F478039

General Info

Members Datasets Scaffolds Average Seq Length
732 312 1464 89

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10125319|Ga0265314_101253192
Length 97
Sequence VVTDHGAVMASAEVLIVNKLGLHARASAKLTQVASGFACEVWLSRNGRRVNAKSIMGVMMLAAGKGASITIDAQGEDAEAALAALQKLIADKFDEGE

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
211 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
212 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
292 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10125319 3300031711 Bacteria 1610
2 JGI24742J22300_10095773 3300002244 Bacteria 571
3 Ga0065707_10026945 3300005295 Bacteria 1605
4 Ga0065707_10972970 3300005295 Bacteria 546
5 Ga0070690_100001184 3300005330 Bacteria 13432
6 Ga0070690_100243928 3300005330 Bacteria 1268
7 Ga0070690_100414379 3300005330 Bacteria 992
8 Ga0070677_10355103 3300005333 Bacteria 760
9 Ga0068869_100000600 3300005334 Bacteria 20255
10 Ga0068869_100224306 3300005334 Bacteria 1491
11 Ga0068869_100404177 3300005334 Bacteria 1124
12 Ga0070666_10128167 3300005335 Bacteria 1762
13 Ga0070666_10369277 3300005335 Bacteria 1029
14 Ga0070680_100000089 3300005336 Bacteria 51222
15 Ga0070682_100002252 3300005337 Bacteria 10695
16 Ga0070682_100028730 3300005337 Bacteria 3346
17 Ga0070682_100841674 3300005337 Bacteria 749
18 Ga0068868_100002798 3300005338 Bacteria 12085
19 Ga0068868_100042982 3300005338 Bacteria 3529
20 Ga0070660_100542365 3300005339 Bacteria 970
21 Ga0070689_100004821 3300005340 Bacteria 9154
22 Ga0070689_100025972 3300005340 Bacteria 4404
23 Ga0070691_10000090 3300005341 Bacteria 25810
24 Ga0070691_10028938 3300005341 Bacteria 2591
25 Ga0070687_100017852 3300005343 Bacteria 3272
26 Ga0070687_100595335 3300005343 Bacteria 759
27 Ga0070661_100173522 3300005344 Bacteria 1638
28 Ga0070692_10070113 3300005345 Bacteria 1866
29 Ga0070692_10091718 3300005345 Bacteria 1653
30 Ga0070692_10415411 3300005345 Bacteria 853
31 Ga0070668_100483529 3300005347 Bacteria 1069
32 Ga0070669_100185059 3300005353 Bacteria 1631
33 Ga0070671_100340693 3300005355 Bacteria 1279
34 Ga0070674_100107291 3300005356 Bacteria 2044
35 Ga0070674_100371704 3300005356 Bacteria 1160
36 Ga0070673_100283171 3300005364 Bacteria 1454
37 Ga0070673_101067474 3300005364 Bacteria 754
38 Ga0070688_100198650 3300005365 Bacteria 1402
39 Ga0070688_100514427 3300005365 Bacteria 905
40 Ga0070688_100769215 3300005365 Bacteria 751
41 Ga0070688_100815422 3300005365 Bacteria 731
42 Ga0070667_101375174 3300005367 Bacteria 662
43 Ga0070703_10067520 3300005406 Bacteria 1186
44 Ga0070703_10169550 3300005406 Bacteria 835
45 Ga0070713_101602418 3300005436 Bacteria 632
46 Ga0070701_10003274 3300005438 Bacteria 6380
47 Ga0070701_10197803 3300005438 Bacteria 1186
48 Ga0070701_10238390 3300005438 Bacteria 1093
49 Ga0070701_10369637 3300005438 Bacteria 901
50 Ga0070701_10414381 3300005438 Bacteria 857
51 Ga0070701_10689971 3300005438 Bacteria 686
52 Ga0070701_11071515 3300005438 Bacteria 566
53 Ga0070711_100237339 3300005439 Bacteria 1424
54 Ga0070711_101658153 3300005439 Bacteria 560
55 Ga0070705_100000867 3300005440 Bacteria 16937
56 Ga0070705_100087446 3300005440 Bacteria 1932
57 Ga0070705_100448487 3300005440 Bacteria 967
58 Ga0070705_101141861 3300005440 Unclassified 639
59 Ga0070700_100007592 3300005441 Bacteria 5865
60 Ga0070700_100172205 3300005441 Bacteria 1500
61 Ga0070700_101111371 3300005441 Bacteria 656
62 Ga0070700_101212310 3300005441 Bacteria 631
63 Ga0070694_100002010 3300005444 Bacteria 12085
64 Ga0070694_100022272 3300005444 Bacteria 4059
65 Ga0070694_100125400 3300005444 Bacteria 1848
66 Ga0070694_100152704 3300005444 Bacteria 1688
67 Ga0070694_100160773 3300005444 Bacteria 1648
68 Ga0070694_100305254 3300005444 Bacteria 1221
69 Ga0070694_100680417 3300005444 Unclassified 835
70 Ga0070678_100157080 3300005456 Bacteria 1838
71 Ga0070678_100617056 3300005456 Bacteria 970
72 Ga0070662_100233572 3300005457 Bacteria 1472
73 Ga0070662_100394583 3300005457 Bacteria 1141
74 Ga0070681_10155761 3300005458 Bacteria 2210
75 Ga0070681_10156429 3300005458 Bacteria 2204
76 Ga0070681_10221411 3300005458 Bacteria 1807
77 Ga0070681_10323045 3300005458 Bacteria 1453
78 Ga0070681_10774894 3300005458 Bacteria 876
79 Ga0068867_100001413 3300005459 Bacteria 16602
80 Ga0068867_100093382 3300005459 Bacteria 2287
81 Ga0068867_100546459 3300005459 Bacteria 1003
82 Ga0068867_100771880 3300005459 Bacteria 855
83 Ga0068867_101381210 3300005459 Bacteria 652
84 Ga0070685_10302792 3300005466 Bacteria 1078
85 Ga0070685_10665633 3300005466 Bacteria 756
86 Ga0070706_100264575 3300005467 Bacteria 1605
87 Ga0070707_100147344 3300005468 Bacteria 2291
88 Ga0070707_100884355 3300005468 Bacteria 858
89 Ga0070698_100065031 3300005471 Bacteria 3673
90 Ga0070698_100207196 3300005471 Bacteria 1896
91 Ga0070679_100014304 3300005530 Bacteria 7621
92 Ga0070679_100239553 3300005530 Bacteria 1772
93 Ga0070679_101445916 3300005530 Bacteria 634
94 Ga0070684_100269768 3300005535 Bacteria 1558
95 Ga0070684_100445826 3300005535 Bacteria 1196
96 Ga0070684_100523638 3300005535 Bacteria 1099
97 Ga0070697_100667959 3300005536 Bacteria 916
98 Ga0070697_101799730 3300005536 Bacteria 548
99 Ga0068853_100411260 3300005539 Bacteria 1267
100 Ga0068853_100803785 3300005539 Bacteria 901
101 Ga0068853_101167316 3300005539 Bacteria 743
102 Ga0070672_100264553 3300005543 Bacteria 1451
103 Ga0070686_100001706 3300005544 Bacteria 12291
104 Ga0070686_100069193 3300005544 Bacteria 2305
105 Ga0070686_100941852 3300005544 Bacteria 705
106 Ga0070695_100001399 3300005545 Bacteria 13371
107 Ga0070695_100017304 3300005545 Bacteria 4370
108 Ga0070695_100254012 3300005545 Bacteria 1281
109 Ga0070695_100525526 3300005545 Bacteria 919
110 Ga0070695_100546385 3300005545 Unclassified 902
111 Ga0070696_100002891 3300005546 Bacteria 11419
112 Ga0070696_100050562 3300005546 Bacteria 2889
113 Ga0070696_100269771 3300005546 Bacteria 1293
114 Ga0070693_100000477 3300005547 Bacteria 17942
115 Ga0070693_100098325 3300005547 Bacteria 1778
116 Ga0070693_100464688 3300005547 Bacteria 891
117 Ga0070665_100178488 3300005548 Bacteria 2125
118 Ga0070704_100001643 3300005549 Bacteria 12121
119 Ga0070704_100016050 3300005549 Bacteria 4723
120 Ga0070704_100061996 3300005549 Bacteria 2679
121 Ga0070704_100296403 3300005549 Bacteria 1346
122 Ga0070704_100473974 3300005549 Bacteria 1082
123 Ga0070704_100515031 3300005549 Unclassified 1040
124 Ga0070704_100526296 3300005549 Bacteria 1030
125 Ga0070704_100677086 3300005549 Bacteria 913
126 Ga0070704_100807613 3300005549 Bacteria 839
127 Ga0070704_100898278 3300005549 Bacteria 797
128 Ga0070704_101786474 3300005549 Bacteria 569
129 Ga0070704_101817805 3300005549 Bacteria 564
130 Ga0068855_100007998 3300005563 Bacteria 12773
131 Ga0068855_100398837 3300005563 Bacteria 1508
