F477950

General Info

Members Datasets Scaffolds Average Seq Length
731 313 1462 237

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100339074|Ga0070674_1003390742
Length 268
Sequence VSHFRRLSIRAVGDEAEPLRARLLELVPAGLEEVVDGNAVELAAYVPVAQVDALLAAFPGAVVEPVPQGWEDAWRSFHHPVTVGGLWVGPPWEEAPDAGSAVVIDPGRAFGTGAHPTTQLCVELLATTAARGSLLDVGCGSGVLAIAGIRLGFGPVVAVDVDPVAVETTVANAVTNAVELDARLSDAESGVLPVAEVAVANVLLRPVEAILGRLDAAEAITSGYLAGERPAHEGWEHVETVTLDGWAADRFRSLRRSGRWARPRGSPS

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
177 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
243 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 9.85
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 10.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100339074 3300005356 Bacteria 1210
2 JGI25406J46586_10020596 3300003203 Bacteria 2663
3 JGI25405J52794_10012704 3300003911 Bacteria 1625
4 Ga0070658_10017271 3300005327 Bacteria 5775
5 Ga0070683_100015947 3300005329 Bacteria 6610
6 Ga0070683_100186325 3300005329 Bacteria 1970
7 Ga0070683_100391678 3300005329 Bacteria 1324
8 Ga0070683_100427694 3300005329 Unclassified 1263
9 Ga0070690_100043515 3300005330 Bacteria 2848
10 Ga0070680_100019813 3300005336 Bacteria 5334
11 Ga0070680_100035733 3300005336 Bacteria 4012
12 Ga0070682_100012996 3300005337 Bacteria 4780
13 Ga0068868_100046407 3300005338 Bacteria 3400
14 Ga0070660_100032467 3300005339 Bacteria 3929
15 Ga0070660_100096384 3300005339 Bacteria 2339
16 Ga0070691_10009103 3300005341 Bacteria 4539
17 Ga0070691_10245115 3300005341 Bacteria 959
18 Ga0070661_100012914 3300005344 Bacteria 5851
19 Ga0070661_100206364 3300005344 Bacteria 1503
20 Ga0070661_100561236 3300005344 Bacteria 920
21 Ga0070692_10066205 3300005345 Bacteria 1914
22 Ga0070671_100134058 3300005355 Unclassified 2087
23 Ga0070671_100232313 3300005355 Bacteria 1565
24 Ga0070674_100255243 3300005356 Bacteria 1379
25 Ga0070673_100542253 3300005364 Unclassified 1056
26 Ga0070659_100035853 3300005366 Bacteria 3864
27 Ga0070659_100216000 3300005366 Bacteria 1582
28 Ga0070667_100004251 3300005367 Bacteria 12095
29 Ga0070703_10011072 3300005406 Bacteria 2547
30 Ga0070709_10216849 3300005434 Unclassified 1363
31 Ga0070709_10297503 3300005434 Bacteria 1178
32 Ga0070714_100005434 3300005435 Bacteria 9725
33 Ga0070714_100513683 3300005435 Bacteria 1144
34 Ga0070713_100065642 3300005436 Bacteria 3050
35 Ga0070713_100116914 3300005436 Bacteria 2333
36 Ga0070701_10109737 3300005438 Bacteria 1540
37 Ga0070701_10276303 3300005438 Bacteria 1024
38 Ga0070705_100029229 3300005440 Bacteria 3028
39 Ga0070705_100068512 3300005440 Bacteria 2136
40 Ga0070705_100255884 3300005440 Bacteria 1232
41 Ga0070700_100004834 3300005441 Bacteria 7072
42 Ga0070700_100012439 3300005441 Bacteria 4750
43 Ga0070694_100032914 3300005444 Bacteria 3406
44 Ga0070694_100286250 3300005444 Bacteria 1258
45 Ga0070708_100025933 3300005445 Bacteria 5013
46 Ga0070708_100457222 3300005445 Bacteria 1204
47 Ga0070663_100246462 3300005455 Bacteria 1412
48 Ga0070678_100054945 3300005456 Bacteria 2905
49 Ga0070662_100056622 3300005457 Bacteria 2846
50 Ga0070681_10041322 3300005458 Bacteria 4621
51 Ga0070681_10397478 3300005458 Unclassified 1289
52 Ga0068867_100056629 3300005459 Bacteria 2901
53 Ga0070706_100009742 3300005467 Bacteria 8929
54 Ga0070706_100015065 3300005467 Bacteria 7140
55 Ga0070707_100000309 3300005468 Bacteria 47965
56 Ga0070698_100010869 3300005471 Bacteria 9685
57 Ga0070698_100136308 3300005471 Bacteria 2408
58 Ga0070699_100013039 3300005518 Bacteria 7163
59 Ga0070699_100091624 3300005518 Bacteria 2658
60 Ga0070699_100186645 3300005518 Bacteria 1841
61 Ga0070699_100292967 3300005518 Bacteria 1459
62 Ga0070699_100514692 3300005518 Bacteria 1088
63 Ga0070679_100011572 3300005530 Bacteria 8407
64 Ga0070679_100031696 3300005530 Bacteria 5225
65 Ga0070679_100197697 3300005530 Bacteria 1977
66 Ga0070679_100556525 3300005530 Bacteria 1091
67 Ga0070684_100023773 3300005535 Bacteria 5132
68 Ga0070684_100251645 3300005535 Bacteria 1615
69 Ga0070684_100377336 3300005535 Bacteria 1306
70 Ga0068853_100422857 3300005539 Bacteria 1250
71 Ga0070672_100170844 3300005543 Bacteria 1808
72 Ga0070686_100021491 3300005544 Bacteria 3837
73 Ga0070695_100032685 3300005545 Bacteria 3252
74 Ga0070695_100088307 3300005545 Bacteria 2064
75 Ga0070696_100030011 3300005546 Bacteria 3720
76 Ga0070696_100120113 3300005546 Bacteria 1901
77 Ga0070693_100010834 3300005547 Bacteria 4576
78 Ga0070665_100392644 3300005548 Bacteria 1395
79 Ga0070665_100608395 3300005548 Unclassified 1106
80 Ga0070704_100178816 3300005549 Bacteria 1695
81 Ga0070704_100211401 3300005549 Unclassified 1572
82 Ga0070704_100477743 3300005549 Bacteria 1078
83 Ga0068855_100029577 3300005563 Bacteria 6548
84 Ga0068855_100090499 3300005563 Bacteria 3531
85 Ga0068855_100263144 3300005563 Bacteria 1921
86 Ga0070664_100276048 3300005564 Bacteria 1515
87 Ga0068857_100056006 3300005577 Bacteria 3498
88 Ga0068854_100016763 3300005578 Bacteria 4889
89 Ga0068856_100064058 3300005614 Bacteria 3632
90 Ga0068856_100129338 3300005614 Bacteria 2529
91 Ga0068856_100174573 3300005614 Bacteria 2161
92 Ga0070702_100012791 3300005615 Bacteria 4221
93 Ga0068852_100062484 3300005616 Bacteria 3240
94 Ga0068852_100092380 3300005616 Bacteria 2710
95 Ga0068861_100065711 3300005719 Bacteria 2795
96 Ga0068861_100259685 3300005719 Bacteria 1486
97 Ga0068858_100036692 3300005842 Bacteria 4545
98 Ga0068860_100073004 3300005843 Bacteria 3262
99 Ga0068862_100136232 3300005844 Bacteria 2176
100 Ga0081455_10006006 3300005937 Bacteria 13168
101 Ga0081540_1002188 3300005983 Bacteria 16164
102 Ga0081540_1005502 3300005983 Bacteria 9446
103 Ga0081539_10000030 3300005985 Bacteria 317236
104 Ga0081539_10001549 3300005985 Bacteria 38322
105 Ga0070717_10320246 3300006028 Bacteria 1381
106 Ga0070717_10454049 3300006028 Bacteria 1155
107 Ga0070717_10596149 3300006028 Bacteria 1002
108 Ga0075364_10070371 3300006051 Bacteria 2303
109 Ga0075432_10001857 3300006058 Bacteria 6973
110 Ga0070712_100040305 3300006175 Bacteria 3201
111 Ga0070712_100553363 3300006175 Bacteria 969
112 Ga0068871_100099525 3300006358 Unclassified 2434
113 Ga0068871_100537595 3300006358 Unclassified 1057
114 Ga0075428_100040993 3300006844 Bacteria 5092
115 Ga0075430_100077424 3300006846 Unclassified 2787
116 Ga0075430_100413049 3300006846 Unclassified 1114
