F477950
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 313 | 1462 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100339074|Ga0070674_1003390742 |
| Length | 268 |
| Sequence | VSHFRRLSIRAVGDEAEPLRARLLELVPAGLEEVVDGNAVELAAYVPVAQVDALLAAFPGAVVEPVPQGWEDAWRSFHHPVTVGGLWVGPPWEEAPDAGSAVVIDPGRAFGTGAHPTTQLCVELLATTAARGSLLDVGCGSGVLAIAGIRLGFGPVVAVDVDPVAVETTVANAVTNAVELDARLSDAESGVLPVAEVAVANVLLRPVEAILGRLDAAEAITSGYLAGERPAHEGWEHVETVTLDGWAADRFRSLRRSGRWARPRGSPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 173 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 176 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 177 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.41 |
| Nodule | 0 |
| Rhizoplane | 9.85 |
| Rhizosphere | 89.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070674_100339074 | 3300005356 | Bacteria | 1210 |
| 2 | JGI25406J46586_10020596 | 3300003203 | Bacteria | 2663 |
| 3 | JGI25405J52794_10012704 | 3300003911 | Bacteria | 1625 |
| 4 | Ga0070658_10017271 | 3300005327 | Bacteria | 5775 |
| 5 | Ga0070683_100015947 | 3300005329 | Bacteria | 6610 |
| 6 | Ga0070683_100186325 | 3300005329 | Bacteria | 1970 |
| 7 | Ga0070683_100391678 | 3300005329 | Bacteria | 1324 |
| 8 | Ga0070683_100427694 | 3300005329 | Unclassified | 1263 |
| 9 | Ga0070690_100043515 | 3300005330 | Bacteria | 2848 |
| 10 | Ga0070680_100019813 | 3300005336 | Bacteria | 5334 |
| 11 | Ga0070680_100035733 | 3300005336 | Bacteria | 4012 |
| 12 | Ga0070682_100012996 | 3300005337 | Bacteria | 4780 |
| 13 | Ga0068868_100046407 | 3300005338 | Bacteria | 3400 |
| 14 | Ga0070660_100032467 | 3300005339 | Bacteria | 3929 |
| 15 | Ga0070660_100096384 | 3300005339 | Bacteria | 2339 |
| 16 | Ga0070691_10009103 | 3300005341 | Bacteria | 4539 |
| 17 | Ga0070691_10245115 | 3300005341 | Bacteria | 959 |
| 18 | Ga0070661_100012914 | 3300005344 | Bacteria | 5851 |
| 19 | Ga0070661_100206364 | 3300005344 | Bacteria | 1503 |
| 20 | Ga0070661_100561236 | 3300005344 | Bacteria | 920 |
| 21 | Ga0070692_10066205 | 3300005345 | Bacteria | 1914 |
| 22 | Ga0070671_100134058 | 3300005355 | Unclassified | 2087 |
| 23 | Ga0070671_100232313 | 3300005355 | Bacteria | 1565 |
| 24 | Ga0070674_100255243 | 3300005356 | Bacteria | 1379 |
| 25 | Ga0070673_100542253 | 3300005364 | Unclassified | 1056 |
| 26 | Ga0070659_100035853 | 3300005366 | Bacteria | 3864 |
| 27 | Ga0070659_100216000 | 3300005366 | Bacteria | 1582 |
| 28 | Ga0070667_100004251 | 3300005367 | Bacteria | 12095 |
| 29 | Ga0070703_10011072 | 3300005406 | Bacteria | 2547 |
| 30 | Ga0070709_10216849 | 3300005434 | Unclassified | 1363 |
| 31 | Ga0070709_10297503 | 3300005434 | Bacteria | 1178 |
| 32 | Ga0070714_100005434 | 3300005435 | Bacteria | 9725 |
| 33 | Ga0070714_100513683 | 3300005435 | Bacteria | 1144 |
| 34 | Ga0070713_100065642 | 3300005436 | Bacteria | 3050 |
| 35 | Ga0070713_100116914 | 3300005436 | Bacteria | 2333 |
| 36 | Ga0070701_10109737 | 3300005438 | Bacteria | 1540 |
| 37 | Ga0070701_10276303 | 3300005438 | Bacteria | 1024 |
| 38 | Ga0070705_100029229 | 3300005440 | Bacteria | 3028 |
| 39 | Ga0070705_100068512 | 3300005440 | Bacteria | 2136 |
| 40 | Ga0070705_100255884 | 3300005440 | Bacteria | 1232 |
| 41 | Ga0070700_100004834 | 3300005441 | Bacteria | 7072 |
| 42 | Ga0070700_100012439 | 3300005441 | Bacteria | 4750 |
| 43 | Ga0070694_100032914 | 3300005444 | Bacteria | 3406 |
| 44 | Ga0070694_100286250 | 3300005444 | Bacteria | 1258 |
| 45 | Ga0070708_100025933 | 3300005445 | Bacteria | 5013 |
| 46 | Ga0070708_100457222 | 3300005445 | Bacteria | 1204 |
| 47 | Ga0070663_100246462 | 3300005455 | Bacteria | 1412 |
| 48 | Ga0070678_100054945 | 3300005456 | Bacteria | 2905 |
| 49 | Ga0070662_100056622 | 3300005457 | Bacteria | 2846 |
| 50 | Ga0070681_10041322 | 3300005458 | Bacteria | 4621 |
| 51 | Ga0070681_10397478 | 3300005458 | Unclassified | 1289 |
| 52 | Ga0068867_100056629 | 3300005459 | Bacteria | 2901 |
| 53 | Ga0070706_100009742 | 3300005467 | Bacteria | 8929 |
| 54 | Ga0070706_100015065 | 3300005467 | Bacteria | 7140 |
| 55 | Ga0070707_100000309 | 3300005468 | Bacteria | 47965 |
| 56 | Ga0070698_100010869 | 3300005471 | Bacteria | 9685 |
| 57 | Ga0070698_100136308 | 3300005471 | Bacteria | 2408 |
| 58 | Ga0070699_100013039 | 3300005518 | Bacteria | 7163 |
| 59 | Ga0070699_100091624 | 3300005518 | Bacteria | 2658 |
| 60 | Ga0070699_100186645 | 3300005518 | Bacteria | 1841 |
| 61 | Ga0070699_100292967 | 3300005518 | Bacteria | 1459 |
| 62 | Ga0070699_100514692 | 3300005518 | Bacteria | 1088 |
| 63 | Ga0070679_100011572 | 3300005530 | Bacteria | 8407 |
| 64 | Ga0070679_100031696 | 3300005530 | Bacteria | 5225 |
| 65 | Ga0070679_100197697 | 3300005530 | Bacteria | 1977 |
| 66 | Ga0070679_100556525 | 3300005530 | Bacteria | 1091 |
| 67 | Ga0070684_100023773 | 3300005535 | Bacteria | 5132 |
| 68 | Ga0070684_100251645 | 3300005535 | Bacteria | 1615 |
| 69 | Ga0070684_100377336 | 3300005535 | Bacteria | 1306 |
| 70 | Ga0068853_100422857 | 3300005539 | Bacteria | 1250 |
| 71 | Ga0070672_100170844 | 3300005543 | Bacteria | 1808 |
| 72 | Ga0070686_100021491 | 3300005544 | Bacteria | 3837 |
| 73 | Ga0070695_100032685 | 3300005545 | Bacteria | 3252 |
| 74 | Ga0070695_100088307 | 3300005545 | Bacteria | 2064 |
| 75 | Ga0070696_100030011 | 3300005546 | Bacteria | 3720 |
| 76 | Ga0070696_100120113 | 3300005546 | Bacteria | 1901 |
| 77 | Ga0070693_100010834 | 3300005547 | Bacteria | 4576 |
| 78 | Ga0070665_100392644 | 3300005548 | Bacteria | 1395 |
| 79 | Ga0070665_100608395 | 3300005548 | Unclassified | 1106 |
| 80 | Ga0070704_100178816 | 3300005549 | Bacteria | 1695 |
| 81 | Ga0070704_100211401 | 3300005549 | Unclassified | 1572 |
| 82 | Ga0070704_100477743 | 3300005549 | Bacteria | 1078 |
| 83 | Ga0068855_100029577 | 3300005563 | Bacteria | 6548 |
| 84 | Ga0068855_100090499 | 3300005563 | Bacteria | 3531 |
| 85 | Ga0068855_100263144 | 3300005563 | Bacteria | 1921 |
| 86 | Ga0070664_100276048 | 3300005564 | Bacteria | 1515 |
| 87 | Ga0068857_100056006 | 3300005577 | Bacteria | 3498 |
| 88 | Ga0068854_100016763 | 3300005578 | Bacteria | 4889 |
| 89 | Ga0068856_100064058 | 3300005614 | Bacteria | 3632 |
| 90 | Ga0068856_100129338 | 3300005614 | Bacteria | 2529 |
| 91 | Ga0068856_100174573 | 3300005614 | Bacteria | 2161 |
| 92 | Ga0070702_100012791 | 3300005615 | Bacteria | 4221 |
| 93 | Ga0068852_100062484 | 3300005616 | Bacteria | 3240 |
| 94 | Ga0068852_100092380 | 3300005616 | Bacteria | 2710 |
| 95 | Ga0068861_100065711 | 3300005719 | Bacteria | 2795 |
| 96 | Ga0068861_100259685 | 3300005719 | Bacteria | 1486 |
| 97 | Ga0068858_100036692 | 3300005842 | Bacteria | 4545 |
| 98 | Ga0068860_100073004 | 3300005843 | Bacteria | 3262 |
| 99 | Ga0068862_100136232 | 3300005844 | Bacteria | 2176 |
| 100 | Ga0081455_10006006 | 3300005937 | Bacteria | 13168 |
| 101 | Ga0081540_1002188 | 3300005983 | Bacteria | 16164 |
| 102 | Ga0081540_1005502 | 3300005983 | Bacteria | 9446 |
| 103 | Ga0081539_10000030 | 3300005985 | Bacteria | 317236 |
| 104 | Ga0081539_10001549 | 3300005985 | Bacteria | 38322 |
| 105 | Ga0070717_10320246 | 3300006028 | Bacteria | 1381 |
| 106 | Ga0070717_10454049 | 3300006028 | Bacteria | 1155 |
| 107 | Ga0070717_10596149 | 3300006028 | Bacteria | 1002 |
| 108 | Ga0075364_10070371 | 3300006051 | Bacteria | 2303 |
| 109 | Ga0075432_10001857 | 3300006058 | Bacteria | 6973 |
| 110 | Ga0070712_100040305 | 3300006175 | Bacteria | 3201 |
| 111 | Ga0070712_100553363 | 3300006175 | Bacteria | 969 |
| 112 | Ga0068871_100099525 | 3300006358 | Unclassified | 2434 |
| 113 | Ga0068871_100537595 | 3300006358 | Unclassified | 1057 |
| 114 | Ga0075428_100040993 | 3300006844 | Bacteria | 5092 |
| 115 | Ga0075430_100077424 | 3300006846 | Unclassified | 2787 |
| 116 | Ga0075430_100413049 | 3300006846 | Unclassified | 1114 |
| 117 | Ga0075431_100115711 | 3300006847 | Unclassified | 2768 |
| 118 | Ga0075431_100217876 | 3300006847 | Bacteria | 1948 |
| 119 | Ga0075433_10085908 | 3300006852 | Bacteria | 2778 |
| 120 | Ga0075433_10112810 | 3300006852 | Bacteria | 2411 |
| 121 | Ga0075433_10705645 | 3300006852 | Bacteria | 883 |
| 122 | Ga0075434_100050721 | 3300006871 | Bacteria | 4122 |
| 123 | Ga0075434_100083490 | 3300006871 | Bacteria | 3192 |
| 124 | Ga0075434_100476992 | 3300006871 | Bacteria | 1269 |
| 125 | Ga0075429_100003982 | 3300006880 | Bacteria | 12638 |
| 126 | Ga0075429_100147850 | 3300006880 | Unclassified | 2057 |
| 127 | Ga0075429_100413357 | 3300006880 | Bacteria | 1181 |
| 128 | Ga0068865_100008163 | 3300006881 | Bacteria | 6462 |
| 129 | Ga0075436_100004064 | 3300006914 | Bacteria | 10039 |
| 130 | Ga0075436_100004709 | 3300006914 | Bacteria | 9363 |
| 131 | Ga0075436_100028138 | 3300006914 | Bacteria | 3867 |
| 132 | Ga0075435_100012083 | 3300007076 | Bacteria | 6383 |
| 133 | Ga0075435_100087343 | 3300007076 | Bacteria | 2569 |