132 Ga0070664_101192880 3300005564 Bacteria 718
133 Ga0068854_100010099 3300005578 Bacteria 6116
134 Ga0068856_100145942 3300005614 Bacteria 2374
135 Ga0068856_100177341 3300005614 Bacteria 2144
136 Ga0068856_101295482 3300005614 Bacteria 744
137 Ga0070702_100000452 3300005615 Bacteria 14615
138 Ga0070702_100040342 3300005615 Bacteria 2611
139 Ga0070702_100337691 3300005615 Bacteria 1056
140 Ga0068852_100048493 3300005616 Bacteria 3629
141 Ga0068852_100241754 3300005616 Bacteria 1726
142 Ga0068859_100009178 3300005617 Bacteria 9986
143 Ga0068859_100058009 3300005617 Bacteria 3899
144 Ga0068859_100112800 3300005617 Bacteria 2782
145 Ga0068859_100244770 3300005617 Bacteria 1883
146 Ga0068859_100386610 3300005617 Bacteria 1495
147 Ga0068859_101157152 3300005617 Bacteria 852
148 Ga0068864_100035096 3300005618 Bacteria 4268
149 Ga0068864_100516539 3300005618 Bacteria 1151
150 Ga0068866_10003697 3300005718 Bacteria 6268
151 Ga0068866_10078129 3300005718 Bacteria 1770
152 Ga0068861_100001570 3300005719 Bacteria 14527
153 Ga0068861_101406482 3300005719 Bacteria 682
154 Ga0068870_10646578 3300005840 Bacteria 724
155 Ga0068870_11226641 3300005840 Bacteria 544
156 Ga0068863_100064198 3300005841 Bacteria 3473
157 Ga0068863_100069502 3300005841 Bacteria 3330
158 Ga0068863_100080466 3300005841 Bacteria 3086
159 Ga0068863_101590109 3300005841 Bacteria 663
160 Ga0068858_100005045 3300005842 Bacteria 12942
161 Ga0068858_100814015 3300005842 Bacteria 911
162 Ga0068858_101048872 3300005842 Bacteria 800
163 Ga0068860_100005089 3300005843 Bacteria 13371
164 Ga0068860_100126370 3300005843 Bacteria 2451
165 Ga0068860_100251128 3300005843 Bacteria 1722
166 Ga0068860_100254166 3300005843 Bacteria 1712
167 Ga0068860_100282401 3300005843 Bacteria 1623
168 Ga0068862_100003474 3300005844 Bacteria 13542
169 Ga0068862_100473044 3300005844 Bacteria 1185
170 Ga0068862_100516787 3300005844 Bacteria 1136
171 Ga0068862_100613691 3300005844 Bacteria 1046
172 Ga0068862_100909257 3300005844 Bacteria 866
173 Ga0070717_10208813 3300006028 Bacteria 1713
174 Ga0070715_10060662 3300006163 Bacteria 1659
175 Ga0070715_10131022 3300006163 Bacteria 1207
176 Ga0070716_100734672 3300006173 Bacteria 758
177 Ga0070712_100912264 3300006175 Bacteria 758
178 Ga0070712_101247507 3300006175 Bacteria 647
179 Ga0075366_10164038 3300006195 Bacteria 1347
180 Ga0097621_100004855 3300006237 Bacteria 9419
181 Ga0097621_100013797 3300006237 Bacteria 6032
182 Ga0097621_100091546 3300006237 Bacteria 2545
183 Ga0097621_100342415 3300006237 Bacteria 1328
184 Ga0097621_101804987 3300006237 Bacteria 583
185 Ga0068871_100000744 3300006358 Bacteria 22076
186 Ga0068871_100005380 3300006358 Bacteria 8970
187 Ga0075428_100001109 3300006844 Bacteria 28681
188 Ga0075428_100325387 3300006844 Bacteria 1651
189 Ga0075431_100002501 3300006847 Bacteria 17729
190 Ga0075431_102222978 3300006847 Bacteria 503
191 Ga0075433_10001605 3300006852 Bacteria 16762
192 Ga0075433_10279536 3300006852 Bacteria 1479
193 Ga0075433_10594418 3300006852 Bacteria 972
194 Ga0075434_100000018 3300006871 Bacteria 73715
195 Ga0075434_102219394 3300006871 Bacteria 553
196 Ga0075429_100000103 3300006880 Bacteria 47421
197 Ga0075429_100000175 3300006880 Bacteria 41423
198 Ga0068865_100001413 3300006881 Bacteria 13989
199 Ga0068865_100166350 3300006881 Bacteria 1687
200 Ga0068865_100436594 3300006881 Bacteria 1080
201 Ga0075436_100000651 3300006914 Bacteria 22851
202 Ga0075436_100108909 3300006914 Bacteria 1933
203 Ga0075436_100148882 3300006914 Bacteria 1646
204 Ga0075436_100776100 3300006914 Bacteria 713
205 Ga0097620_100009178 3300006931 Bacteria 9986
206 Ga0097620_100058007 3300006931 Bacteria 3899
207 Ga0097620_100112807 3300006931 Bacteria 2782
208 Ga0097620_100244786 3300006931 Bacteria 1883
209 Ga0097620_100386594 3300006931 Bacteria 1495
210 Ga0097620_101157119 3300006931 Bacteria 852
211 Ga0075435_100049945 3300007076 Bacteria 3365
212 Ga0075435_100719257 3300007076 Bacteria 868
213 Ga0075435_100892623 3300007076 Bacteria 775
214 Ga0099794_10116642 3300007265 Bacteria 1341
215 Ga0105250_10067554 3300009092 Bacteria 1442
216 Ga0111539_10111527 3300009094 Bacteria 3209
217 Ga0111539_10111541 3300009094 Bacteria 3209
218 Ga0111539_10114418 3300009094 Bacteria 3164
219 Ga0111539_10150662 3300009094 Bacteria 2722
220 Ga0111539_10393447 3300009094 Bacteria 1614
221 Ga0111539_11050375 3300009094 Bacteria 947
222 Ga0111539_12155798 3300009094 Bacteria 647
223 Ga0105245_10003518 3300009098 Bacteria 14009
224 Ga0105245_10147471 3300009098 Bacteria 2221
225 Ga0105245_10156523 3300009098 Bacteria 2158
226 Ga0105247_10057434 3300009101 Bacteria 2406
227 Ga0114129_10002499 3300009147 Bacteria 25510
228 Ga0114129_10099854 3300009147 Bacteria 4016
229 Ga0114129_11453936 3300009147 Bacteria 844
230 Ga0105243_10003728 3300009148 Bacteria 12223
231 Ga0105243_10622308 3300009148 Bacteria 1042
232 Ga0105243_10837726 3300009148 Bacteria 910
233 Ga0105241_10008217 3300009174 Bacteria 7684
234 Ga0105241_10128887 3300009174 Bacteria 2046
235 Ga0105241_10394165 3300009174 Bacteria 1213
236 Ga0105242_10001851 3300009176 Bacteria 16595
237 Ga0105242_10020279 3300009176 Bacteria 5211
238 Ga0105242_10051637 3300009176 Bacteria 3351
239 Ga0105242_10456953 3300009176 Bacteria 1205
240 Ga0105242_10686070 3300009176 Bacteria 1000
241 Ga0105242_11522409 3300009176 Bacteria 700
242 Ga0105248_10009251 3300009177 Bacteria 10842
243 Ga0105248_10429617 3300009177 Bacteria 1488
244 Ga0105248_10979487 3300009177 Bacteria 955
245 Ga0105248_12336364 3300009177 Bacteria 609
246 Ga0105237_11016455 3300009545 Bacteria 836
247 Ga0105237_12750167 3300009545 Bacteria 503
248 Ga0105238_10088214 3300009551 Bacteria 3088
249 Ga0105249_10000917 3300009553 Bacteria 26070
250 Ga0105249_10245316 3300009553 Bacteria 1773
251 Ga0105249_11280102 3300009553 Bacteria 805
252 Ga0105249_11372258 3300009553 Bacteria 779
253 Ga0105239_10080203 3300010375 Bacteria 3591
254 Ga0105239_10376863 3300010375 Bacteria 1604
255 Ga0105246_10281472 3300011119 Bacteria 1334
256 Ga0105246_10631986 3300011119 Bacteria 929
257 Ga0157339_1002947 3300012505 Bacteria 1191
258 Ga0157369_10350084 3300013105 Bacteria 1534
259 Ga0157369_10655345 3300013105 Bacteria 1082
260 Ga0157369_10760154 3300013105 Bacteria 997
261 Ga0157374_10343467 3300013296 Bacteria 1482
262 Ga0157374_11377663 3300013296 Bacteria 728
263 Ga0157378_10315201 3300013297 Bacteria 1518
264 Ga0163162_10065303 3300013306 Bacteria 3686
265 Ga0163162_10392497 3300013306 Bacteria 1520
266 Ga0157372_10072658 3300013307 Bacteria 3877
267 Ga0157372_10993695 3300013307 Bacteria 972
268 Ga0157372_11269772 3300013307 Bacteria 850
269 Ga0157372_12453978 3300013307 Bacteria 599
270 Ga0157375_10264563 3300013308 Bacteria 1881
271 Ga0157375_10898031 3300013308 Bacteria 1030
