F478041

General Info

Members Datasets Scaffolds Average Seq Length
732 348 1464 108

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0890974|Ga0395899_0890974_127_516
Length 129
Sequence MAASAVDKVFDELGKMSVLDLVELKKKIEDEWGVTAAAPVAVAAPGAVPGGDGAXXAEEKTSFDVILNAAGGQKIQVIKVVRAITGLGLKEAKDLVDSAPKPVKEGVAQDEADSIKAQLEEAGATVEVK

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
187 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
188 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
216 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
217 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
218 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
219 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
220 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
224 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
225 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
344 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
345 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
346 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
347 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
348 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 5.46
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 4.51
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0890974 3300037312 Bacteria 543
2 JGI25407J50210_10083856 3300003373 Bacteria 791
3 Ga0058861_11719844 3300004800 Bacteria 765
4 Ga0058860_11991362 3300004801 Bacteria 2246
5 Ga0058862_12771121 3300004803 Bacteria 893
6 Ga0070683_100048064 3300005329 Bacteria 3944
7 Ga0070683_100103147 3300005329 Bacteria 2687
8 Ga0070683_100126953 3300005329 Bacteria 2411
9 Ga0070683_100455591 3300005329 Bacteria 1221
10 Ga0070690_100316064 3300005330 Bacteria 1124
11 Ga0068869_100687109 3300005334 Bacteria 872
12 Ga0070680_100020676 3300005336 Bacteria 5224
13 Ga0070680_100212099 3300005336 Bacteria 1634
14 Ga0070680_101655490 3300005336 Bacteria 554
15 Ga0070682_100156014 3300005337 Bacteria 1571
16 Ga0070660_100049323 3300005339 Bacteria 3236
17 Ga0070689_100874391 3300005340 Bacteria 794
18 Ga0070691_10281865 3300005341 Bacteria 902
19 Ga0070687_100046842 3300005343 Bacteria 2215
20 Ga0070661_100039844 3300005344 Bacteria 3424
21 Ga0070661_100524454 3300005344 Bacteria 950
22 Ga0070661_101368398 3300005344 Bacteria 595
23 Ga0070674_100227269 3300005356 Bacteria 1455
24 Ga0070674_101237840 3300005356 Bacteria 664
25 Ga0070688_101286437 3300005365 Bacteria 590
26 Ga0070659_101329648 3300005366 Bacteria 638
27 Ga0070667_100484211 3300005367 Bacteria 1133
28 Ga0070709_10065585 3300005434 Bacteria 2326
29 Ga0070709_10118789 3300005434 Bacteria 1788
30 Ga0070709_10379393 3300005434 Bacteria 1051
31 Ga0070714_100046913 3300005435 Bacteria 3667
32 Ga0070714_100081812 3300005435 Bacteria 2812
33 Ga0070714_100252354 3300005435 Bacteria 1631
34 Ga0070713_100004061 3300005436 Bacteria 9744
35 Ga0070713_100084545 3300005436 Bacteria 2715
36 Ga0070713_100169420 3300005436 Bacteria 1955
37 Ga0070713_100440302 3300005436 Bacteria 1222
38 Ga0070701_10100707 3300005438 Bacteria 1600
39 Ga0070711_100185608 3300005439 Bacteria 1594
40 Ga0070711_101486886 3300005439 Bacteria 591
41 Ga0070694_101187975 3300005444 Bacteria 639
42 Ga0070708_100000449 3300005445 Bacteria 30862
43 Ga0070708_100072001 3300005445 Bacteria 3113
44 Ga0070708_100231495 3300005445 Bacteria 1734
45 Ga0070708_100313963 3300005445 Bacteria 1476
46 Ga0070708_102098891 3300005445 Bacteria 523
47 Ga0070663_100454851 3300005455 Bacteria 1056
48 Ga0070678_100414724 3300005456 Bacteria 1173
49 Ga0070678_100693930 3300005456 Bacteria 917
50 Ga0070678_101340446 3300005456 Bacteria 667
51 Ga0070662_100637021 3300005457 Bacteria 899
52 Ga0070681_10208529 3300005458 Bacteria 1870
53 Ga0070681_10307863 3300005458 Bacteria 1494
54 Ga0070681_10556838 3300005458 Bacteria 1060
55 Ga0070681_11124624 3300005458 Bacteria 706
56 Ga0068867_100284035 3300005459 Bacteria 1358
57 Ga0070706_100006030 3300005467 Bacteria 11454
58 Ga0070706_100395958 3300005467 Bacteria 1286
59 Ga0070706_101883680 3300005467 Bacteria 543
60 Ga0070707_100007428 3300005468 Bacteria 10176
61 Ga0070707_100193748 3300005468 Bacteria 1982
62 Ga0070707_100454130 3300005468 Bacteria 1242
63 Ga0070707_100820528 3300005468 Bacteria 894
64 Ga0070707_101283045 3300005468 Bacteria 699
65 Ga0070707_101509886 3300005468 Bacteria 639
66 Ga0070698_100248805 3300005471 Bacteria 1710
67 Ga0070698_100603855 3300005471 Bacteria 1038
68 Ga0070698_100862508 3300005471 Bacteria 850
69 Ga0070698_100948491 3300005471 Bacteria 807
70 Ga0070698_101002029 3300005471 Bacteria 783
71 Ga0070699_100022344 3300005518 Bacteria 5451
72 Ga0070679_100098810 3300005530 Bacteria 2906
73 Ga0070679_100161832 3300005530 Bacteria 2212
74 Ga0070679_100326081 3300005530 Bacteria 1484
75 Ga0070679_100341081 3300005530 Bacteria 1446
76 Ga0070679_100584003 3300005530 Bacteria 1061
77 Ga0070679_100611025 3300005530 Bacteria 1033
78 Ga0070684_100183894 3300005535 Bacteria 1900
79 Ga0070684_100243474 3300005535 Bacteria 1643
80 Ga0070686_100086098 3300005544 Bacteria 2092
81 Ga0070686_100146176 3300005544 Bacteria 1651
82 Ga0070686_100323531 3300005544 Bacteria 1150
83 Ga0070695_100623813 3300005545 Bacteria 849
84 Ga0070695_101094184 3300005545 Bacteria 652
85 Ga0070696_100537626 3300005546 Bacteria 935
86 Ga0070665_100018075 3300005548 Bacteria 7077
87 Ga0070704_101149041 3300005549 Unclassified 707
88 Ga0068855_100476930 3300005563 Bacteria 1358
89 Ga0068855_100529673 3300005563 Bacteria 1277
90 Ga0068855_101153829 3300005563 Bacteria 808
91 Ga0070664_100602425 3300005564 Bacteria 1019
92 Ga0068854_100279917 3300005578 Bacteria 1343
93 Ga0068856_100168068 3300005614 Bacteria 2204
94 Ga0070702_100031818 3300005615 Bacteria 2890
95 Ga0070702_100666614 3300005615 Bacteria 789
96 Ga0070702_101142076 3300005615 Bacteria 625
97 Ga0068852_100243045 3300005616 Bacteria 1721
98 Ga0068852_100824422 3300005616 Bacteria 943
99 Ga0068852_100958305 3300005616 Bacteria 874
100 Ga0068852_101225382 3300005616 Bacteria 772
101 Ga0068852_102039980 3300005616 Bacteria 596
102 Ga0068859_101350478 3300005617 Bacteria 786
103 Ga0068863_100374972 3300005841 Bacteria 1389
104 Ga0068863_101623269 3300005841 Bacteria 656
105 Ga0068860_100231926 3300005843 Bacteria 1794
106 Ga0068860_100455994 3300005843 Bacteria 1272
107 Ga0068860_100735080 3300005843 Bacteria 998
108 Ga0068860_101491718 3300005843 Bacteria 698
109 Ga0081455_10013222 3300005937 Bacteria 8175
110 Ga0081455_10078872 3300005937 Bacteria 2705
111 Ga0081455_10217283 3300005937 Bacteria 1420
112 Ga0081455_10305252 3300005937 Bacteria 1140
113 Ga0081538_10000761 3300005981 Bacteria 35201
