10038349
855 Ga0075365_10122771
856 Ga0075365_10137808
857 Ga0075363_100005934
858 Ga0075363_100123712
859 Ga0075364_10045672
860 Ga0075364_10067396
861 Ga0070715_10035799
862 Ga0070716_100059836
863 Ga0070716_100126585
864 Ga0070712_100009376
865 Ga0070712_100010060
866 Ga0070712_100020675
867 Ga0070712_100048398
868 Ga0070712_100056649
869 Ga0075362_10001097
870 Ga0075362_10087247
871 Ga0075367_10001540
872 Ga0075367_10001959
873 Ga0075369_10000106
874 Ga0075369_10040648
875 Ga0075366_10004804
876 Ga0075366_10109445
877 Ga0075370_10003315
878 Ga0075370_10007764
879 Ga0075370_10024530
880 Ga0075370_10026246
881 Ga0075370_10045416
882 Ga0075428_100001568
883 Ga0075428_100064438
884 Ga0075428_100064532
885 Ga0075428_100072013
886 Ga0075430_100009419
887 Ga0075430_100011000
888 Ga0075430_100014903
889 Ga0075430_100040472
890 Ga0075431_100000110
891 Ga0075431_100064670
892 Ga0075431_100085094
893 Ga0075431_100145708
894 Ga0075433_10001538
895 Ga0075434_100002679
896 Ga0075434_100013294
897 Ga0075434_100290929
898 Ga0075429_100010965
899 Ga0075429_100046476
900 Ga0075436_100000863
901 Ga0075436_100249452
902 Ga0075435_100103087
903 Ga0075435_100208044
904 Ga0099794_10000628
905 Ga0099794_10010403
906 Ga0099794_10016490
907 Ga0111539_10000570
908 Ga0111539_10073473
909 Ga0111539_10143480
910 Ga0111539_10278953
911 Ga0111539_10300573
912 Ga0105245_10130209
913 Ga0105247_10019784
914 Ga0105247_10047000
915 Ga0105247_10222243
916 Ga0114129_10000766
917 Ga0114129_10045330
918 Ga0114129_10167269
919 Ga0114129_10200337
920 Ga0114129_10257021
921 Ga0105243_10007473
922 Ga0105243_10018111
923 Ga0105241_10034717
924 Ga0105241_10064231
925 Ga0105242_10266828
926 Ga0105248_10311580
927 Ga0105248_10425602
928 Ga0105237_10248843
929 Ga0105238_10076600
930 Ga0105249_10021556
931 Ga0105249_10457758
932 Ga0099796_10005417
933 Ga0099796_10019757
934 Ga0099796_10032891
935 Ga0105239_10023240
936 Ga0105239_10060470
937 Ga0105246_10128980
938 Ga0105246_10213564
939 Ga0157374_10124771
940 Ga0157374_10251751
941 Ga0157378_10146495
942 Ga0163162_10031551
943 Ga0163162_10151128
944 Ga0163162_10171322
945 Ga0163162_10352472
946 Ga0157375_10356457
947 Ga0157375_10377689
948 Ga0163163_10015404
949 Ga0157376_10135314
950 Ga0163161_10046964
951 Ga0163161_10052806
952 Ga0213876_10035942
953 Ga0213871_10005103
954 Ga0209563_101772
955 Ga0209677_101975
956 Ga0209677_102808
957 Ga0209148_1012845
958 Ga0209233_1002127
959 Ga0209233_1004746
960 Ga0209455_1012420
961 Ga0209564_1003588
962 Ga0209564_1007333
963 Ga0209758_1000024
964 Ga0209758_1000139
965 Ga0209758_1000209
966 Ga0209758_1003797
967 Ga0209758_1006334
968 Ga0209758_1007918
969 Ga0209758_1008134
970 Ga0209758_1029049
971 Ga0209256_1006206
972 Ga0209256_1021882
973 Ga0207426_1000237
974 Ga0207426_1002648
975 Ga0209257_1000416
976 Ga0207692_10003561
977 Ga0207692_10020640
978 Ga0207692_10078585
979 Ga0207647_10057719
980 Ga0207699_10004084
981 Ga0207699_10006269
982 Ga0207699_10007551