117 Ga0075431_100115711 3300006847 Unclassified 2768
118 Ga0075431_100217876 3300006847 Bacteria 1948
119 Ga0075433_10085908 3300006852 Bacteria 2778
120 Ga0075433_10112810 3300006852 Bacteria 2411
121 Ga0075433_10705645 3300006852 Bacteria 883
122 Ga0075434_100050721 3300006871 Bacteria 4122
123 Ga0075434_100083490 3300006871 Bacteria 3192
124 Ga0075434_100476992 3300006871 Bacteria 1269
125 Ga0075429_100003982 3300006880 Bacteria 12638
126 Ga0075429_100147850 3300006880 Unclassified 2057
127 Ga0075429_100413357 3300006880 Bacteria 1181
128 Ga0068865_100008163 3300006881 Bacteria 6462
129 Ga0075436_100004064 3300006914 Bacteria 10039
130 Ga0075436_100004709 3300006914 Bacteria 9363
131 Ga0075436_100028138 3300006914 Bacteria 3867
132 Ga0075435_100012083 3300007076 Bacteria 6383
133 Ga0075435_100087343 3300007076 Bacteria 2569
134 Ga0075435_100100383 3300007076 Unclassified 2398
135 Ga0075435_100215078 3300007076 Unclassified 1631
136 Ga0075435_100289303 3300007076 Bacteria 1400
137 Ga0075435_100691137 3300007076 Bacteria 886
138 Ga0105240_10017356 3300009093 Bacteria 9703
139 Ga0105240_10618829 3300009093 Bacteria 1190
140 Ga0111539_11150121 3300009094 Bacteria 902
141 Ga0105245_10027075 3300009098 Bacteria 5050
142 Ga0105245_10039719 3300009098 Bacteria 4188
143 Ga0105245_10067581 3300009098 Bacteria 3237
144 Ga0105245_10108136 3300009098 Bacteria 2582
145 Ga0114129_11036502 3300009147 Unclassified 1031
146 Ga0114129_11355654 3300009147 Bacteria 879
147 Ga0105243_10045047 3300009148 Bacteria 3465
148 Ga0105243_10203915 3300009148 Bacteria 1736
149 Ga0105243_11101335 3300009148 Bacteria 802
150 Ga0105242_10079019 3300009176 Bacteria 2747
151 Ga0105242_10103160 3300009176 Bacteria 2419
152 Ga0105242_10109918 3300009176 Bacteria 2347
153 Ga0105248_11111470 3300009177 Bacteria 893
154 Ga0105237_10057860 3300009545 Bacteria 3879
155 Ga0105238_10257056 3300009551 Bacteria 1726
156 Ga0105238_10296692 3300009551 Bacteria 1599
157 Ga0105238_10684126 3300009551 Bacteria 1037
158 Ga0105249_10039000 3300009553 Bacteria 4312
159 Ga0105249_10176789 3300009553 Bacteria 2074
160 Ga0105239_10114517 3300010375 Bacteria 2991
161 Ga0105239_10339899 3300010375 Unclassified 1694
162 Ga0105239_10345423 3300010375 Bacteria 1680
163 Ga0105246_10068844 3300011119 Bacteria 2484
164 Ga0157371_10019381 3300013102 Bacteria 5019
165 Ga0157370_10075146 3300013104 Bacteria 3186
166 Ga0157369_10066860 3300013105 Bacteria 3866
167 Ga0157369_10191137 3300013105 Bacteria 2151
168 Ga0157369_10598397 3300013105 Bacteria 1138
169 Ga0157378_10326927 3300013297 Bacteria 1491
170 Ga0163162_10102468 3300013306 Bacteria 2956
171 Ga0157372_10063226 3300013307 Bacteria 4149
172 Ga0157372_10131994 3300013307 Bacteria 2874
173 Ga0157372_10433197 3300013307 Bacteria 1533
174 Ga0157375_10334166 3300013308 Unclassified 1680
175 Ga0157375_10948927 3300013308 Bacteria 1002
176 Ga0163163_10379423 3300014325 Bacteria 1471
177 Ga0157380_10010919 3300014326 Bacteria 6550
178 Ga0157380_10103441 3300014326 Bacteria 2377
179 Ga0182008_10121674 3300014497 Bacteria 1297
180 Ga0157376_10107223 3300014969 Bacteria 2452
181 Ga0157376_10582726 3300014969 Bacteria 1111
182 Ga0206356_10215950 3300020070 Unclassified 2796
183 Ga0207692_10162479 3300025898 Bacteria 1288
184 Ga0207699_10374386 3300025906 Unclassified 1009
185 Ga0207705_10338927 3300025909 Bacteria 1157
186 Ga0207684_10028135 3300025910 Bacteria 4788
187 Ga0207684_10061939 3300025910 Bacteria 3176
188 Ga0207684_10070639 3300025910 Bacteria 2967
189 Ga0207684_10128107 3300025910 Bacteria 2178
190 Ga0207684_10245311 3300025910 Bacteria 1545
191 Ga0207707_10035927 3300025912 Bacteria 4333
192 Ga0207707_10496300 3300025912 Unclassified 1041
193 Ga0207695_10016353 3300025913 Bacteria 8682
194 Ga0207671_10416411 3300025914 Bacteria 1069
195 Ga0207693_10007819 3300025915 Bacteria 8778
196 Ga0207693_10037411 3300025915 Bacteria 3825
197 Ga0207693_10038166 3300025915 Bacteria 3783
198 Ga0207663_10016268 3300025916 Bacteria 4120
199 Ga0207663_10593295 3300025916 Bacteria 870
200 Ga0207660_10028795 3300025917 Bacteria 3803
201 Ga0207660_10102222 3300025917 Bacteria 2142
202 Ga0207662_10072495 3300025918 Bacteria 2087
203 Ga0207657_10041391 3300025919 Bacteria 4074
204 Ga0207652_10013179 3300025921 Bacteria 6695
205 Ga0207652_10287977 3300025921 Bacteria 1482
206 Ga0207652_10327140 3300025921 Bacteria 1384
207 Ga0207652_10506136 3300025921 Bacteria 1087
208 Ga0207646_10001136 3300025922 Bacteria 33979
209 Ga0207681_10581806 3300025923 Unclassified 924
210 Ga0207694_10648187 3300025924 Bacteria 890
211 Ga0207687_10053841 3300025927 Bacteria 2813
212 Ga0207700_10068745 3300025928 Bacteria 2716
213 Ga0207700_10154144 3300025928 Bacteria 1902
214 Ga0207664_10126618 3300025929 Bacteria 2145
215 Ga0207664_10202700 3300025929 Bacteria 1713
216 Ga0207644_10075898 3300025931 Bacteria 2471
217 Ga0207644_10195015 3300025931 Bacteria 1595
218 Ga0207690_10026441 3300025932 Bacteria 3654
219 Ga0207690_10073083 3300025932 Bacteria 2370
220 Ga0207706_10005602 3300025933 Bacteria 11698
221 Ga0207669_10231408 3300025937 Bacteria 1364
222 Ga0207665_10240531 3300025939 Unclassified 1333
223 Ga0207711_10442249 3300025941 Bacteria 1210
224 Ga0207689_10288031 3300025942 Bacteria 1360
225 Ga0207661_10001401 3300025944 Bacteria 16231
226 Ga0207661_10316452 3300025944 Bacteria 1402
227 Ga0207661_10461469 3300025944 Bacteria 1158
228 Ga0207667_10193371 3300025949 Bacteria 2087
229 Ga0207667_10303469 3300025949 Bacteria 1631
230 Ga0207712_10070744 3300025961 Bacteria 2507
231 Ga0207712_10185067 3300025961 Unclassified 1639
232 Ga0207668_10022781 3300025972 Bacteria 4015
233 Ga0207668_10207376 3300025972 Unclassified 1565
234 Ga0207640_10007164 3300025981 Bacteria 6144
235 Ga0207640_10181904 3300025981 Bacteria 1577
236 Ga0207658_10003739 3300025986 Bacteria 10717
237 Ga0207677_10042987 3300026023 Bacteria 3001
238 Ga0207677_10358039 3300026023 Unclassified 1225
239 Ga0207639_10289303 3300026041 Bacteria 1444
240 Ga0207678_10472643 3300026067 Bacteria 1091
241 Ga0207708_10047840 3300026075 Bacteria 3255
242 Ga0207702_10107652 3300026078 Bacteria 2472
243 Ga0207702_10219138 3300026078 Bacteria 1773
244 Ga0207702_10362082 3300026078 Bacteria 1390
245 Ga0207702_10374106 3300026078 Bacteria 1368
246 Ga0207648_10049936 3300026089 Bacteria 3658
247 Ga0207648_10056812 3300026089 Bacteria 3415