272 Ga0163163_10357049 3300014325 Bacteria 1518
273 Ga0163163_13273661 3300014325 Bacteria 505
274 Ga0157380_10100784 3300014326 Bacteria 2405
275 Ga0157380_10109791 3300014326 Bacteria 2315
276 Ga0157380_10113035 3300014326 Bacteria 2286
277 Ga0157380_11147971 3300014326 Bacteria 818
278 Ga0157377_10281781 3300014745 Bacteria 1090
279 Ga0157377_10297958 3300014745 Bacteria 1063
280 Ga0157377_10367218 3300014745 Bacteria 970
281 Ga0157379_10017026 3300014968 Bacteria 6398
282 Ga0157379_10039178 3300014968 Bacteria 4228
283 Ga0157379_10112014 3300014968 Bacteria 2452
284 Ga0157376_10010610 3300014969 Bacteria 6747
285 Ga0157376_10127648 3300014969 Bacteria 2264
286 Ga0157376_11362719 3300014969 Bacteria 740
287 Ga0163161_10022441 3300017792 Bacteria 4445
288 Ga0163161_11525790 3300017792 Bacteria 587
289 Ga0163161_11555311 3300017792 Bacteria 582
290 Ga0206356_10226033 3300020070 Bacteria 930
291 Ga0207653_10043198 3300025885 Bacteria 1484
292 Ga0207642_10001241 3300025899 Bacteria 7896
293 Ga0207642_10032002 3300025899 Bacteria 2210
294 Ga0207642_10093488 3300025899 Bacteria 1491
295 Ga0207688_10007284 3300025901 Bacteria 6021
296 Ga0207680_10068338 3300025903 Bacteria 2192
297 Ga0207680_10427235 3300025903 Bacteria 939
298 Ga0207685_10044217 3300025905 Bacteria 1682
299 Ga0207685_10082632 3300025905 Bacteria 1333
300 Ga0207699_10302076 3300025906 Bacteria 1118
301 Ga0207643_10196116 3300025908 Bacteria 1228
302 Ga0207643_10582740 3300025908 Bacteria 719
303 Ga0207654_10007036 3300025911 Bacteria 5666
304 Ga0207654_10402696 3300025911 Bacteria 952
305 Ga0207707_10199250 3300025912 Bacteria 1746
306 Ga0207707_10288982 3300025912 Bacteria 1419
307 Ga0207707_10399865 3300025912 Bacteria 1179
308 Ga0207663_10035399 3300025916 Bacteria 2995
309 Ga0207663_10273570 3300025916 Bacteria 1252
310 Ga0207663_10807369 3300025916 Bacteria 747
311 Ga0207660_10002436 3300025917 Bacteria 12221
312 Ga0207662_10025391 3300025918 Bacteria 3412
313 Ga0207662_10123482 3300025918 Bacteria 1626
314 Ga0207662_10294178 3300025918 Bacteria 1078
315 Ga0207657_10650713 3300025919 Bacteria 820
316 Ga0207652_10035243 3300025921 Bacteria 4222
317 Ga0207652_10291093 3300025921 Bacteria 1473
318 Ga0207646_10543368 3300025922 Bacteria 1045
319 Ga0207646_10670784 3300025922 Bacteria 928
320 Ga0207646_11313660 3300025922 Bacteria 631
321 Ga0207681_10303063 3300025923 Bacteria 1265
322 Ga0207687_10004970 3300025927 Bacteria 8814
323 Ga0207687_10099059 3300025927 Bacteria 2141
324 Ga0207687_10158010 3300025927 Bacteria 1737
325 Ga0207700_10363307 3300025928 Bacteria 1263
326 Ga0207644_10260917 3300025931 Bacteria 1385
327 Ga0207644_10362168 3300025931 Bacteria 1180
328 Ga0207706_10406793 3300025933 Bacteria 1180
329 Ga0207686_10000992 3300025934 Bacteria 16854
330 Ga0207686_10017224 3300025934 Bacteria 4068
331 Ga0207686_10087557 3300025934 Bacteria 2048
332 Ga0207686_10152117 3300025934 Bacteria 1612
333 Ga0207686_10260607 3300025934 Bacteria 1271
334 Ga0207709_10001315 3300025935 Bacteria 17635
335 Ga0207670_10013013 3300025936 Bacteria 4892
336 Ga0207670_10054367 3300025936 Bacteria 2701
337 Ga0207670_10101688 3300025936 Bacteria 2054
338 Ga0207670_10509641 3300025936 Bacteria 978
339 Ga0207669_10430694 3300025937 Bacteria 1040
340 Ga0207669_10483061 3300025937 Bacteria 988
341 Ga0207669_10643193 3300025937 Bacteria 866
342 Ga0207704_10000483 3300025938 Bacteria 17756
343 Ga0207704_10041711 3300025938 Bacteria 2694
344 Ga0207704_10338462 3300025938 Bacteria 1167
345 Ga0207704_11245053 3300025938 Bacteria 635
346 Ga0207665_10052071 3300025939 Bacteria 2757
347 Ga0207665_10071683 3300025939 Bacteria 2365
348 Ga0207691_11645094 3300025940 Bacteria 521
349 Ga0207711_10273400 3300025941 Bacteria 1555
350 Ga0207711_11916543 3300025941 Bacteria 535
351 Ga0207689_10000544 3300025942 Bacteria 35849
352 Ga0207689_10001506 3300025942 Bacteria 22191
353 Ga0207689_10320071 3300025942 Bacteria 1287
354 Ga0207661_10201412 3300025944 Bacteria 1750
355 Ga0207661_10800155 3300025944 Bacteria 868
356 Ga0207679_10266719 3300025945 Bacteria 1463
357 Ga0207667_10008307 3300025949 Bacteria 12352
358 Ga0207667_10729005 3300025949 Bacteria 992
359 Ga0207651_10684299 3300025960 Bacteria 902
360 Ga0207651_11114864 3300025960 Bacteria 707
361 Ga0207712_10026729 3300025961 Bacteria 3848
362 Ga0207712_10174142 3300025961 Bacteria 1685
363 Ga0207712_11096434 3300025961 Bacteria 708
364 Ga0207712_11501058 3300025961 Bacteria 604
365 Ga0207668_11155302 3300025972 Bacteria 695
366 Ga0207640_10025995 3300025981 Bacteria 3550
367 Ga0207658_11771867 3300025986 Bacteria 564
368 Ga0207677_10003254 3300026023 Bacteria 8578
369 Ga0207677_10896672 3300026023 Bacteria 799
370 Ga0207703_10050727 3300026035 Bacteria 3360
371 Ga0207639_10161964 3300026041 Bacteria 1886
372 Ga0207639_11357310 3300026041 Bacteria 667
373 Ga0207708_10233289 3300026075 Bacteria 1478
374 Ga0207708_10237392 3300026075 Bacteria 1465
375 Ga0207708_10443545 3300026075 Bacteria 1080
376 Ga0207708_11969439 3300026075 Bacteria 512
377 Ga0207702_10022953 3300026078 Bacteria 5176
378 Ga0207702_10099129 3300026078 Bacteria 2568
379 Ga0207702_10276058 3300026078 Bacteria 1587
380 Ga0207641_10330708 3300026088 Bacteria 1447
381 Ga0207641_10483765 3300026088 Bacteria 1200
382 Ga0207641_10597084 3300026088 Bacteria 1080
383 Ga0207641_11107543 3300026088 Bacteria 790
384 Ga0207648_10000135 3300026089 Bacteria 73544
385 Ga0207648_10018245 3300026089 Bacteria 6356
386 Ga0207648_10228858 3300026089 Bacteria 1653
387 Ga0207648_10234133 3300026089 Bacteria 1634
388 Ga0207648_10796485 3300026089 Bacteria 879
389 Ga0207676_10009765 3300026095 Bacteria 6826
390 Ga0207676_10383231 3300026095 Bacteria 1309
391 Ga0207676_11569195 3300026095 Bacteria 656
392 Ga0207674_10275248 3300026116 Bacteria 1631
393 Ga0207675_100000825 3300026118 Bacteria 30861
394 Ga0207675_100023033 3300026118 Bacteria 5793
395 Ga0207675_100694982 3300026118 Bacteria 1026
396 Ga0207675_101953010 3300026118 Bacteria 605
397 Ga0207683_10042184 3300026121 Bacteria 3984
398 Ga0207683_10099514 3300026121 Bacteria 2595
399 Ga0207698_10019299 3300026142 Bacteria 4665
400 Ga0207698_10072032 3300026142 Bacteria 2745
401 Ga0209588_1022157 3300027671 Bacteria 1999
402 Ga0207428_10000265 3300027907 Bacteria 70984
403 Ga0207428_10109225 3300027907 Bacteria 2130
404 Ga0268266_10143459 3300028379 Bacteria 2145
405 Ga0268265_10002564 3300028380 Bacteria 13587
406 Ga0268265_10106540 3300028380 Bacteria 2277
407 Ga0268265_10299679 3300028380 Bacteria 1447
408 Ga0268265_10300707 3300028380 Bacteria 1445
409 Ga0268265_10793599 3300028380 Bacteria 922
410 Ga0268264_10001495 3300028381 Bacteria 21802
411 Ga0268264_10191662 3300028381 Bacteria 1864
412 Ga0268264_10339973 3300028381 Bacteria 1425
413 Ga0265336_10048081 3300028666 Bacteria 1294