983 Ga0207699_10057284
984 Ga0207645_10151084
985 Ga0207643_10073125
986 Ga0207705_10029754
987 Ga0207684_10105805
988 Ga0207684_10182359
989 Ga0207693_10003198
990 Ga0207693_10004819
991 Ga0207693_10016822
992 Ga0207693_10021983
993 Ga0207693_10030609
994 Ga0207693_10121953
995 Ga0207663_10007150
996 Ga0207663_10011977
997 Ga0207663_10023870
998 Ga0207663_10026736
999 Ga0207663_10039546
1000 Ga0207657_10210886
1001 Ga0207646_10225703
1002 Ga0207687_10003095
1003 Ga0207700_10043818
1004 Ga0207700_10065195
1005 Ga0207700_10098429
1006 Ga0207664_10007583
1007 Ga0207664_10019667
1008 Ga0207644_10145448
1009 Ga0207706_10001722
1010 Ga0207709_10090925
1011 Ga0207709_10095924
1012 Ga0207709_10102744
1013 Ga0207670_10105169
1014 Ga0207665_10000779
1015 Ga0207665_10007372
1016 Ga0207665_10018743
1017 Ga0207665_10089786
1018 Ga0207691_10241364
1019 Ga0207711_10029434
1020 Ga0207689_10009304
1021 Ga0207679_10220388
1022 Ga0207667_10284840
1023 Ga0207712_10015694
1024 Ga0207712_10017511
1025 Ga0207668_10001369
1026 Ga0207668_10014288
1027 Ga0207668_10017270
1028 Ga0207668_10038101
1029 Ga0207668_10051323
1030 Ga0207639_10140765
1031 Ga0207678_10002397
1032 Ga0207678_10003316
1033 Ga0207678_10014230
1034 Ga0207678_10147298
1035 Ga0207708_10061683
1036 Ga0207641_10051008
1037 Ga0207676_10079181
1038 Ga0207674_10068585
1039 Ga0207675_100010951
1040 Ga0207675_100094094
1041 Ga0207683_10211671
1042 Ga0209179_1000450
1043 Ga0209588_1000521
1044 Ga0207428_10002129
1045 Ga0207428_10007040
1046 Ga0207428_10011549
1047 Ga0268266_10001022
1048 Ga0268266_10005075
1049 Ga0268266_10050761
1050 Ga0268265_10012713
1051 Ga0268265_10016290
1052 Ga0268264_10011779
1053 Ga0268264_10156706
1054 Ga0265334_10011662
1055 Ga0265760_10022120
1056 Ga0307509_10152254
1057 Ga0307509_10174701
1058 Ga0307409_100033655
1059 Ga0307409_100041610
1060 Ga0307411_10027550
1061 Ga0307411_10092584
1062 Ga0307415_100062558
1063 Ga0307510_10014098
1064 Ga0307510_10061641
1065 Ga0373934_0015153
1066 Ga0373954_0001354
1067 Ga0373956_0006917
1068 Ga0373943_0046526
1069 Ga0373955_0001045
1070 Ga0373924_0003482
1071 Ga0373927_0017396
1072 Ga0373927_0059883
1073 Ga0373933_0001089
1074 Ga0373947_0041692
1075 Ga0373937_0006280
1076 Ga0373925_0097765
1077 Ga0373925_0189165
1078 Ga0436365_0999537
1079 Ga0436360_0435591
1080 Ga0436361_0426039
1081 Ga0436361_0714685
1082 Ga0436361_0961182
1083 Ga0466959_0083273
1084 Ga0495592_0008630
1085 Ga0495603_0021639
1086 Ga0495590_0050120
1087 Ga0495629_0008997
1088 Ga0495629_0058992
1089 Ga0495638_0002575
1090 Ga0495638_0010632
1091 Ga0495651_0033585
1092 Ga0495653_0013015
1093 Ga0495653_0077153
1094 Ga0495605_0023824
1095 Ga0495639_0103180
1096 Ga0495662_0008323
1097 Ga0495664_0011428
1098 Ga0495584_0018523
1099 Ga0495585_0021409
1100 Ga0495606_0011605
1101 Ga0495608_0002629
1102 Ga0495628_0057941
1103 Ga0495630_0057520
1104 Ga0495631_0050058
1105 Ga0495632_0042259
1106 Ga0495637_0046525
1107 Ga0495637_0077350
1108 Ga0495643_0026380