| 134 | Ga0075435_100100383 | 3300007076 | Unclassified | 2398 |
| 135 | Ga0075435_100215078 | 3300007076 | Unclassified | 1631 |
| 136 | Ga0075435_100289303 | 3300007076 | Bacteria | 1400 |
| 137 | Ga0075435_100691137 | 3300007076 | Bacteria | 886 |
| 138 | Ga0105240_10017356 | 3300009093 | Bacteria | 9703 |
| 139 | Ga0105240_10618829 | 3300009093 | Bacteria | 1190 |
| 140 | Ga0111539_11150121 | 3300009094 | Bacteria | 902 |
| 141 | Ga0105245_10027075 | 3300009098 | Bacteria | 5050 |
| 142 | Ga0105245_10039719 | 3300009098 | Bacteria | 4188 |
| 143 | Ga0105245_10067581 | 3300009098 | Bacteria | 3237 |
| 144 | Ga0105245_10108136 | 3300009098 | Bacteria | 2582 |
| 145 | Ga0114129_11036502 | 3300009147 | Unclassified | 1031 |
| 146 | Ga0114129_11355654 | 3300009147 | Bacteria | 879 |
| 147 | Ga0105243_10045047 | 3300009148 | Bacteria | 3465 |
| 148 | Ga0105243_10203915 | 3300009148 | Bacteria | 1736 |
| 149 | Ga0105243_11101335 | 3300009148 | Bacteria | 802 |
| 150 | Ga0105242_10079019 | 3300009176 | Bacteria | 2747 |
| 151 | Ga0105242_10103160 | 3300009176 | Bacteria | 2419 |
| 152 | Ga0105242_10109918 | 3300009176 | Bacteria | 2347 |
| 153 | Ga0105248_11111470 | 3300009177 | Bacteria | 893 |
| 154 | Ga0105237_10057860 | 3300009545 | Bacteria | 3879 |
| 155 | Ga0105238_10257056 | 3300009551 | Bacteria | 1726 |
| 156 | Ga0105238_10296692 | 3300009551 | Bacteria | 1599 |
| 157 | Ga0105238_10684126 | 3300009551 | Bacteria | 1037 |
| 158 | Ga0105249_10039000 | 3300009553 | Bacteria | 4312 |
| 159 | Ga0105249_10176789 | 3300009553 | Bacteria | 2074 |
| 160 | Ga0105239_10114517 | 3300010375 | Bacteria | 2991 |
| 161 | Ga0105239_10339899 | 3300010375 | Unclassified | 1694 |
| 162 | Ga0105239_10345423 | 3300010375 | Bacteria | 1680 |
| 163 | Ga0105246_10068844 | 3300011119 | Bacteria | 2484 |
| 164 | Ga0157371_10019381 | 3300013102 | Bacteria | 5019 |
| 165 | Ga0157370_10075146 | 3300013104 | Bacteria | 3186 |
| 166 | Ga0157369_10066860 | 3300013105 | Bacteria | 3866 |
| 167 | Ga0157369_10191137 | 3300013105 | Bacteria | 2151 |
| 168 | Ga0157369_10598397 | 3300013105 | Bacteria | 1138 |
| 169 | Ga0157378_10326927 | 3300013297 | Bacteria | 1491 |
| 170 | Ga0163162_10102468 | 3300013306 | Bacteria | 2956 |
| 171 | Ga0157372_10063226 | 3300013307 | Bacteria | 4149 |
| 172 | Ga0157372_10131994 | 3300013307 | Bacteria | 2874 |
| 173 | Ga0157372_10433197 | 3300013307 | Bacteria | 1533 |
| 174 | Ga0157375_10334166 | 3300013308 | Unclassified | 1680 |
| 175 | Ga0157375_10948927 | 3300013308 | Bacteria | 1002 |
| 176 | Ga0163163_10379423 | 3300014325 | Bacteria | 1471 |
| 177 | Ga0157380_10010919 | 3300014326 | Bacteria | 6550 |
| 178 | Ga0157380_10103441 | 3300014326 | Bacteria | 2377 |
| 179 | Ga0182008_10121674 | 3300014497 | Bacteria | 1297 |
| 180 | Ga0157376_10107223 | 3300014969 | Bacteria | 2452 |
| 181 | Ga0157376_10582726 | 3300014969 | Bacteria | 1111 |
| 182 | Ga0206356_10215950 | 3300020070 | Unclassified | 2796 |
| 183 | Ga0207692_10162479 | 3300025898 | Bacteria | 1288 |
| 184 | Ga0207699_10374386 | 3300025906 | Unclassified | 1009 |
| 185 | Ga0207705_10338927 | 3300025909 | Bacteria | 1157 |
| 186 | Ga0207684_10028135 | 3300025910 | Bacteria | 4788 |
| 187 | Ga0207684_10061939 | 3300025910 | Bacteria | 3176 |
| 188 | Ga0207684_10070639 | 3300025910 | Bacteria | 2967 |
| 189 | Ga0207684_10128107 | 3300025910 | Bacteria | 2178 |
| 190 | Ga0207684_10245311 | 3300025910 | Bacteria | 1545 |
| 191 | Ga0207707_10035927 | 3300025912 | Bacteria | 4333 |
| 192 | Ga0207707_10496300 | 3300025912 | Unclassified | 1041 |
| 193 | Ga0207695_10016353 | 3300025913 | Bacteria | 8682 |
| 194 | Ga0207671_10416411 | 3300025914 | Bacteria | 1069 |
| 195 | Ga0207693_10007819 | 3300025915 | Bacteria | 8778 |
| 196 | Ga0207693_10037411 | 3300025915 | Bacteria | 3825 |
| 197 | Ga0207693_10038166 | 3300025915 | Bacteria | 3783 |
| 198 | Ga0207663_10016268 | 3300025916 | Bacteria | 4120 |
| 199 | Ga0207663_10593295 | 3300025916 | Bacteria | 870 |
| 200 | Ga0207660_10028795 | 3300025917 | Bacteria | 3803 |
| 201 | Ga0207660_10102222 | 3300025917 | Bacteria | 2142 |
| 202 | Ga0207662_10072495 | 3300025918 | Bacteria | 2087 |
| 203 | Ga0207657_10041391 | 3300025919 | Bacteria | 4074 |
| 204 | Ga0207652_10013179 | 3300025921 | Bacteria | 6695 |
| 205 | Ga0207652_10287977 | 3300025921 | Bacteria | 1482 |
| 206 | Ga0207652_10327140 | 3300025921 | Bacteria | 1384 |
| 207 | Ga0207652_10506136 | 3300025921 | Bacteria | 1087 |
| 208 | Ga0207646_10001136 | 3300025922 | Bacteria | 33979 |
| 209 | Ga0207681_10581806 | 3300025923 | Unclassified | 924 |
| 210 | Ga0207694_10648187 | 3300025924 | Bacteria | 890 |
| 211 | Ga0207687_10053841 | 3300025927 | Bacteria | 2813 |
| 212 | Ga0207700_10068745 | 3300025928 | Bacteria | 2716 |
| 213 | Ga0207700_10154144 | 3300025928 | Bacteria | 1902 |
| 214 | Ga0207664_10126618 | 3300025929 | Bacteria | 2145 |
| 215 | Ga0207664_10202700 | 3300025929 | Bacteria | 1713 |
| 216 | Ga0207644_10075898 | 3300025931 | Bacteria | 2471 |
| 217 | Ga0207644_10195015 | 3300025931 | Bacteria | 1595 |
| 218 | Ga0207690_10026441 | 3300025932 | Bacteria | 3654 |
| 219 | Ga0207690_10073083 | 3300025932 | Bacteria | 2370 |
| 220 | Ga0207706_10005602 | 3300025933 | Bacteria | 11698 |
| 221 | Ga0207669_10231408 | 3300025937 | Bacteria | 1364 |
| 222 | Ga0207665_10240531 | 3300025939 | Unclassified | 1333 |
| 223 | Ga0207711_10442249 | 3300025941 | Bacteria | 1210 |
| 224 | Ga0207689_10288031 | 3300025942 | Bacteria | 1360 |
| 225 | Ga0207661_10001401 | 3300025944 | Bacteria | 16231 |
| 226 | Ga0207661_10316452 | 3300025944 | Bacteria | 1402 |
| 227 | Ga0207661_10461469 | 3300025944 | Bacteria | 1158 |
| 228 | Ga0207667_10193371 | 3300025949 | Bacteria | 2087 |
| 229 | Ga0207667_10303469 | 3300025949 | Bacteria | 1631 |
| 230 | Ga0207712_10070744 | 3300025961 | Bacteria | 2507 |
| 231 | Ga0207712_10185067 | 3300025961 | Unclassified | 1639 |
| 232 | Ga0207668_10022781 | 3300025972 | Bacteria | 4015 |
| 233 | Ga0207668_10207376 | 3300025972 | Unclassified | 1565 |
| 234 | Ga0207640_10007164 | 3300025981 | Bacteria | 6144 |
| 235 | Ga0207640_10181904 | 3300025981 | Bacteria | 1577 |
| 236 | Ga0207658_10003739 | 3300025986 | Bacteria | 10717 |
| 237 | Ga0207677_10042987 | 3300026023 | Bacteria | 3001 |
| 238 | Ga0207677_10358039 | 3300026023 | Unclassified | 1225 |
| 239 | Ga0207639_10289303 | 3300026041 | Bacteria | 1444 |
| 240 | Ga0207678_10472643 | 3300026067 | Bacteria | 1091 |
| 241 | Ga0207708_10047840 | 3300026075 | Bacteria | 3255 |
| 242 | Ga0207702_10107652 | 3300026078 | Bacteria | 2472 |
| 243 | Ga0207702_10219138 | 3300026078 | Bacteria | 1773 |
| 244 | Ga0207702_10362082 | 3300026078 | Bacteria | 1390 |
| 245 | Ga0207702_10374106 | 3300026078 | Bacteria | 1368 |
| 246 | Ga0207648_10049936 | 3300026089 | Bacteria | 3658 |
| 247 | Ga0207648_10056812 | 3300026089 | Bacteria | 3415 |
| 248 | Ga0207648_10057970 | 3300026089 | Bacteria | 3378 |
| 249 | Ga0207674_10040199 | 3300026116 | Bacteria | 4847 |
| 250 | Ga0207675_100001015 | 3300026118 | Bacteria | 27803 |
| 251 | Ga0207675_100002032 | 3300026118 | Bacteria | 20174 |
| 252 | Ga0207683_10050082 | 3300026121 | Bacteria | 3658 |
| 253 | Ga0207698_10141432 | 3300026142 | Bacteria | 2074 |
| 254 | Ga0207698_10180431 | 3300026142 | Unclassified | 1870 |
| 255 | Ga0207428_10028425 | 3300027907 | Bacteria | 4646 |
| 256 | Ga0265336_10003729 | 3300028666 | Bacteria | 5902 |
| 257 | Ga0265324_10013537 | 3300029957 | Bacteria | 3039 |
| 258 | Ga0265340_10006557 | 3300031247 | Bacteria | 6396 |
| 259 | Ga0307408_100087099 | 3300031548 | Bacteria | 2349 |
| 260 | Ga0307408_100139721 | 3300031548 | Bacteria | 1900 |
| 261 | Ga0265313_10024931 | 3300031595 | Bacteria | 3182 |
| 262 | Ga0307405_10243330 | 3300031731 | Bacteria | 1334 |
| 263 | Ga0307405_10293212 | 3300031731 | Bacteria | 1230 |
| 264 | Ga0307413_10088670 | 3300031824 | Bacteria | 2007 |
| 265 | Ga0307407_10086629 | 3300031903 | Bacteria | 1908 |
| 266 | Ga0307407_10108254 | 3300031903 | Bacteria | 1740 |
| 267 | Ga0307409_100264833 | 3300031995 | Bacteria | 1579 |
| 268 | Ga0307416_100024939 | 3300032002 | Bacteria | 4375 |
| 269 | Ga0307416_100256291 | 3300032002 | Bacteria | 1706 |
| 270 | Ga0307414_10077881 | 3300032004 | Unclassified | 2415 |
| 271 | Ga0307411_10205124 | 3300032005 | Unclassified | 1517 |
| 272 | Ga0307415_100149544 | 3300032126 | Bacteria | 1795 |
| 273 | Ga0373958_0014349 | 3300034819 | Bacteria | 1385 |
| 274 | Ga0373944_0004552 | 3300035089 | Bacteria | 3618 |
| 275 | Ga0373944_0090639 | 3300035089 | Unclassified | 1021 |
| 276 | Ga0373945_0002806 | 3300035116 | Bacteria | 5469 |
| 277 | Ga0373945_0007576 | 3300035116 | Bacteria | 3521 |
| 278 | Ga0373945_0026214 | 3300035116 | Bacteria | 2030 |
| 279 | Ga0373960_0017999 | 3300035121 | Unclassified | 1837 |