248 Ga0207648_10057970 3300026089 Bacteria 3378
249 Ga0207674_10040199 3300026116 Bacteria 4847
250 Ga0207675_100001015 3300026118 Bacteria 27803
251 Ga0207675_100002032 3300026118 Bacteria 20174
252 Ga0207683_10050082 3300026121 Bacteria 3658
253 Ga0207698_10141432 3300026142 Bacteria 2074
254 Ga0207698_10180431 3300026142 Unclassified 1870
255 Ga0207428_10028425 3300027907 Bacteria 4646
256 Ga0265336_10003729 3300028666 Bacteria 5902
257 Ga0265324_10013537 3300029957 Bacteria 3039
258 Ga0265340_10006557 3300031247 Bacteria 6396
259 Ga0307408_100087099 3300031548 Bacteria 2349
260 Ga0307408_100139721 3300031548 Bacteria 1900
261 Ga0265313_10024931 3300031595 Bacteria 3182
262 Ga0307405_10243330 3300031731 Bacteria 1334
263 Ga0307405_10293212 3300031731 Bacteria 1230
264 Ga0307413_10088670 3300031824 Bacteria 2007
265 Ga0307407_10086629 3300031903 Bacteria 1908
266 Ga0307407_10108254 3300031903 Bacteria 1740
267 Ga0307409_100264833 3300031995 Bacteria 1579
268 Ga0307416_100024939 3300032002 Bacteria 4375
269 Ga0307416_100256291 3300032002 Bacteria 1706
270 Ga0307414_10077881 3300032004 Unclassified 2415
271 Ga0307411_10205124 3300032005 Unclassified 1517
272 Ga0307415_100149544 3300032126 Bacteria 1795
273 Ga0373958_0014349 3300034819 Bacteria 1385
274 Ga0373944_0004552 3300035089 Bacteria 3618
275 Ga0373944_0090639 3300035089 Unclassified 1021
276 Ga0373945_0002806 3300035116 Bacteria 5469
277 Ga0373945_0007576 3300035116 Bacteria 3521
278 Ga0373945_0026214 3300035116 Bacteria 2030
279 Ga0373960_0017999 3300035121 Unclassified 1837
280 Ga0373943_0006660 3300035170 Bacteria 5181
281 Ga0373943_0010455 3300035170 Bacteria 4158
282 Ga0373943_0029755 3300035170 Bacteria 2581
283 Ga0373946_0003486 3300035171 Bacteria 5580
284 Ga0373961_0026375 3300035241 Bacteria 1588
285 Ga0373924_0181216 3300035410 Bacteria 927
286 Ga0373931_0236112 3300035691 Unclassified 1106
287 Ga0373931_0281904 3300035691 Unclassified 1021
288 Ga0373935_0019823 3300035692 Bacteria 4105
289 Ga0373935_0053217 3300035692 Bacteria 2575
290 Ga0373947_0002323 3300035725 Bacteria 11501
291 Ga0373947_0012264 3300035725 Bacteria 4910
292 Ga0373947_0033498 3300035725 Bacteria 3033
293 Ga0373947_0315409 3300035725 Unclassified 1045
294 Ga0373925_0005408 3300037068 Bacteria 9516
295 Ga0373925_0054964 3300037068 Bacteria 2979
296 Ga0395899_0002477 3300037312 Bacteria 14979
297 Ga0395899_0004322 3300037312 Bacteria 11094
298 Ga0395899_0100204 3300037312 Bacteria 2092
299 Ga0395899_0157036 3300037312 Unclassified 1609
300 Ga0395899_0185805 3300037312 Bacteria 1456
301 Ga0395900_0003203 3300037418 Bacteria 17718
302 Ga0395900_0005102 3300037418 Bacteria 13789
303 Ga0395900_0008552 3300037418 Bacteria 10524
304 Ga0395900_0116060 3300037418 Bacteria 2747
305 Ga0395900_0122553 3300037418 Unclassified 2666
306 Ga0395900_0599885 3300037418 Bacteria 1042
307 Ga0395898_0010794 3300037466 Bacteria 9542
308 Ga0395898_0011779 3300037466 Bacteria 9064
309 Ga0395898_0013287 3300037466 Bacteria 8479
310 Ga0395898_0022687 3300037466 Bacteria 6353
311 Ga0395898_0055207 3300037466 Bacteria 3874
312 Ga0395898_0149118 3300037466 Bacteria 2238
313 Ga0395898_0211013 3300037466 Bacteria 1852
314 Ga0395905_0000568 3300037471 Bacteria 50013
315 Ga0395905_0018824 3300037471 Bacteria 6550
316 Ga0395905_0042892 3300037471 Bacteria 4244
317 Ga0395905_0105509 3300037471 Bacteria 2646
318 Ga0395905_0137950 3300037471 Bacteria 2295
319 Ga0395901_0008882 3300038443 Bacteria 10174
320 Ga0395901_0012951 3300038443 Bacteria 8460
321 Ga0395901_0012998 3300038443 Bacteria 8447
322 Ga0395901_0049630 3300038443 Bacteria 4360
323 Ga0395901_0061179 3300038443 Bacteria 3918
324 Ga0395901_0137441 3300038443 Bacteria 2568
325 Ga0395901_0200733 3300038443 Unclassified 2090
326 Ga0395901_0544102 3300038443 Bacteria 1177
327 Ga0395901_0565012 3300038443 Bacteria 1151
328 Ga0395901_0641247 3300038443 Bacteria 1067
329 Ga0395901_0767855 3300038443 Bacteria 955
330 Ga0436363_0658494 3300039450 Unclassified 852
331 Ga0439447_031891 3300041407 Bacteria 1321
332 Ga0451789_1111844 3300041443 Bacteria 1531
333 Ga0451802_0966161 3300041460 Unclassified 1219
334 Ga0451849_0053658 3300041505 Bacteria 1949
335 Ga0451851_0696550 3300041507 Bacteria 2154
336 Ga0451855_1495820 3300041511 Bacteria 1725
337 Ga0439448_0018733 3300042005 Bacteria 2125
338 Ga0439446_0010089 3300042156 Bacteria 2539
339 Ga0439458_0006164 3300042157 Bacteria 2676
340 Ga0466961_0002298 3300044693 Bacteria 11884
341 Ga0466961_0068358 3300044693 Unclassified 2256
342 Ga0466963_0002261 3300044694 Bacteria 10700
343 Ga0466963_0005306 3300044694 Bacteria 7532
344 Ga0466963_0022081 3300044694 Bacteria 4026
345 Ga0466963_0026259 3300044694 Bacteria 3723
346 Ga0466963_0043669 3300044694 Bacteria 2949
347 Ga0466963_0228220 3300044694 Bacteria 1304
348 Ga0466963_0379323 3300044694 Bacteria 996
349 Ga0466964_0002218 3300044706 Bacteria 6875
350 Ga0466964_0002975 3300044706 Bacteria 6131
351 Ga0466971_0000910 3300044719 Bacteria 12117
352 Ga0466968_0060418 3300044735 Bacteria 1634
353 Ga0466957_0000349 3300044842 Bacteria 22576
354 Ga0466957_0097550 3300044842 Bacteria 1849
355 Ga0466957_0101416 3300044842 Bacteria 1815
356 Ga0466960_0084353 3300044901 Bacteria 1607
357 Ga0466959_0024411 3300045049 Bacteria 4478
358 Ga0466959_0037515 3300045049 Bacteria 3581
359 Ga0451576_0013003 3300045051 Bacteria 9323
360 Ga0451576_0996180 3300045051 Unclassified 878
361 Ga0466958_0000685 3300045836 Bacteria 14737
362 Ga0466958_0081755 3300045836 Bacteria 1988
363 Ga0466967_0000265 3300045976 Bacteria 23015
364 Ga0466967_0001447 3300045976 Bacteria 13783
365 Ga0466967_0030138 3300045976 Bacteria 4550
366 Ga0466967_0039010 3300045976 Bacteria 4079
367 Ga0466967_0043204 3300045976 Bacteria 3901
368 Ga0466967_0053883 3300045976 Bacteria 3537
369 Ga0466967_0062904 3300045976 Bacteria 3295
370 Ga0466967_0076865 3300045976 Bacteria 3004
371 Ga0466967_0091674 3300045976 Bacteria 2762
372 Ga0466967_0097322 3300045976 Bacteria 2686
373 Ga0466967_0099074 3300045976 Bacteria 2661
374 Ga0466967_0162355 3300045976 Unclassified 2098
375 Ga0466967_0172958 3300045976 Bacteria 2033
376 Ga0466967_0181900 3300045976 Bacteria 1983
377 Ga0466967_0195505 3300045976 Bacteria 1913
378 Ga0466967_0221155 3300045976 Unclassified 1799
379 Ga0466967_0325398 3300045976 Bacteria 1483
380 Ga0466967_0368778 3300045976 Bacteria 1392