1109 Ga0495648_0002795
1110 Ga0495648_0008057
1111 Ga0495648_0009873
1112 Ga0495640_0015625
1113 Ga0495587_0036423
1114 Ga0495609_0066868
1115 Ga0495621_0003718
1116 Ga0495645_0002685
1117 Ga0495622_0038526
1118 Ga0495667_0013388
1119 Ga0495656_0047775
1120 Ga0495668_0034892
1121 Ga0495634_0010658
1122 Ga0495634_0020002
1123 Ga0495634_0181157
1124 Ga0495611_0006627
1125 Ga0495625_0074786
1126 Ga0495625_0110434
1127 Ga0495625_0145442
1128 Ga0495635_0002628
1129 Ga0495635_0108406
1130 Ga0495659_0037244
1131 Ga0495659_0041900
1132 Ga0495588_0010521
1133 Ga0495657_0038615
1134 Ga0495599_0001303
1135 Ga0495646_0015281
1136 Ga0495669_0004419
1137 Ga0495669_0103791
1138 Ga0495624_0062665
1139 Ga0495670_0141359
1140 Ga0495671_0130530
1141 Ga0495649_0093385
1142 Ga0495600_0004004
1143 Ga0495604_0029571
1144 Ga0495604_0053329
1145 Ga0495674_0120296
1146 Ga0495672_0065522
1147 Ga0495676_0106458
1148 Ga0495680_0002436
1149 Ga0495683_0063856
1150 Ga0495675_0055280
1151 Ga0495673_0025002
1152 Ga0495673_0099165
1153 Ga0495684_0003077
1154 Ga0495684_0003990
1155 Ga0495686_0053148
1156 Ga0495686_0077384
1157 Ga0495686_0090192
1158 Ga0495686_0120278
1159 Ga0495593_0002110
1160 Ga0495602_0099140
1161 Ga0496101_0013290
1162 Ga0496101_0016299
1163 Ga0496102_0098305
1164 Ga0496104_0059661
1165 Ga0496104_0066176
1166 Ga0496105_0006689
1167 Ga0496105_0011260
1168 Ga0496106_0030102
1169 Ga0496106_0135656
1170 Ga0496107_0111704
1171 Ga0496108_0240300
1172 Ga0496109_0124509
1173 Ga0496110_0016254
1174 Ga0496110_0183101
1175 Ga0496110_0282219
1176 Ga0496111_0031450
1177 Ga0496112_0097976
1178 Ga0496112_0168225
1179 Ga0496112_0182165
1180 Ga0496112_0219713
1181 Ga0496113_0085819
1182 Ga0496114_0027824
1183 Ga0496114_0107054
1184 Ga0496114_0143490
1185 Ga0496115_0035644
1186 Ga0496115_0179133
1187 Ga0496117_0055679
1188 Ga0496118_0015721
1189 Ga0496119_0090890
1190 Ga0496121_0000178
1191 Ga0496121_0000868
1192 Ga0496121_0001346
1193 Ga0496121_0007484
1194 Ga0496121_0036811
1195 Ga0496121_0077900
1196 Ga0496121_0103860
1197 Ga0496121_0104292
1198 Ga0496121_0104972
1199 Ga0496122_0043294
1200 Ga0496126_0002980
1201 Ga0496126_0013853
1202 Ga0496126_0017979
1203 Ga0496126_0040784
1204 Ga0496126_0045621
1205 Ga0496126_0087272
1206 Ga0496126_0106425
1207 Ga0495682_0016089
1208 nmdc:mga03683_32382_c1
1209 nmdc:mga03683_672_c1
1210 nmdc:mga03683_90323_c1
1211 nmdc:mga03n38_2843_c1
1212 nmdc:mga03n38_3844_c1
1213 nmdc:mga00v17_27330_c1
1214 nmdc:mga00v17_38782_c1
1215 nmdc:mga00v17_86617_c1
1216 nmdc:mga0yw44_104964_c1
1217 nmdc:mga0yw44_125676_c1
1218 nmdc:mga0yw44_405_c1
1219 nmdc:mga0k408_1338_c1
1220 nmdc:mga06z11_2034_c1
1221 nmdc:mga06z11_38_c1
1222 nmdc:mga06z11_5543_c1
1223 nmdc:mga07m45_106_c1
1224 nmdc:mga07m45_10894_c1
1225 nmdc:mga07m45_38426_c1
1226 nmdc:mga07m45_40886_c1
1227 nmdc:mga07m45_8693_c1
1228 nmdc:mga05p37_12561_c1
1229 nmdc:mga05p37_160_c1
1230 nmdc:mga09592_15829_c1
1231 nmdc:mga09592_2214_c1