| 280 | Ga0373943_0006660 | 3300035170 | Bacteria | 5181 |
| 281 | Ga0373943_0010455 | 3300035170 | Bacteria | 4158 |
| 282 | Ga0373943_0029755 | 3300035170 | Bacteria | 2581 |
| 283 | Ga0373946_0003486 | 3300035171 | Bacteria | 5580 |
| 284 | Ga0373961_0026375 | 3300035241 | Bacteria | 1588 |
| 285 | Ga0373924_0181216 | 3300035410 | Bacteria | 927 |
| 286 | Ga0373931_0236112 | 3300035691 | Unclassified | 1106 |
| 287 | Ga0373931_0281904 | 3300035691 | Unclassified | 1021 |
| 288 | Ga0373935_0019823 | 3300035692 | Bacteria | 4105 |
| 289 | Ga0373935_0053217 | 3300035692 | Bacteria | 2575 |
| 290 | Ga0373947_0002323 | 3300035725 | Bacteria | 11501 |
| 291 | Ga0373947_0012264 | 3300035725 | Bacteria | 4910 |
| 292 | Ga0373947_0033498 | 3300035725 | Bacteria | 3033 |
| 293 | Ga0373947_0315409 | 3300035725 | Unclassified | 1045 |
| 294 | Ga0373925_0005408 | 3300037068 | Bacteria | 9516 |
| 295 | Ga0373925_0054964 | 3300037068 | Bacteria | 2979 |
| 296 | Ga0395899_0002477 | 3300037312 | Bacteria | 14979 |
| 297 | Ga0395899_0004322 | 3300037312 | Bacteria | 11094 |
| 298 | Ga0395899_0100204 | 3300037312 | Bacteria | 2092 |
| 299 | Ga0395899_0157036 | 3300037312 | Unclassified | 1609 |
| 300 | Ga0395899_0185805 | 3300037312 | Bacteria | 1456 |
| 301 | Ga0395900_0003203 | 3300037418 | Bacteria | 17718 |
| 302 | Ga0395900_0005102 | 3300037418 | Bacteria | 13789 |
| 303 | Ga0395900_0008552 | 3300037418 | Bacteria | 10524 |
| 304 | Ga0395900_0116060 | 3300037418 | Bacteria | 2747 |
| 305 | Ga0395900_0122553 | 3300037418 | Unclassified | 2666 |
| 306 | Ga0395900_0599885 | 3300037418 | Bacteria | 1042 |
| 307 | Ga0395898_0010794 | 3300037466 | Bacteria | 9542 |
| 308 | Ga0395898_0011779 | 3300037466 | Bacteria | 9064 |
| 309 | Ga0395898_0013287 | 3300037466 | Bacteria | 8479 |
| 310 | Ga0395898_0022687 | 3300037466 | Bacteria | 6353 |
| 311 | Ga0395898_0055207 | 3300037466 | Bacteria | 3874 |
| 312 | Ga0395898_0149118 | 3300037466 | Bacteria | 2238 |
| 313 | Ga0395898_0211013 | 3300037466 | Bacteria | 1852 |
| 314 | Ga0395905_0000568 | 3300037471 | Bacteria | 50013 |
| 315 | Ga0395905_0018824 | 3300037471 | Bacteria | 6550 |
| 316 | Ga0395905_0042892 | 3300037471 | Bacteria | 4244 |
| 317 | Ga0395905_0105509 | 3300037471 | Bacteria | 2646 |
| 318 | Ga0395905_0137950 | 3300037471 | Bacteria | 2295 |
| 319 | Ga0395901_0008882 | 3300038443 | Bacteria | 10174 |
| 320 | Ga0395901_0012951 | 3300038443 | Bacteria | 8460 |
| 321 | Ga0395901_0012998 | 3300038443 | Bacteria | 8447 |
| 322 | Ga0395901_0049630 | 3300038443 | Bacteria | 4360 |
| 323 | Ga0395901_0061179 | 3300038443 | Bacteria | 3918 |
| 324 | Ga0395901_0137441 | 3300038443 | Bacteria | 2568 |
| 325 | Ga0395901_0200733 | 3300038443 | Unclassified | 2090 |
| 326 | Ga0395901_0544102 | 3300038443 | Bacteria | 1177 |
| 327 | Ga0395901_0565012 | 3300038443 | Bacteria | 1151 |
| 328 | Ga0395901_0641247 | 3300038443 | Bacteria | 1067 |
| 329 | Ga0395901_0767855 | 3300038443 | Bacteria | 955 |
| 330 | Ga0436363_0658494 | 3300039450 | Unclassified | 852 |
| 331 | Ga0439447_031891 | 3300041407 | Bacteria | 1321 |
| 332 | Ga0451789_1111844 | 3300041443 | Bacteria | 1531 |
| 333 | Ga0451802_0966161 | 3300041460 | Unclassified | 1219 |
| 334 | Ga0451849_0053658 | 3300041505 | Bacteria | 1949 |
| 335 | Ga0451851_0696550 | 3300041507 | Bacteria | 2154 |
| 336 | Ga0451855_1495820 | 3300041511 | Bacteria | 1725 |
| 337 | Ga0439448_0018733 | 3300042005 | Bacteria | 2125 |
| 338 | Ga0439446_0010089 | 3300042156 | Bacteria | 2539 |
| 339 | Ga0439458_0006164 | 3300042157 | Bacteria | 2676 |
| 340 | Ga0466961_0002298 | 3300044693 | Bacteria | 11884 |
| 341 | Ga0466961_0068358 | 3300044693 | Unclassified | 2256 |
| 342 | Ga0466963_0002261 | 3300044694 | Bacteria | 10700 |
| 343 | Ga0466963_0005306 | 3300044694 | Bacteria | 7532 |
| 344 | Ga0466963_0022081 | 3300044694 | Bacteria | 4026 |
| 345 | Ga0466963_0026259 | 3300044694 | Bacteria | 3723 |
| 346 | Ga0466963_0043669 | 3300044694 | Bacteria | 2949 |
| 347 | Ga0466963_0228220 | 3300044694 | Bacteria | 1304 |
| 348 | Ga0466963_0379323 | 3300044694 | Bacteria | 996 |
| 349 | Ga0466964_0002218 | 3300044706 | Bacteria | 6875 |
| 350 | Ga0466964_0002975 | 3300044706 | Bacteria | 6131 |
| 351 | Ga0466971_0000910 | 3300044719 | Bacteria | 12117 |
| 352 | Ga0466968_0060418 | 3300044735 | Bacteria | 1634 |
| 353 | Ga0466957_0000349 | 3300044842 | Bacteria | 22576 |
| 354 | Ga0466957_0097550 | 3300044842 | Bacteria | 1849 |
| 355 | Ga0466957_0101416 | 3300044842 | Bacteria | 1815 |
| 356 | Ga0466960_0084353 | 3300044901 | Bacteria | 1607 |
| 357 | Ga0466959_0024411 | 3300045049 | Bacteria | 4478 |
| 358 | Ga0466959_0037515 | 3300045049 | Bacteria | 3581 |
| 359 | Ga0451576_0013003 | 3300045051 | Bacteria | 9323 |
| 360 | Ga0451576_0996180 | 3300045051 | Unclassified | 878 |
| 361 | Ga0466958_0000685 | 3300045836 | Bacteria | 14737 |
| 362 | Ga0466958_0081755 | 3300045836 | Bacteria | 1988 |
| 363 | Ga0466967_0000265 | 3300045976 | Bacteria | 23015 |
| 364 | Ga0466967_0001447 | 3300045976 | Bacteria | 13783 |
| 365 | Ga0466967_0030138 | 3300045976 | Bacteria | 4550 |
| 366 | Ga0466967_0039010 | 3300045976 | Bacteria | 4079 |
| 367 | Ga0466967_0043204 | 3300045976 | Bacteria | 3901 |
| 368 | Ga0466967_0053883 | 3300045976 | Bacteria | 3537 |
| 369 | Ga0466967_0062904 | 3300045976 | Bacteria | 3295 |
| 370 | Ga0466967_0076865 | 3300045976 | Bacteria | 3004 |
| 371 | Ga0466967_0091674 | 3300045976 | Bacteria | 2762 |
| 372 | Ga0466967_0097322 | 3300045976 | Bacteria | 2686 |
| 373 | Ga0466967_0099074 | 3300045976 | Bacteria | 2661 |
| 374 | Ga0466967_0162355 | 3300045976 | Unclassified | 2098 |
| 375 | Ga0466967_0172958 | 3300045976 | Bacteria | 2033 |
| 376 | Ga0466967_0181900 | 3300045976 | Bacteria | 1983 |
| 377 | Ga0466967_0195505 | 3300045976 | Bacteria | 1913 |
| 378 | Ga0466967_0221155 | 3300045976 | Unclassified | 1799 |
| 379 | Ga0466967_0325398 | 3300045976 | Bacteria | 1483 |
| 380 | Ga0466967_0368778 | 3300045976 | Bacteria | 1392 |
| 381 | Ga0495592_0063223 | 3300046454 | Bacteria | 2715 |
| 382 | Ga0495603_0001442 | 3300046455 | Bacteria | 13834 |
| 383 | Ga0495603_0035613 | 3300046455 | Unclassified | 2989 |
| 384 | Ga0495603_0052007 | 3300046455 | Bacteria | 2433 |
| 385 | Ga0495629_0000880 | 3300046459 | Bacteria | 24212 |
| 386 | Ga0495629_0366119 | 3300046459 | Unclassified | 982 |
| 387 | Ga0495629_0471883 | 3300046459 | Bacteria | 848 |
| 388 | Ga0495641_0000552 | 3300046461 | Bacteria | 31604 |
| 389 | Ga0495641_0013029 | 3300046461 | Bacteria | 4603 |
| 390 | Ga0495641_0041163 | 3300046461 | Bacteria | 2147 |
| 391 | Ga0495641_0079837 | 3300046461 | Bacteria | 1466 |
| 392 | Ga0495641_0168366 | 3300046461 | Bacteria | 980 |
| 393 | Ga0495651_0042661 | 3300046462 | Bacteria | 3521 |
| 394 | Ga0495651_0090289 | 3300046462 | Bacteria | 2298 |
| 395 | Ga0495653_0086536 | 3300046463 | Bacteria | 2303 |
| 396 | Ga0495580_0017054 | 3300046472 | Bacteria | 5441 |
| 397 | Ga0495582_0000240 | 3300046473 | Bacteria | 30558 |
| 398 | Ga0495582_0297671 | 3300046473 | Bacteria | 927 |
| 399 | Ga0495605_0167590 | 3300046474 | Bacteria | 972 |
| 400 | Ga0495639_0004699 | 3300046475 | Bacteria | 5868 |
| 401 | Ga0495639_0180077 | 3300046475 | Unclassified | 1029 |
| 402 | Ga0495662_0001469 | 3300046476 | Bacteria | 11662 |
| 403 | Ga0495662_0099717 | 3300046476 | Bacteria | 1420 |
| 404 | Ga0495664_0027647 | 3300046477 | Bacteria | 3308 |
| 405 | Ga0495584_0051989 | 3300046491 | Bacteria | 2062 |
| 406 | Ga0495594_0004755 | 3300046499 | Bacteria | 6994 |
| 407 | Ga0495594_0028377 | 3300046499 | Unclassified | 3020 |
| 408 | Ga0495607_0079927 | 3300046501 | Bacteria | 1800 |
| 409 | Ga0495608_0018577 | 3300046511 | Bacteria | 4792 |
| 410 | Ga0495608_0407445 | 3300046511 | Bacteria | 831 |
| 411 | Ga0495618_0249383 | 3300046514 | Bacteria | 1114 |
| 412 | Ga0495630_0034360 | 3300046517 | Bacteria | 3786 |
| 413 | Ga0495630_0070298 | 3300046517 | Bacteria | 2634 |
| 414 | Ga0495630_0104747 | 3300046517 | Bacteria | 2141 |
| 415 | Ga0495631_0140239 | 3300046518 | Bacteria | 1038 |
| 416 | Ga0495644_0047065 | 3300046523 | Bacteria | 1621 |
| 417 | Ga0495663_0018172 | 3300046525 | Bacteria | 2000 |
| 418 | Ga0495663_0056413 | 3300046525 | Bacteria | 1227 |
| 419 | Ga0495666_0007316 | 3300046526 | Bacteria | 5536 |
| 420 | Ga0495666_0082876 | 3300046526 | Bacteria | 1516 |
| 421 | Ga0495642_0053740 | 3300046528 | Bacteria | 1660 |
| 422 | Ga0495652_0146616 | 3300046529 | Bacteria | 1849 |
| 423 | Ga0495665_0000685 | 3300046531 | Bacteria | 17384 |
| 424 | Ga0495640_0284578 | 3300046533 | Bacteria | 1029 |
| 425 | Ga0495586_0180282 | 3300046535 | Unclassified | 1195 |
| 426 | Ga0495586_0220157 | 3300046535 | Bacteria | 1079 |
| 427 | Ga0495587_0040463 | 3300046536 | Bacteria | 2786 |
| 428 | Ga0495587_0178530 | 3300046536 | Bacteria | 1205 |