381 Ga0495592_0063223 3300046454 Bacteria 2715
382 Ga0495603_0001442 3300046455 Bacteria 13834
383 Ga0495603_0035613 3300046455 Unclassified 2989
384 Ga0495603_0052007 3300046455 Bacteria 2433
385 Ga0495629_0000880 3300046459 Bacteria 24212
386 Ga0495629_0366119 3300046459 Unclassified 982
387 Ga0495629_0471883 3300046459 Bacteria 848
388 Ga0495641_0000552 3300046461 Bacteria 31604
389 Ga0495641_0013029 3300046461 Bacteria 4603
390 Ga0495641_0041163 3300046461 Bacteria 2147
391 Ga0495641_0079837 3300046461 Bacteria 1466
392 Ga0495641_0168366 3300046461 Bacteria 980
393 Ga0495651_0042661 3300046462 Bacteria 3521
394 Ga0495651_0090289 3300046462 Bacteria 2298
395 Ga0495653_0086536 3300046463 Bacteria 2303
396 Ga0495580_0017054 3300046472 Bacteria 5441
397 Ga0495582_0000240 3300046473 Bacteria 30558
398 Ga0495582_0297671 3300046473 Bacteria 927
399 Ga0495605_0167590 3300046474 Bacteria 972
400 Ga0495639_0004699 3300046475 Bacteria 5868
401 Ga0495639_0180077 3300046475 Unclassified 1029
402 Ga0495662_0001469 3300046476 Bacteria 11662
403 Ga0495662_0099717 3300046476 Bacteria 1420
404 Ga0495664_0027647 3300046477 Bacteria 3308
405 Ga0495584_0051989 3300046491 Bacteria 2062
406 Ga0495594_0004755 3300046499 Bacteria 6994
407 Ga0495594_0028377 3300046499 Unclassified 3020
408 Ga0495607_0079927 3300046501 Bacteria 1800
409 Ga0495608_0018577 3300046511 Bacteria 4792
410 Ga0495608_0407445 3300046511 Bacteria 831
411 Ga0495618_0249383 3300046514 Bacteria 1114
412 Ga0495630_0034360 3300046517 Bacteria 3786
413 Ga0495630_0070298 3300046517 Bacteria 2634
414 Ga0495630_0104747 3300046517 Bacteria 2141
415 Ga0495631_0140239 3300046518 Bacteria 1038
416 Ga0495644_0047065 3300046523 Bacteria 1621
417 Ga0495663_0018172 3300046525 Bacteria 2000
418 Ga0495663_0056413 3300046525 Bacteria 1227
419 Ga0495666_0007316 3300046526 Bacteria 5536
420 Ga0495666_0082876 3300046526 Bacteria 1516
421 Ga0495642_0053740 3300046528 Bacteria 1660
422 Ga0495652_0146616 3300046529 Bacteria 1849
423 Ga0495665_0000685 3300046531 Bacteria 17384
424 Ga0495640_0284578 3300046533 Bacteria 1029
425 Ga0495586_0180282 3300046535 Unclassified 1195
426 Ga0495586_0220157 3300046535 Bacteria 1079
427 Ga0495587_0040463 3300046536 Bacteria 2786
428 Ga0495587_0178530 3300046536 Bacteria 1205
429 Ga0495609_0049345 3300046538 Bacteria 1879
430 Ga0495609_0102280 3300046538 Unclassified 1241
431 Ga0495621_0107452 3300046539 Bacteria 1067
432 Ga0495645_0031083 3300046543 Bacteria 3889
433 Ga0495645_0128823 3300046543 Bacteria 1776
434 Ga0495667_0030843 3300046559 Bacteria 3601
435 Ga0495667_0055962 3300046559 Bacteria 2594
436 Ga0495656_0006370 3300046615 Bacteria 4138
437 Ga0495656_0247325 3300046615 Bacteria 900
438 Ga0495634_0061886 3300046642 Bacteria 2487
439 Ga0495635_0086918 3300046663 Unclassified 2139
440 Ga0495659_0035500 3300046664 Bacteria 1757
441 Ga0495661_0061563 3300046665 Unclassified 2228
442 Ga0495657_0084673 3300046675 Bacteria 2045
443 Ga0495657_0095307 3300046675 Unclassified 1902
444 Ga0495657_0130346 3300046675 Bacteria 1576
445 Ga0495647_0040438 3300046681 Bacteria 1772
446 Ga0495658_0000782 3300046683 Bacteria 17147
447 Ga0495658_0022699 3300046683 Bacteria 3322
448 Ga0495658_0052773 3300046683 Bacteria 2307
449 Ga0495658_0101207 3300046683 Bacteria 1720
450 Ga0495658_0255619 3300046683 Unclassified 1102
451 Ga0495613_0015795 3300046689 Bacteria 5620
452 Ga0495624_0009739 3300046690 Bacteria 6648
453 Ga0495624_0083370 3300046690 Bacteria 1977
454 Ga0495624_0207280 3300046690 Bacteria 1190
455 Ga0495589_0058362 3300046794 Bacteria 1897
456 Ga0495600_0001921 3300046809 Bacteria 11663
457 Ga0495581_0000754 3300047315 Bacteria 17163
458 Ga0495581_0021980 3300047315 Bacteria 3697
459 Ga0495581_0110593 3300047315 Bacteria 1598
460 Ga0495604_0081923 3300047317 Bacteria 2414
461 Ga0495604_0088813 3300047317 Unclassified 2299
462 Ga0495674_0041425 3300047319 Bacteria 4113
463 Ga0495674_0127424 3300047319 Bacteria 2146
464 Ga0495674_0173434 3300047319 Bacteria 1799
465 Ga0495674_0373028 3300047319 Bacteria 1155
466 Ga0495676_0000116 3300047321 Bacteria 61181
467 Ga0495676_0004439 3300047321 Bacteria 12831
468 Ga0495676_0198519 3300047321 Unclassified 1395
469 Ga0495676_0388227 3300047321 Bacteria 928
470 Ga0495680_0007595 3300047322 Bacteria 9909
471 Ga0495680_0228477 3300047322 Bacteria 1326
472 Ga0495680_0436137 3300047322 Bacteria 899
473 Ga0495675_0184308 3300047444 Bacteria 1277
474 Ga0495677_0024988 3300047445 Bacteria 2167
475 Ga0495685_145065 3300047447 Unclassified 772
476 Ga0495684_0277226 3300047471 Bacteria 1211
477 Ga0495684_0344114 3300047471 Bacteria 1060
478 Ga0495593_0011497 3300047673 Bacteria 5082
479 Ga0495602_0094660 3300048088 Unclassified 2468
480 Ga0495615_0053522 3300048090 Bacteria 1046
481 Ga0496100_0084246 3300048903 Bacteria 2155
482 Ga0496100_0096496 3300048903 Unclassified 2028
483 Ga0496100_0530197 3300048903 Bacteria 909
484 Ga0496101_0022022 3300048904 Bacteria 4383
485 Ga0496101_0085441 3300048904 Bacteria 2338
486 Ga0496102_0087944 3300048905 Bacteria 2871
487 Ga0496102_0488914 3300048905 Bacteria 1152
488 Ga0496103_0056976 3300048906 Bacteria 2426
489 Ga0496103_0120367 3300048906 Bacteria 1672
490 Ga0496104_0036190 3300048907 Bacteria 4613
491 Ga0496104_0216154 3300048907 Bacteria 1828
492 Ga0496105_0000804 3300048908 Bacteria 21255
493 Ga0496105_0006495 3300048908 Bacteria 8989
494 Ga0496105_0027403 3300048908 Bacteria 4654
495 Ga0496105_0068622 3300048908 Bacteria 2929
496 Ga0496105_0089690 3300048908 Bacteria 2540
497 Ga0496105_0336210 3300048908 Bacteria 1208
498 Ga0496105_0400977 3300048908 Bacteria 1089
499 Ga0496106_0007207 3300048909 Bacteria 8214
500 Ga0496106_0091234 3300048909 Bacteria 2352
501 Ga0496106_0118590 3300048909 Bacteria 2067
502 Ga0496106_0133329 3300048909 Unclassified 1949
503 Ga0496106_0289510 3300048909 Bacteria 1313
504 Ga0496107_0005507 3300048910 Bacteria 8665
505 Ga0496107_0011620 3300048910 Bacteria 6136
506 Ga0496107_0170408 3300048910 Unclassified 1615
507 Ga0496108_0004142 3300048911 Bacteria 11659
508 Ga0496108_0006063 3300048911 Bacteria 9776
509 Ga0496108_0052834 3300048911 Bacteria 3406
510 Ga0496108_0276687 3300048911 Bacteria 1461
511 Ga0496109_0002881 3300048912 Bacteria 14396
512 Ga0496109_0005058 3300048912 Bacteria 11014
513 Ga0496109_0037984 3300048912 Bacteria 4352
514 Ga0496109_0102753 3300048912 Bacteria 2652