1232 nmdc:mga0qj67_1410_c1
1233 nmdc:mga0qj67_15607_c1
1234 nmdc:mga0qj67_2560_c1
1235 nmdc:mga0qj67_7961_c1
1236 nmdc:mga06r32_237637_c1
1237 nmdc:mga06r32_27771_c1
1238 nmdc:mga06r32_289_c1
1239 nmdc:mga06r32_9691_c1
1240 nmdc:mga08y16_16366_c1
1241 nmdc:mga08y16_326_c1
1242 nmdc:mga08y16_45923_c1
1243 nmdc:mga0n895_10230_c1
1244 nmdc:mga0n895_107985_c1
1245 nmdc:mga0n895_11454_c1
1246 nmdc:mga0n895_607_c1
1247 nmdc:mga0rr50_13607_c1
1248 nmdc:mga0rr50_18914_c1
1249 nmdc:mga0rr50_314058_c1
1250 nmdc:mga08x19_297048_c1
1251 nmdc:mga0a205_699_c1
1252 nmdc:mga0sz30_15_c1
1253 nmdc:mga0sz30_906_c1
1254 Ga0495601_0015061
1255 Ga0495601_0077875
1256 Ga0500635_0014361
1257 Ga0495595_0000180
1258 Ga0495619_0023652
1259 Ga0500643_000097
1260 Ga0500647_0026590
1261 Ga0500651_0000964
1262 Ga0500566_0000009
1263 Ga0500566_0000029
1264 Ga0500640_018844
1265 Ga0500641_0027513
1266 Ga0500555_003423
1267 Ga0500556_0001943
1268 Ga0500572_000142
1269 Ga0500595_002504
1270 Ga0500595_004564
1271 Ga0500595_014813
1272 Ga0500608_005239
1273 Ga0500608_081297
1274 Ga0500614_002205
1275 Ga0500603_000016
1276 Ga0500604_0018905
1277 Ga0500620_003225
1278 Ga0500622_0047979
1279 Ga0500630_000034
1280 Ga0500634_0079014
1281 Ga0500638_088424
1282 Ga0500639_000017
1283 Ga0500636_0000420
1284 Ga0500637_0022250
1285 Ga0500637_0033234
1286 Ga0500645_030151
1287 Ga0500609_000642
1288 Ga0500601_000149
1289 2508693909
1290 2509146952
1291 2509148442
1292 2509150864
1293 2509153951
1294 2513642441
1295 2513642489
1296 2513651984
1297 2513671552
1298 2513677478
1299 2513693841
1300 2513702779
1301 2513892949
1302 2517101018
1303 2524442555
1304 2524464859
1305 2524466205
1306 2524533864
1307 2643983712
1308 2644157395
1309 2723843365
1310 2745075520
1311 2792750404
1312 2793077910
1313 2818239168
1314 2824604854
1315 2824611394
1316 2824620251
1317 2824629516
1318 2824635836
1319 2824646138
1320 2824656081
1321 2824663183
1322 2824707712
1323 2824716664
1324 2824726621
1325 2824757901
1326 2824766967
1327 2824774638
1328 2841961241
1329 2849078859
1330 2857512505
1331 2869168125
1332 2874611723
1333 2874617371
1334 2874632527
1335 2874633799
1336 2876764494
1337 2876771849
1338 2876816600
1339 2876826547
1340 2879075701
1341 2879104213
1342 2879114964
1343 2879150421
1344 2881368275
1345 2881672310
1346 2885369745
1347 2885384803
1348 2885389665
1349 2888379199
1350 2888389491
1351 2889037681
1352 2903771331
1353 2903773874
1354 2904697107
1355 2904712495
1356 2906627622
1357 2906629563
1358 2908762624
1359 2922387800
1360 2929620790
1361 2929626684
1362 2932784450
1363 2932801850
1364 2932809433
1365 2932818824
1366 2932826056
1367 2932828220
1368 2933582705
1369 2935610163
1370 2935617194
1371 2935636355
1372 2935639325
1373 2935650307
1374 2935658454
1375 2935665824
1376 2935675470
1377 2935685519
1378 2935698768
1379 2935704332
1380 2935714072
1381 2935724691
1382 2935732951
1383 2935733617
1384 2935742330
1385 2935742996
1386 2935751484
1387 2935765744