414 Ga0265324_10000638 3300029957 Bacteria 23778
415 Ga0265325_10036677 3300031241 Bacteria 2596
416 Ga0265331_10173266 3300031250 Bacteria 976
417 Ga0307408_100345867 3300031548 Bacteria 1260
418 Ga0307408_100467089 3300031548 Bacteria 1098
419 Ga0307408_101375881 3300031548 Bacteria 664
420 Ga0307408_101902897 3300031548 Bacteria 570
421 Ga0265314_10001595 3300031711 Bacteria 24937
422 Ga0307405_12110474 3300031731 Bacteria 506
423 Ga0373930_0000750 3300034816 Bacteria 4602
424 Ga0373930_0038076 3300034816 Bacteria 1015
425 Ga0373948_0050680 3300034817 Bacteria 891
426 Ga0373958_0010504 3300034819 Bacteria 1546
427 Ga0373959_0019020 3300034820 Bacteria 1297
428 Ga0373959_0040768 3300034820 Bacteria 973
429 Ga0373938_0048666 3300034957 Bacteria 962
430 Ga0373938_0057860 3300034957 Bacteria 900
431 Ga0373938_0222853 3300034957 Bacteria 530
432 Ga0373926_0014875 3300035083 Bacteria 2649
433 Ga0373928_0074707 3300035084 Bacteria 845
434 Ga0373928_0113394 3300035084 Bacteria 719
435 Ga0373928_0200493 3300035084 Bacteria 575
436 Ga0373929_0003502 3300035085 Bacteria 2826
437 Ga0373940_0010236 3300035088 Bacteria 2200
438 Ga0373944_0008517 3300035089 Bacteria 2771
439 Ga0373949_0101895 3300035090 Bacteria 787
440 Ga0373951_0012238 3300035091 Bacteria 1929
441 Ga0373923_0085334 3300035111 Bacteria 1374
442 Ga0373932_0001394 3300035112 Bacteria 6773
443 Ga0373932_0038195 3300035112 Bacteria 1372
444 Ga0373936_0011508 3300035113 Bacteria 3350
445 Ga0373936_0025859 3300035113 Bacteria 2297
446 Ga0373936_0032734 3300035113 Bacteria 2057
447 Ga0373939_0014234 3300035114 Bacteria 2061
448 Ga0373941_0033892 3300035115 Bacteria 1537
449 Ga0373945_0000490 3300035116 Bacteria 11249
450 Ga0373945_0030544 3300035116 Bacteria 1900
451 Ga0373953_0028763 3300035117 Bacteria 2145
452 Ga0373954_0009507 3300035118 Bacteria 4276
453 Ga0373954_0016658 3300035118 Bacteria 3292
454 Ga0373956_0162252 3300035119 Bacteria 1053
455 Ga0373957_0004401 3300035120 Bacteria 4284
456 Ga0373960_0020225 3300035121 Bacteria 1758
457 Ga0373960_0253274 3300035121 Bacteria 640
458 Ga0373960_0437636 3300035121 Bacteria 510
459 Ga0373943_0035914 3300035170 Bacteria 2371
460 Ga0373943_0175008 3300035170 Bacteria 1176
461 Ga0373946_0010712 3300035171 Bacteria 3403
462 Ga0373955_0131984 3300035172 Bacteria 1458
463 Ga0373942_0025750 3300035207 Bacteria 1518
464 Ga0373942_0150427 3300035207 Bacteria 747
465 Ga0373942_0238994 3300035207 Bacteria 614
466 Ga0373961_0068209 3300035241 Bacteria 1095
467 Ga0373961_0146716 3300035241 Bacteria 801
468 Ga0373961_0222526 3300035241 Bacteria 673
469 Ga0373961_0388234 3300035241 Bacteria 534
470 Ga0373962_0039885 3300035242 Bacteria 1319
471 Ga0373962_0194117 3300035242 Bacteria 684
472 Ga0373924_0000841 3300035410 Bacteria 9631
473 Ga0373924_0119155 3300035410 Bacteria 1144
474 Ga0373931_0000878 3300035691 Bacteria 12684
475 Ga0373931_0593292 3300035691 Bacteria 723
476 Ga0373935_0004021 3300035692 Bacteria 8596
477 Ga0373935_0007086 3300035692 Bacteria 6693
478 Ga0373935_0515536 3300035692 Bacteria 869
479 Ga0373927_0004990 3300035695 Bacteria 9193
480 Ga0373927_0020432 3300035695 Bacteria 4342
481 Ga0373927_0078573 3300035695 Bacteria 2137
482 Ga0373933_0205896 3300035724 Bacteria 1260
483 Ga0373933_0243629 3300035724 Bacteria 1156
484 Ga0373947_0050048 3300035725 Bacteria 2511
485 Ga0373947_0105472 3300035725 Bacteria 1775
486 Ga0373937_0361426 3300036401 Bacteria 1376
487 Ga0373937_0405354 3300036401 Bacteria 1294
488 Ga0373937_0434320 3300036401 Bacteria 1246
489 Ga0373937_0459505 3300036401 Bacteria 1209
490 Ga0373937_0629126 3300036401 Bacteria 1018
491 Ga0373937_0631787 3300036401 Bacteria 1016
492 Ga0373937_1059776 3300036401 Bacteria 759
493 Ga0373937_1285178 3300036401 Bacteria 680
494 Ga0373925_0064929 3300037068 Bacteria 2748
495 Ga0373925_0087245 3300037068 Bacteria 2381
496 Ga0373925_0157960 3300037068 Bacteria 1784
497 Ga0373925_0474792 3300037068 Bacteria 1025
498 Ga0373925_1471715 3300037068 Bacteria 557
499 Ga0436360_0514046 3300039438 Bacteria 727
500 Ga0439436_0253889 3300041404 Bacteria 510
501 Ga0451845_0049100 3300041501 Bacteria 513
502 Ga0451847_0725833 3300041503 Bacteria 522
503 Ga0439441_000166 3300042001 Bacteria 5832
504 Ga0439441_007729 3300042001 Bacteria 1741
505 Ga0450888_030189 3300042126 Bacteria 723
506 Ga0439446_0079736 3300042156 Bacteria 1012
507 Ga0439446_0342295 3300042156 Bacteria 532
508 Ga0439435_0080036 3300042436 Bacteria 979
509 Ga0451577_0527883 3300042876 Bacteria 1072
510 Ga0451577_0563339 3300042876 Bacteria 1034
511 Ga0451577_1367877 3300042876 Bacteria 628
512 Ga0453683_0367787 3300044673 Bacteria 925
513 Ga0453683_0463135 3300044673 Bacteria 821
514 Ga0453683_0777096 3300044673 Bacteria 630
515 Ga0451576_0019665 3300045051 Bacteria 7368
516 Ga0451576_0059758 3300045051 Bacteria 3978
517 Ga0451576_0073172 3300045051 Bacteria 3566
518 Ga0451576_0095837 3300045051 Bacteria 3086
519 Ga0451576_0141586 3300045051 Bacteria 2507
520 Ga0451576_0180085 3300045051 Bacteria 2206
521 Ga0451576_0590023 3300045051 Bacteria 1168
522 Ga0451576_0915696 3300045051 Bacteria 920
523 Ga0451576_1572532 3300045051 Bacteria 682
524 Ga0495592_0137491 3300046454 Bacteria 1702
525 Ga0495592_0141565 3300046454 Bacteria 1672
526 Ga0495603_0007268 3300046455 Bacteria 6654
527 Ga0495641_0048494 3300046461 Bacteria 1947
528 Ga0495651_0135407 3300046462 Bacteria 1793
529 Ga0495580_0003325 3300046472 Bacteria 13747
530 Ga0495580_0084946 3300046472 Bacteria 2204
531 Ga0495582_0019016 3300046473 Bacteria 3759
532 Ga0495582_0027600 3300046473 Bacteria 3113
533 Ga0495639_0003336 3300046475 Bacteria 6960
534 Ga0495639_0005792 3300046475 Bacteria 5316
535 Ga0495664_0008986 3300046477 Bacteria 5585
536 Ga0495594_0038953 3300046499 Bacteria 2597
537 Ga0495594_0139152 3300046499 Bacteria 1376
538 Ga0495608_0314789 3300046511 Bacteria 967
539 Ga0495618_0083267 3300046514 Bacteria 2043
540 Ga0495628_0087107 3300046516 Bacteria 2421
541 Ga0495630_0374943 3300046517 Bacteria 1089
542 Ga0495630_0606078 3300046517 Bacteria 839
543 Ga0495666_0002107 3300046526 Bacteria 9864
544 Ga0495666_0002191 3300046526 Bacteria 9735
545 Ga0495652_0073010 3300046529 Bacteria 2858
546 Ga0495665_0034817 3300046531 Bacteria 2693
547 Ga0495665_0104600 3300046531 Bacteria 1485
548 Ga0495640_0152429 3300046533 Bacteria 1484
549 Ga0495586_0011151 3300046535 Bacteria 4776
550 Ga0495586_0803134 3300046535 Bacteria 543
551 Ga0495587_0243200 3300046536 Bacteria 1012
552 Ga0495587_0274916 3300046536 Bacteria 944
553 Ga0495598_0096902 3300046537 Bacteria 970
554 Ga0495621_0389248 3300046539 Bacteria 590
555 Ga0495621_0397850 3300046539 Bacteria 584
556 Ga0495622_0219348 3300046557 Bacteria 843
557 Ga0495667_0104764 3300046559 Bacteria 1828
558 Ga0495667_0320024 3300046559 Bacteria 981