515 Ga0496109_0111135 3300048912 Bacteria 2548
516 Ga0496109_0146250 3300048912 Bacteria 2211
517 Ga0496109_0350159 3300048912 Bacteria 1395
518 Ga0496110_0003995 3300048913 Bacteria 11359
519 Ga0496110_0017934 3300048913 Bacteria 5928
520 Ga0496110_0034680 3300048913 Bacteria 4373
521 Ga0496110_0053367 3300048913 Bacteria 3554
522 Ga0496110_0123347 3300048913 Bacteria 2336
523 Ga0496110_0191517 3300048913 Bacteria 1857
524 Ga0496111_0000612 3300048914 Bacteria 18851
525 Ga0496111_0004721 3300048914 Bacteria 8645
526 Ga0496111_0034872 3300048914 Bacteria 3594
527 Ga0496111_0159260 3300048914 Unclassified 1676
528 Ga0496111_0414961 3300048914 Unclassified 994
529 Ga0496112_0004864 3300048915 Bacteria 11480
530 Ga0496112_0078048 3300048915 Bacteria 3275
531 Ga0496112_0086100 3300048915 Bacteria 3109
532 Ga0496112_0111165 3300048915 Bacteria 2710
533 Ga0496112_0147600 3300048915 Bacteria 2320
534 Ga0496112_0176537 3300048915 Bacteria 2101
535 Ga0496113_0001184 3300048916 Bacteria 14249
536 Ga0496113_0078045 3300048916 Bacteria 2533
537 Ga0496113_0215453 3300048916 Bacteria 1529
538 Ga0496114_0024067 3300048917 Bacteria 4969
539 Ga0496114_0061843 3300048917 Bacteria 3133
540 Ga0496114_0093268 3300048917 Unclassified 2559
541 Ga0496114_0182046 3300048917 Bacteria 1835
542 Ga0496114_0183884 3300048917 Bacteria 1826
543 Ga0496114_0185265 3300048917 Bacteria 1819
544 Ga0496114_0320670 3300048917 Unclassified 1369
545 Ga0496114_0693683 3300048917 Unclassified 893
546 Ga0496115_0003315 3300048918 Bacteria 11559
547 Ga0496115_0010047 3300048918 Bacteria 7055
548 Ga0496115_0015265 3300048918 Bacteria 5824
549 Ga0496115_0059343 3300048918 Bacteria 3081
550 Ga0496115_0172204 3300048918 Bacteria 1790
551 Ga0501031_0000814 3300049568 Bacteria 18745
552 Ga0501031_0027568 3300049568 Bacteria 3703
553 Ga0501031_0074413 3300049568 Bacteria 2212
554 Ga0501032_0028423 3300049569 Bacteria 3842
555 Ga0501032_0035166 3300049569 Bacteria 3427
556 Ga0501032_0112771 3300049569 Bacteria 1799
557 Ga0501032_0254922 3300049569 Bacteria 1138
558 Ga0501033_0079862 3300049570 Bacteria 2400
559 Ga0501034_0210123 3300049571 Bacteria 1902
560 Ga0501036_0000261 3300049572 Bacteria 35846
561 Ga0501036_0114443 3300049572 Bacteria 2279
562 Ga0501036_0139435 3300049572 Bacteria 2047
563 Ga0501036_0177672 3300049572 Bacteria 1792
564 Ga0501038_0011161 3300049574 Bacteria 8205
565 Ga0501038_0013580 3300049574 Bacteria 7421
566 Ga0501038_0214327 3300049574 Bacteria 1539
567 Ga0501038_0350145 3300049574 Bacteria 1150
568 Ga0501039_0003652 3300049575 Bacteria 11537
569 Ga0501039_0012492 3300049575 Bacteria 6484
570 Ga0501039_0088738 3300049575 Bacteria 2408
571 Ga0501039_0135774 3300049575 Bacteria 1931
572 Ga0501039_0295901 3300049575 Bacteria 1272
573 Ga0501039_0513541 3300049575 Bacteria 941
574 Ga0501040_0000344 3300049576 Bacteria 27241
575 Ga0501040_0009035 3300049576 Bacteria 6482
576 Ga0501040_0020599 3300049576 Bacteria 4395
577 Ga0501040_0025005 3300049576 Bacteria 4012
578 Ga0501040_0134826 3300049576 Bacteria 1738
579 Ga0501041_0004745 3300049577 Bacteria 7888
580 Ga0501041_0036076 3300049577 Bacteria 2996
581 Ga0501041_0043809 3300049577 Bacteria 2720
582 Ga0501041_0080096 3300049577 Bacteria 2011
583 Ga0501041_0152477 3300049577 Bacteria 1443
584 Ga0501042_0000265 3300049578 Bacteria 25490
585 Ga0501042_0015339 3300049578 Bacteria 5245
586 Ga0501042_0016132 3300049578 Bacteria 5125
587 Ga0501042_0043624 3300049578 Bacteria 3194
588 Ga0501042_0205507 3300049578 Bacteria 1420
589 Ga0501043_0069592 3300049579 Bacteria 2764
590 Ga0501043_0119159 3300049579 Bacteria 2070
591 Ga0501043_0146105 3300049579 Bacteria 1851
592 Ga0501043_0191308 3300049579 Bacteria 1591
593 Ga0501046_0004011 3300049580 Bacteria 13446
594 Ga0501046_0093483 3300049580 Bacteria 2311
595 Ga0501046_0147840 3300049580 Bacteria 1774
596 Ga0501048_0003306 3300049582 Bacteria 12278
597 Ga0501048_0015084 3300049582 Bacteria 5710
598 Ga0501048_0051199 3300049582 Bacteria 2940
599 Ga0501048_0054897 3300049582 Bacteria 2830
600 Ga0501048_0133718 3300049582 Bacteria 1752
601 Ga0501067_0000979 3300049583 Bacteria 15319
602 Ga0501067_0001810 3300049583 Bacteria 11749
603 Ga0501067_0017011 3300049583 Unclassified 4018
604 Ga0501068_0073555 3300049584 Bacteria 2088
605 Ga0501068_0089194 3300049584 Bacteria 1901
606 Ga0501069_0001159 3300049585 Bacteria 12758
607 Ga0501069_0003793 3300049585 Bacteria 7776
608 Ga0501069_0005476 3300049585 Bacteria 6604
609 Ga0501069_0058073 3300049585 Bacteria 2158
610 Ga0501069_0063889 3300049585 Bacteria 2057
611 Ga0501069_0136325 3300049585 Bacteria 1407
612 Ga0501069_0319194 3300049585 Bacteria 913
613 Ga0501070_0037313 3300049586 Bacteria 4057
614 Ga0501070_0060668 3300049586 Bacteria 3134
615 Ga0501070_0146868 3300049586 Bacteria 1946
616 Ga0501070_0224926 3300049586 Bacteria 1538
617 Ga0501070_0304167 3300049586 Bacteria 1299
618 Ga0501071_0000599 3300049587 Bacteria 18628
619 Ga0501071_0007145 3300049587 Bacteria 7302
620 Ga0501071_0010208 3300049587 Bacteria 6283
621 Ga0501071_0021065 3300049587 Bacteria 4539
622 Ga0501071_0057058 3300049587 Bacteria 2822
623 Ga0501071_0171876 3300049587 Bacteria 1622
624 Ga0501071_0306972 3300049587 Unclassified 1203
625 Ga0501072_0001550 3300049588 Bacteria 17142
626 Ga0501072_0012442 3300049588 Bacteria 6502
627 Ga0501072_0196799 3300049588 Bacteria 1607
628 Ga0501072_0240263 3300049588 Bacteria 1443
629 Ga0501072_0641274 3300049588 Unclassified 836
630 Ga0501073_0120634 3300049589 Bacteria 1817
631 Ga0501074_0011485 3300049590 Bacteria 6439
632 Ga0501074_0021865 3300049590 Bacteria 4644
633 Ga0501074_0077037 3300049590 Bacteria 2393
634 Ga0501074_0083446 3300049590 Bacteria 2291
635 Ga0501075_0001217 3300049591 Bacteria 16683
636 Ga0501075_0001579 3300049591 Bacteria 14891
637 Ga0501075_0002376 3300049591 Bacteria 12517
638 Ga0501075_0010127 3300049591 Bacteria 6616
639 Ga0501075_0022084 3300049591 Bacteria 4645
640 Ga0501075_0266614 3300049591 Bacteria 1305
641 Ga0501076_0000330 3300049592 Bacteria 29312
642 Ga0501076_0003816 3300049592 Bacteria 10614
643 Ga0501076_0008579 3300049592 Bacteria 7496
644 Ga0501076_0008610 3300049592 Bacteria 7484
645 Ga0501076_0035301 3300049592 Bacteria 3913
646 Ga0501076_0064116 3300049592 Bacteria 2928
647 Ga0501076_0067975 3300049592 Bacteria 2846
648 Ga0501076_0100765 3300049592 Bacteria 2327