1388 2935773849
1389 2935776866
1390 2935778342
1391 2935788715
1392 2935792876
1393 2935795659
1394 2935800982
1395 2935802414
1396 2935811238
1397 2935823323
1398 2935828820
1399 2935840194
1400 2935855819
1401 2935866238
1402 2935877436
1403 2935916285
1404 2935923566
1405 2935933727
1406 2935942211
1407 2935950703
1408 2935959118
1409 2935961589
1410 2935975220
1411 2935986019
1412 2935992381
1413 2936002253
1414 2936013134
1415 2936021779
1416 2936030427
1417 2936037342
1418 2936047973
1419 2936057973
1420 2940557714
1421 2941512986
1422 2941520712
1423 2941528727
1424 2941537440
1425 2941540465
1426 2958065407
1427 3005712189
1428 8006966741
1429 8006993905
1430 8006994738
1431 8016521316
1432 8016529822
1433 8016535056
1434 8016548262
1435 8016553864
1436 8016562238
1437 8016573398
1438 8016577531
1439 8016588291
1440 8016600054
1441 8016610707
1442 8016614223
1443 8016624867
1444 8016626760
1445 8016631130
1446 8016638444
1447 8017064305
1448 8019534811
1449 8019544664
1450 8019551909
1451 8019553872
1452 8019559280
1453 8019566018
1454 8019591464
1455 8019599878
1456 8019618670
1457 8019625835
1458 8019638482
1459 8019639803
1460 8019667816
1461 8019691573
1462 8055745652
1463 8056680793
1464 8056683636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

89

136

0.96

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

77

313

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r1m-assembly1.cif.gz_A crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.9698 101 175
6r1o-assembly1.cif.gz_A-2 crystal structure of e. coli seryl-trna synthetase complexed to a seryl sulfamoyl adenosine derivative 0.9643 101 175
6r1m-assembly1.cif.gz_B crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.9588 101 175
8cwy-assembly1.cif.gz_H accurate computational design of genetically encoded 3d protein crystals 0.9498 100 175
8cwy-assembly1.cif.gz_R accurate computational design of genetically encoded 3d protein crystals 0.9494 100 175
ID Description Score Start End Superfamily
af_A0A0P0XQ02_80_398_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9781 101 175 1.20.1270.60
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9754 101 177 1.20.1600.10
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9716 67 211 2.40.50.100
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9638 103 174 1.10.287.470
af_I1KAB5_393_712_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9595 101 175 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A3B0WKP4-F1-model_v4 RND efflux system, membrane fusion protein 0.9101 290 364 GO:0005886
GO:0046677
AF-A0A2V7TVZ0-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8686 45 362 GO:0015562
GO:0030313
GO:1990281
AF-A0A7V9PGL9-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8637 46 362 GO:0015562
GO:1990281
AF-A0A537RT60-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8635 25 363 GO:0015562
GO:1990281
AF-A0A6D0ENE7-F1-model_v4 deleted 0.863 58 217

Map