114 Ga0081538_10047302 3300005981 Bacteria 2640
115 Ga0081540_1148615 3300005983 Bacteria 928
116 Ga0081539_10002193 3300005985 Bacteria 28646
117 Ga0070717_10053595 3300006028 Bacteria 3325
118 Ga0070717_10166222 3300006028 Bacteria 1916
119 Ga0070717_10381709 3300006028 Bacteria 1263
120 Ga0075364_11013064 3300006051 Bacteria 564
121 Ga0075432_10036034 3300006058 Bacteria 1720
122 Ga0070715_10671492 3300006163 Bacteria 616
123 Ga0070716_100023303 3300006173 Bacteria 3281
124 Ga0070716_101508365 3300006173 Bacteria 550
125 Ga0070712_100004954 3300006175 Bacteria 8236
126 Ga0070712_100100809 3300006175 Bacteria 2135
127 Ga0070712_100806588 3300006175 Bacteria 806
128 Ga0070712_101746742 3300006175 Bacteria 545
129 Ga0097621_101280398 3300006237 Bacteria 692
130 Ga0068871_102088018 3300006358 Bacteria 540
131 Ga0075431_100266836 3300006847 Bacteria 1736
132 Ga0075431_100798858 3300006847 Bacteria 917
133 Ga0075433_10017172 3300006852 Bacteria 5988
134 Ga0075433_10020704 3300006852 Bacteria 5505
135 Ga0075433_11080764 3300006852 Bacteria 698
136 Ga0075434_100011976 3300006871 Bacteria 8206
137 Ga0075434_100013114 3300006871 Bacteria 7871
138 Ga0075434_100067747 3300006871 Bacteria 3556
139 Ga0075434_100188061 3300006871 Bacteria 2085
140 Ga0075434_100405944 3300006871 Bacteria 1383
141 Ga0075434_100968940 3300006871 Bacteria 865
142 Ga0075434_101144462 3300006871 Bacteria 791
143 Ga0068865_100358799 3300006881 Bacteria 1183
144 Ga0075436_100005794 3300006914 Bacteria 8484
145 Ga0075436_100014573 3300006914 Bacteria 5387
146 Ga0075436_100093137 3300006914 Bacteria 2095
147 Ga0075436_100345835 3300006914 Bacteria 1071
148 Ga0075436_100405150 3300006914 Bacteria 989
149 Ga0097620_101350418 3300006931 Bacteria 786
150 Ga0075435_100020281 3300007076 Bacteria 5090
151 Ga0075435_100038697 3300007076 Bacteria 3803
152 Ga0075435_100281935 3300007076 Bacteria 1419
153 Ga0075435_100713790 3300007076 Bacteria 872
154 Ga0099794_10373743 3300007265 Bacteria 743
155 Ga0105250_10539505 3300009092 Bacteria 534
156 Ga0105240_10081583 3300009093 Bacteria 3974
157 Ga0105240_10191549 3300009093 Bacteria 2404
158 Ga0105240_10266423 3300009093 Bacteria 1974
159 Ga0105240_10381576 3300009093 Bacteria 1592
160 Ga0105240_10522160 3300009093 Bacteria 1317
161 Ga0105240_10657675 3300009093 Bacteria 1148
162 Ga0105240_10661796 3300009093 Bacteria 1143
163 Ga0105240_12660044 3300009093 Bacteria 517
164 Ga0105245_10084649 3300009098 Bacteria 2906
165 Ga0105245_10700326 3300009098 Bacteria 1046
166 Ga0105247_10560233 3300009101 Bacteria 841
167 Ga0114129_10083381 3300009147 Bacteria 4441
168 Ga0114129_10098697 3300009147 Bacteria 4042
169 Ga0114129_10195677 3300009147 Bacteria 2742
170 Ga0114129_10451920 3300009147 Bacteria 1685
171 Ga0114129_10929013 3300009147 Bacteria 1100
172 Ga0105243_10356179 3300009148 Bacteria 1345
173 Ga0105241_11626199 3300009174 Bacteria 625
174 Ga0105241_11866448 3300009174 Bacteria 588
175 Ga0105242_10034350 3300009176 Bacteria 4065
176 Ga0105242_10169313 3300009176 Bacteria 1918
177 Ga0105237_10010685 3300009545 Bacteria 9746
178 Ga0105237_10532637 3300009545 Bacteria 1181
179 Ga0105238_10055655 3300009551 Bacteria 3970
180 Ga0105238_10522033 3300009551 Bacteria 1190
181 Ga0105249_10348922 3300009553 Bacteria 1499
182 Ga0105249_11884072 3300009553 Bacteria 671
183 Ga0105246_10461193 3300011119 Bacteria 1070
184 Ga0157371_10108613 3300013102 Bacteria 1969
185 Ga0157371_10188638 3300013102 Bacteria 1476
186 Ga0157370_10081355 3300013104 Bacteria 3048
187 Ga0157370_10089088 3300013104 Bacteria 2898
188 Ga0157370_10126381 3300013104 Bacteria 2386
189 Ga0157369_10056232 3300013105 Bacteria 4246
190 Ga0157369_10059042 3300013105 Bacteria 4137
191 Ga0157369_10110704 3300013105 Bacteria 2919
192 Ga0157369_10135818 3300013105 Bacteria 2604
193 Ga0157369_10515543 3300013105 Bacteria 1237
194 Ga0157374_10301107 3300013296 Bacteria 1586
195 Ga0157374_10335819 3300013296 Bacteria 1499
196 Ga0157378_12728723 3300013297 Bacteria 546
197 Ga0163162_11001443 3300013306 Bacteria 945
198 Ga0157372_10053575 3300013307 Bacteria 4497
199 Ga0157372_10318081 3300013307 Bacteria 1812
200 Ga0157372_11771299 3300013307 Bacteria 710
201 Ga0157375_10024694 3300013308 Bacteria 5568
202 Ga0157375_10082006 3300013308 Bacteria 3266
203 Ga0163163_10463754 3300014325 Bacteria 1327
204 Ga0163163_11836577 3300014325 Bacteria 666
205 Ga0157380_10136478 3300014326 Bacteria 2100
206 Ga0157380_10550455 3300014326 Bacteria 1132
207 Ga0182008_10018399 3300014497 Bacteria 3617
208 Ga0182008_10172776 3300014497 Bacteria 1091
209 Ga0182008_10274095 3300014497 Bacteria 876
210 Ga0157377_11608787 3300014745 Bacteria 521
211 Ga0157379_10322957 3300014968 Bacteria 1409
212 Ga0157379_10345551 3300014968 Bacteria 1361
213 Ga0157379_10439699 3300014968 Bacteria 1203
214 Ga0157379_10445399 3300014968 Bacteria 1195
215 Ga0157379_10461104 3300014968 Bacteria 1174
216 Ga0157376_10477676 3300014969 Bacteria 1221
217 Ga0157376_10976088 3300014969 Bacteria 869
218 Ga0182006_1012735 3300015261 Bacteria 3673
219 Ga0182007_10024597 3300015262 Bacteria 2106
220 Ga0197907_10457830 3300020069 Bacteria 3250
221 Ga0197907_10659982 3300020069 Bacteria 1630
222 Ga0197907_10723134 3300020069 Bacteria 1435
223 Ga0197907_11158638 3300020069 Bacteria 1836
224 Ga0206356_10071890 3300020070 Bacteria 3131
225 Ga0206356_10485985 3300020070 Bacteria 1072
226 Ga0206356_10685347 3300020070 Bacteria 1309
227 Ga0206356_11252740 3300020070 Bacteria 1819
228 Ga0206356_11638035 3300020070 Bacteria 1540
229 Ga0206356_11641957 3300020070 Bacteria 870
230 Ga0206356_11884232 3300020070 Bacteria 918
231 Ga0206351_10393698 3300020077 Bacteria 1410
232 Ga0206352_10990627 3300020078 Bacteria 1889
233 Ga0206350_10360023 3300020080 Bacteria 2471
234 Ga0206350_10732868 3300020080 Bacteria 593
235 Ga0206354_10544677 3300020081 Bacteria 2371
236 Ga0206354_11080608 3300020081 Bacteria 1878
237 Ga0206353_10120954 3300020082 Bacteria 1215
238 Ga0206353_10955710 3300020082 Bacteria 2688
239 Ga0206353_11706380 3300020082 Bacteria 1033
240 Ga0154015_1369718 3300020610 Bacteria 694
241 Ga0213871_10012176 3300021441 Bacteria 1991
242 Ga0224712_10310555 3300022467 Bacteria 739
243 Ga0207688_10151433 3300025901 Bacteria 1370
244 Ga0207688_10719067 3300025901 Bacteria 632
245 Ga0207699_10106546 3300025906 Bacteria 1789
246 Ga0207699_10198721 3300025906 Bacteria 1357
247 Ga0207699_10568141 3300025906 Bacteria 824
248 Ga0207643_10068224 3300025908 Bacteria 2043
249 Ga0207705_10078678 3300025909 Bacteria 2400
250 Ga0207705_10120524 3300025909 Bacteria 1946
251 Ga0207705_10444032 3300025909 Bacteria 1005
252 Ga0207684_10005943 3300025910 Bacteria 11173
253 Ga0207684_10170909 3300025910 Bacteria 1874