649 Ga0501076_0182087 3300049592 Bacteria 1713
650 Ga0501077_0002195 3300049593 Bacteria 11787
651 Ga0501077_0002794 3300049593 Bacteria 10473
652 Ga0501077_0006316 3300049593 Bacteria 7256
653 Ga0501077_0008751 3300049593 Bacteria 6281
654 Ga0501077_0017848 3300049593 Bacteria 4484
655 Ga0501077_0254147 3300049593 Unclassified 1118
656 Ga0501079_0001641 3300049741 Bacteria 15928
657 Ga0501079_0003329 3300049741 Bacteria 11789
658 Ga0501079_0004610 3300049741 Bacteria 10212
659 Ga0501079_0014630 3300049741 Bacteria 5984
660 Ga0501079_0032577 3300049741 Bacteria 4008
661 Ga0501080_0003166 3300049742 Bacteria 14502
662 Ga0501080_0026343 3300049742 Bacteria 5403
663 Ga0501080_0027682 3300049742 Bacteria 5270
664 Ga0501080_0201343 3300049742 Bacteria 1828
665 Ga0501080_0314666 3300049742 Bacteria 1418
666 Ga0501081_0001194 3300049743 Bacteria 15741
667 Ga0501081_0027450 3300049743 Bacteria 3840
668 Ga0501081_0028154 3300049743 Bacteria 3791
669 Ga0501081_0076890 3300049743 Bacteria 2331
670 Ga0501081_0230129 3300049743 Bacteria 1350
671 Ga0501081_0321862 3300049743 Bacteria 1137
672 Ga0501083_0002907 3300049744 Bacteria 11860
673 Ga0501035_0006323 3300049822 Bacteria 11133
674 Ga0501035_0016071 3300049822 Bacteria 6906
675 Ga0501035_0017965 3300049822 Bacteria 6521
676 Ga0501035_0069006 3300049822 Bacteria 3134
677 Ga0501035_0441253 3300049822 Bacteria 1078
678 Ga0501044_0122443 3300049823 Bacteria 2601
679 Ga0501044_0427656 3300049823 Bacteria 1234
680 Ga0501045_0000784 3300049824 Bacteria 20425
681 Ga0501045_0001676 3300049824 Bacteria 14903
682 Ga0501045_0007858 3300049824 Bacteria 7424
683 Ga0501045_0160576 3300049824 Bacteria 1673
684 nmdc:mga00v17_448297_c1 3300050491 Bacteria 838
685 nmdc:mga0yw44_22461_c1 3300050492 Bacteria 3539
686 nmdc:mga05p37_172096_c1 3300050507 Bacteria 2641
687 nmdc:mga09592_7067_c1 3300050508 Bacteria 9123
688 nmdc:mga0qj67_24935_c1 3300050509 Bacteria 4615
689 nmdc:mga0qj67_81299_c1 3300050509 Bacteria 2598
690 nmdc:mga06r32_93487_c1 3300050510 Bacteria 2941
691 nmdc:mga08y16_1379983_c1 3300050511 Unclassified 669
692 nmdc:mga08y16_68620_c1 3300050511 Bacteria 3697
693 nmdc:mga0n895_270519_c1 3300050512 Unclassified 1724
694 nmdc:mga0n895_391736_c1 3300050512 Bacteria 1405
695 nmdc:mga0n895_9385_c1 3300050512 Bacteria 8559
696 nmdc:mga0rr50_271289_c1 3300050513 Bacteria 1414
697 nmdc:mga0rr50_275284_c1 3300050513 Unclassified 1404
698 nmdc:mga0rr50_6260_c1 3300050513 Bacteria 7221
699 nmdc:mga0rr50_62897_c1 3300050513 Bacteria 2801
700 nmdc:mga08x19_36082_c1 3300050514 Bacteria 3130
701 nmdc:mga08x19_52464_c1 3300050514 Bacteria 2623
702 nmdc:mga08x19_64759_c1 3300050514 Bacteria 2373
703 nmdc:mga0a205_129154_c1 3300050515 Bacteria 2428
704 nmdc:mga0a205_294415_c1 3300050515 Bacteria 1497
705 nmdc:mga0a205_48662_c1 3300050515 Bacteria 4092
706 Ga0495601_0010791 3300053077 Bacteria 5451
707 Ga0495601_0055221 3300053077 Bacteria 2514
708 Ga0495601_0124934 3300053077 Unclassified 1673
709 Ga0495612_0008646 3300053078 Bacteria 4128
710 Ga0495595_0010409 3300053084 Bacteria 3865
711 Ga0495595_0010825 3300053084 Bacteria 3803
712 Ga0495595_0039080 3300053084 Bacteria 2164
713 Ga0495619_0027625 3300053085 Bacteria 3656
714 Ga0495619_0033979 3300053085 Unclassified 3313
715 Ga0495619_0077742 3300053085 Bacteria 2230
716 Ga0495619_0165134 3300053085 Bacteria 1530
717 Ga0501084_0001989 3300054114 Bacteria 16312
718 Ga0501084_0024246 3300054114 Bacteria 5058
719 Ga0501084_0025078 3300054114 Bacteria 4974
720 Ga0501084_0047299 3300054114 Bacteria 3603
721 Ga0501084_0082522 3300054114 Bacteria 2697
722 Ga0501084_0232568 3300054114 Bacteria 1556
723 Ga0590071_037197 3300059421 Bacteria 1168
724 Ga0501082_0002118 3300060353 Bacteria 17481
725 Ga0501082_0011430 3300060353 Bacteria 7637
726 Ga0501082_0015729 3300060353 Bacteria 6509
727 Ga0501082_0068994 3300060353 Bacteria 3044
728 Ga0530510_0010431 3300061734 Bacteria 6514
729 Ga0530510_0020673 3300061734 Bacteria 4680
730 Ga0530510_0036878 3300061734 Bacteria 3523
731 Ga0530510_0119546 3300061734 Bacteria 1933
732 Ga0070674_100339074
733 JGI25406J46586_10020596
734 JGI25405J52794_10012704
735 Ga0070658_10017271
736 Ga0070683_100015947
737 Ga0070683_100186325
738 Ga0070683_100391678
739 Ga0070683_100427694
740 Ga0070690_100043515
741 Ga0070680_100019813
742 Ga0070680_100035733
743 Ga0070682_100012996
744 Ga0068868_100046407
745 Ga0070660_100032467
746 Ga0070660_100096384
747 Ga0070691_10009103
748 Ga0070691_10245115
749 Ga0070661_100012914
750 Ga0070661_100206364
751 Ga0070661_100561236
752 Ga0070692_10066205
753 Ga0070671_100134058
754 Ga0070671_100232313
755 Ga0070674_100255243
756 Ga0070673_100542253
757 Ga0070659_100035853
758 Ga0070659_100216000
759 Ga0070667_100004251
760 Ga0070703_10011072
761 Ga0070709_10216849
762 Ga0070709_10297503
763 Ga0070714_100005434
764 Ga0070714_100513683
765 Ga0070713_100065642
766 Ga0070713_100116914
767 Ga0070701_10109737
768 Ga0070701_10276303
769 Ga0070705_100029229
770 Ga0070705_100068512
771 Ga0070705_100255884
772 Ga0070700_100004834
773 Ga0070700_100012439
774 Ga0070694_100032914
775 Ga0070694_100286250
776 Ga0070708_100025933
777 Ga0070708_100457222
778 Ga0070663_100246462
779 Ga0070678_100054945
780 Ga0070662_100056622
781 Ga0070681_10041322
782 Ga0070681_10397478
783 Ga0068867_100056629
784 Ga0070706_100009742
785 Ga0070706_100015065
786 Ga0070707_100000309
787 Ga0070698_100010869
788 Ga0070698_100136308
789 Ga0070699_100013039
790 Ga0070699_100091624
791 Ga0070699_100186645
792 Ga0070699_100292967
793 Ga0070699_100514692
794 Ga0070679_100011572
795 Ga0070679_100031696
796 Ga0070679_100197697
797 Ga0070679_100556525
798 Ga0070684_100023773
799 Ga0070684_100251645
800 Ga0070684_100377336
801 Ga0068853_100422857
802 Ga0070672_100170844
803 Ga0070686_100021491
804 Ga0070695_100032685
805 Ga0070695_100088307
806 Ga0070696_100030011
807 Ga0070696_100120113
808 Ga0070693_100010834
809 Ga0070665_100392644
810 Ga0070665_100608395
811 Ga0070704_100178816
812 Ga0070704_100211401
813 Ga0070704_100477743
814 Ga0068855_100029577
815 Ga0068855_100090499
816 Ga0068855_100263144
817 Ga0070664_100276048
818 Ga0068857_100056006
819 Ga0068854_100016763
820 Ga0068856_100064058
821 Ga0068856_100129338
822 Ga0068856_100174573
823 Ga0070702_100012791
824 Ga0068852_100062484
825 Ga0068852_100092380
826 Ga0068861_100065711
827 Ga0068861_100259685
828 Ga0068858_100036692