559 Ga0495656_0090356 3300046615 Bacteria 1399
560 Ga0495634_0092779 3300046642 Bacteria 1958
561 Ga0495659_0044127 3300046664 Bacteria 1602
562 Ga0495588_0210925 3300046674 Bacteria 1025
563 Ga0495657_0034588 3300046675 Bacteria 3508
564 Ga0495599_0093625 3300046678 Bacteria 1874
565 Ga0495599_0114126 3300046678 Bacteria 1681
566 Ga0495647_0000141 3300046681 Bacteria 18379
567 Ga0495647_0001079 3300046681 Bacteria 8320
568 Ga0495658_0016976 3300046683 Bacteria 3752
569 Ga0495658_0026026 3300046683 Bacteria 3131
570 Ga0495624_0321274 3300046690 Bacteria 932
571 Ga0495600_0089368 3300046809 Bacteria 2009
572 Ga0495581_0043311 3300047315 Bacteria 2604
573 Ga0495581_0072769 3300047315 Bacteria 1989
574 Ga0495604_0071904 3300047317 Bacteria 2615
575 Ga0495636_0690137 3300047318 Bacteria 503
576 Ga0495674_0123942 3300047319 Bacteria 2181
577 Ga0495676_0045806 3300047321 Bacteria 3556
578 Ga0495675_0011755 3300047444 Bacteria 5500
579 Ga0495675_0578529 3300047444 Bacteria 638
580 Ga0495684_0798995 3300047471 Bacteria 616
581 Ga0495602_0582505 3300048088 Bacteria 772
582 Ga0495614_0582226 3300048089 Bacteria 537
583 Ga0501298_029883 3300049521 Bacteria 1064
584 Ga0501031_0078957 3300049568 Bacteria 2144
585 Ga0501032_0084193 3300049569 Bacteria 2114
586 Ga0501032_0295160 3300049569 Bacteria 1048
587 Ga0501033_0010402 3300049570 Bacteria 7135
588 Ga0501033_0519839 3300049570 Bacteria 822
589 Ga0501034_1463547 3300049571 Bacteria 557
590 Ga0501036_0000673 3300049572 Bacteria 25118
591 Ga0501036_0036206 3300049572 Bacteria 4176
592 Ga0501036_0220146 3300049572 Bacteria 1594
593 Ga0501037_0033626 3300049573 Bacteria 3786
594 Ga0501037_0044474 3300049573 Bacteria 3261
595 Ga0501038_0005866 3300049574 Bacteria 11361
596 Ga0501038_0072982 3300049574 Bacteria 2907
597 Ga0501039_0004682 3300049575 Bacteria 10351
598 Ga0501039_0006737 3300049575 Bacteria 8744
599 Ga0501039_0093362 3300049575 Bacteria 2345
600 Ga0501039_0476431 3300049575 Bacteria 980
601 Ga0501039_1531885 3300049575 Bacteria 512
602 Ga0501040_0000414 3300049576 Bacteria 25172
603 Ga0501040_0004812 3300049576 Bacteria 8749
604 Ga0501040_0917878 3300049576 Bacteria 634
605 Ga0501041_0002212 3300049577 Bacteria 10993
606 Ga0501041_0002737 3300049577 Bacteria 10062
607 Ga0501041_0174092 3300049577 Bacteria 1347
608 Ga0501041_0485564 3300049577 Bacteria 785
609 Ga0501042_0008509 3300049578 Bacteria 6777
610 Ga0501042_0011465 3300049578 Bacteria 5983
611 Ga0501042_0483450 3300049578 Bacteria 899
612 Ga0501043_0032366 3300049579 Bacteria 4111
613 Ga0501043_0039346 3300049579 Bacteria 3716
614 Ga0501046_0001535 3300049580 Bacteria 22030
615 Ga0501046_0032860 3300049580 Bacteria 4198
616 Ga0501047_0147755 3300049581 Bacteria 2227
617 Ga0501047_1272916 3300049581 Bacteria 549
618 Ga0501048_0006330 3300049582 Bacteria 9005
619 Ga0501048_0064812 3300049582 Bacteria 2584
620 Ga0501048_0496428 3300049582 Bacteria 875
621 Ga0501068_0051512 3300049584 Bacteria 2490
622 Ga0501068_0058338 3300049584 Bacteria 2342
623 Ga0501068_0096466 3300049584 Bacteria 1829
624 Ga0501068_0209113 3300049584 Bacteria 1239
625 Ga0501069_0081437 3300049585 Bacteria 1823
626 Ga0501069_0461816 3300049585 Bacteria 755
627 Ga0501069_0517484 3300049585 Bacteria 712
628 Ga0501070_0012508 3300049586 Bacteria 7159
629 Ga0501070_0056135 3300049586 Bacteria 3264
630 Ga0501070_0058022 3300049586 Bacteria 3209
631 Ga0501071_0004412 3300049587 Bacteria 8927
632 Ga0501071_0031185 3300049587 Bacteria 3776
633 Ga0501071_0125023 3300049587 Bacteria 1908
634 Ga0501071_0910986 3300049587 Bacteria 678
635 Ga0501071_0997523 3300049587 Bacteria 647
636 Ga0501072_0001165 3300049588 Bacteria 19567
637 Ga0501072_0030301 3300049588 Bacteria 4231
638 Ga0501072_0052324 3300049588 Bacteria 3215
639 Ga0501072_0094729 3300049588 Bacteria 2372
640 Ga0501072_1067992 3300049588 Bacteria 628
641 Ga0501073_0083560 3300049589 Bacteria 2222
642 Ga0501073_0278721 3300049589 Bacteria 1154
643 Ga0501073_0833622 3300049589 Bacteria 635
644 Ga0501074_0002747 3300049590 Bacteria 12321
645 Ga0501074_0212889 3300049590 Bacteria 1376
646 Ga0501074_0353157 3300049590 Bacteria 1043
647 Ga0501075_0002954 3300049591 Bacteria 11376
648 Ga0501075_0005370 3300049591 Bacteria 8764
649 Ga0501075_0080018 3300049591 Bacteria 2473
650 Ga0501075_0444942 3300049591 Bacteria 988
651 Ga0501076_0002293 3300049592 Bacteria 13095
652 Ga0501076_0419859 3300049592 Bacteria 1100
653 Ga0501076_0831115 3300049592 Bacteria 762
654 Ga0501077_0006322 3300049593 Bacteria 7254
655 Ga0501077_0041668 3300049593 Bacteria 2922
656 Ga0501077_1125794 3300049593 Bacteria 505
657 Ga0501225_0247301 3300049705 Bacteria 585
658 Ga0501079_0002386 3300049741 Bacteria 13625
659 Ga0501079_0003076 3300049741 Bacteria 12216
660 Ga0501079_0088305 3300049741 Bacteria 2400
661 Ga0501079_0309134 3300049741 Bacteria 1237
662 Ga0501079_0417480 3300049741 Bacteria 1053
663 Ga0501079_0533769 3300049741 Bacteria 922
664 Ga0501080_0003000 3300049742 Bacteria 14879
665 Ga0501080_0005354 3300049742 Bacteria 11436
666 Ga0501080_0161648 3300049742 Bacteria 2068
667 Ga0501080_0323225 3300049742 Bacteria 1396
668 Ga0501080_0497189 3300049742 Bacteria 1090
669 Ga0501081_0001111 3300049743 Bacteria 16161
670 Ga0501081_0022293 3300049743 Bacteria 4235
671 Ga0501081_0269952 3300049743 Bacteria 1244
672 Ga0501081_0449302 3300049743 Bacteria 957
673 Ga0501081_1067152 3300049743 Bacteria 611
674 Ga0501083_0065012 3300049744 Bacteria 2430
675 Ga0501280_000798 3300049776 Bacteria 6838
676 Ga0501282_000988 3300049778 Bacteria 3222
677 Ga0501035_0006687 3300049822 Bacteria 10773
678 Ga0501044_0604780 3300049823 Bacteria 989
679 Ga0501044_0621273 3300049823 Bacteria 972
680 Ga0501044_1372283 3300049823 Bacteria 572
681 Ga0501044_1519045 3300049823 Bacteria 535
682 Ga0501045_0000338 3300049824 Bacteria 27724
683 Ga0501045_0012401 3300049824 Bacteria 6002
684 nmdc:mga03n38_887282_c1 3300050490 Bacteria 523
685 nmdc:mga0k408_754579_c1 3300050493 Bacteria 568
686 nmdc:mga0k408_93448_c1 3300050493 Bacteria 1768
687 nmdc:mga05p37_2013066_c1 3300050507 Bacteria 546
688 nmdc:mga05p37_675149_c1 3300050507 Bacteria 1153
689 nmdc:mga05p37_834_c1 3300050507 Bacteria 34530
690 nmdc:mga09592_102754_c1 3300050508 Bacteria 2449
691 nmdc:mga09592_13051_c1 3300050508 Bacteria 6782
692 nmdc:mga09592_618470_c1 3300050508 Bacteria 927
693 nmdc:mga0qj67_326511_c1 3300050509 Bacteria 1242
694 nmdc:mga06r32_1524719_c1 3300050510 Bacteria 608
695 nmdc:mga06r32_1647_c1 3300050510 Bacteria 20161
696 nmdc:mga06r32_773587_c1 3300050510 Bacteria 922
697 nmdc:mga08y16_101521_c1 3300050511 Bacteria 2995
698 nmdc:mga08y16_1135093_c1 3300050511 Bacteria 755
699 nmdc:mga08y16_1534541_c1 3300050511 Bacteria 626
700 nmdc:mga08y16_645_c1 3300050511 Bacteria 32765