254 Ga0207684_10233515 3300025910 Bacteria 1587
255 Ga0207684_10632239 3300025910 Bacteria 913
256 Ga0207684_11414436 3300025910 Bacteria 569
257 Ga0207684_11567240 3300025910 Bacteria 534
258 Ga0207707_10259485 3300025912 Bacteria 1508
259 Ga0207707_10770823 3300025912 Bacteria 803
260 Ga0207707_10941714 3300025912 Bacteria 712
261 Ga0207707_11248723 3300025912 Bacteria 599
262 Ga0207695_10218757 3300025913 Bacteria 1813
263 Ga0207695_10539127 3300025913 Bacteria 1048
264 Ga0207695_10791952 3300025913 Bacteria 828
265 Ga0207671_10127068 3300025914 Bacteria 1954
266 Ga0207693_10007191 3300025915 Bacteria 9169
267 Ga0207693_10163259 3300025915 Bacteria 1753
268 Ga0207693_10181877 3300025915 Bacteria 1654
269 Ga0207693_10331881 3300025915 Bacteria 1191
270 Ga0207693_10782626 3300025915 Bacteria 736
271 Ga0207663_10077102 3300025916 Bacteria 2168
272 Ga0207660_10767684 3300025917 Bacteria 787
273 Ga0207660_11050369 3300025917 Bacteria 664
274 Ga0207662_10302420 3300025918 Bacteria 1064
275 Ga0207657_10061744 3300025919 Bacteria 3211
276 Ga0207657_10297074 3300025919 Bacteria 1280
277 Ga0207657_10631248 3300025919 Bacteria 835
278 Ga0207649_10056335 3300025920 Bacteria 2454
279 Ga0207649_10199445 3300025920 Bacteria 1413
280 Ga0207652_10006540 3300025921 Bacteria 9390
281 Ga0207652_10095869 3300025921 Bacteria 2613
282 Ga0207652_10157549 3300025921 Bacteria 2034
283 Ga0207652_10416984 3300025921 Bacteria 1211
284 Ga0207652_10472490 3300025921 Bacteria 1130
285 Ga0207646_10008647 3300025922 Bacteria 10177
286 Ga0207646_10199181 3300025922 Bacteria 1809
287 Ga0207646_10879886 3300025922 Bacteria 795
288 Ga0207646_10986307 3300025922 Bacteria 745
289 Ga0207694_10019451 3300025924 Bacteria 5132
290 Ga0207694_11335223 3300025924 Bacteria 606
291 Ga0207694_11819977 3300025924 Bacteria 511
292 Ga0207687_10039538 3300025927 Bacteria 3230
293 Ga0207687_10341833 3300025927 Bacteria 1217
294 Ga0207700_10000001 3300025928 Bacteria 1122509
295 Ga0207700_10095659 3300025928 Bacteria 2356
296 Ga0207700_10096966 3300025928 Bacteria 2342
297 Ga0207700_10292563 3300025928 Bacteria 1404
298 Ga0207664_10057424 3300025929 Bacteria 3093
299 Ga0207664_10072546 3300025929 Bacteria 2776
300 Ga0207664_10113373 3300025929 Bacteria 2258
301 Ga0207664_10122040 3300025929 Bacteria 2182
302 Ga0207664_10314591 3300025929 Bacteria 1380
303 Ga0207664_10451890 3300025929 Bacteria 1147
304 Ga0207664_10764259 3300025929 Bacteria 869
305 Ga0207664_10928835 3300025929 Bacteria 781
306 Ga0207664_10987792 3300025929 Bacteria 755
307 Ga0207664_10989163 3300025929 Bacteria 754
308 Ga0207686_10127755 3300025934 Bacteria 1739
309 Ga0207686_11833320 3300025934 Bacteria 502
310 Ga0207709_10841877 3300025935 Bacteria 743
311 Ga0207670_11071895 3300025936 Bacteria 680
312 Ga0207669_10250615 3300025937 Bacteria 1318
313 Ga0207704_10593070 3300025938 Bacteria 906
314 Ga0207665_10024809 3300025939 Bacteria 3955
315 Ga0207711_11641882 3300025941 Bacteria 586
316 Ga0207689_10623387 3300025942 Bacteria 908
317 Ga0207661_10008390 3300025944 Bacteria 7382
318 Ga0207661_10059027 3300025944 Bacteria 3090
319 Ga0207661_10348524 3300025944 Bacteria 1336
320 Ga0207667_10283952 3300025949 Bacteria 1691
321 Ga0207667_10772745 3300025949 Bacteria 959
322 Ga0207651_10176076 3300025960 Bacteria 1692
323 Ga0207651_11725640 3300025960 Bacteria 564
324 Ga0207668_11652451 3300025972 Bacteria 578
325 Ga0207640_10193672 3300025981 Bacteria 1534
326 Ga0207658_10002202 3300025986 Bacteria 14475
327 Ga0207703_10891275 3300026035 Bacteria 852
328 Ga0207703_11996392 3300026035 Bacteria 556
329 Ga0207678_10320017 3300026067 Bacteria 1335
330 Ga0207708_10013451 3300026075 Bacteria 6118
331 Ga0207702_10066307 3300026078 Bacteria 3094
332 Ga0207702_10899281 3300026078 Bacteria 877
333 Ga0207641_10309263 3300026088 Bacteria 1495
334 Ga0207648_11516523 3300026089 Bacteria 630
335 Ga0207683_10039633 3300026121 Bacteria 4110
336 Ga0207683_10058739 3300026121 Bacteria 3378
337 Ga0207698_10284592 3300026142 Bacteria 1531
338 Ga0207428_10468142 3300027907 Bacteria 918
339 Ga0268266_10008552 3300028379 Bacteria 9097
340 Ga0268264_10563685 3300028381 Bacteria 1119
341 Ga0265326_10006779 3300028558 Bacteria 3536
342 Ga0265319_1007032 3300028563 Bacteria 5117
343 Ga0265319_1225651 3300028563 Bacteria 572
344 Ga0265334_10075204 3300028573 Bacteria 1252
345 Ga0265334_10284215 3300028573 Bacteria 567
346 Ga0265318_10000309 3300028577 Bacteria 39338
347 Ga0265323_10285130 3300028653 Bacteria 512
348 Ga0265322_10127989 3300028654 Bacteria 724
349 Ga0265322_10173787 3300028654 Bacteria 616
350 Ga0265336_10011250 3300028666 Bacteria 3049
351 Ga0265336_10021573 3300028666 Bacteria 2058
352 Ga0265338_10005814 3300028800 Bacteria 15914
353 Ga0265338_10075845 3300028800 Bacteria 2851
354 Ga0265338_10098223 3300028800 Bacteria 2396
355 Ga0265338_10133021 3300028800 Bacteria 1960
356 Ga0265338_10601875 3300028800 Bacteria 765
357 Ga0316181_1239539 3300030744 Bacteria 515
358 Ga0265330_10000870 3300031235 Bacteria 18861
359 Ga0265330_10024138 3300031235 Bacteria 2758
360 Ga0265332_10004318 3300031238 Bacteria 6704
361 Ga0265332_10204785 3300031238 Bacteria 819
362 Ga0265328_10004480 3300031239 Bacteria 6067
363 Ga0265320_10218834 3300031240 Bacteria 848
364 Ga0265320_10389745 3300031240 Bacteria 615
365 Ga0265325_10003460 3300031241 Bacteria 10303
366 Ga0265325_10165945 3300031241 Bacteria 1036
367 Ga0265325_10285259 3300031241 Bacteria 740
368 Ga0265329_10008950 3300031242 Bacteria 3765
369 Ga0265329_10022225 3300031242 Bacteria 2123
370 Ga0265340_10037137 3300031247 Bacteria 2413
371 Ga0265340_10136945 3300031247 Bacteria 1121
372 Ga0265339_10000850 3300031249 Bacteria 23491
373 Ga0265339_10311499 3300031249 Bacteria 748
374 Ga0265331_10006738 3300031250 Bacteria 6734
375 Ga0265327_10346927 3300031251 Bacteria 649
376 Ga0265316_10005758 3300031344 Bacteria 11965
377 Ga0265316_10015813 3300031344 Bacteria 6575
378 Ga0265316_10033380 3300031344 Bacteria 4191
379 Ga0265316_10117691 3300031344 Bacteria 2008
380 Ga0265316_10168621 3300031344 Bacteria 1634
381 Ga0265316_10952939 3300031344 Unclassified 598
382 Ga0307408_100352044 3300031548 Bacteria 1250
383 Ga0307408_100608552 3300031548 Bacteria 972
384 Ga0265313_10002480 3300031595 Bacteria 15906
385 Ga0265313_10071132 3300031595 Bacteria 1601
386 Ga0265313_10136911 3300031595 Bacteria 1056
387 Ga0316575_10508028 3300031665 Bacteria 523
388 Ga0265314_10062107 3300031711 Bacteria 2540
389 Ga0265314_10215175 3300031711 Bacteria 1126
390 Ga0265314_10358944 3300031711 Bacteria 799
391 Ga0265342_10018745 3300031712 Bacteria 4473
392 Ga0316576_10013514 3300031727 Bacteria 5430
393 Ga0307405_10184192 3300031731 Bacteria 1502