| 429 | Ga0495609_0049345 | 3300046538 | Bacteria | 1879 |
| 430 | Ga0495609_0102280 | 3300046538 | Unclassified | 1241 |
| 431 | Ga0495621_0107452 | 3300046539 | Bacteria | 1067 |
| 432 | Ga0495645_0031083 | 3300046543 | Bacteria | 3889 |
| 433 | Ga0495645_0128823 | 3300046543 | Bacteria | 1776 |
| 434 | Ga0495667_0030843 | 3300046559 | Bacteria | 3601 |
| 435 | Ga0495667_0055962 | 3300046559 | Bacteria | 2594 |
| 436 | Ga0495656_0006370 | 3300046615 | Bacteria | 4138 |
| 437 | Ga0495656_0247325 | 3300046615 | Bacteria | 900 |
| 438 | Ga0495634_0061886 | 3300046642 | Bacteria | 2487 |
| 439 | Ga0495635_0086918 | 3300046663 | Unclassified | 2139 |
| 440 | Ga0495659_0035500 | 3300046664 | Bacteria | 1757 |
| 441 | Ga0495661_0061563 | 3300046665 | Unclassified | 2228 |
| 442 | Ga0495657_0084673 | 3300046675 | Bacteria | 2045 |
| 443 | Ga0495657_0095307 | 3300046675 | Unclassified | 1902 |
| 444 | Ga0495657_0130346 | 3300046675 | Bacteria | 1576 |
| 445 | Ga0495647_0040438 | 3300046681 | Bacteria | 1772 |
| 446 | Ga0495658_0000782 | 3300046683 | Bacteria | 17147 |
| 447 | Ga0495658_0022699 | 3300046683 | Bacteria | 3322 |
| 448 | Ga0495658_0052773 | 3300046683 | Bacteria | 2307 |
| 449 | Ga0495658_0101207 | 3300046683 | Bacteria | 1720 |
| 450 | Ga0495658_0255619 | 3300046683 | Unclassified | 1102 |
| 451 | Ga0495613_0015795 | 3300046689 | Bacteria | 5620 |
| 452 | Ga0495624_0009739 | 3300046690 | Bacteria | 6648 |
| 453 | Ga0495624_0083370 | 3300046690 | Bacteria | 1977 |
| 454 | Ga0495624_0207280 | 3300046690 | Bacteria | 1190 |
| 455 | Ga0495589_0058362 | 3300046794 | Bacteria | 1897 |
| 456 | Ga0495600_0001921 | 3300046809 | Bacteria | 11663 |
| 457 | Ga0495581_0000754 | 3300047315 | Bacteria | 17163 |
| 458 | Ga0495581_0021980 | 3300047315 | Bacteria | 3697 |
| 459 | Ga0495581_0110593 | 3300047315 | Bacteria | 1598 |
| 460 | Ga0495604_0081923 | 3300047317 | Bacteria | 2414 |
| 461 | Ga0495604_0088813 | 3300047317 | Unclassified | 2299 |
| 462 | Ga0495674_0041425 | 3300047319 | Bacteria | 4113 |
| 463 | Ga0495674_0127424 | 3300047319 | Bacteria | 2146 |
| 464 | Ga0495674_0173434 | 3300047319 | Bacteria | 1799 |
| 465 | Ga0495674_0373028 | 3300047319 | Bacteria | 1155 |
| 466 | Ga0495676_0000116 | 3300047321 | Bacteria | 61181 |
| 467 | Ga0495676_0004439 | 3300047321 | Bacteria | 12831 |
| 468 | Ga0495676_0198519 | 3300047321 | Unclassified | 1395 |
| 469 | Ga0495676_0388227 | 3300047321 | Bacteria | 928 |
| 470 | Ga0495680_0007595 | 3300047322 | Bacteria | 9909 |
| 471 | Ga0495680_0228477 | 3300047322 | Bacteria | 1326 |
| 472 | Ga0495680_0436137 | 3300047322 | Bacteria | 899 |
| 473 | Ga0495675_0184308 | 3300047444 | Bacteria | 1277 |
| 474 | Ga0495677_0024988 | 3300047445 | Bacteria | 2167 |
| 475 | Ga0495685_145065 | 3300047447 | Unclassified | 772 |
| 476 | Ga0495684_0277226 | 3300047471 | Bacteria | 1211 |
| 477 | Ga0495684_0344114 | 3300047471 | Bacteria | 1060 |
| 478 | Ga0495593_0011497 | 3300047673 | Bacteria | 5082 |
| 479 | Ga0495602_0094660 | 3300048088 | Unclassified | 2468 |
| 480 | Ga0495615_0053522 | 3300048090 | Bacteria | 1046 |
| 481 | Ga0496100_0084246 | 3300048903 | Bacteria | 2155 |
| 482 | Ga0496100_0096496 | 3300048903 | Unclassified | 2028 |
| 483 | Ga0496100_0530197 | 3300048903 | Bacteria | 909 |
| 484 | Ga0496101_0022022 | 3300048904 | Bacteria | 4383 |
| 485 | Ga0496101_0085441 | 3300048904 | Bacteria | 2338 |
| 486 | Ga0496102_0087944 | 3300048905 | Bacteria | 2871 |
| 487 | Ga0496102_0488914 | 3300048905 | Bacteria | 1152 |
| 488 | Ga0496103_0056976 | 3300048906 | Bacteria | 2426 |
| 489 | Ga0496103_0120367 | 3300048906 | Bacteria | 1672 |
| 490 | Ga0496104_0036190 | 3300048907 | Bacteria | 4613 |
| 491 | Ga0496104_0216154 | 3300048907 | Bacteria | 1828 |
| 492 | Ga0496105_0000804 | 3300048908 | Bacteria | 21255 |
| 493 | Ga0496105_0006495 | 3300048908 | Bacteria | 8989 |
| 494 | Ga0496105_0027403 | 3300048908 | Bacteria | 4654 |
| 495 | Ga0496105_0068622 | 3300048908 | Bacteria | 2929 |
| 496 | Ga0496105_0089690 | 3300048908 | Bacteria | 2540 |
| 497 | Ga0496105_0336210 | 3300048908 | Bacteria | 1208 |
| 498 | Ga0496105_0400977 | 3300048908 | Bacteria | 1089 |
| 499 | Ga0496106_0007207 | 3300048909 | Bacteria | 8214 |
| 500 | Ga0496106_0091234 | 3300048909 | Bacteria | 2352 |
| 501 | Ga0496106_0118590 | 3300048909 | Bacteria | 2067 |
| 502 | Ga0496106_0133329 | 3300048909 | Unclassified | 1949 |
| 503 | Ga0496106_0289510 | 3300048909 | Bacteria | 1313 |
| 504 | Ga0496107_0005507 | 3300048910 | Bacteria | 8665 |
| 505 | Ga0496107_0011620 | 3300048910 | Bacteria | 6136 |
| 506 | Ga0496107_0170408 | 3300048910 | Unclassified | 1615 |
| 507 | Ga0496108_0004142 | 3300048911 | Bacteria | 11659 |
| 508 | Ga0496108_0006063 | 3300048911 | Bacteria | 9776 |
| 509 | Ga0496108_0052834 | 3300048911 | Bacteria | 3406 |
| 510 | Ga0496108_0276687 | 3300048911 | Bacteria | 1461 |
| 511 | Ga0496109_0002881 | 3300048912 | Bacteria | 14396 |
| 512 | Ga0496109_0005058 | 3300048912 | Bacteria | 11014 |
| 513 | Ga0496109_0037984 | 3300048912 | Bacteria | 4352 |
| 514 | Ga0496109_0102753 | 3300048912 | Bacteria | 2652 |
| 515 | Ga0496109_0111135 | 3300048912 | Bacteria | 2548 |
| 516 | Ga0496109_0146250 | 3300048912 | Bacteria | 2211 |
| 517 | Ga0496109_0350159 | 3300048912 | Bacteria | 1395 |
| 518 | Ga0496110_0003995 | 3300048913 | Bacteria | 11359 |
| 519 | Ga0496110_0017934 | 3300048913 | Bacteria | 5928 |
| 520 | Ga0496110_0034680 | 3300048913 | Bacteria | 4373 |
| 521 | Ga0496110_0053367 | 3300048913 | Bacteria | 3554 |
| 522 | Ga0496110_0123347 | 3300048913 | Bacteria | 2336 |
| 523 | Ga0496110_0191517 | 3300048913 | Bacteria | 1857 |
| 524 | Ga0496111_0000612 | 3300048914 | Bacteria | 18851 |
| 525 | Ga0496111_0004721 | 3300048914 | Bacteria | 8645 |
| 526 | Ga0496111_0034872 | 3300048914 | Bacteria | 3594 |
| 527 | Ga0496111_0159260 | 3300048914 | Unclassified | 1676 |
| 528 | Ga0496111_0414961 | 3300048914 | Unclassified | 994 |
| 529 | Ga0496112_0004864 | 3300048915 | Bacteria | 11480 |
| 530 | Ga0496112_0078048 | 3300048915 | Bacteria | 3275 |
| 531 | Ga0496112_0086100 | 3300048915 | Bacteria | 3109 |
| 532 | Ga0496112_0111165 | 3300048915 | Bacteria | 2710 |
| 533 | Ga0496112_0147600 | 3300048915 | Bacteria | 2320 |
| 534 | Ga0496112_0176537 | 3300048915 | Bacteria | 2101 |
| 535 | Ga0496113_0001184 | 3300048916 | Bacteria | 14249 |
| 536 | Ga0496113_0078045 | 3300048916 | Bacteria | 2533 |
| 537 | Ga0496113_0215453 | 3300048916 | Bacteria | 1529 |
| 538 | Ga0496114_0024067 | 3300048917 | Bacteria | 4969 |
| 539 | Ga0496114_0061843 | 3300048917 | Bacteria | 3133 |
| 540 | Ga0496114_0093268 | 3300048917 | Unclassified | 2559 |
| 541 | Ga0496114_0182046 | 3300048917 | Bacteria | 1835 |
| 542 | Ga0496114_0183884 | 3300048917 | Bacteria | 1826 |
| 543 | Ga0496114_0185265 | 3300048917 | Bacteria | 1819 |
| 544 | Ga0496114_0320670 | 3300048917 | Unclassified | 1369 |
| 545 | Ga0496114_0693683 | 3300048917 | Unclassified | 893 |
| 546 | Ga0496115_0003315 | 3300048918 | Bacteria | 11559 |
| 547 | Ga0496115_0010047 | 3300048918 | Bacteria | 7055 |
| 548 | Ga0496115_0015265 | 3300048918 | Bacteria | 5824 |
| 549 | Ga0496115_0059343 | 3300048918 | Bacteria | 3081 |
| 550 | Ga0496115_0172204 | 3300048918 | Bacteria | 1790 |
| 551 | Ga0501031_0000814 | 3300049568 | Bacteria | 18745 |
| 552 | Ga0501031_0027568 | 3300049568 | Bacteria | 3703 |
| 553 | Ga0501031_0074413 | 3300049568 | Bacteria | 2212 |
| 554 | Ga0501032_0028423 | 3300049569 | Bacteria | 3842 |
| 555 | Ga0501032_0035166 | 3300049569 | Bacteria | 3427 |
| 556 | Ga0501032_0112771 | 3300049569 | Bacteria | 1799 |
| 557 | Ga0501032_0254922 | 3300049569 | Bacteria | 1138 |
| 558 | Ga0501033_0079862 | 3300049570 | Bacteria | 2400 |
| 559 | Ga0501034_0210123 | 3300049571 | Bacteria | 1902 |
| 560 | Ga0501036_0000261 | 3300049572 | Bacteria | 35846 |
| 561 | Ga0501036_0114443 | 3300049572 | Bacteria | 2279 |
| 562 | Ga0501036_0139435 | 3300049572 | Bacteria | 2047 |
| 563 | Ga0501036_0177672 | 3300049572 | Bacteria | 1792 |
| 564 | Ga0501038_0011161 | 3300049574 | Bacteria | 8205 |
| 565 | Ga0501038_0013580 | 3300049574 | Bacteria | 7421 |
| 566 | Ga0501038_0214327 | 3300049574 | Bacteria | 1539 |
| 567 | Ga0501038_0350145 | 3300049574 | Bacteria | 1150 |
| 568 | Ga0501039_0003652 | 3300049575 | Bacteria | 11537 |
| 569 | Ga0501039_0012492 | 3300049575 | Bacteria | 6484 |
| 570 | Ga0501039_0088738 | 3300049575 | Bacteria | 2408 |
| 571 | Ga0501039_0135774 | 3300049575 | Bacteria | 1931 |
| 572 | Ga0501039_0295901 | 3300049575 | Bacteria | 1272 |
| 573 | Ga0501039_0513541 | 3300049575 | Bacteria | 941 |
| 574 | Ga0501040_0000344 | 3300049576 | Bacteria | 27241 |
| 575 | Ga0501040_0009035 | 3300049576 | Bacteria | 6482 |
| 576 | Ga0501040_0020599 | 3300049576 | Bacteria | 4395 |
| 577 | Ga0501040_0025005 | 3300049576 | Bacteria | 4012 |