829 Ga0068860_100073004
830 Ga0068862_100136232
831 Ga0081455_10006006
832 Ga0081540_1002188
833 Ga0081540_1005502
834 Ga0081539_10000030
835 Ga0081539_10001549
836 Ga0070717_10320246
837 Ga0070717_10454049
838 Ga0070717_10596149
839 Ga0075364_10070371
840 Ga0075432_10001857
841 Ga0070712_100040305
842 Ga0070712_100553363
843 Ga0068871_100099525
844 Ga0068871_100537595
845 Ga0075428_100040993
846 Ga0075430_100077424
847 Ga0075430_100413049
848 Ga0075431_100115711
849 Ga0075431_100217876
850 Ga0075433_10085908
851 Ga0075433_10112810
852 Ga0075433_10705645
853 Ga0075434_100050721
854 Ga0075434_100083490
855 Ga0075434_100476992
856 Ga0075429_100003982
857 Ga0075429_100147850
858 Ga0075429_100413357
859 Ga0068865_100008163
860 Ga0075436_100004064
861 Ga0075436_100004709
862 Ga0075436_100028138
863 Ga0075435_100012083
864 Ga0075435_100087343
865 Ga0075435_100100383
866 Ga0075435_100215078
867 Ga0075435_100289303
868 Ga0075435_100691137
869 Ga0105240_10017356
870 Ga0105240_10618829
871 Ga0111539_11150121
872 Ga0105245_10027075
873 Ga0105245_10039719
874 Ga0105245_10067581
875 Ga0105245_10108136
876 Ga0114129_11036502
877 Ga0114129_11355654
878 Ga0105243_10045047
879 Ga0105243_10203915
880 Ga0105243_11101335
881 Ga0105242_10079019
882 Ga0105242_10103160
883 Ga0105242_10109918
884 Ga0105248_11111470
885 Ga0105237_10057860
886 Ga0105238_10257056
887 Ga0105238_10296692
888 Ga0105238_10684126
889 Ga0105249_10039000
890 Ga0105249_10176789
891 Ga0105239_10114517
892 Ga0105239_10339899
893 Ga0105239_10345423
894 Ga0105246_10068844
895 Ga0157371_10019381
896 Ga0157370_10075146
897 Ga0157369_10066860
898 Ga0157369_10191137
899 Ga0157369_10598397
900 Ga0157378_10326927
901 Ga0163162_10102468
902 Ga0157372_10063226
903 Ga0157372_10131994
904 Ga0157372_10433197
905 Ga0157375_10334166
906 Ga0157375_10948927
907 Ga0163163_10379423
908 Ga0157380_10010919
909 Ga0157380_10103441
910 Ga0182008_10121674
911 Ga0157376_10107223
912 Ga0157376_10582726
913 Ga0206356_10215950
914 Ga0207692_10162479
915 Ga0207699_10374386
916 Ga0207705_10338927
917 Ga0207684_10028135
918 Ga0207684_10061939
919 Ga0207684_10070639
920 Ga0207684_10128107
921 Ga0207684_10245311
922 Ga0207707_10035927
923 Ga0207707_10496300
924 Ga0207695_10016353
925 Ga0207671_10416411
926 Ga0207693_10007819
927 Ga0207693_10037411
928 Ga0207693_10038166
929 Ga0207663_10016268
930 Ga0207663_10593295
931 Ga0207660_10028795
932 Ga0207660_10102222
933 Ga0207662_10072495
934 Ga0207657_10041391
935 Ga0207652_10013179
936 Ga0207652_10287977
937 Ga0207652_10327140
938 Ga0207652_10506136
939 Ga0207646_10001136
940 Ga0207681_10581806
941 Ga0207694_10648187
942 Ga0207687_10053841
943 Ga0207700_10068745
944 Ga0207700_10154144
945 Ga0207664_10126618
946 Ga0207664_10202700
947 Ga0207644_10075898
948 Ga0207644_10195015
949 Ga0207690_10026441
950 Ga0207690_10073083
951 Ga0207706_10005602
952 Ga0207669_10231408
953 Ga0207665_10240531
954 Ga0207711_10442249
955 Ga0207689_10288031
956 Ga0207661_10001401
957 Ga0207661_10316452
958 Ga0207661_10461469
959 Ga0207667_10193371
960 Ga0207667_10303469
961 Ga0207712_10070744
962 Ga0207712_10185067
963 Ga0207668_10022781
964 Ga0207668_10207376
965 Ga0207640_10007164
966 Ga0207640_10181904
967 Ga0207658_10003739
968 Ga0207677_10042987
969 Ga0207677_10358039
970 Ga0207639_10289303
971 Ga0207678_10472643
972 Ga0207708_10047840
973 Ga0207702_10107652
974 Ga0207702_10219138
975 Ga0207702_10362082
976 Ga0207702_10374106
977 Ga0207648_10049936
978 Ga0207648_10056812
979 Ga0207648_10057970
980 Ga0207674_10040199
981 Ga0207675_100001015
982 Ga0207675_100002032
983 Ga0207683_10050082
984 Ga0207698_10141432
985 Ga0207698_10180431
986 Ga0207428_10028425
987 Ga0265336_10003729
988 Ga0265324_10013537
989 Ga0265340_10006557
990 Ga0307408_100087099
991 Ga0307408_100139721
992 Ga0265313_10024931
993 Ga0307405_10243330
994 Ga0307405_10293212
995 Ga0307413_10088670
996 Ga0307407_10086629
997 Ga0307407_10108254
998 Ga0307409_100264833
999 Ga0307416_100024939
1000 Ga0307416_100256291
1001 Ga0307414_10077881
1002 Ga0307411_10205124
1003 Ga0307415_100149544
1004 Ga0373958_0014349
1005 Ga0373944_0004552
1006 Ga0373944_0090639
1007 Ga0373945_0002806
1008 Ga0373945_0007576
1009 Ga0373945_0026214
1010 Ga0373960_0017999
1011 Ga0373943_0006660
1012 Ga0373943_0010455
1013 Ga0373943_0029755
1014 Ga0373946_0003486
1015 Ga0373961_0026375
1016 Ga0373924_0181216
1017 Ga0373931_0236112
1018 Ga0373931_0281904
1019 Ga0373935_0019823
1020 Ga0373935_0053217
1021 Ga0373947_0002323
1022 Ga0373947_0012264
1023 Ga0373947_0033498
1024 Ga0373947_0315409
1025 Ga0373925_0005408
1026 Ga0373925_0054964
1027 Ga0395899_0002477
1028 Ga0395899_0004322
1029 Ga0395899_0100204
1030 Ga0395899_0157036
1031 Ga0395899_0185805
1032 Ga0395900_0003203
1033 Ga0395900_0005102
1034 Ga0395900_0008552
1035 Ga0395900_0116060
1036 Ga0395900_0122553
1037 Ga0395900_0599885
1038 Ga0395898_0010794
1039 Ga0395898_0011779
1040 Ga0395898_0013287
1041 Ga0395898_0022687
1042 Ga0395898_0055207
1043 Ga0395898_0149118
1044 Ga0395898_0211013
1045 Ga0395905_0000568
1046 Ga0395905_0018824
1047 Ga0395905_0042892
1048 Ga0395905_0105509
1049 Ga0395905_0137950
1050 Ga0395901_0008882
1051 Ga0395901_0012951
1052 Ga0395901_0012998
1053 Ga0395901_0049630
1054 Ga0395901_0061179
1055 Ga0395901_0137441
1056 Ga0395901_0200733
1057 Ga0395901_0544102
1058 Ga0395901_0565012
1059 Ga0395901_0641247
1060 Ga0395901_0767855
1061 Ga0436363_0658494
1062 Ga0439447_031891
1063 Ga0451789_1111844
1064 Ga0451802_0966161
1065 Ga0451849_0053658
1066 Ga0451851_0696550
1067 Ga0451855_1495820
1068 Ga0439448_0018733
1069 Ga0439446_0010089
1070 Ga0439458_0006164
1071 Ga0466961_0002298
1072 Ga0466961_0068358
1073 Ga0466963_0002261
1074 Ga0466963_0005306
1075 Ga0466963_0022081
1076 Ga0466963_0026259
1077 Ga0466963_0043669
1078 Ga0466963_0228220
1079 Ga0466963_0379323
1080 Ga0466964_0002218
1081 Ga0466964_0002975
1082 Ga0466971_0000910
1083 Ga0466968_0060418
1084 Ga0466957_0000349
1085 Ga0466957_0097550
1086 Ga0466957_0101416
1087 Ga0466960_0084353
1088 Ga0466959_0024411
1089 Ga0466959_0037515
1090 Ga0451576_0013003
1091 Ga0451576_0996180
1092 Ga0466958_0000685
1093 Ga0466958_0081755
1094 Ga0466967_0000265
1095 Ga0466967_0001447
1096 Ga0466967_0030138
1097 Ga0466967_0039010
1098 Ga0466967_0043204
1099 Ga0466967_0053883
1100 Ga0466967_0062904
1101 Ga0466967_0076865
1102 Ga0466967_0091674
1103 Ga0466967_0097322