394 Ga0316577_10707399 3300031733 Bacteria 572
395 Ga0307410_11308767 3300031852 Bacteria 634
396 Ga0307412_10607984 3300031911 Bacteria 927
397 Ga0307415_101467069 3300032126 Bacteria 652
398 Ga0316583_10007229 3300032133 Bacteria 3996
399 Ga0316580_10006254 3300032139 Bacteria 3513
400 Ga0316593_10002697 3300032168 Bacteria 4270
401 Ga0316593_10052215 3300032168 Bacteria 1383
402 Ga0316593_10365203 3300032168 Bacteria 554
403 Ga0316593_10383520 3300032168 Bacteria 541
404 Ga0316592_1003342 3300033524 Bacteria 2881
405 Ga0316586_1050275 3300033527 Bacteria 745
406 Ga0316587_1022583 3300033529 Bacteria 1079
407 Ga0316587_1053290 3300033529 Bacteria 743
408 Ga0316596_1009001 3300033541 Bacteria 2391
409 Ga0316596_1022867 3300033541 Unclassified 1599
410 Ga0316596_1091406 3300033541 Bacteria 820
411 Ga0373951_0135795 3300035091 Bacteria 680
412 Ga0373954_0627656 3300035118 Bacteria 533
413 Ga0373960_0233240 3300035121 Bacteria 663
414 Ga0373943_0088136 3300035170 Bacteria 1603
415 Ga0373946_0258540 3300035171 Bacteria 851
416 Ga0373946_0770300 3300035171 Bacteria 506
417 Ga0373955_0042452 3300035172 Bacteria 2442
418 Ga0316574_0037933 3300035398 Bacteria 2957
419 Ga0316574_0141492 3300035398 Bacteria 1550
420 Ga0373935_0592647 3300035692 Bacteria 810
421 Ga0373947_0283808 3300035725 Bacteria 1101
422 Ga0373937_0000556 3300036401 Bacteria 33122
423 Ga0373937_0077045 3300036401 Bacteria 3081
424 Ga0316582_0106118 3300036647 Bacteria 1865
425 Ga0316582_0296904 3300036647 Bacteria 1110
426 Ga0316582_1029506 3300036647 Bacteria 562
427 Ga0373925_0605581 3300037068 Bacteria 902
428 Ga0373925_1451637 3300037068 Bacteria 562
429 Ga0395899_0008779 3300037312 Bacteria 7778
430 Ga0395899_0013473 3300037312 Bacteria 6252
431 Ga0395899_0014016 3300037312 Bacteria 6120
432 Ga0395899_0144931 3300037312 Bacteria 1687
433 Ga0395899_0257297 3300037312 Bacteria 1195
434 Ga0395899_0445548 3300037312 Bacteria 849
435 Ga0395899_0501922 3300037312 Unclassified 787
436 Ga0395899_0627526 3300037312 Bacteria 682
437 Ga0395899_0628224 3300037312 Bacteria 681
438 Ga0395900_0003410 3300037418 Bacteria 17178
439 Ga0395900_0015740 3300037418 Bacteria 7710
440 Ga0395900_0016452 3300037418 Bacteria 7541
441 Ga0395900_0114140 3300037418 Bacteria 2772
442 Ga0395900_0325752 3300037418 Bacteria 1515
443 Ga0395900_0335234 3300037418 Bacteria 1489
444 Ga0395900_0360376 3300037418 Bacteria 1425
445 Ga0395900_0363773 3300037418 Bacteria 1417
446 Ga0395900_0418283 3300037418 Bacteria 1301
447 Ga0395900_0612425 3300037418 Bacteria 1028
448 Ga0395900_1183035 3300037418 Bacteria 680
449 Ga0395898_0004636 3300037466 Bacteria 14988
450 Ga0395898_0013510 3300037466 Bacteria 8408
451 Ga0395898_0026565 3300037466 Bacteria 5822
452 Ga0395898_0032034 3300037466 Bacteria 5247
453 Ga0395898_0033773 3300037466 Bacteria 5102
454 Ga0395898_0058571 3300037466 Bacteria 3749
455 Ga0395898_0067485 3300037466 Bacteria 3462
456 Ga0395898_0089733 3300037466 Bacteria 2958
457 Ga0395898_0142508 3300037466 Bacteria 2294
458 Ga0395898_0193486 3300037466 Bacteria 1943
459 Ga0395898_0309665 3300037466 Bacteria 1506
460 Ga0395898_0380715 3300037466 Bacteria 1346
461 Ga0395898_0432902 3300037466 Bacteria 1253
462 Ga0395898_0722098 3300037466 Bacteria 938
463 Ga0395898_0828001 3300037466 Bacteria 865
464 Ga0395905_0002779 3300037471 Bacteria 19166
465 Ga0395905_0008273 3300037471 Bacteria 10270
466 Ga0395905_0017609 3300037471 Bacteria 6781
467 Ga0395905_0021362 3300037471 Bacteria 6121
468 Ga0395905_0024341 3300037471 Bacteria 5715
469 Ga0395905_0069899 3300037471 Bacteria 3289
470 Ga0395905_0105862 3300037471 Bacteria 2641
471 Ga0395905_0132708 3300037471 Bacteria 2342
472 Ga0395905_0199992 3300037471 Bacteria 1874
473 Ga0395905_0499264 3300037471 Bacteria 1117
474 Ga0395905_1624328 3300037471 Bacteria 551
475 Ga0316581_0081734 3300037588 Bacteria 994
476 Ga0436364_0892201 3300037853 Bacteria 601
477 Ga0395901_0005128 3300038443 Bacteria 13224
478 Ga0395901_0011953 3300038443 Bacteria 8802
479 Ga0395901_0016806 3300038443 Bacteria 7456
480 Ga0395901_0034480 3300038443 Bacteria 5226
481 Ga0395901_0038915 3300038443 Bacteria 4918
482 Ga0395901_0073783 3300038443 Bacteria 3559
483 Ga0395901_0075129 3300038443 Bacteria 3525
484 Ga0395901_0165894 3300038443 Bacteria 2319
485 Ga0395901_0235142 3300038443 Bacteria 1912
486 Ga0395901_0248967 3300038443 Bacteria 1852
487 Ga0395901_0273786 3300038443 Bacteria 1755
488 Ga0395901_0321777 3300038443 Bacteria 1600
489 Ga0395901_0430597 3300038443 Bacteria 1351
490 Ga0395901_0439386 3300038443 Bacteria 1336
491 Ga0395901_0521560 3300038443 Bacteria 1207
492 Ga0395901_0898965 3300038443 Bacteria 867
493 Ga0395901_1826241 3300038443 Bacteria 556
494 Ga0400490_07105 3300038726 Bacteria 3043
495 Ga0400490_18978 3300038726 Bacteria 41932
496 Ga0436360_0294018 3300039438 Bacteria 4503
497 Ga0436360_0387295 3300039438 Bacteria 11023
498 Ga0436363_0799049 3300039450 Bacteria 811
499 Ga0436363_1274357 3300039450 Bacteria 1372
500 Ga0436362_0885277 3300039453 Bacteria 527
501 Ga0439447_084978 3300041407 Bacteria 729
502 Ga0439453_0097824 3300041408 Bacteria 651
503 Ga0451788_22619 3300041442 Bacteria 673
504 Ga0451794_54159 3300041446 Bacteria 1166
505 Ga0451798_0853137 3300041458 Bacteria 680
506 Ga0451804_0440748 3300041463 Bacteria 677
507 Ga0451807_1198143 3300041486 Bacteria 664
508 Ga0451853_3415776 3300041512 Bacteria 845
509 Ga0439451_026368 3300042009 Bacteria 1171
510 Ga0439454_091711 3300042011 Bacteria 562
511 Ga0439458_0159245 3300042157 Bacteria 607
512 Ga0451577_0011607 3300042876 Bacteria 8323
513 Ga0451577_1645415 3300042876 Bacteria 566
514 Ga0439440_0062677 3300042993 Bacteria 952
515 Ga0466961_0100733 3300044693 Bacteria 1820
516 Ga0466963_0014918 3300044694 Bacteria 4801
517 Ga0466964_0037566 3300044706 Bacteria 1945
518 Ga0466964_0089330 3300044706 Bacteria 1338
519 Ga0466964_0248821 3300044706 Bacteria 875
520 Ga0453684_0006165 3300044712 Bacteria 23060
521 Ga0453684_0404497 3300044712 Bacteria 1528
522 Ga0453684_0490678 3300044712 Bacteria 1361
523 Ga0453684_1767722 3300044712 Bacteria 630
524 Ga0466968_0184126 3300044735 Bacteria 972
525 Ga0466957_0013596 3300044842 Bacteria 4724
526 Ga0466957_0247654 3300044842 Bacteria 1184
527 Ga0466960_0012112 3300044901 Bacteria 3630
528 Ga0466960_0554938 3300044901 Bacteria 678
529 Ga0466960_0614543 3300044901 Bacteria 646
530 Ga0451576_0040399 3300045051 Bacteria 4938
531 Ga0451576_0194744 3300045051 Bacteria 2117
532 Ga0466967_0026850 3300045976 Bacteria 4778
533 Ga0466967_0055799 3300045976 Bacteria 3480
534 Ga0466967_0120776 3300045976 Bacteria 2420
535 Ga0466967_0147537 3300045976 Bacteria 2195
536 Ga0466967_1730998 3300045976 Bacteria 622