| 578 | Ga0501040_0134826 | 3300049576 | Bacteria | 1738 |
| 579 | Ga0501041_0004745 | 3300049577 | Bacteria | 7888 |
| 580 | Ga0501041_0036076 | 3300049577 | Bacteria | 2996 |
| 581 | Ga0501041_0043809 | 3300049577 | Bacteria | 2720 |
| 582 | Ga0501041_0080096 | 3300049577 | Bacteria | 2011 |
| 583 | Ga0501041_0152477 | 3300049577 | Bacteria | 1443 |
| 584 | Ga0501042_0000265 | 3300049578 | Bacteria | 25490 |
| 585 | Ga0501042_0015339 | 3300049578 | Bacteria | 5245 |
| 586 | Ga0501042_0016132 | 3300049578 | Bacteria | 5125 |
| 587 | Ga0501042_0043624 | 3300049578 | Bacteria | 3194 |
| 588 | Ga0501042_0205507 | 3300049578 | Bacteria | 1420 |
| 589 | Ga0501043_0069592 | 3300049579 | Bacteria | 2764 |
| 590 | Ga0501043_0119159 | 3300049579 | Bacteria | 2070 |
| 591 | Ga0501043_0146105 | 3300049579 | Bacteria | 1851 |
| 592 | Ga0501043_0191308 | 3300049579 | Bacteria | 1591 |
| 593 | Ga0501046_0004011 | 3300049580 | Bacteria | 13446 |
| 594 | Ga0501046_0093483 | 3300049580 | Bacteria | 2311 |
| 595 | Ga0501046_0147840 | 3300049580 | Bacteria | 1774 |
| 596 | Ga0501048_0003306 | 3300049582 | Bacteria | 12278 |
| 597 | Ga0501048_0015084 | 3300049582 | Bacteria | 5710 |
| 598 | Ga0501048_0051199 | 3300049582 | Bacteria | 2940 |
| 599 | Ga0501048_0054897 | 3300049582 | Bacteria | 2830 |
| 600 | Ga0501048_0133718 | 3300049582 | Bacteria | 1752 |
| 601 | Ga0501067_0000979 | 3300049583 | Bacteria | 15319 |
| 602 | Ga0501067_0001810 | 3300049583 | Bacteria | 11749 |
| 603 | Ga0501067_0017011 | 3300049583 | Unclassified | 4018 |
| 604 | Ga0501068_0073555 | 3300049584 | Bacteria | 2088 |
| 605 | Ga0501068_0089194 | 3300049584 | Bacteria | 1901 |
| 606 | Ga0501069_0001159 | 3300049585 | Bacteria | 12758 |
| 607 | Ga0501069_0003793 | 3300049585 | Bacteria | 7776 |
| 608 | Ga0501069_0005476 | 3300049585 | Bacteria | 6604 |
| 609 | Ga0501069_0058073 | 3300049585 | Bacteria | 2158 |
| 610 | Ga0501069_0063889 | 3300049585 | Bacteria | 2057 |
| 611 | Ga0501069_0136325 | 3300049585 | Bacteria | 1407 |
| 612 | Ga0501069_0319194 | 3300049585 | Bacteria | 913 |
| 613 | Ga0501070_0037313 | 3300049586 | Bacteria | 4057 |
| 614 | Ga0501070_0060668 | 3300049586 | Bacteria | 3134 |
| 615 | Ga0501070_0146868 | 3300049586 | Bacteria | 1946 |
| 616 | Ga0501070_0224926 | 3300049586 | Bacteria | 1538 |
| 617 | Ga0501070_0304167 | 3300049586 | Bacteria | 1299 |
| 618 | Ga0501071_0000599 | 3300049587 | Bacteria | 18628 |
| 619 | Ga0501071_0007145 | 3300049587 | Bacteria | 7302 |
| 620 | Ga0501071_0010208 | 3300049587 | Bacteria | 6283 |
| 621 | Ga0501071_0021065 | 3300049587 | Bacteria | 4539 |
| 622 | Ga0501071_0057058 | 3300049587 | Bacteria | 2822 |
| 623 | Ga0501071_0171876 | 3300049587 | Bacteria | 1622 |
| 624 | Ga0501071_0306972 | 3300049587 | Unclassified | 1203 |
| 625 | Ga0501072_0001550 | 3300049588 | Bacteria | 17142 |
| 626 | Ga0501072_0012442 | 3300049588 | Bacteria | 6502 |
| 627 | Ga0501072_0196799 | 3300049588 | Bacteria | 1607 |
| 628 | Ga0501072_0240263 | 3300049588 | Bacteria | 1443 |
| 629 | Ga0501072_0641274 | 3300049588 | Unclassified | 836 |
| 630 | Ga0501073_0120634 | 3300049589 | Bacteria | 1817 |
| 631 | Ga0501074_0011485 | 3300049590 | Bacteria | 6439 |
| 632 | Ga0501074_0021865 | 3300049590 | Bacteria | 4644 |
| 633 | Ga0501074_0077037 | 3300049590 | Bacteria | 2393 |
| 634 | Ga0501074_0083446 | 3300049590 | Bacteria | 2291 |
| 635 | Ga0501075_0001217 | 3300049591 | Bacteria | 16683 |
| 636 | Ga0501075_0001579 | 3300049591 | Bacteria | 14891 |
| 637 | Ga0501075_0002376 | 3300049591 | Bacteria | 12517 |
| 638 | Ga0501075_0010127 | 3300049591 | Bacteria | 6616 |
| 639 | Ga0501075_0022084 | 3300049591 | Bacteria | 4645 |
| 640 | Ga0501075_0266614 | 3300049591 | Bacteria | 1305 |
| 641 | Ga0501076_0000330 | 3300049592 | Bacteria | 29312 |
| 642 | Ga0501076_0003816 | 3300049592 | Bacteria | 10614 |
| 643 | Ga0501076_0008579 | 3300049592 | Bacteria | 7496 |
| 644 | Ga0501076_0008610 | 3300049592 | Bacteria | 7484 |
| 645 | Ga0501076_0035301 | 3300049592 | Bacteria | 3913 |
| 646 | Ga0501076_0064116 | 3300049592 | Bacteria | 2928 |
| 647 | Ga0501076_0067975 | 3300049592 | Bacteria | 2846 |
| 648 | Ga0501076_0100765 | 3300049592 | Bacteria | 2327 |
| 649 | Ga0501076_0182087 | 3300049592 | Bacteria | 1713 |
| 650 | Ga0501077_0002195 | 3300049593 | Bacteria | 11787 |
| 651 | Ga0501077_0002794 | 3300049593 | Bacteria | 10473 |
| 652 | Ga0501077_0006316 | 3300049593 | Bacteria | 7256 |
| 653 | Ga0501077_0008751 | 3300049593 | Bacteria | 6281 |
| 654 | Ga0501077_0017848 | 3300049593 | Bacteria | 4484 |
| 655 | Ga0501077_0254147 | 3300049593 | Unclassified | 1118 |
| 656 | Ga0501079_0001641 | 3300049741 | Bacteria | 15928 |
| 657 | Ga0501079_0003329 | 3300049741 | Bacteria | 11789 |
| 658 | Ga0501079_0004610 | 3300049741 | Bacteria | 10212 |
| 659 | Ga0501079_0014630 | 3300049741 | Bacteria | 5984 |
| 660 | Ga0501079_0032577 | 3300049741 | Bacteria | 4008 |
| 661 | Ga0501080_0003166 | 3300049742 | Bacteria | 14502 |
| 662 | Ga0501080_0026343 | 3300049742 | Bacteria | 5403 |
| 663 | Ga0501080_0027682 | 3300049742 | Bacteria | 5270 |
| 664 | Ga0501080_0201343 | 3300049742 | Bacteria | 1828 |
| 665 | Ga0501080_0314666 | 3300049742 | Bacteria | 1418 |
| 666 | Ga0501081_0001194 | 3300049743 | Bacteria | 15741 |
| 667 | Ga0501081_0027450 | 3300049743 | Bacteria | 3840 |
| 668 | Ga0501081_0028154 | 3300049743 | Bacteria | 3791 |
| 669 | Ga0501081_0076890 | 3300049743 | Bacteria | 2331 |
| 670 | Ga0501081_0230129 | 3300049743 | Bacteria | 1350 |
| 671 | Ga0501081_0321862 | 3300049743 | Bacteria | 1137 |
| 672 | Ga0501083_0002907 | 3300049744 | Bacteria | 11860 |
| 673 | Ga0501035_0006323 | 3300049822 | Bacteria | 11133 |
| 674 | Ga0501035_0016071 | 3300049822 | Bacteria | 6906 |
| 675 | Ga0501035_0017965 | 3300049822 | Bacteria | 6521 |
| 676 | Ga0501035_0069006 | 3300049822 | Bacteria | 3134 |
| 677 | Ga0501035_0441253 | 3300049822 | Bacteria | 1078 |
| 678 | Ga0501044_0122443 | 3300049823 | Bacteria | 2601 |
| 679 | Ga0501044_0427656 | 3300049823 | Bacteria | 1234 |
| 680 | Ga0501045_0000784 | 3300049824 | Bacteria | 20425 |
| 681 | Ga0501045_0001676 | 3300049824 | Bacteria | 14903 |
| 682 | Ga0501045_0007858 | 3300049824 | Bacteria | 7424 |
| 683 | Ga0501045_0160576 | 3300049824 | Bacteria | 1673 |
| 684 | nmdc:mga00v17_448297_c1 | 3300050491 | Bacteria | 838 |
| 685 | nmdc:mga0yw44_22461_c1 | 3300050492 | Bacteria | 3539 |
| 686 | nmdc:mga05p37_172096_c1 | 3300050507 | Bacteria | 2641 |
| 687 | nmdc:mga09592_7067_c1 | 3300050508 | Bacteria | 9123 |
| 688 | nmdc:mga0qj67_24935_c1 | 3300050509 | Bacteria | 4615 |
| 689 | nmdc:mga0qj67_81299_c1 | 3300050509 | Bacteria | 2598 |
| 690 | nmdc:mga06r32_93487_c1 | 3300050510 | Bacteria | 2941 |
| 691 | nmdc:mga08y16_1379983_c1 | 3300050511 | Unclassified | 669 |
| 692 | nmdc:mga08y16_68620_c1 | 3300050511 | Bacteria | 3697 |
| 693 | nmdc:mga0n895_270519_c1 | 3300050512 | Unclassified | 1724 |
| 694 | nmdc:mga0n895_391736_c1 | 3300050512 | Bacteria | 1405 |
| 695 | nmdc:mga0n895_9385_c1 | 3300050512 | Bacteria | 8559 |
| 696 | nmdc:mga0rr50_271289_c1 | 3300050513 | Bacteria | 1414 |
| 697 | nmdc:mga0rr50_275284_c1 | 3300050513 | Unclassified | 1404 |
| 698 | nmdc:mga0rr50_6260_c1 | 3300050513 | Bacteria | 7221 |
| 699 | nmdc:mga0rr50_62897_c1 | 3300050513 | Bacteria | 2801 |
| 700 | nmdc:mga08x19_36082_c1 | 3300050514 | Bacteria | 3130 |
| 701 | nmdc:mga08x19_52464_c1 | 3300050514 | Bacteria | 2623 |
| 702 | nmdc:mga08x19_64759_c1 | 3300050514 | Bacteria | 2373 |
| 703 | nmdc:mga0a205_129154_c1 | 3300050515 | Bacteria | 2428 |
| 704 | nmdc:mga0a205_294415_c1 | 3300050515 | Bacteria | 1497 |
| 705 | nmdc:mga0a205_48662_c1 | 3300050515 | Bacteria | 4092 |
| 706 | Ga0495601_0010791 | 3300053077 | Bacteria | 5451 |
| 707 | Ga0495601_0055221 | 3300053077 | Bacteria | 2514 |
| 708 | Ga0495601_0124934 | 3300053077 | Unclassified | 1673 |
| 709 | Ga0495612_0008646 | 3300053078 | Bacteria | 4128 |
| 710 | Ga0495595_0010409 | 3300053084 | Bacteria | 3865 |
| 711 | Ga0495595_0010825 | 3300053084 | Bacteria | 3803 |
| 712 | Ga0495595_0039080 | 3300053084 | Bacteria | 2164 |
| 713 | Ga0495619_0027625 | 3300053085 | Bacteria | 3656 |
| 714 | Ga0495619_0033979 | 3300053085 | Unclassified | 3313 |
| 715 | Ga0495619_0077742 | 3300053085 | Bacteria | 2230 |
| 716 | Ga0495619_0165134 | 3300053085 | Bacteria | 1530 |
| 717 | Ga0501084_0001989 | 3300054114 | Bacteria | 16312 |
| 718 | Ga0501084_0024246 | 3300054114 | Bacteria | 5058 |
| 719 | Ga0501084_0025078 | 3300054114 | Bacteria | 4974 |
| 720 | Ga0501084_0047299 | 3300054114 | Bacteria | 3603 |
| 721 | Ga0501084_0082522 | 3300054114 | Bacteria | 2697 |
| 722 | Ga0501084_0232568 | 3300054114 | Bacteria | 1556 |
| 723 | Ga0590071_037197 | 3300059421 | Bacteria | 1168 |
| 724 | Ga0501082_0002118 | 3300060353 | Bacteria | 17481 |