701 nmdc:mga08y16_66045_c1 3300050511 Bacteria 3775
702 nmdc:mga08y16_681216_c1 3300050511 Bacteria 1030
703 nmdc:mga08y16_71473_c1 3300050511 Bacteria 3616
704 nmdc:mga0n895_1513_c1 3300050512 Bacteria 17434
705 nmdc:mga0n895_503108_c1 3300050512 Bacteria 1220
706 nmdc:mga0n895_831305_c1 3300050512 Bacteria 912
707 nmdc:mga0rr50_1101556_c1 3300050513 Bacteria 676
708 nmdc:mga0rr50_11180_c1 3300050513 Bacteria 5729
709 nmdc:mga0rr50_317998_c1 3300050513 Bacteria 1304
710 nmdc:mga08x19_268558_c1 3300050514 Bacteria 1180
711 nmdc:mga08x19_319746_c1 3300050514 Bacteria 1080
712 nmdc:mga08x19_852_c1 3300050514 Bacteria 19371
713 nmdc:mga08x19_87331_c1 3300050514 Bacteria 2054
714 nmdc:mga08x19_907121_c1 3300050514 Bacteria 626
715 nmdc:mga0a205_242_c2 3300050515 Bacteria 16279
716 nmdc:mga0a205_266509_c1 3300050515 Bacteria 1590
717 nmdc:mga0a205_390975_c1 3300050515 Bacteria 1255
718 Ga0495601_0137188 3300053077 Bacteria 1595
719 Ga0495595_0002862 3300053084 Bacteria 6802
720 Ga0501084_0006328 3300054114 Bacteria 9723
721 Ga0501084_0241085 3300054114 Bacteria 1526
722 Ga0501084_0253562 3300054114 Bacteria 1485
723 Ga0501084_0685613 3300054114 Bacteria 864
724 Ga0590077_016967 3300059426 Bacteria 1529
725 Ga0501082_0002716 3300060353 Bacteria 15453
726 Ga0501082_0003774 3300060353 Bacteria 13237
727 Ga0501082_1179978 3300060353 Bacteria 669
728 Ga0501082_1230261 3300060353 Bacteria 654
729 Ga0530510_0002589 3300061734 Bacteria 12422
730 Ga0530510_0012372 3300061734 Bacteria 5995
731 Ga0530510_0145418 3300061734 Bacteria 1749
732 Ga0530510_0336940 3300061734 Bacteria 1132
733 Ga0265314_10125319
734 JGI24742J22300_10095773
735 Ga0065707_10026945
736 Ga0065707_10972970
737 Ga0070690_100001184
738 Ga0070690_100243928
739 Ga0070690_100414379
740 Ga0070677_10355103
741 Ga0068869_100000600
742 Ga0068869_100224306
743 Ga0068869_100404177
744 Ga0070666_10128167
745 Ga0070666_10369277
746 Ga0070680_100000089
747 Ga0070682_100002252
748 Ga0070682_100028730
749 Ga0070682_100841674
750 Ga0068868_100002798
751 Ga0068868_100042982
752 Ga0070660_100542365
753 Ga0070689_100004821
754 Ga0070689_100025972
755 Ga0070691_10000090
756 Ga0070691_10028938
757 Ga0070687_100017852
758 Ga0070687_100595335
759 Ga0070661_100173522
760 Ga0070692_10070113
761 Ga0070692_10091718
762 Ga0070692_10415411
763 Ga0070668_100483529
764 Ga0070669_100185059
765 Ga0070671_100340693
766 Ga0070674_100107291
767 Ga0070674_100371704
768 Ga0070673_100283171
769 Ga0070673_101067474
770 Ga0070688_100198650
771 Ga0070688_100514427
772 Ga0070688_100769215
773 Ga0070688_100815422
774 Ga0070667_101375174
775 Ga0070703_10067520
776 Ga0070703_10169550
777 Ga0070713_101602418
778 Ga0070701_10003274
779 Ga0070701_10197803
780 Ga0070701_10238390
781 Ga0070701_10369637
782 Ga0070701_10414381
783 Ga0070701_10689971
784 Ga0070701_11071515
785 Ga0070711_100237339
786 Ga0070711_101658153
787 Ga0070705_100000867
788 Ga0070705_100087446
789 Ga0070705_100448487
790 Ga0070705_101141861
791 Ga0070700_100007592
792 Ga0070700_100172205
793 Ga0070700_101111371
794 Ga0070700_101212310
795 Ga0070694_100002010
796 Ga0070694_100022272
797 Ga0070694_100125400
798 Ga0070694_100152704
799 Ga0070694_100160773
800 Ga0070694_100305254
801 Ga0070694_100680417
802 Ga0070678_100157080
803 Ga0070678_100617056
804 Ga0070662_100233572
805 Ga0070662_100394583
806 Ga0070681_10155761
807 Ga0070681_10156429
808 Ga0070681_10221411
809 Ga0070681_10323045
810 Ga0070681_10774894
811 Ga0068867_100001413
812 Ga0068867_100093382
813 Ga0068867_100546459
814 Ga0068867_100771880
815 Ga0068867_101381210
816 Ga0070685_10302792
817 Ga0070685_10665633
818 Ga0070706_100264575
819 Ga0070707_100147344
820 Ga0070707_100884355
821 Ga0070698_100065031
822 Ga0070698_100207196
823 Ga0070679_100014304
824 Ga0070679_100239553
825 Ga0070679_101445916
826 Ga0070684_100269768
827 Ga0070684_100445826
828 Ga0070684_100523638
829 Ga0070697_100667959
830 Ga0070697_101799730
831 Ga0068853_100411260
832 Ga0068853_100803785
833 Ga0068853_101167316
834 Ga0070672_100264553
835 Ga0070686_100001706
836 Ga0070686_100069193
837 Ga0070686_100941852
838 Ga0070695_100001399
839 Ga0070695_100017304
840 Ga0070695_100254012
841 Ga0070695_100525526
842 Ga0070695_100546385
843 Ga0070696_100002891
844 Ga0070696_100050562
845 Ga0070696_100269771
846 Ga0070693_100000477
847 Ga0070693_100098325
848 Ga0070693_100464688
849 Ga0070665_100178488
850 Ga0070704_100001643
851 Ga0070704_100016050
852 Ga0070704_100061996
853 Ga0070704_100296403
854 Ga0070704_100473974
855 Ga0070704_100515031
856 Ga0070704_100526296
857 Ga0070704_100677086
858 Ga0070704_100807613
859 Ga0070704_100898278
860 Ga0070704_101786474
861 Ga0070704_101817805
862 Ga0068855_100007998
863 Ga0068855_100398837
864 Ga0070664_101192880
865 Ga0068854_100010099
866 Ga0068856_100145942
867 Ga0068856_100177341
868 Ga0068856_101295482
869 Ga0070702_100000452
870 Ga0070702_100040342
871 Ga0070702_100337691
872 Ga0068852_100048493
873 Ga0068852_100241754
874 Ga0068859_100009178
875 Ga0068859_100058009
876 Ga0068859_100112800
877 Ga0068859_100244770
878 Ga0068859_100386610
879 Ga0068859_101157152
880 Ga0068864_100035096
881 Ga0068864_100516539
882 Ga0068866_10003697
883 Ga0068866_10078129
884 Ga0068861_100001570
885 Ga0068861_101406482
886 Ga0068870_10646578
887 Ga0068870_11226641
888 Ga0068863_100064198
889 Ga0068863_100069502
890 Ga0068863_100080466
891 Ga0068863_101590109
892 Ga0068858_100005045
893 Ga0068858_100814015
894 Ga0068858_101048872
895 Ga0068860_100005089
896 Ga0068860_100126370
897 Ga0068860_100251128
898 Ga0068860_100254166
899 Ga0068860_100282401
900 Ga0068862_100003474
901 Ga0068862_100473044
902 Ga0068862_100516787
903 Ga0068862_100613691
904 Ga0068862_100909257
905 Ga0070717_10208813
906 Ga0070715_10060662
907 Ga0070715_10131022
908 Ga0070716_100734672
909 Ga0070712_100912264
910 Ga0070712_101247507
911 Ga0075366_10164038
912 Ga0097621_100004855
913 Ga0097621_100013797
914 Ga0097621_100091546
915 Ga0097621_100342415
916 Ga0097621_101804987
917 Ga0068871_100000744
918 Ga0068871_100005380
919 Ga0075428_100001109
920 Ga0075428_100325387
921 Ga0075431_100002501
922 Ga0075431_102222978
923 Ga0075433_10001605
924 Ga0075433_10279536
925 Ga0075433_10594418
926 Ga0075434_100000018
927 Ga0075434_102219394
928 Ga0075429_100000103
929 Ga0075429_100000175
930 Ga0068865_100001413
931 Ga0068865_100166350
932 Ga0068865_100436594
933 Ga0075436_100000651
934 Ga0075436_100108909
935 Ga0075436_100148882
936 Ga0075436_100776100
937 Ga0097620_100009178
938 Ga0097620_100058007
939 Ga0097620_100112807
940 Ga0097620_100244786
941 Ga0097620_100386594
942 Ga0097620_101157119
943 Ga0075435_100049945
944 Ga0075435_100719257
945 Ga0075435_100892623
946 Ga0099794_10116642
947 Ga0105250_10067554
948 Ga0111539_10111527
949 Ga0111539_10111541
950 Ga0111539_10114418