537 Ga0466967_2546346 3300045976 Bacteria 506
538 Ga0495592_0000114 3300046454 Bacteria 70630
539 Ga0495590_0076363 3300046457 Bacteria 1179
540 Ga0495629_0212444 3300046459 Bacteria 1336
541 Ga0495651_0000254 3300046462 Bacteria 41379
542 Ga0495651_0078321 3300046462 Bacteria 2500
543 Ga0495653_0020225 3300046463 Bacteria 5397
544 Ga0495653_0051397 3300046463 Bacteria 3165
545 Ga0495605_0175751 3300046474 Bacteria 944
546 Ga0495664_0323446 3300046477 Bacteria 930
547 Ga0495584_0139587 3300046491 Bacteria 1230
548 Ga0495584_0446926 3300046491 Bacteria 657
549 Ga0495596_0220966 3300046500 Bacteria 736
550 Ga0495607_0529795 3300046501 Bacteria 519
551 Ga0495608_0069748 3300046511 Bacteria 2295
552 Ga0495608_0223211 3300046511 Bacteria 1181
553 Ga0495616_0292362 3300046513 Bacteria 690
554 Ga0495618_0002678 3300046514 Bacteria 11341
555 Ga0495618_0314574 3300046514 Bacteria 971
556 Ga0495620_0120155 3300046515 Bacteria 1036
557 Ga0495628_0000310 3300046516 Bacteria 43937
558 Ga0495628_0362808 3300046516 Bacteria 1063
559 Ga0495630_0027985 3300046517 Bacteria 4188
560 Ga0495630_0228178 3300046517 Bacteria 1422
561 Ga0495631_0128693 3300046518 Bacteria 1088
562 Ga0495663_0120678 3300046525 Bacteria 877
563 Ga0495642_0038379 3300046528 Bacteria 1941
564 Ga0495642_0394315 3300046528 Bacteria 610
565 Ga0495652_0000144 3300046529 Bacteria 80486
566 Ga0495652_0144234 3300046529 Bacteria 1869
567 Ga0495640_0505828 3300046533 Bacteria 735
568 Ga0495640_0619924 3300046533 Bacteria 652
569 Ga0495587_0000060 3300046536 Bacteria 93780
570 Ga0495587_0451494 3300046536 Bacteria 712
571 Ga0495598_0179582 3300046537 Bacteria 754
572 Ga0495621_0024289 3300046539 Bacteria 2024
573 Ga0495621_0223325 3300046539 Bacteria 763
574 Ga0495645_0000054 3300046543 Bacteria 84855
575 Ga0495656_0201051 3300046615 Bacteria 989
576 Ga0495656_0701193 3300046615 Bacteria 545
577 Ga0495668_0624504 3300046616 Bacteria 595
578 Ga0495634_0213352 3300046642 Bacteria 1194
579 Ga0495635_0195449 3300046663 Bacteria 1373
580 Ga0495635_0490573 3300046663 Bacteria 809
581 Ga0495659_0008504 3300046664 Bacteria 3266
582 Ga0495661_0042809 3300046665 Bacteria 2789
583 Ga0495661_0299759 3300046665 Bacteria 805
584 Ga0495657_0091834 3300046675 Bacteria 1946
585 Ga0495657_0098441 3300046675 Bacteria 1866
586 Ga0495599_0000048 3300046678 Bacteria 85175
587 Ga0495623_0000838 3300046679 Bacteria 20793
588 Ga0495623_0129997 3300046679 Bacteria 1509
589 Ga0495658_0186459 3300046683 Bacteria 1288
590 Ga0495613_0053815 3300046689 Bacteria 2960
591 Ga0495613_1010521 3300046689 Bacteria 534
592 Ga0495624_0176497 3300046690 Bacteria 1302
593 Ga0495671_0332837 3300046692 Bacteria 729
594 Ga0495600_0010048 3300046809 Bacteria 5867
595 Ga0495600_0221156 3300046809 Bacteria 1211
596 Ga0495600_0375946 3300046809 Bacteria 887
597 Ga0495604_0000043 3300047317 Bacteria 116335
598 Ga0495604_0085044 3300047317 Bacteria 2361
599 Ga0495674_0030037 3300047319 Bacteria 4944
600 Ga0495680_0001621 3300047322 Bacteria 23946
601 Ga0495680_0009485 3300047322 Bacteria 8748
602 Ga0495680_0137727 3300047322 Bacteria 1788
603 Ga0495683_0332676 3300047323 Bacteria 645
604 Ga0495675_0000041 3300047444 Bacteria 86087
605 Ga0495675_0290201 3300047444 Bacteria 974
606 Ga0495684_0027976 3300047471 Bacteria 4330
607 Ga0495684_0112194 3300047471 Bacteria 2056
608 Ga0495602_0000931 3300048088 Bacteria 28283
609 Ga0495602_0099402 3300048088 Bacteria 2392
610 Ga0495615_0265222 3300048090 Bacteria 548
611 Ga0496100_1424415 3300048903 Bacteria 547
612 Ga0496101_0006135 3300048904 Bacteria 7714
613 Ga0496101_0157478 3300048904 Bacteria 1740
614 Ga0496101_1096221 3300048904 Bacteria 625
615 Ga0496102_1006640 3300048905 Bacteria 754
616 Ga0496104_0044677 3300048907 Bacteria 4163
617 Ga0496104_1235703 3300048907 Bacteria 650
618 Ga0496105_0533384 3300048908 Bacteria 918
619 Ga0496105_0593165 3300048908 Bacteria 860
620 Ga0496105_0772350 3300048908 Bacteria 732
621 Ga0496106_0005968 3300048909 Bacteria 8998
622 Ga0496107_0932642 3300048910 Bacteria 632
623 Ga0496108_0085413 3300048911 Bacteria 2679
624 Ga0496108_1076327 3300048911 Bacteria 684
625 Ga0496109_0001583 3300048912 Bacteria 19001
626 Ga0496109_0152497 3300048912 Bacteria 2164
627 Ga0496110_0046541 3300048913 Bacteria 3795
628 Ga0496110_0491042 3300048913 Bacteria 1118
629 Ga0496111_0076053 3300048914 Bacteria 2447
630 Ga0496112_0049451 3300048915 Bacteria 4122
631 Ga0496112_0270347 3300048915 Bacteria 1648
632 Ga0496112_0285334 3300048915 Bacteria 1597
633 Ga0496112_0384745 3300048915 Bacteria 1344
634 Ga0496112_0491819 3300048915 Bacteria 1163
635 Ga0496112_0536818 3300048915 Bacteria 1104
636 Ga0496112_0556662 3300048915 Bacteria 1080
637 Ga0496113_0948449 3300048916 Bacteria 679
638 Ga0496114_1532544 3300048917 Bacteria 554
639 Ga0496125_0004021 3300048928 Bacteria 17262
640 Ga0501317_047014 3300049533 Bacteria 675
641 Ga0501031_0931617 3300049568 Bacteria 556
642 Ga0501034_0149229 3300049571 Bacteria 2314
643 Ga0501034_0342337 3300049571 Bacteria 1425
644 Ga0501034_0460573 3300049571 Bacteria 1188
645 Ga0501036_1140994 3300049572 Bacteria 636
646 Ga0501038_0281515 3300049574 Bacteria 1309
647 Ga0501039_0796847 3300049575 Bacteria 737
648 Ga0501040_0463882 3300049576 Bacteria 912
649 Ga0501042_0194945 3300049578 Bacteria 1461
650 Ga0501047_0203413 3300049581 Bacteria 1840
651 Ga0501047_0259871 3300049581 Bacteria 1584
652 Ga0501048_0365111 3300049582 Bacteria 1030
653 Ga0501067_0041531 3300049583 Bacteria 2554
654 Ga0501067_0194312 3300049583 Bacteria 1130
655 Ga0501067_0200031 3300049583 Bacteria 1113
656 Ga0501068_0132740 3300049584 Bacteria 1558
657 Ga0501069_0056496 3300049585 Bacteria 2187
658 Ga0501070_0018413 3300049586 Bacteria 5859
659 Ga0501070_0161891 3300049586 Bacteria 1844
660 Ga0501070_0167203 3300049586 Bacteria 1812
661 Ga0501073_0895744 3300049589 Bacteria 611
662 Ga0501074_0049602 3300049590 Bacteria 3031
663 Ga0501074_0104777 3300049590 Bacteria 2025
664 Ga0501074_0229648 3300049590 Bacteria 1321
665 Ga0501074_0371278 3300049590 Bacteria 1015
666 Ga0501075_0255692 3300049591 Bacteria 1335
667 Ga0501076_0383537 3300049592 Bacteria 1155
668 Ga0501076_0693624 3300049592 Bacteria 841
669 Ga0501076_0888319 3300049592 Bacteria 735
670 Ga0501077_0114995 3300049593 Bacteria 1705
671 Ga0501077_0378857 3300049593 Bacteria 904
672 Ga0501077_0408365 3300049593 Bacteria 868
673 Ga0501079_0397735 3300049741 Bacteria 1080
674 Ga0501080_0259660 3300049742 Bacteria 1583
675 Ga0501081_0491923 3300049743 Bacteria 914
676 Ga0501081_0707166 3300049743 Bacteria 757
677 Ga0501083_0363837 3300049744 Bacteria 941
678 Ga0501035_0026873 3300049822 Bacteria 5263
679 Ga0501035_0135908 3300049822 Bacteria 2141