| 725 | Ga0501082_0011430 | 3300060353 | Bacteria | 7637 |
| 726 | Ga0501082_0015729 | 3300060353 | Bacteria | 6509 |
| 727 | Ga0501082_0068994 | 3300060353 | Bacteria | 3044 |
| 728 | Ga0530510_0010431 | 3300061734 | Bacteria | 6514 |
| 729 | Ga0530510_0020673 | 3300061734 | Bacteria | 4680 |
| 730 | Ga0530510_0036878 | 3300061734 | Bacteria | 3523 |
| 731 | Ga0530510_0119546 | 3300061734 | Bacteria | 1933 |
| 732 | Ga0070674_100339074 | |||
| 733 | JGI25406J46586_10020596 | |||
| 734 | JGI25405J52794_10012704 | |||
| 735 | Ga0070658_10017271 | |||
| 736 | Ga0070683_100015947 | |||
| 737 | Ga0070683_100186325 | |||
| 738 | Ga0070683_100391678 | |||
| 739 | Ga0070683_100427694 | |||
| 740 | Ga0070690_100043515 | |||
| 741 | Ga0070680_100019813 | |||
| 742 | Ga0070680_100035733 | |||
| 743 | Ga0070682_100012996 | |||
| 744 | Ga0068868_100046407 | |||
| 745 | Ga0070660_100032467 | |||
| 746 | Ga0070660_100096384 | |||
| 747 | Ga0070691_10009103 | |||
| 748 | Ga0070691_10245115 | |||
| 749 | Ga0070661_100012914 | |||
| 750 | Ga0070661_100206364 | |||
| 751 | Ga0070661_100561236 | |||
| 752 | Ga0070692_10066205 | |||
| 753 | Ga0070671_100134058 | |||
| 754 | Ga0070671_100232313 | |||
| 755 | Ga0070674_100255243 | |||
| 756 | Ga0070673_100542253 | |||
| 757 | Ga0070659_100035853 | |||
| 758 | Ga0070659_100216000 | |||
| 759 | Ga0070667_100004251 | |||
| 760 | Ga0070703_10011072 | |||
| 761 | Ga0070709_10216849 | |||
| 762 | Ga0070709_10297503 | |||
| 763 | Ga0070714_100005434 | |||
| 764 | Ga0070714_100513683 | |||
| 765 | Ga0070713_100065642 | |||
| 766 | Ga0070713_100116914 | |||
| 767 | Ga0070701_10109737 | |||
| 768 | Ga0070701_10276303 | |||
| 769 | Ga0070705_100029229 | |||
| 770 | Ga0070705_100068512 | |||
| 771 | Ga0070705_100255884 | |||
| 772 | Ga0070700_100004834 | |||
| 773 | Ga0070700_100012439 | |||
| 774 | Ga0070694_100032914 | |||
| 775 | Ga0070694_100286250 | |||
| 776 | Ga0070708_100025933 | |||
| 777 | Ga0070708_100457222 | |||
| 778 | Ga0070663_100246462 | |||
| 779 | Ga0070678_100054945 | |||
| 780 | Ga0070662_100056622 | |||
| 781 | Ga0070681_10041322 | |||
| 782 | Ga0070681_10397478 | |||
| 783 | Ga0068867_100056629 | |||
| 784 | Ga0070706_100009742 | |||
| 785 | Ga0070706_100015065 | |||
| 786 | Ga0070707_100000309 | |||
| 787 | Ga0070698_100010869 | |||
| 788 | Ga0070698_100136308 | |||
| 789 | Ga0070699_100013039 | |||
| 790 | Ga0070699_100091624 | |||
| 791 | Ga0070699_100186645 | |||
| 792 | Ga0070699_100292967 | |||
| 793 | Ga0070699_100514692 | |||
| 794 | Ga0070679_100011572 | |||
| 795 | Ga0070679_100031696 | |||
| 796 | Ga0070679_100197697 | |||
| 797 | Ga0070679_100556525 | |||
| 798 | Ga0070684_100023773 | |||
| 799 | Ga0070684_100251645 | |||
| 800 | Ga0070684_100377336 | |||
| 801 | Ga0068853_100422857 | |||
| 802 | Ga0070672_100170844 | |||
| 803 | Ga0070686_100021491 | |||
| 804 | Ga0070695_100032685 | |||
| 805 | Ga0070695_100088307 | |||
| 806 | Ga0070696_100030011 | |||
| 807 | Ga0070696_100120113 | |||
| 808 | Ga0070693_100010834 | |||
| 809 | Ga0070665_100392644 | |||
| 810 | Ga0070665_100608395 | |||
| 811 | Ga0070704_100178816 | |||
| 812 | Ga0070704_100211401 | |||
| 813 | Ga0070704_100477743 | |||
| 814 | Ga0068855_100029577 | |||
| 815 | Ga0068855_100090499 | |||
| 816 | Ga0068855_100263144 | |||
| 817 | Ga0070664_100276048 | |||
| 818 | Ga0068857_100056006 | |||
| 819 | Ga0068854_100016763 | |||
| 820 | Ga0068856_100064058 | |||
| 821 | Ga0068856_100129338 | |||
| 822 | Ga0068856_100174573 | |||
| 823 | Ga0070702_100012791 | |||
| 824 | Ga0068852_100062484 | |||
| 825 | Ga0068852_100092380 | |||
| 826 | Ga0068861_100065711 | |||
| 827 | Ga0068861_100259685 | |||
| 828 | Ga0068858_100036692 | |||
| 829 | Ga0068860_100073004 | |||
| 830 | Ga0068862_100136232 | |||
| 831 | Ga0081455_10006006 | |||
| 832 | Ga0081540_1002188 | |||
| 833 | Ga0081540_1005502 | |||
| 834 | Ga0081539_10000030 | |||
| 835 | Ga0081539_10001549 | |||
| 836 | Ga0070717_10320246 | |||
| 837 | Ga0070717_10454049 | |||
| 838 | Ga0070717_10596149 | |||
| 839 | Ga0075364_10070371 | |||
| 840 | Ga0075432_10001857 | |||
| 841 | Ga0070712_100040305 | |||
| 842 | Ga0070712_100553363 | |||
| 843 | Ga0068871_100099525 | |||
| 844 | Ga0068871_100537595 | |||
| 845 | Ga0075428_100040993 | |||
| 846 | Ga0075430_100077424 | |||
| 847 | Ga0075430_100413049 | |||
| 848 | Ga0075431_100115711 | |||
| 849 | Ga0075431_100217876 | |||
| 850 | Ga0075433_10085908 | |||
| 851 | Ga0075433_10112810 | |||
| 852 | Ga0075433_10705645 | |||
| 853 | Ga0075434_100050721 | |||
| 854 | Ga0075434_100083490 | |||
| 855 | Ga0075434_100476992 | |||
| 856 | Ga0075429_100003982 | |||
| 857 | Ga0075429_100147850 | |||
| 858 | Ga0075429_100413357 | |||
| 859 | Ga0068865_100008163 | |||
| 860 | Ga0075436_100004064 | |||
| 861 | Ga0075436_100004709 | |||
| 862 | Ga0075436_100028138 | |||
| 863 | Ga0075435_100012083 | |||
| 864 | Ga0075435_100087343 | |||
| 865 | Ga0075435_100100383 | |||
| 866 | Ga0075435_100215078 | |||
| 867 | Ga0075435_100289303 | |||
| 868 | Ga0075435_100691137 | |||
| 869 | Ga0105240_10017356 | |||
| 870 | Ga0105240_10618829 | |||
| 871 | Ga0111539_11150121 | |||
| 872 | Ga0105245_10027075 | |||
| 873 | Ga0105245_10039719 | |||
| 874 | Ga0105245_10067581 | |||
| 875 | Ga0105245_10108136 | |||
| 876 | Ga0114129_11036502 | |||
| 877 | Ga0114129_11355654 | |||
| 878 | Ga0105243_10045047 | |||
| 879 | Ga0105243_10203915 | |||
| 880 | Ga0105243_11101335 | |||
| 881 | Ga0105242_10079019 | |||
| 882 | Ga0105242_10103160 | |||
| 883 | Ga0105242_10109918 | |||
| 884 | Ga0105248_11111470 | |||
| 885 | Ga0105237_10057860 | |||
| 886 | Ga0105238_10257056 | |||
| 887 | Ga0105238_10296692 | |||
| 888 | Ga0105238_10684126 | |||
| 889 | Ga0105249_10039000 | |||
| 890 | Ga0105249_10176789 | |||
| 891 | Ga0105239_10114517 | |||
| 892 | Ga0105239_10339899 | |||
| 893 | Ga0105239_10345423 | |||
| 894 | Ga0105246_10068844 | |||
| 895 | Ga0157371_10019381 | |||
| 896 | Ga0157370_10075146 | |||
| 897 | Ga0157369_10066860 | |||
| 898 | Ga0157369_10191137 | |||
| 899 | Ga0157369_10598397 | |||
| 900 | Ga0157378_10326927 | |||
| 901 | Ga0163162_10102468 | |||
| 902 | Ga0157372_10063226 | |||
| 903 | Ga0157372_10131994 | |||
| 904 | Ga0157372_10433197 | |||
| 905 | Ga0157375_10334166 | |||
| 906 | Ga0157375_10948927 | |||
| 907 | Ga0163163_10379423 | |||
| 908 | Ga0157380_10010919 | |||
| 909 | Ga0157380_10103441 | |||
| 910 | Ga0182008_10121674 | |||
| 911 | Ga0157376_10107223 | |||
| 912 | Ga0157376_10582726 | |||
| 913 | Ga0206356_10215950 | |||
| 914 | Ga0207692_10162479 | |||
| 915 | Ga0207699_10374386 | |||
| 916 | Ga0207705_10338927 | |||
| 917 | Ga0207684_10028135 | |||
| 918 | Ga0207684_10061939 | |||
| 919 | Ga0207684_10070639 | |||
| 920 | Ga0207684_10128107 | |||
| 921 | Ga0207684_10245311 | |||
| 922 | Ga0207707_10035927 | |||
| 923 | Ga0207707_10496300 | |||
| 924 | Ga0207695_10016353 | |||
| 925 | Ga0207671_10416411 | |||
| 926 | Ga0207693_10007819 | |||
| 927 | Ga0207693_10037411 | |||
| 928 | Ga0207693_10038166 | |||
| 929 | Ga0207663_10016268 | |||
| 930 | Ga0207663_10593295 | |||
| 931 | Ga0207660_10028795 | |||
| 932 | Ga0207660_10102222 | |||
| 933 | Ga0207662_10072495 | |||
| 934 | Ga0207657_10041391 | |||
| 935 | Ga0207652_10013179 | |||
| 936 | Ga0207652_10287977 | |||
| 937 | Ga0207652_10327140 | |||
| 938 | Ga0207652_10506136 | |||
| 939 | Ga0207646_10001136 | |||
| 940 | Ga0207681_10581806 | |||
| 941 | Ga0207694_10648187 | |||
| 942 | Ga0207687_10053841 | |||
| 943 | Ga0207700_10068745 | |||
| 944 | Ga0207700_10154144 | |||
| 945 | Ga0207664_10126618 | |||
| 946 | Ga0207664_10202700 | |||
| 947 | Ga0207644_10075898 | |||
| 948 | Ga0207644_10195015 | |||
| 949 | Ga0207690_10026441 | |||
| 950 | Ga0207690_10073083 | |||
| 951 | Ga0207706_10005602 | |||
| 952 | Ga0207669_10231408 | |||
| 953 | Ga0207665_10240531 | |||
| 954 | Ga0207711_10442249 | |||
| 955 | Ga0207689_10288031 | |||
| 956 | Ga0207661_10001401 | |||
| 957 | Ga0207661_10316452 | |||
| 958 | Ga0207661_10461469 | |||
| 959 | Ga0207667_10193371 | |||
| 960 | Ga0207667_10303469 | |||
| 961 | Ga0207712_10070744 | |||
| 962 | Ga0207712_10185067 | |||
| 963 | Ga0207668_10022781 | |||
| 964 | Ga0207668_10207376 | |||
| 965 | Ga0207640_10007164 | |||
| 966 | Ga0207640_10181904 | |||
| 967 | Ga0207658_10003739 | |||
| 968 | Ga0207677_10042987 | |||
| 969 | Ga0207677_10358039 | |||
| 970 | Ga0207639_10289303 | |||
| 971 | Ga0207678_10472643 | |||
| 972 | Ga0207708_10047840 | |||
| 973 | Ga0207702_10107652 | |||
| 974 | Ga0207702_10219138 | |||
| 975 | Ga0207702_10362082 | |||
| 976 | Ga0207702_10374106 | |||
| 977 | Ga0207648_10049936 | |||
| 978 | Ga0207648_10056812 | |||
| 979 | Ga0207648_10057970 | |||
| 980 | Ga0207674_10040199 | |||
| 981 | Ga0207675_100001015 | |||
| 982 | Ga0207675_100002032 | |||