951 Ga0111539_10150662
952 Ga0111539_10393447
953 Ga0111539_11050375
954 Ga0111539_12155798
955 Ga0105245_10003518
956 Ga0105245_10147471
957 Ga0105245_10156523
958 Ga0105247_10057434
959 Ga0114129_10002499
960 Ga0114129_10099854
961 Ga0114129_11453936
962 Ga0105243_10003728
963 Ga0105243_10622308
964 Ga0105243_10837726
965 Ga0105241_10008217
966 Ga0105241_10128887
967 Ga0105241_10394165
968 Ga0105242_10001851
969 Ga0105242_10020279
970 Ga0105242_10051637
971 Ga0105242_10456953
972 Ga0105242_10686070
973 Ga0105242_11522409
974 Ga0105248_10009251
975 Ga0105248_10429617
976 Ga0105248_10979487
977 Ga0105248_12336364
978 Ga0105237_11016455
979 Ga0105237_12750167
980 Ga0105238_10088214
981 Ga0105249_10000917
982 Ga0105249_10245316
983 Ga0105249_11280102
984 Ga0105249_11372258
985 Ga0105239_10080203
986 Ga0105239_10376863
987 Ga0105246_10281472
988 Ga0105246_10631986
989 Ga0157339_1002947
990 Ga0157369_10350084
991 Ga0157369_10655345
992 Ga0157369_10760154
993 Ga0157374_10343467
994 Ga0157374_11377663
995 Ga0157378_10315201
996 Ga0163162_10065303
997 Ga0163162_10392497
998 Ga0157372_10072658
999 Ga0157372_10993695
1000 Ga0157372_11269772
1001 Ga0157372_12453978
1002 Ga0157375_10264563
1003 Ga0157375_10898031
1004 Ga0163163_10357049
1005 Ga0163163_13273661
1006 Ga0157380_10100784
1007 Ga0157380_10109791
1008 Ga0157380_10113035
1009 Ga0157380_11147971
1010 Ga0157377_10281781
1011 Ga0157377_10297958
1012 Ga0157377_10367218
1013 Ga0157379_10017026
1014 Ga0157379_10039178
1015 Ga0157379_10112014
1016 Ga0157376_10010610
1017 Ga0157376_10127648
1018 Ga0157376_11362719
1019 Ga0163161_10022441
1020 Ga0163161_11525790
1021 Ga0163161_11555311
1022 Ga0206356_10226033
1023 Ga0207653_10043198
1024 Ga0207642_10001241
1025 Ga0207642_10032002
1026 Ga0207642_10093488
1027 Ga0207688_10007284
1028 Ga0207680_10068338
1029 Ga0207680_10427235
1030 Ga0207685_10044217
1031 Ga0207685_10082632
1032 Ga0207699_10302076
1033 Ga0207643_10196116
1034 Ga0207643_10582740
1035 Ga0207654_10007036
1036 Ga0207654_10402696
1037 Ga0207707_10199250
1038 Ga0207707_10288982
1039 Ga0207707_10399865
1040 Ga0207663_10035399
1041 Ga0207663_10273570
1042 Ga0207663_10807369
1043 Ga0207660_10002436
1044 Ga0207662_10025391
1045 Ga0207662_10123482
1046 Ga0207662_10294178
1047 Ga0207657_10650713
1048 Ga0207652_10035243
1049 Ga0207652_10291093
1050 Ga0207646_10543368
1051 Ga0207646_10670784
1052 Ga0207646_11313660
1053 Ga0207681_10303063
1054 Ga0207687_10004970
1055 Ga0207687_10099059
1056 Ga0207687_10158010
1057 Ga0207700_10363307
1058 Ga0207644_10260917
1059 Ga0207644_10362168
1060 Ga0207706_10406793
1061 Ga0207686_10000992
1062 Ga0207686_10017224
1063 Ga0207686_10087557
1064 Ga0207686_10152117
1065 Ga0207686_10260607
1066 Ga0207709_10001315
1067 Ga0207670_10013013
1068 Ga0207670_10054367
1069 Ga0207670_10101688
1070 Ga0207670_10509641
1071 Ga0207669_10430694
1072 Ga0207669_10483061
1073 Ga0207669_10643193
1074 Ga0207704_10000483
1075 Ga0207704_10041711
1076 Ga0207704_10338462
1077 Ga0207704_11245053
1078 Ga0207665_10052071
1079 Ga0207665_10071683
1080 Ga0207691_11645094
1081 Ga0207711_10273400
1082 Ga0207711_11916543
1083 Ga0207689_10000544
1084 Ga0207689_10001506
1085 Ga0207689_10320071
1086 Ga0207661_10201412
1087 Ga0207661_10800155
1088 Ga0207679_10266719
1089 Ga0207667_10008307
1090 Ga0207667_10729005
1091 Ga0207651_10684299
1092 Ga0207651_11114864
1093 Ga0207712_10026729
1094 Ga0207712_10174142
1095 Ga0207712_11096434
1096 Ga0207712_11501058
1097 Ga0207668_11155302
1098 Ga0207640_10025995
1099 Ga0207658_11771867
1100 Ga0207677_10003254
1101 Ga0207677_10896672
1102 Ga0207703_10050727
1103 Ga0207639_10161964
1104 Ga0207639_11357310
1105 Ga0207708_10233289
1106 Ga0207708_10237392
1107 Ga0207708_10443545
1108 Ga0207708_11969439
1109 Ga0207702_10022953
1110 Ga0207702_10099129
1111 Ga0207702_10276058
1112 Ga0207641_10330708
1113 Ga0207641_10483765
1114 Ga0207641_10597084
1115 Ga0207641_11107543
1116 Ga0207648_10000135
1117 Ga0207648_10018245
1118 Ga0207648_10228858
1119 Ga0207648_10234133
1120 Ga0207648_10796485
1121 Ga0207676_10009765
1122 Ga0207676_10383231
1123 Ga0207676_11569195
1124 Ga0207674_10275248
1125 Ga0207675_100000825
1126 Ga0207675_100023033
1127 Ga0207675_100694982
1128 Ga0207675_101953010
1129 Ga0207683_10042184
1130 Ga0207683_10099514
1131 Ga0207698_10019299
1132 Ga0207698_10072032
1133 Ga0209588_1022157
1134 Ga0207428_10000265
1135 Ga0207428_10109225
1136 Ga0268266_10143459
1137 Ga0268265_10002564
1138 Ga0268265_10106540
1139 Ga0268265_10299679
1140 Ga0268265_10300707
1141 Ga0268265_10793599
1142 Ga0268264_10001495
1143 Ga0268264_10191662
1144 Ga0268264_10339973
1145 Ga0265336_10048081
1146 Ga0265324_10000638
1147 Ga0265325_10036677
1148 Ga0265331_10173266
1149 Ga0307408_100345867
1150 Ga0307408_100467089
1151 Ga0307408_101375881
1152 Ga0307408_101902897
1153 Ga0265314_10001595
1154 Ga0307405_12110474
1155 Ga0373930_0000750
1156 Ga0373930_0038076
1157 Ga0373948_0050680
1158 Ga0373958_0010504
1159 Ga0373959_0019020
1160 Ga0373959_0040768
1161 Ga0373938_0048666
1162 Ga0373938_0057860
1163 Ga0373938_0222853
1164 Ga0373926_0014875
1165 Ga0373928_0074707
1166 Ga0373928_0113394
1167 Ga0373928_0200493
1168 Ga0373929_0003502
1169 Ga0373940_0010236
1170 Ga0373944_0008517
1171 Ga0373949_0101895
1172 Ga0373951_0012238
1173 Ga0373923_0085334
1174 Ga0373932_0001394
1175 Ga0373932_0038195
1176 Ga0373936_0011508
1177 Ga0373936_0025859
1178 Ga0373936_0032734
1179 Ga0373939_0014234
1180 Ga0373941_0033892
1181 Ga0373945_0000490
1182 Ga0373945_0030544
1183 Ga0373953_0028763
1184 Ga0373954_0009507
1185 Ga0373954_0016658
1186 Ga0373956_0162252
1187 Ga0373957_0004401
1188 Ga0373960_0020225
1189 Ga0373960_0253274
1190 Ga0373960_0437636
1191 Ga0373943_0035914
1192 Ga0373943_0175008
1193 Ga0373946_0010712
1194 Ga0373955_0131984
1195 Ga0373942_0025750
1196 Ga0373942_0150427
1197 Ga0373942_0238994
1198 Ga0373961_0068209
1199 Ga0373961_0146716
1200 Ga0373961_0222526
1201 Ga0373961_0388234
1202 Ga0373962_0039885
1203 Ga0373962_0194117
1204 Ga0373924_0000841
1205 Ga0373924_0119155
1206 Ga0373931_0000878
1207 Ga0373931_0593292
1208 Ga0373935_0004021
1209 Ga0373935_0007086
1210 Ga0373935_0515536
1211 Ga0373927_0004990
1212 Ga0373927_0020432
1213 Ga0373927_0078573
1214 Ga0373933_0205896
1215 Ga0373933_0243629
1216 Ga0373947_0050048
1217 Ga0373947_0105472
1218 Ga0373937_0361426
1219 Ga0373937_0405354
1220 Ga0373937_0434320
1221 Ga0373937_0459505
1222 Ga0373937_0629126
1223 Ga0373937_0631787
1224 Ga0373937_1059776
1225 Ga0373937_1285178
1226 Ga0373925_0064929
1227 Ga0373925_0087245
1228 Ga0373925_0157960
1229 Ga0373925_0474792
1230 Ga0373925_1471715
1231 Ga0436360_0514046
1232 Ga0439436_0253889
1233 Ga0451845_0049100
1234 Ga0451847_0725833
1235 Ga0439441_000166
1236 Ga0439441_007729
1237 Ga0450888_030189
1238 Ga0439446_0079736