680 Ga0501044_0752314 3300049823 Bacteria 857
681 nmdc:mga00v17_964323_c1 3300050491 Bacteria 538
682 nmdc:mga06z11_957140_c1 3300050494 Bacteria 522
683 nmdc:mga05p37_15718_c1 3300050507 Bacteria 9099
684 nmdc:mga05p37_178788_c1 3300050507 Bacteria 2583
685 nmdc:mga05p37_352791_c1 3300050507 Bacteria 1732
686 nmdc:mga05p37_458925_c1 3300050507 Bacteria 1473
687 nmdc:mga05p37_712228_c1 3300050507 Bacteria 1113
688 nmdc:mga06r32_486752_c1 3300050510 Bacteria 1211
689 nmdc:mga06r32_729658_c1 3300050510 Bacteria 955
690 nmdc:mga0n895_11599_c1 3300050512 Bacteria 7872
691 nmdc:mga0n895_1211904_c1 3300050512 Bacteria 728
692 nmdc:mga0n895_142965_c1 3300050512 Bacteria 2421
693 nmdc:mga0n895_1579_c1 3300050512 Bacteria 17141
694 nmdc:mga0n895_189780_c1 3300050512 Bacteria 2086
695 nmdc:mga0n895_24369_c1 3300050512 Bacteria 5702
696 nmdc:mga0n895_283120_c1 3300050512 Bacteria 1681
697 nmdc:mga0n895_708334_c1 3300050512 Bacteria 1002
698 nmdc:mga0n895_908830_c1 3300050512 Bacteria 865
699 nmdc:mga0rr50_12450_c1 3300050513 Bacteria 5501
700 nmdc:mga0rr50_263276_c1 3300050513 Bacteria 1435
701 nmdc:mga0rr50_69422_c1 3300050513 Bacteria 2682
702 nmdc:mga08x19_34195_c1 3300050514 Bacteria 3212
703 nmdc:mga08x19_529080_c1 3300050514 Bacteria 833
704 nmdc:mga08x19_543957_c1 3300050514 Bacteria 821
705 nmdc:mga08x19_87149_c1 3300050514 Bacteria 2056
706 nmdc:mga0a205_142339_c1 3300050515 Bacteria 2298
707 nmdc:mga0a205_414352_c1 3300050515 Bacteria 567
708 nmdc:mga0a205_458467_c1 3300050515 Bacteria 1134
709 nmdc:mga0a205_515_c1 3300050515 Bacteria 30339
710 Ga0495601_0000084 3300053077 Bacteria 51113
711 Ga0495601_0043279 3300053077 Bacteria 2828
712 Ga0495601_0520345 3300053077 Bacteria 767
713 Ga0495601_0909589 3300053077 Bacteria 556
714 Ga0495612_0057539 3300053078 Bacteria 1605
715 Ga0495655_0071771 3300053083 Bacteria 970
716 Ga0495595_0125103 3300053084 Bacteria 1254
717 Ga0495619_0003387 3300053085 Bacteria 10305
718 Ga0501084_0176410 3300054114 Bacteria 1804
719 Ga0501084_0291259 3300054114 Bacteria 1379
720 Ga0590071_000248 3300059421 Bacteria 15569
721 Ga0590071_020897 3300059421 Bacteria 1542
722 Ga0590075_002960 3300059424 Bacteria 4042
723 Ga0590075_058514 3300059424 Bacteria 992
724 Ga0587071_179159 3300060344 Bacteria 543
725 Ga0501082_0224351 3300060353 Bacteria 1635
726 Ga0530510_0015703 3300061734 Bacteria 5352
727 2523466055 2523231067 Bacteria 5230452
728 2739347251 2738543031 Bacteria 5769731
729 2745170159 2744054657 Bacteria 5016802
730 2817616441 2816332336 Bacteria 5207640
731 2857472338 2857465823 Bacteria 6772595
732 2898908932 2898907183 Bacteria 4067722
733 Ga0395899_0890974
734 JGI25407J50210_10083856
735 Ga0058861_11719844
736 Ga0058860_11991362
737 Ga0058862_12771121
738 Ga0070683_100048064
739 Ga0070683_100103147
740 Ga0070683_100126953
741 Ga0070683_100455591
742 Ga0070690_100316064
743 Ga0068869_100687109
744 Ga0070680_100020676
745 Ga0070680_100212099
746 Ga0070680_101655490
747 Ga0070682_100156014
748 Ga0070660_100049323
749 Ga0070689_100874391
750 Ga0070691_10281865
751 Ga0070687_100046842
752 Ga0070661_100039844
753 Ga0070661_100524454
754 Ga0070661_101368398
755 Ga0070674_100227269
756 Ga0070674_101237840
757 Ga0070688_101286437
758 Ga0070659_101329648
759 Ga0070667_100484211
760 Ga0070709_10065585
761 Ga0070709_10118789
762 Ga0070709_10379393
763 Ga0070714_100046913
764 Ga0070714_100081812
765 Ga0070714_100252354
766 Ga0070713_100004061
767 Ga0070713_100084545
768 Ga0070713_100169420
769 Ga0070713_100440302
770 Ga0070701_10100707
771 Ga0070711_100185608
772 Ga0070711_101486886
773 Ga0070694_101187975
774 Ga0070708_100000449
775 Ga0070708_100072001
776 Ga0070708_100231495
777 Ga0070708_100313963
778 Ga0070708_102098891
779 Ga0070663_100454851
780 Ga0070678_100414724
781 Ga0070678_100693930
782 Ga0070678_101340446
783 Ga0070662_100637021
784 Ga0070681_10208529
785 Ga0070681_10307863
786 Ga0070681_10556838
787 Ga0070681_11124624
788 Ga0068867_100284035
789 Ga0070706_100006030
790 Ga0070706_100395958
791 Ga0070706_101883680
792 Ga0070707_100007428
793 Ga0070707_100193748
794 Ga0070707_100454130
795 Ga0070707_100820528
796 Ga0070707_101283045
797 Ga0070707_101509886
798 Ga0070698_100248805
799 Ga0070698_100603855
800 Ga0070698_100862508
801 Ga0070698_100948491
802 Ga0070698_101002029
803 Ga0070699_100022344
804 Ga0070679_100098810
805 Ga0070679_100161832
806 Ga0070679_100326081
807 Ga0070679_100341081
808 Ga0070679_100584003
809 Ga0070679_100611025
810 Ga0070684_100183894
811 Ga0070684_100243474
812 Ga0070686_100086098
813 Ga0070686_100146176
814 Ga0070686_100323531
815 Ga0070695_100623813
816 Ga0070695_101094184
817 Ga0070696_100537626
818 Ga0070665_100018075
819 Ga0070704_101149041
820 Ga0068855_100476930
821 Ga0068855_100529673
822 Ga0068855_101153829
823 Ga0070664_100602425
824 Ga0068854_100279917
825 Ga0068856_100168068
826 Ga0070702_100031818
827 Ga0070702_100666614
828 Ga0070702_101142076
829 Ga0068852_100243045
830 Ga0068852_100824422
831 Ga0068852_100958305
832 Ga0068852_101225382
833 Ga0068852_102039980
834 Ga0068859_101350478
835 Ga0068863_100374972
836 Ga0068863_101623269
837 Ga0068860_100231926
838 Ga0068860_100455994
839 Ga0068860_100735080
840 Ga0068860_101491718
841 Ga0081455_10013222
842 Ga0081455_10078872
843 Ga0081455_10217283
844 Ga0081455_10305252
845 Ga0081538_10000761
846 Ga0081538_10047302
847 Ga0081540_1148615
848 Ga0081539_10002193
849 Ga0070717_10053595
850 Ga0070717_10166222
851 Ga0070717_10381709
852 Ga0075364_11013064
853 Ga0075432_10036034
854 Ga0070715_10671492
855 Ga0070716_100023303
856 Ga0070716_101508365
857 Ga0070712_100004954
858 Ga0070712_100100809
859 Ga0070712_100806588
860 Ga0070712_101746742
861 Ga0097621_101280398
862 Ga0068871_102088018
863 Ga0075431_100266836
864 Ga0075431_100798858
865 Ga0075433_10017172
866 Ga0075433_10020704
867 Ga0075433_11080764
868 Ga0075434_100011976
869 Ga0075434_100013114
870 Ga0075434_100067747
871 Ga0075434_100188061
872 Ga0075434_100405944
873 Ga0075434_100968940
874 Ga0075434_101144462
875 Ga0068865_100358799
876 Ga0075436_100005794
877 Ga0075436_100014573
878 Ga0075436_100093137
879 Ga0075436_100345835
880 Ga0075436_100405150
881 Ga0097620_101350418
882 Ga0075435_100020281
883 Ga0075435_100038697
884 Ga0075435_100281935
885 Ga0075435_100713790
886 Ga0099794_10373743
887 Ga0105250_10539505
888 Ga0105240_10081583
889 Ga0105240_10191549
890 Ga0105240_10266423
891 Ga0105240_10381576
892 Ga0105240_10522160
893 Ga0105240_10657675
894 Ga0105240_10661796
895 Ga0105240_12660044
896 Ga0105245_10084649
897 Ga0105245_10700326
898 Ga0105247_10560233
899 Ga0114129_10083381
900 Ga0114129_10098697
901 Ga0114129_10195677
902 Ga0114129_10451920
903 Ga0114129_10929013