| 983 | Ga0207683_10050082 | |||
| 984 | Ga0207698_10141432 | |||
| 985 | Ga0207698_10180431 | |||
| 986 | Ga0207428_10028425 | |||
| 987 | Ga0265336_10003729 | |||
| 988 | Ga0265324_10013537 | |||
| 989 | Ga0265340_10006557 | |||
| 990 | Ga0307408_100087099 | |||
| 991 | Ga0307408_100139721 | |||
| 992 | Ga0265313_10024931 | |||
| 993 | Ga0307405_10243330 | |||
| 994 | Ga0307405_10293212 | |||
| 995 | Ga0307413_10088670 | |||
| 996 | Ga0307407_10086629 | |||
| 997 | Ga0307407_10108254 | |||
| 998 | Ga0307409_100264833 | |||
| 999 | Ga0307416_100024939 | |||
| 1000 | Ga0307416_100256291 | |||
| 1001 | Ga0307414_10077881 | |||
| 1002 | Ga0307411_10205124 | |||
| 1003 | Ga0307415_100149544 | |||
| 1004 | Ga0373958_0014349 | |||
| 1005 | Ga0373944_0004552 | |||
| 1006 | Ga0373944_0090639 | |||
| 1007 | Ga0373945_0002806 | |||
| 1008 | Ga0373945_0007576 | |||
| 1009 | Ga0373945_0026214 | |||
| 1010 | Ga0373960_0017999 | |||
| 1011 | Ga0373943_0006660 | |||
| 1012 | Ga0373943_0010455 | |||
| 1013 | Ga0373943_0029755 | |||
| 1014 | Ga0373946_0003486 | |||
| 1015 | Ga0373961_0026375 | |||
| 1016 | Ga0373924_0181216 | |||
| 1017 | Ga0373931_0236112 | |||
| 1018 | Ga0373931_0281904 | |||
| 1019 | Ga0373935_0019823 | |||
| 1020 | Ga0373935_0053217 | |||
| 1021 | Ga0373947_0002323 | |||
| 1022 | Ga0373947_0012264 | |||
| 1023 | Ga0373947_0033498 | |||
| 1024 | Ga0373947_0315409 | |||
| 1025 | Ga0373925_0005408 | |||
| 1026 | Ga0373925_0054964 | |||
| 1027 | Ga0395899_0002477 | |||
| 1028 | Ga0395899_0004322 | |||
| 1029 | Ga0395899_0100204 | |||
| 1030 | Ga0395899_0157036 | |||
| 1031 | Ga0395899_0185805 | |||
| 1032 | Ga0395900_0003203 | |||
| 1033 | Ga0395900_0005102 | |||
| 1034 | Ga0395900_0008552 | |||
| 1035 | Ga0395900_0116060 | |||
| 1036 | Ga0395900_0122553 | |||
| 1037 | Ga0395900_0599885 | |||
| 1038 | Ga0395898_0010794 | |||
| 1039 | Ga0395898_0011779 | |||
| 1040 | Ga0395898_0013287 | |||
| 1041 | Ga0395898_0022687 | |||
| 1042 | Ga0395898_0055207 | |||
| 1043 | Ga0395898_0149118 | |||
| 1044 | Ga0395898_0211013 | |||
| 1045 | Ga0395905_0000568 | |||
| 1046 | Ga0395905_0018824 | |||
| 1047 | Ga0395905_0042892 | |||
| 1048 | Ga0395905_0105509 | |||
| 1049 | Ga0395905_0137950 | |||
| 1050 | Ga0395901_0008882 | |||
| 1051 | Ga0395901_0012951 | |||
| 1052 | Ga0395901_0012998 | |||
| 1053 | Ga0395901_0049630 | |||
| 1054 | Ga0395901_0061179 | |||
| 1055 | Ga0395901_0137441 | |||
| 1056 | Ga0395901_0200733 | |||
| 1057 | Ga0395901_0544102 | |||
| 1058 | Ga0395901_0565012 | |||
| 1059 | Ga0395901_0641247 | |||
| 1060 | Ga0395901_0767855 | |||
| 1061 | Ga0436363_0658494 | |||
| 1062 | Ga0439447_031891 | |||
| 1063 | Ga0451789_1111844 | |||
| 1064 | Ga0451802_0966161 | |||
| 1065 | Ga0451849_0053658 | |||
| 1066 | Ga0451851_0696550 | |||
| 1067 | Ga0451855_1495820 | |||
| 1068 | Ga0439448_0018733 | |||
| 1069 | Ga0439446_0010089 | |||
| 1070 | Ga0439458_0006164 | |||
| 1071 | Ga0466961_0002298 | |||
| 1072 | Ga0466961_0068358 | |||
| 1073 | Ga0466963_0002261 | |||
| 1074 | Ga0466963_0005306 | |||
| 1075 | Ga0466963_0022081 | |||
| 1076 | Ga0466963_0026259 | |||
| 1077 | Ga0466963_0043669 | |||
| 1078 | Ga0466963_0228220 | |||
| 1079 | Ga0466963_0379323 | |||
| 1080 | Ga0466964_0002218 | |||
| 1081 | Ga0466964_0002975 | |||
| 1082 | Ga0466971_0000910 | |||
| 1083 | Ga0466968_0060418 | |||
| 1084 | Ga0466957_0000349 | |||
| 1085 | Ga0466957_0097550 | |||
| 1086 | Ga0466957_0101416 | |||
| 1087 | Ga0466960_0084353 | |||
| 1088 | Ga0466959_0024411 | |||
| 1089 | Ga0466959_0037515 | |||
| 1090 | Ga0451576_0013003 | |||
| 1091 | Ga0451576_0996180 | |||
| 1092 | Ga0466958_0000685 | |||
| 1093 | Ga0466958_0081755 | |||
| 1094 | Ga0466967_0000265 | |||
| 1095 | Ga0466967_0001447 | |||
| 1096 | Ga0466967_0030138 | |||
| 1097 | Ga0466967_0039010 | |||
| 1098 | Ga0466967_0043204 | |||
| 1099 | Ga0466967_0053883 | |||
| 1100 | Ga0466967_0062904 | |||
| 1101 | Ga0466967_0076865 | |||
| 1102 | Ga0466967_0091674 | |||
| 1103 | Ga0466967_0097322 | |||
| 1104 | Ga0466967_0099074 | |||
| 1105 | Ga0466967_0162355 | |||
| 1106 | Ga0466967_0172958 | |||
| 1107 | Ga0466967_0181900 | |||
| 1108 | Ga0466967_0195505 | |||
| 1109 | Ga0466967_0221155 | |||
| 1110 | Ga0466967_0325398 | |||
| 1111 | Ga0466967_0368778 | |||
| 1112 | Ga0495592_0063223 | |||
| 1113 | Ga0495603_0001442 | |||
| 1114 | Ga0495603_0035613 | |||
| 1115 | Ga0495603_0052007 | |||
| 1116 | Ga0495629_0000880 | |||
| 1117 | Ga0495629_0366119 | |||
| 1118 | Ga0495629_0471883 | |||
| 1119 | Ga0495641_0000552 | |||
| 1120 | Ga0495641_0013029 | |||
| 1121 | Ga0495641_0041163 | |||
| 1122 | Ga0495641_0079837 | |||
| 1123 | Ga0495641_0168366 | |||
| 1124 | Ga0495651_0042661 | |||
| 1125 | Ga0495651_0090289 | |||
| 1126 | Ga0495653_0086536 | |||
| 1127 | Ga0495580_0017054 | |||
| 1128 | Ga0495582_0000240 | |||
| 1129 | Ga0495582_0297671 | |||
| 1130 | Ga0495605_0167590 | |||
| 1131 | Ga0495639_0004699 | |||
| 1132 | Ga0495639_0180077 | |||
| 1133 | Ga0495662_0001469 | |||
| 1134 | Ga0495662_0099717 | |||
| 1135 | Ga0495664_0027647 | |||
| 1136 | Ga0495584_0051989 | |||
| 1137 | Ga0495594_0004755 | |||
| 1138 | Ga0495594_0028377 | |||
| 1139 | Ga0495607_0079927 | |||
| 1140 | Ga0495608_0018577 | |||
| 1141 | Ga0495608_0407445 | |||
| 1142 | Ga0495618_0249383 | |||
| 1143 | Ga0495630_0034360 | |||
| 1144 | Ga0495630_0070298 | |||
| 1145 | Ga0495630_0104747 | |||
| 1146 | Ga0495631_0140239 | |||
| 1147 | Ga0495644_0047065 | |||
| 1148 | Ga0495663_0018172 | |||
| 1149 | Ga0495663_0056413 | |||
| 1150 | Ga0495666_0007316 | |||
| 1151 | Ga0495666_0082876 | |||
| 1152 | Ga0495642_0053740 | |||
| 1153 | Ga0495652_0146616 | |||
| 1154 | Ga0495665_0000685 | |||
| 1155 | Ga0495640_0284578 | |||
| 1156 | Ga0495586_0180282 | |||
| 1157 | Ga0495586_0220157 | |||
| 1158 | Ga0495587_0040463 | |||
| 1159 | Ga0495587_0178530 | |||
| 1160 | Ga0495609_0049345 | |||
| 1161 | Ga0495609_0102280 | |||
| 1162 | Ga0495621_0107452 | |||
| 1163 | Ga0495645_0031083 | |||
| 1164 | Ga0495645_0128823 | |||
| 1165 | Ga0495667_0030843 | |||
| 1166 | Ga0495667_0055962 | |||
| 1167 | Ga0495656_0006370 | |||
| 1168 | Ga0495656_0247325 | |||
| 1169 | Ga0495634_0061886 | |||
| 1170 | Ga0495635_0086918 | |||
| 1171 | Ga0495659_0035500 | |||
| 1172 | Ga0495661_0061563 | |||
| 1173 | Ga0495657_0084673 | |||
| 1174 | Ga0495657_0095307 | |||
| 1175 | Ga0495657_0130346 | |||
| 1176 | Ga0495647_0040438 | |||
| 1177 | Ga0495658_0000782 | |||
| 1178 | Ga0495658_0022699 | |||
| 1179 | Ga0495658_0052773 | |||
| 1180 | Ga0495658_0101207 | |||
| 1181 | Ga0495658_0255619 | |||
| 1182 | Ga0495613_0015795 | |||
| 1183 | Ga0495624_0009739 | |||
| 1184 | Ga0495624_0083370 | |||
| 1185 | Ga0495624_0207280 | |||
| 1186 | Ga0495589_0058362 | |||
| 1187 | Ga0495600_0001921 | |||
| 1188 | Ga0495581_0000754 | |||
| 1189 | Ga0495581_0021980 | |||
| 1190 | Ga0495581_0110593 | |||
| 1191 | Ga0495604_0081923 | |||
| 1192 | Ga0495604_0088813 | |||
| 1193 | Ga0495674_0041425 | |||
| 1194 | Ga0495674_0127424 | |||
| 1195 | Ga0495674_0173434 | |||
| 1196 | Ga0495674_0373028 | |||
| 1197 | Ga0495676_0000116 | |||
| 1198 | Ga0495676_0004439 | |||
| 1199 | Ga0495676_0198519 | |||
| 1200 | Ga0495676_0388227 | |||
| 1201 | Ga0495680_0007595 | |||
| 1202 | Ga0495680_0228477 | |||
| 1203 | Ga0495680_0436137 | |||
| 1204 | Ga0495675_0184308 | |||
| 1205 | Ga0495677_0024988 | |||
| 1206 | Ga0495685_145065 | |||
| 1207 | Ga0495684_0277226 | |||
| 1208 | Ga0495684_0344114 | |||
| 1209 | Ga0495593_0011497 | |||
| 1210 | Ga0495602_0094660 | |||
| 1211 | Ga0495615_0053522 | |||
| 1212 | Ga0496100_0084246 | |||
| 1213 | Ga0496100_0096496 | |||
| 1214 | Ga0496100_0530197 | |||
| 1215 | Ga0496101_0022022 | |||
| 1216 | Ga0496101_0085441 | |||
| 1217 | Ga0496102_0087944 | |||
| 1218 | Ga0496102_0488914 | |||
| 1219 | Ga0496103_0056976 | |||
| 1220 | Ga0496103_0120367 | |||
| 1221 | Ga0496104_0036190 | |||
| 1222 | Ga0496104_0216154 | |||
| 1223 | Ga0496105_0000804 | |||
| 1224 | Ga0496105_0006495 | |||
| 1225 | Ga0496105_0027403 | |||
| 1226 | Ga0496105_0068622 | |||
| 1227 | Ga0496105_0089690 | |||
| 1228 | Ga0496105_0336210 | |||
| 1229 | Ga0496105_0400977 | |||
| 1230 | Ga0496106_0007207 | |||
| 1231 | Ga0496106_0091234 | |||
| 1232 | Ga0496106_0118590 | |||
| 1233 | Ga0496106_0133329 | |||
| 1234 | Ga0496106_0289510 | |||
| 1235 | Ga0496107_0005507 | |||
| 1236 | Ga0496107_0011620 | |||
| 1237 | Ga0496107_0170408 | |||
| 1238 | Ga0496108_0004142 | |||
| 1239 | Ga0496108_0006063 | |||
| 1240 | Ga0496108_0052834 | |||
| 1241 | Ga0496108_0276687 | |||
| 1242 | Ga0496109_0002881 | |||
| 1243 | Ga0496109_0005058 | |||
| 1244 | Ga0496109_0037984 | |||
| 1245 | Ga0496109_0102753 | |||
| 1246 | Ga0496109_0111135 | |||
| 1247 | Ga0496109_0146250 | |||
| 1248 | Ga0496109_0350159 | |||
| 1249 | Ga0496110_0003995 | |||
| 1250 | Ga0496110_0017934 | |||