1239 Ga0439446_0342295
1240 Ga0439435_0080036
1241 Ga0451577_0527883
1242 Ga0451577_0563339
1243 Ga0451577_1367877
1244 Ga0453683_0367787
1245 Ga0453683_0463135
1246 Ga0453683_0777096
1247 Ga0451576_0019665
1248 Ga0451576_0059758
1249 Ga0451576_0073172
1250 Ga0451576_0095837
1251 Ga0451576_0141586
1252 Ga0451576_0180085
1253 Ga0451576_0590023
1254 Ga0451576_0915696
1255 Ga0451576_1572532
1256 Ga0495592_0137491
1257 Ga0495592_0141565
1258 Ga0495603_0007268
1259 Ga0495641_0048494
1260 Ga0495651_0135407
1261 Ga0495580_0003325
1262 Ga0495580_0084946
1263 Ga0495582_0019016
1264 Ga0495582_0027600
1265 Ga0495639_0003336
1266 Ga0495639_0005792
1267 Ga0495664_0008986
1268 Ga0495594_0038953
1269 Ga0495594_0139152
1270 Ga0495608_0314789
1271 Ga0495618_0083267
1272 Ga0495628_0087107
1273 Ga0495630_0374943
1274 Ga0495630_0606078
1275 Ga0495666_0002107
1276 Ga0495666_0002191
1277 Ga0495652_0073010
1278 Ga0495665_0034817
1279 Ga0495665_0104600
1280 Ga0495640_0152429
1281 Ga0495586_0011151
1282 Ga0495586_0803134
1283 Ga0495587_0243200
1284 Ga0495587_0274916
1285 Ga0495598_0096902
1286 Ga0495621_0389248
1287 Ga0495621_0397850
1288 Ga0495622_0219348
1289 Ga0495667_0104764
1290 Ga0495667_0320024
1291 Ga0495656_0090356
1292 Ga0495634_0092779
1293 Ga0495659_0044127
1294 Ga0495588_0210925
1295 Ga0495657_0034588
1296 Ga0495599_0093625
1297 Ga0495599_0114126
1298 Ga0495647_0000141
1299 Ga0495647_0001079
1300 Ga0495658_0016976
1301 Ga0495658_0026026
1302 Ga0495624_0321274
1303 Ga0495600_0089368
1304 Ga0495581_0043311
1305 Ga0495581_0072769
1306 Ga0495604_0071904
1307 Ga0495636_0690137
1308 Ga0495674_0123942
1309 Ga0495676_0045806
1310 Ga0495675_0011755
1311 Ga0495675_0578529
1312 Ga0495684_0798995
1313 Ga0495602_0582505
1314 Ga0495614_0582226
1315 Ga0501298_029883
1316 Ga0501031_0078957
1317 Ga0501032_0084193
1318 Ga0501032_0295160
1319 Ga0501033_0010402
1320 Ga0501033_0519839
1321 Ga0501034_1463547
1322 Ga0501036_0000673
1323 Ga0501036_0036206
1324 Ga0501036_0220146
1325 Ga0501037_0033626
1326 Ga0501037_0044474
1327 Ga0501038_0005866
1328 Ga0501038_0072982
1329 Ga0501039_0004682
1330 Ga0501039_0006737
1331 Ga0501039_0093362
1332 Ga0501039_0476431
1333 Ga0501039_1531885
1334 Ga0501040_0000414
1335 Ga0501040_0004812
1336 Ga0501040_0917878
1337 Ga0501041_0002212
1338 Ga0501041_0002737
1339 Ga0501041_0174092
1340 Ga0501041_0485564
1341 Ga0501042_0008509
1342 Ga0501042_0011465
1343 Ga0501042_0483450
1344 Ga0501043_0032366
1345 Ga0501043_0039346
1346 Ga0501046_0001535
1347 Ga0501046_0032860
1348 Ga0501047_0147755
1349 Ga0501047_1272916
1350 Ga0501048_0006330
1351 Ga0501048_0064812
1352 Ga0501048_0496428
1353 Ga0501068_0051512
1354 Ga0501068_0058338
1355 Ga0501068_0096466
1356 Ga0501068_0209113
1357 Ga0501069_0081437
1358 Ga0501069_0461816
1359 Ga0501069_0517484
1360 Ga0501070_0012508
1361 Ga0501070_0056135
1362 Ga0501070_0058022
1363 Ga0501071_0004412
1364 Ga0501071_0031185
1365 Ga0501071_0125023
1366 Ga0501071_0910986
1367 Ga0501071_0997523
1368 Ga0501072_0001165
1369 Ga0501072_0030301
1370 Ga0501072_0052324
1371 Ga0501072_0094729
1372 Ga0501072_1067992
1373 Ga0501073_0083560
1374 Ga0501073_0278721
1375 Ga0501073_0833622
1376 Ga0501074_0002747
1377 Ga0501074_0212889
1378 Ga0501074_0353157
1379 Ga0501075_0002954
1380 Ga0501075_0005370
1381 Ga0501075_0080018
1382 Ga0501075_0444942
1383 Ga0501076_0002293
1384 Ga0501076_0419859
1385 Ga0501076_0831115
1386 Ga0501077_0006322
1387 Ga0501077_0041668
1388 Ga0501077_1125794
1389 Ga0501225_0247301
1390 Ga0501079_0002386
1391 Ga0501079_0003076
1392 Ga0501079_0088305
1393 Ga0501079_0309134
1394 Ga0501079_0417480
1395 Ga0501079_0533769
1396 Ga0501080_0003000
1397 Ga0501080_0005354
1398 Ga0501080_0161648
1399 Ga0501080_0323225
1400 Ga0501080_0497189
1401 Ga0501081_0001111
1402 Ga0501081_0022293
1403 Ga0501081_0269952
1404 Ga0501081_0449302
1405 Ga0501081_1067152
1406 Ga0501083_0065012
1407 Ga0501280_000798
1408 Ga0501282_000988
1409 Ga0501035_0006687
1410 Ga0501044_0604780
1411 Ga0501044_0621273
1412 Ga0501044_1372283
1413 Ga0501044_1519045
1414 Ga0501045_0000338
1415 Ga0501045_0012401
1416 nmdc:mga03n38_887282_c1
1417 nmdc:mga0k408_754579_c1
1418 nmdc:mga0k408_93448_c1
1419 nmdc:mga05p37_2013066_c1
1420 nmdc:mga05p37_675149_c1
1421 nmdc:mga05p37_834_c1
1422 nmdc:mga09592_102754_c1
1423 nmdc:mga09592_13051_c1
1424 nmdc:mga09592_618470_c1
1425 nmdc:mga0qj67_326511_c1
1426 nmdc:mga06r32_1524719_c1
1427 nmdc:mga06r32_1647_c1
1428 nmdc:mga06r32_773587_c1
1429 nmdc:mga08y16_101521_c1
1430 nmdc:mga08y16_1135093_c1
1431 nmdc:mga08y16_1534541_c1
1432 nmdc:mga08y16_645_c1
1433 nmdc:mga08y16_66045_c1
1434 nmdc:mga08y16_681216_c1
1435 nmdc:mga08y16_71473_c1
1436 nmdc:mga0n895_1513_c1
1437 nmdc:mga0n895_503108_c1
1438 nmdc:mga0n895_831305_c1
1439 nmdc:mga0rr50_1101556_c1
1440 nmdc:mga0rr50_11180_c1
1441 nmdc:mga0rr50_317998_c1
1442 nmdc:mga08x19_268558_c1
1443 nmdc:mga08x19_319746_c1
1444 nmdc:mga08x19_852_c1
1445 nmdc:mga08x19_87331_c1
1446 nmdc:mga08x19_907121_c1
1447 nmdc:mga0a205_242_c2
1448 nmdc:mga0a205_266509_c1
1449 nmdc:mga0a205_390975_c1
1450 Ga0495601_0137188
1451 Ga0495595_0002862
1452 Ga0501084_0006328
1453 Ga0501084_0241085
1454 Ga0501084_0253562
1455 Ga0501084_0685613
1456 Ga0590077_016967
1457 Ga0501082_0002716
1458 Ga0501082_0003774
1459 Ga0501082_1179978
1460 Ga0501082_1230261
1461 Ga0530510_0002589
1462 Ga0530510_0012372
1463 Ga0530510_0145418
1464 Ga0530510_0336940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

10

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9766 1 83
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9763 1 83
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.9723 2 79
7x7h-assembly1.cif.gz_D crystal structure of fructose regulator/histidine phosphocarrier protein complex from vibrio cholerae 0.9703 2 83
1sph-assembly1.cif.gz_B refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition 0.9686 2 80
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9772 1 83 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9729 2 88 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9658 2 79 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9621 2 88 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9539 4 82 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A3M0BYV9-F1-model_v4 Phosphocarrier protein 1.005 2 89 GO:0005737
GO:0009401
AF-A0A2S6U7H5-F1-model_v4 Phosphocarrier protein HPr (EC 2.7.11.-) 1.004 2 89 GO:0005737
GO:0009401
GO:0016740
AF-A0A3B0SD05-F1-model_v4 Phosphocarrier protein, nitrogen regulation associated 1.004 2 87 GO:0005737
GO:0009401
AF-A0A084IPA2-F1-model_v4 Phosphotransferase system, phosphocarrier protein HPr 1.003 1 89 GO:0005737
GO:0009401
GO:0016740
AF-A0A446CD47-F1-model_v4 Phosphocarrier protein HPr (EC 2.7.11.-) 1.003 1 89 GO:0005737
GO:0009401
GO:0016740

Map