904 Ga0105243_10356179
905 Ga0105241_11626199
906 Ga0105241_11866448
907 Ga0105242_10034350
908 Ga0105242_10169313
909 Ga0105237_10010685
910 Ga0105237_10532637
911 Ga0105238_10055655
912 Ga0105238_10522033
913 Ga0105249_10348922
914 Ga0105249_11884072
915 Ga0105246_10461193
916 Ga0157371_10108613
917 Ga0157371_10188638
918 Ga0157370_10081355
919 Ga0157370_10089088
920 Ga0157370_10126381
921 Ga0157369_10056232
922 Ga0157369_10059042
923 Ga0157369_10110704
924 Ga0157369_10135818
925 Ga0157369_10515543
926 Ga0157374_10301107
927 Ga0157374_10335819
928 Ga0157378_12728723
929 Ga0163162_11001443
930 Ga0157372_10053575
931 Ga0157372_10318081
932 Ga0157372_11771299
933 Ga0157375_10024694
934 Ga0157375_10082006
935 Ga0163163_10463754
936 Ga0163163_11836577
937 Ga0157380_10136478
938 Ga0157380_10550455
939 Ga0182008_10018399
940 Ga0182008_10172776
941 Ga0182008_10274095
942 Ga0157377_11608787
943 Ga0157379_10322957
944 Ga0157379_10345551
945 Ga0157379_10439699
946 Ga0157379_10445399
947 Ga0157379_10461104
948 Ga0157376_10477676
949 Ga0157376_10976088
950 Ga0182006_1012735
951 Ga0182007_10024597
952 Ga0197907_10457830
953 Ga0197907_10659982
954 Ga0197907_10723134
955 Ga0197907_11158638
956 Ga0206356_10071890
957 Ga0206356_10485985
958 Ga0206356_10685347
959 Ga0206356_11252740
960 Ga0206356_11638035
961 Ga0206356_11641957
962 Ga0206356_11884232
963 Ga0206351_10393698
964 Ga0206352_10990627
965 Ga0206350_10360023
966 Ga0206350_10732868
967 Ga0206354_10544677
968 Ga0206354_11080608
969 Ga0206353_10120954
970 Ga0206353_10955710
971 Ga0206353_11706380
972 Ga0154015_1369718
973 Ga0213871_10012176
974 Ga0224712_10310555
975 Ga0207688_10151433
976 Ga0207688_10719067
977 Ga0207699_10106546
978 Ga0207699_10198721
979 Ga0207699_10568141
980 Ga0207643_10068224
981 Ga0207705_10078678
982 Ga0207705_10120524
983 Ga0207705_10444032
984 Ga0207684_10005943
985 Ga0207684_10170909
986 Ga0207684_10233515
987 Ga0207684_10632239
988 Ga0207684_11414436
989 Ga0207684_11567240
990 Ga0207707_10259485
991 Ga0207707_10770823
992 Ga0207707_10941714
993 Ga0207707_11248723
994 Ga0207695_10218757
995 Ga0207695_10539127
996 Ga0207695_10791952
997 Ga0207671_10127068
998 Ga0207693_10007191
999 Ga0207693_10163259
1000 Ga0207693_10181877
1001 Ga0207693_10331881
1002 Ga0207693_10782626
1003 Ga0207663_10077102
1004 Ga0207660_10767684
1005 Ga0207660_11050369
1006 Ga0207662_10302420
1007 Ga0207657_10061744
1008 Ga0207657_10297074
1009 Ga0207657_10631248
1010 Ga0207649_10056335
1011 Ga0207649_10199445
1012 Ga0207652_10006540
1013 Ga0207652_10095869
1014 Ga0207652_10157549
1015 Ga0207652_10416984
1016 Ga0207652_10472490
1017 Ga0207646_10008647
1018 Ga0207646_10199181
1019 Ga0207646_10879886
1020 Ga0207646_10986307
1021 Ga0207694_10019451
1022 Ga0207694_11335223
1023 Ga0207694_11819977
1024 Ga0207687_10039538
1025 Ga0207687_10341833
1026 Ga0207700_10000001
1027 Ga0207700_10095659
1028 Ga0207700_10096966
1029 Ga0207700_10292563
1030 Ga0207664_10057424
1031 Ga0207664_10072546
1032 Ga0207664_10113373
1033 Ga0207664_10122040
1034 Ga0207664_10314591
1035 Ga0207664_10451890
1036 Ga0207664_10764259
1037 Ga0207664_10928835
1038 Ga0207664_10987792
1039 Ga0207664_10989163
1040 Ga0207686_10127755
1041 Ga0207686_11833320
1042 Ga0207709_10841877
1043 Ga0207670_11071895
1044 Ga0207669_10250615
1045 Ga0207704_10593070
1046 Ga0207665_10024809
1047 Ga0207711_11641882
1048 Ga0207689_10623387
1049 Ga0207661_10008390
1050 Ga0207661_10059027
1051 Ga0207661_10348524
1052 Ga0207667_10283952
1053 Ga0207667_10772745
1054 Ga0207651_10176076
1055 Ga0207651_11725640
1056 Ga0207668_11652451
1057 Ga0207640_10193672
1058 Ga0207658_10002202
1059 Ga0207703_10891275
1060 Ga0207703_11996392
1061 Ga0207678_10320017
1062 Ga0207708_10013451
1063 Ga0207702_10066307
1064 Ga0207702_10899281
1065 Ga0207641_10309263
1066 Ga0207648_11516523
1067 Ga0207683_10039633
1068 Ga0207683_10058739
1069 Ga0207698_10284592
1070 Ga0207428_10468142
1071 Ga0268266_10008552
1072 Ga0268264_10563685
1073 Ga0265326_10006779
1074 Ga0265319_1007032
1075 Ga0265319_1225651
1076 Ga0265334_10075204
1077 Ga0265334_10284215
1078 Ga0265318_10000309
1079 Ga0265323_10285130
1080 Ga0265322_10127989
1081 Ga0265322_10173787
1082 Ga0265336_10011250
1083 Ga0265336_10021573
1084 Ga0265338_10005814
1085 Ga0265338_10075845
1086 Ga0265338_10098223
1087 Ga0265338_10133021
1088 Ga0265338_10601875
1089 Ga0316181_1239539
1090 Ga0265330_10000870
1091 Ga0265330_10024138
1092 Ga0265332_10004318
1093 Ga0265332_10204785
1094 Ga0265328_10004480
1095 Ga0265320_10218834
1096 Ga0265320_10389745
1097 Ga0265325_10003460
1098 Ga0265325_10165945
1099 Ga0265325_10285259
1100 Ga0265329_10008950
1101 Ga0265329_10022225
1102 Ga0265340_10037137
1103 Ga0265340_10136945
1104 Ga0265339_10000850
1105 Ga0265339_10311499
1106 Ga0265331_10006738
1107 Ga0265327_10346927
1108 Ga0265316_10005758
1109 Ga0265316_10015813
1110 Ga0265316_10033380
1111 Ga0265316_10117691
1112 Ga0265316_10168621
1113 Ga0265316_10952939
1114 Ga0307408_100352044
1115 Ga0307408_100608552
1116 Ga0265313_10002480
1117 Ga0265313_10071132
1118 Ga0265313_10136911
1119 Ga0316575_10508028
1120 Ga0265314_10062107
1121 Ga0265314_10215175
1122 Ga0265314_10358944
1123 Ga0265342_10018745
1124 Ga0316576_10013514
1125 Ga0307405_10184192
1126 Ga0316577_10707399
1127 Ga0307410_11308767
1128 Ga0307412_10607984
1129 Ga0307415_101467069
1130 Ga0316583_10007229
1131 Ga0316580_10006254
1132 Ga0316593_10002697
1133 Ga0316593_10052215
1134 Ga0316593_10365203
1135 Ga0316593_10383520
1136 Ga0316592_1003342
1137 Ga0316586_1050275
1138 Ga0316587_1022583
1139 Ga0316587_1053290
1140 Ga0316596_1009001
1141 Ga0316596_1022867
1142 Ga0316596_1091406
1143 Ga0373951_0135795
1144 Ga0373954_0627656
1145 Ga0373960_0233240
1146 Ga0373943_0088136
1147 Ga0373946_0258540
1148 Ga0373946_0770300
1149 Ga0373955_0042452
1150 Ga0316574_0037933
1151 Ga0316574_0141492
1152 Ga0373935_0592647
1153 Ga0373947_0283808
1154 Ga0373937_0000556
1155 Ga0373937_0077045
1156 Ga0316582_0106118
1157 Ga0316582_0296904
1158 Ga0316582_1029506
1159 Ga0373925_0605581
1160 Ga0373925_1451637
1161 Ga0395899_0008779
1162 Ga0395899_0013473
1163 Ga0395899_0014016
1164 Ga0395899_0144931
1165 Ga0395899_0257297
1166 Ga0395899_0445548
1167 Ga0395899_0501922
1168 Ga0395899_0627526
1169 Ga0395899_0628224
1170 Ga0395900_0003410
1171 Ga0395900_0015740
1172 Ga0395900_0016452
1173 Ga0395900_0114140
1174 Ga0395900_0325752
1175 Ga0395900_0335234
1176 Ga0395900_0360376
1177 Ga0395900_0363773
1178 Ga0395900_0418283
1179 Ga0395900_0612425
1180 Ga0395900_1183035
1181 Ga0395898_0004636
1182 Ga0395898_0013510
1183 Ga0395898_0026565
1184 Ga0395898_0032034
1185 Ga0395898_0033773
1186 Ga0395898_0058571
1187 Ga0395898_0067485