| 1251 | Ga0496110_0034680 | |||
| 1252 | Ga0496110_0053367 | |||
| 1253 | Ga0496110_0123347 | |||
| 1254 | Ga0496110_0191517 | |||
| 1255 | Ga0496111_0000612 | |||
| 1256 | Ga0496111_0004721 | |||
| 1257 | Ga0496111_0034872 | |||
| 1258 | Ga0496111_0159260 | |||
| 1259 | Ga0496111_0414961 | |||
| 1260 | Ga0496112_0004864 | |||
| 1261 | Ga0496112_0078048 | |||
| 1262 | Ga0496112_0086100 | |||
| 1263 | Ga0496112_0111165 | |||
| 1264 | Ga0496112_0147600 | |||
| 1265 | Ga0496112_0176537 | |||
| 1266 | Ga0496113_0001184 | |||
| 1267 | Ga0496113_0078045 | |||
| 1268 | Ga0496113_0215453 | |||
| 1269 | Ga0496114_0024067 | |||
| 1270 | Ga0496114_0061843 | |||
| 1271 | Ga0496114_0093268 | |||
| 1272 | Ga0496114_0182046 | |||
| 1273 | Ga0496114_0183884 | |||
| 1274 | Ga0496114_0185265 | |||
| 1275 | Ga0496114_0320670 | |||
| 1276 | Ga0496114_0693683 | |||
| 1277 | Ga0496115_0003315 | |||
| 1278 | Ga0496115_0010047 | |||
| 1279 | Ga0496115_0015265 | |||
| 1280 | Ga0496115_0059343 | |||
| 1281 | Ga0496115_0172204 | |||
| 1282 | Ga0501031_0000814 | |||
| 1283 | Ga0501031_0027568 | |||
| 1284 | Ga0501031_0074413 | |||
| 1285 | Ga0501032_0028423 | |||
| 1286 | Ga0501032_0035166 | |||
| 1287 | Ga0501032_0112771 | |||
| 1288 | Ga0501032_0254922 | |||
| 1289 | Ga0501033_0079862 | |||
| 1290 | Ga0501034_0210123 | |||
| 1291 | Ga0501036_0000261 | |||
| 1292 | Ga0501036_0114443 | |||
| 1293 | Ga0501036_0139435 | |||
| 1294 | Ga0501036_0177672 | |||
| 1295 | Ga0501038_0011161 | |||
| 1296 | Ga0501038_0013580 | |||
| 1297 | Ga0501038_0214327 | |||
| 1298 | Ga0501038_0350145 | |||
| 1299 | Ga0501039_0003652 | |||
| 1300 | Ga0501039_0012492 | |||
| 1301 | Ga0501039_0088738 | |||
| 1302 | Ga0501039_0135774 | |||
| 1303 | Ga0501039_0295901 | |||
| 1304 | Ga0501039_0513541 | |||
| 1305 | Ga0501040_0000344 | |||
| 1306 | Ga0501040_0009035 | |||
| 1307 | Ga0501040_0020599 | |||
| 1308 | Ga0501040_0025005 | |||
| 1309 | Ga0501040_0134826 | |||
| 1310 | Ga0501041_0004745 | |||
| 1311 | Ga0501041_0036076 | |||
| 1312 | Ga0501041_0043809 | |||
| 1313 | Ga0501041_0080096 | |||
| 1314 | Ga0501041_0152477 | |||
| 1315 | Ga0501042_0000265 | |||
| 1316 | Ga0501042_0015339 | |||
| 1317 | Ga0501042_0016132 | |||
| 1318 | Ga0501042_0043624 | |||
| 1319 | Ga0501042_0205507 | |||
| 1320 | Ga0501043_0069592 | |||
| 1321 | Ga0501043_0119159 | |||
| 1322 | Ga0501043_0146105 | |||
| 1323 | Ga0501043_0191308 | |||
| 1324 | Ga0501046_0004011 | |||
| 1325 | Ga0501046_0093483 | |||
| 1326 | Ga0501046_0147840 | |||
| 1327 | Ga0501048_0003306 | |||
| 1328 | Ga0501048_0015084 | |||
| 1329 | Ga0501048_0051199 | |||
| 1330 | Ga0501048_0054897 | |||
| 1331 | Ga0501048_0133718 | |||
| 1332 | Ga0501067_0000979 | |||
| 1333 | Ga0501067_0001810 | |||
| 1334 | Ga0501067_0017011 | |||
| 1335 | Ga0501068_0073555 | |||
| 1336 | Ga0501068_0089194 | |||
| 1337 | Ga0501069_0001159 | |||
| 1338 | Ga0501069_0003793 | |||
| 1339 | Ga0501069_0005476 | |||
| 1340 | Ga0501069_0058073 | |||
| 1341 | Ga0501069_0063889 | |||
| 1342 | Ga0501069_0136325 | |||
| 1343 | Ga0501069_0319194 | |||
| 1344 | Ga0501070_0037313 | |||
| 1345 | Ga0501070_0060668 | |||
| 1346 | Ga0501070_0146868 | |||
| 1347 | Ga0501070_0224926 | |||
| 1348 | Ga0501070_0304167 | |||
| 1349 | Ga0501071_0000599 | |||
| 1350 | Ga0501071_0007145 | |||
| 1351 | Ga0501071_0010208 | |||
| 1352 | Ga0501071_0021065 | |||
| 1353 | Ga0501071_0057058 | |||
| 1354 | Ga0501071_0171876 | |||
| 1355 | Ga0501071_0306972 | |||
| 1356 | Ga0501072_0001550 | |||
| 1357 | Ga0501072_0012442 | |||
| 1358 | Ga0501072_0196799 | |||
| 1359 | Ga0501072_0240263 | |||
| 1360 | Ga0501072_0641274 | |||
| 1361 | Ga0501073_0120634 | |||
| 1362 | Ga0501074_0011485 | |||
| 1363 | Ga0501074_0021865 | |||
| 1364 | Ga0501074_0077037 | |||
| 1365 | Ga0501074_0083446 | |||
| 1366 | Ga0501075_0001217 | |||
| 1367 | Ga0501075_0001579 | |||
| 1368 | Ga0501075_0002376 | |||
| 1369 | Ga0501075_0010127 | |||
| 1370 | Ga0501075_0022084 | |||
| 1371 | Ga0501075_0266614 | |||
| 1372 | Ga0501076_0000330 | |||
| 1373 | Ga0501076_0003816 | |||
| 1374 | Ga0501076_0008579 | |||
| 1375 | Ga0501076_0008610 | |||
| 1376 | Ga0501076_0035301 | |||
| 1377 | Ga0501076_0064116 | |||
| 1378 | Ga0501076_0067975 | |||
| 1379 | Ga0501076_0100765 | |||
| 1380 | Ga0501076_0182087 | |||
| 1381 | Ga0501077_0002195 | |||
| 1382 | Ga0501077_0002794 | |||
| 1383 | Ga0501077_0006316 | |||
| 1384 | Ga0501077_0008751 | |||
| 1385 | Ga0501077_0017848 | |||
| 1386 | Ga0501077_0254147 | |||
| 1387 | Ga0501079_0001641 | |||
| 1388 | Ga0501079_0003329 | |||
| 1389 | Ga0501079_0004610 | |||
| 1390 | Ga0501079_0014630 | |||
| 1391 | Ga0501079_0032577 | |||
| 1392 | Ga0501080_0003166 | |||
| 1393 | Ga0501080_0026343 | |||
| 1394 | Ga0501080_0027682 | |||
| 1395 | Ga0501080_0201343 | |||
| 1396 | Ga0501080_0314666 | |||
| 1397 | Ga0501081_0001194 | |||
| 1398 | Ga0501081_0027450 | |||
| 1399 | Ga0501081_0028154 | |||
| 1400 | Ga0501081_0076890 | |||
| 1401 | Ga0501081_0230129 | |||
| 1402 | Ga0501081_0321862 | |||
| 1403 | Ga0501083_0002907 | |||
| 1404 | Ga0501035_0006323 | |||
| 1405 | Ga0501035_0016071 | |||
| 1406 | Ga0501035_0017965 | |||
| 1407 | Ga0501035_0069006 | |||
| 1408 | Ga0501035_0441253 | |||
| 1409 | Ga0501044_0122443 | |||
| 1410 | Ga0501044_0427656 | |||
| 1411 | Ga0501045_0000784 | |||
| 1412 | Ga0501045_0001676 | |||
| 1413 | Ga0501045_0007858 | |||
| 1414 | Ga0501045_0160576 | |||
| 1415 | nmdc:mga00v17_448297_c1 | |||
| 1416 | nmdc:mga0yw44_22461_c1 | |||
| 1417 | nmdc:mga05p37_172096_c1 | |||
| 1418 | nmdc:mga09592_7067_c1 | |||
| 1419 | nmdc:mga0qj67_24935_c1 | |||
| 1420 | nmdc:mga0qj67_81299_c1 | |||
| 1421 | nmdc:mga06r32_93487_c1 | |||
| 1422 | nmdc:mga08y16_1379983_c1 | |||
| 1423 | nmdc:mga08y16_68620_c1 | |||
| 1424 | nmdc:mga0n895_270519_c1 | |||
| 1425 | nmdc:mga0n895_391736_c1 | |||
| 1426 | nmdc:mga0n895_9385_c1 | |||
| 1427 | nmdc:mga0rr50_271289_c1 | |||
| 1428 | nmdc:mga0rr50_275284_c1 | |||
| 1429 | nmdc:mga0rr50_6260_c1 | |||
| 1430 | nmdc:mga0rr50_62897_c1 | |||
| 1431 | nmdc:mga08x19_36082_c1 | |||
| 1432 | nmdc:mga08x19_52464_c1 | |||
| 1433 | nmdc:mga08x19_64759_c1 | |||
| 1434 | nmdc:mga0a205_129154_c1 | |||
| 1435 | nmdc:mga0a205_294415_c1 | |||
| 1436 | nmdc:mga0a205_48662_c1 | |||
| 1437 | Ga0495601_0010791 | |||
| 1438 | Ga0495601_0055221 | |||
| 1439 | Ga0495601_0124934 | |||
| 1440 | Ga0495612_0008646 | |||
| 1441 | Ga0495595_0010409 | |||
| 1442 | Ga0495595_0010825 | |||
| 1443 | Ga0495595_0039080 | |||
| 1444 | Ga0495619_0027625 | |||
| 1445 | Ga0495619_0033979 | |||
| 1446 | Ga0495619_0077742 | |||
| 1447 | Ga0495619_0165134 | |||
| 1448 | Ga0501084_0001989 | |||
| 1449 | Ga0501084_0024246 | |||
| 1450 | Ga0501084_0025078 | |||
| 1451 | Ga0501084_0047299 | |||
| 1452 | Ga0501084_0082522 | |||
| 1453 | Ga0501084_0232568 | |||
| 1454 | Ga0590071_037197 | |||
| 1455 | Ga0501082_0002118 | |||
| 1456 | Ga0501082_0011430 | |||
| 1457 | Ga0501082_0015729 | |||
| 1458 | Ga0501082_0068994 | |||
| 1459 | Ga0530510_0010431 | |||
| 1460 | Ga0530510_0020673 | |||
| 1461 | Ga0530510_0036878 | |||
| 1462 | Ga0530510_0119546 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nxe-assembly2.cif.gz_B | t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine | 0.9006 | 52 | 221 |
| 3grz-assembly1.cif.gz_B | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.8753 | 56 | 221 |
| 3cjq-assembly1.cif.gz_A | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 | 0.8672 | 42 | 221 |
| 3grz-assembly1.cif.gz_A | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.8667 | 64 | 221 |
| 5eku-assembly1.cif.gz_B | crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine | 0.8558 | 97 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ILX8_228_372_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9181 | 110 | 154 | 3.40.50.150 |
| af_Q8IHP7_693_845_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8999 | 110 | 154 | 3.40.50.150 |
| 3grzA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8906 | 91 | 221 | 3.40.50.150 |
| af_Q9FN34_163_370_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.881 | 57 | 221 | 3.40.50.150 |
| af_Q2FXZ4_114_311_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8766 | 55 | 221 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538IEE3-F1-model_v4 | Methyltransferase | 0.9269 | 59 | 222 |
GO:0008276
GO:0032259 |
| AF-A0A7V9CRN4-F1-model_v4 | 50S ribosomal protein L11 methyltransferase | 0.9253 | 2 | 222 |
GO:0005840
GO:0008276 GO:0032259 |
| AF-A0A4R9VHA3-F1-model_v4 | 50S ribosomal protein L11 methyltransferase | 0.9193 | 57 | 158 |
GO:0005840
GO:0008276 GO:0032259 |
| AF-A0A7V9CRN4-F1-model_v4 | 50S ribosomal protein L11 methyltransferase | 0.9173 | 2 | 222 |
GO:0005840
GO:0008276 GO:0032259 |
| AF-A0A6J6P8C7-F1-model_v4 | Unannotated protein | 0.9106 | 41 | 222 |
GO:0008276
GO:0032259 |