1188 Ga0395898_0089733
1189 Ga0395898_0142508
1190 Ga0395898_0193486
1191 Ga0395898_0309665
1192 Ga0395898_0380715
1193 Ga0395898_0432902
1194 Ga0395898_0722098
1195 Ga0395898_0828001
1196 Ga0395905_0002779
1197 Ga0395905_0008273
1198 Ga0395905_0017609
1199 Ga0395905_0021362
1200 Ga0395905_0024341
1201 Ga0395905_0069899
1202 Ga0395905_0105862
1203 Ga0395905_0132708
1204 Ga0395905_0199992
1205 Ga0395905_0499264
1206 Ga0395905_1624328
1207 Ga0316581_0081734
1208 Ga0436364_0892201
1209 Ga0395901_0005128
1210 Ga0395901_0011953
1211 Ga0395901_0016806
1212 Ga0395901_0034480
1213 Ga0395901_0038915
1214 Ga0395901_0073783
1215 Ga0395901_0075129
1216 Ga0395901_0165894
1217 Ga0395901_0235142
1218 Ga0395901_0248967
1219 Ga0395901_0273786
1220 Ga0395901_0321777
1221 Ga0395901_0430597
1222 Ga0395901_0439386
1223 Ga0395901_0521560
1224 Ga0395901_0898965
1225 Ga0395901_1826241
1226 Ga0400490_07105
1227 Ga0400490_18978
1228 Ga0436360_0294018
1229 Ga0436360_0387295
1230 Ga0436363_0799049
1231 Ga0436363_1274357
1232 Ga0436362_0885277
1233 Ga0439447_084978
1234 Ga0439453_0097824
1235 Ga0451788_22619
1236 Ga0451794_54159
1237 Ga0451798_0853137
1238 Ga0451804_0440748
1239 Ga0451807_1198143
1240 Ga0451853_3415776
1241 Ga0439451_026368
1242 Ga0439454_091711
1243 Ga0439458_0159245
1244 Ga0451577_0011607
1245 Ga0451577_1645415
1246 Ga0439440_0062677
1247 Ga0466961_0100733
1248 Ga0466963_0014918
1249 Ga0466964_0037566
1250 Ga0466964_0089330
1251 Ga0466964_0248821
1252 Ga0453684_0006165
1253 Ga0453684_0404497
1254 Ga0453684_0490678
1255 Ga0453684_1767722
1256 Ga0466968_0184126
1257 Ga0466957_0013596
1258 Ga0466957_0247654
1259 Ga0466960_0012112
1260 Ga0466960_0554938
1261 Ga0466960_0614543
1262 Ga0451576_0040399
1263 Ga0451576_0194744
1264 Ga0466967_0026850
1265 Ga0466967_0055799
1266 Ga0466967_0120776
1267 Ga0466967_0147537
1268 Ga0466967_1730998
1269 Ga0466967_2546346
1270 Ga0495592_0000114
1271 Ga0495590_0076363
1272 Ga0495629_0212444
1273 Ga0495651_0000254
1274 Ga0495651_0078321
1275 Ga0495653_0020225
1276 Ga0495653_0051397
1277 Ga0495605_0175751
1278 Ga0495664_0323446
1279 Ga0495584_0139587
1280 Ga0495584_0446926
1281 Ga0495596_0220966
1282 Ga0495607_0529795
1283 Ga0495608_0069748
1284 Ga0495608_0223211
1285 Ga0495616_0292362
1286 Ga0495618_0002678
1287 Ga0495618_0314574
1288 Ga0495620_0120155
1289 Ga0495628_0000310
1290 Ga0495628_0362808
1291 Ga0495630_0027985
1292 Ga0495630_0228178
1293 Ga0495631_0128693
1294 Ga0495663_0120678
1295 Ga0495642_0038379
1296 Ga0495642_0394315
1297 Ga0495652_0000144
1298 Ga0495652_0144234
1299 Ga0495640_0505828
1300 Ga0495640_0619924
1301 Ga0495587_0000060
1302 Ga0495587_0451494
1303 Ga0495598_0179582
1304 Ga0495621_0024289
1305 Ga0495621_0223325
1306 Ga0495645_0000054
1307 Ga0495656_0201051
1308 Ga0495656_0701193
1309 Ga0495668_0624504
1310 Ga0495634_0213352
1311 Ga0495635_0195449
1312 Ga0495635_0490573
1313 Ga0495659_0008504
1314 Ga0495661_0042809
1315 Ga0495661_0299759
1316 Ga0495657_0091834
1317 Ga0495657_0098441
1318 Ga0495599_0000048
1319 Ga0495623_0000838
1320 Ga0495623_0129997
1321 Ga0495658_0186459
1322 Ga0495613_0053815
1323 Ga0495613_1010521
1324 Ga0495624_0176497
1325 Ga0495671_0332837
1326 Ga0495600_0010048
1327 Ga0495600_0221156
1328 Ga0495600_0375946
1329 Ga0495604_0000043
1330 Ga0495604_0085044
1331 Ga0495674_0030037
1332 Ga0495680_0001621
1333 Ga0495680_0009485
1334 Ga0495680_0137727
1335 Ga0495683_0332676
1336 Ga0495675_0000041
1337 Ga0495675_0290201
1338 Ga0495684_0027976
1339 Ga0495684_0112194
1340 Ga0495602_0000931
1341 Ga0495602_0099402
1342 Ga0495615_0265222
1343 Ga0496100_1424415
1344 Ga0496101_0006135
1345 Ga0496101_0157478
1346 Ga0496101_1096221
1347 Ga0496102_1006640
1348 Ga0496104_0044677
1349 Ga0496104_1235703
1350 Ga0496105_0533384
1351 Ga0496105_0593165
1352 Ga0496105_0772350
1353 Ga0496106_0005968
1354 Ga0496107_0932642
1355 Ga0496108_0085413
1356 Ga0496108_1076327
1357 Ga0496109_0001583
1358 Ga0496109_0152497
1359 Ga0496110_0046541
1360 Ga0496110_0491042
1361 Ga0496111_0076053
1362 Ga0496112_0049451
1363 Ga0496112_0270347
1364 Ga0496112_0285334
1365 Ga0496112_0384745
1366 Ga0496112_0491819
1367 Ga0496112_0536818
1368 Ga0496112_0556662
1369 Ga0496113_0948449
1370 Ga0496114_1532544
1371 Ga0496125_0004021
1372 Ga0501317_047014
1373 Ga0501031_0931617
1374 Ga0501034_0149229
1375 Ga0501034_0342337
1376 Ga0501034_0460573
1377 Ga0501036_1140994
1378 Ga0501038_0281515
1379 Ga0501039_0796847
1380 Ga0501040_0463882
1381 Ga0501042_0194945
1382 Ga0501047_0203413
1383 Ga0501047_0259871
1384 Ga0501048_0365111
1385 Ga0501067_0041531
1386 Ga0501067_0194312
1387 Ga0501067_0200031
1388 Ga0501068_0132740
1389 Ga0501069_0056496
1390 Ga0501070_0018413
1391 Ga0501070_0161891
1392 Ga0501070_0167203
1393 Ga0501073_0895744
1394 Ga0501074_0049602
1395 Ga0501074_0104777
1396 Ga0501074_0229648
1397 Ga0501074_0371278
1398 Ga0501075_0255692
1399 Ga0501076_0383537
1400 Ga0501076_0693624
1401 Ga0501076_0888319
1402 Ga0501077_0114995
1403 Ga0501077_0378857
1404 Ga0501077_0408365
1405 Ga0501079_0397735
1406 Ga0501080_0259660
1407 Ga0501081_0491923
1408 Ga0501081_0707166
1409 Ga0501083_0363837
1410 Ga0501035_0026873
1411 Ga0501035_0135908
1412 Ga0501044_0752314
1413 nmdc:mga00v17_964323_c1
1414 nmdc:mga06z11_957140_c1
1415 nmdc:mga05p37_15718_c1
1416 nmdc:mga05p37_178788_c1
1417 nmdc:mga05p37_352791_c1
1418 nmdc:mga05p37_458925_c1
1419 nmdc:mga05p37_712228_c1
1420 nmdc:mga06r32_486752_c1
1421 nmdc:mga06r32_729658_c1
1422 nmdc:mga0n895_11599_c1
1423 nmdc:mga0n895_1211904_c1
1424 nmdc:mga0n895_142965_c1
1425 nmdc:mga0n895_1579_c1
1426 nmdc:mga0n895_189780_c1
1427 nmdc:mga0n895_24369_c1
1428 nmdc:mga0n895_283120_c1
1429 nmdc:mga0n895_708334_c1
1430 nmdc:mga0n895_908830_c1
1431 nmdc:mga0rr50_12450_c1
1432 nmdc:mga0rr50_263276_c1
1433 nmdc:mga0rr50_69422_c1
1434 nmdc:mga08x19_34195_c1
1435 nmdc:mga08x19_529080_c1
1436 nmdc:mga08x19_543957_c1
1437 nmdc:mga08x19_87149_c1
1438 nmdc:mga0a205_142339_c1
1439 nmdc:mga0a205_414352_c1
1440 nmdc:mga0a205_458467_c1
1441 nmdc:mga0a205_515_c1
1442 Ga0495601_0000084
1443 Ga0495601_0043279
1444 Ga0495601_0520345
1445 Ga0495601_0909589
1446 Ga0495612_0057539
1447 Ga0495655_0071771
1448 Ga0495595_0125103
1449 Ga0495619_0003387
1450 Ga0501084_0176410
1451 Ga0501084_0291259
1452 Ga0590071_000248
1453 Ga0590071_020897
1454 Ga0590075_002960
1455 Ga0590075_058514
1456 Ga0587071_179159
1457 Ga0501082_0224351
1458 Ga0530510_0015703
1459 2523466055
1460 2739347251
1461 2745170159
1462 2817616441
1463 2857472338
1464 2898908932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00542

Ribosomal_L12

Ribosomal protein L7/L12 C-terminal domain

63

129

0.99

PF16320

Ribosomal_L12_N

Ribosomal protein L7/L12 dimerisation domain

6

54

0.85

Map