1104 Ga0466967_0099074
1105 Ga0466967_0162355
1106 Ga0466967_0172958
1107 Ga0466967_0181900
1108 Ga0466967_0195505
1109 Ga0466967_0221155
1110 Ga0466967_0325398
1111 Ga0466967_0368778
1112 Ga0495592_0063223
1113 Ga0495603_0001442
1114 Ga0495603_0035613
1115 Ga0495603_0052007
1116 Ga0495629_0000880
1117 Ga0495629_0366119
1118 Ga0495629_0471883
1119 Ga0495641_0000552
1120 Ga0495641_0013029
1121 Ga0495641_0041163
1122 Ga0495641_0079837
1123 Ga0495641_0168366
1124 Ga0495651_0042661
1125 Ga0495651_0090289
1126 Ga0495653_0086536
1127 Ga0495580_0017054
1128 Ga0495582_0000240
1129 Ga0495582_0297671
1130 Ga0495605_0167590
1131 Ga0495639_0004699
1132 Ga0495639_0180077
1133 Ga0495662_0001469
1134 Ga0495662_0099717
1135 Ga0495664_0027647
1136 Ga0495584_0051989
1137 Ga0495594_0004755
1138 Ga0495594_0028377
1139 Ga0495607_0079927
1140 Ga0495608_0018577
1141 Ga0495608_0407445
1142 Ga0495618_0249383
1143 Ga0495630_0034360
1144 Ga0495630_0070298
1145 Ga0495630_0104747
1146 Ga0495631_0140239
1147 Ga0495644_0047065
1148 Ga0495663_0018172
1149 Ga0495663_0056413
1150 Ga0495666_0007316
1151 Ga0495666_0082876
1152 Ga0495642_0053740
1153 Ga0495652_0146616
1154 Ga0495665_0000685
1155 Ga0495640_0284578
1156 Ga0495586_0180282
1157 Ga0495586_0220157
1158 Ga0495587_0040463
1159 Ga0495587_0178530
1160 Ga0495609_0049345
1161 Ga0495609_0102280
1162 Ga0495621_0107452
1163 Ga0495645_0031083
1164 Ga0495645_0128823
1165 Ga0495667_0030843
1166 Ga0495667_0055962
1167 Ga0495656_0006370
1168 Ga0495656_0247325
1169 Ga0495634_0061886
1170 Ga0495635_0086918
1171 Ga0495659_0035500
1172 Ga0495661_0061563
1173 Ga0495657_0084673
1174 Ga0495657_0095307
1175 Ga0495657_0130346
1176 Ga0495647_0040438
1177 Ga0495658_0000782
1178 Ga0495658_0022699
1179 Ga0495658_0052773
1180 Ga0495658_0101207
1181 Ga0495658_0255619
1182 Ga0495613_0015795
1183 Ga0495624_0009739
1184 Ga0495624_0083370
1185 Ga0495624_0207280
1186 Ga0495589_0058362
1187 Ga0495600_0001921
1188 Ga0495581_0000754
1189 Ga0495581_0021980
1190 Ga0495581_0110593
1191 Ga0495604_0081923
1192 Ga0495604_0088813
1193 Ga0495674_0041425
1194 Ga0495674_0127424
1195 Ga0495674_0173434
1196 Ga0495674_0373028
1197 Ga0495676_0000116
1198 Ga0495676_0004439
1199 Ga0495676_0198519
1200 Ga0495676_0388227
1201 Ga0495680_0007595
1202 Ga0495680_0228477
1203 Ga0495680_0436137
1204 Ga0495675_0184308
1205 Ga0495677_0024988
1206 Ga0495685_145065
1207 Ga0495684_0277226
1208 Ga0495684_0344114
1209 Ga0495593_0011497
1210 Ga0495602_0094660
1211 Ga0495615_0053522
1212 Ga0496100_0084246
1213 Ga0496100_0096496
1214 Ga0496100_0530197
1215 Ga0496101_0022022
1216 Ga0496101_0085441
1217 Ga0496102_0087944
1218 Ga0496102_0488914
1219 Ga0496103_0056976
1220 Ga0496103_0120367
1221 Ga0496104_0036190
1222 Ga0496104_0216154
1223 Ga0496105_0000804
1224 Ga0496105_0006495
1225 Ga0496105_0027403
1226 Ga0496105_0068622
1227 Ga0496105_0089690
1228 Ga0496105_0336210
1229 Ga0496105_0400977
1230 Ga0496106_0007207
1231 Ga0496106_0091234
1232 Ga0496106_0118590
1233 Ga0496106_0133329
1234 Ga0496106_0289510
1235 Ga0496107_0005507
1236 Ga0496107_0011620
1237 Ga0496107_0170408
1238 Ga0496108_0004142
1239 Ga0496108_0006063
1240 Ga0496108_0052834
1241 Ga0496108_0276687
1242 Ga0496109_0002881
1243 Ga0496109_0005058
1244 Ga0496109_0037984
1245 Ga0496109_0102753
1246 Ga0496109_0111135
1247 Ga0496109_0146250
1248 Ga0496109_0350159
1249 Ga0496110_0003995
1250 Ga0496110_0017934
1251 Ga0496110_0034680
1252 Ga0496110_0053367
1253 Ga0496110_0123347
1254 Ga0496110_0191517
1255 Ga0496111_0000612
1256 Ga0496111_0004721
1257 Ga0496111_0034872
1258 Ga0496111_0159260
1259 Ga0496111_0414961
1260 Ga0496112_0004864
1261 Ga0496112_0078048
1262 Ga0496112_0086100
1263 Ga0496112_0111165
1264 Ga0496112_0147600
1265 Ga0496112_0176537
1266 Ga0496113_0001184
1267 Ga0496113_0078045
1268 Ga0496113_0215453
1269 Ga0496114_0024067
1270 Ga0496114_0061843
1271 Ga0496114_0093268
1272 Ga0496114_0182046
1273 Ga0496114_0183884
1274 Ga0496114_0185265
1275 Ga0496114_0320670
1276 Ga0496114_0693683
1277 Ga0496115_0003315
1278 Ga0496115_0010047
1279 Ga0496115_0015265
1280 Ga0496115_0059343
1281 Ga0496115_0172204
1282 Ga0501031_0000814
1283 Ga0501031_0027568
1284 Ga0501031_0074413
1285 Ga0501032_0028423
1286 Ga0501032_0035166
1287 Ga0501032_0112771
1288 Ga0501032_0254922
1289 Ga0501033_0079862
1290 Ga0501034_0210123
1291 Ga0501036_0000261
1292 Ga0501036_0114443
1293 Ga0501036_0139435
1294 Ga0501036_0177672
1295 Ga0501038_0011161
1296 Ga0501038_0013580
1297 Ga0501038_0214327
1298 Ga0501038_0350145
1299 Ga0501039_0003652
1300 Ga0501039_0012492
1301 Ga0501039_0088738
1302 Ga0501039_0135774
1303 Ga0501039_0295901
1304 Ga0501039_0513541
1305 Ga0501040_0000344
1306 Ga0501040_0009035
1307 Ga0501040_0020599
1308 Ga0501040_0025005
1309 Ga0501040_0134826
1310 Ga0501041_0004745
1311 Ga0501041_0036076
1312 Ga0501041_0043809
1313 Ga0501041_0080096
1314 Ga0501041_0152477
1315 Ga0501042_0000265
1316 Ga0501042_0015339
1317 Ga0501042_0016132
1318 Ga0501042_0043624
1319 Ga0501042_0205507
1320 Ga0501043_0069592
1321 Ga0501043_0119159
1322 Ga0501043_0146105
1323 Ga0501043_0191308
1324 Ga0501046_0004011
1325 Ga0501046_0093483
1326 Ga0501046_0147840
1327 Ga0501048_0003306
1328 Ga0501048_0015084
1329 Ga0501048_0051199
1330 Ga0501048_0054897
1331 Ga0501048_0133718
1332 Ga0501067_0000979
1333 Ga0501067_0001810
1334 Ga0501067_0017011
1335 Ga0501068_0073555
1336 Ga0501068_0089194
1337 Ga0501069_0001159
1338 Ga0501069_0003793
1339 Ga0501069_0005476
1340 Ga0501069_0058073
1341 Ga0501069_0063889
1342 Ga0501069_0136325
1343 Ga0501069_0319194
1344 Ga0501070_0037313
1345 Ga0501070_0060668
1346 Ga0501070_0146868
1347 Ga0501070_0224926
1348 Ga0501070_0304167
1349 Ga0501071_0000599
1350 Ga0501071_0007145
1351 Ga0501071_0010208
1352 Ga0501071_0021065
1353 Ga0501071_0057058
1354 Ga0501071_0171876
1355 Ga0501071_0306972
1356 Ga0501072_0001550
1357 Ga0501072_0012442
1358 Ga0501072_0196799
1359 Ga0501072_0240263
1360 Ga0501072_0641274
1361 Ga0501073_0120634
1362 Ga0501074_0011485
1363 Ga0501074_0021865
1364 Ga0501074_0077037
1365 Ga0501074_0083446
1366 Ga0501075_0001217
1367 Ga0501075_0001579
1368 Ga0501075_0002376
1369 Ga0501075_0010127
1370 Ga0501075_0022084
1371 Ga0501075_0266614
1372 Ga0501076_0000330
1373 Ga0501076_0003816
1374 Ga0501076_0008579
1375 Ga0501076_0008610
1376 Ga0501076_0035301
1377 Ga0501076_0064116
1378 Ga0501076_0067975
1379 Ga0501076_0100765
1380 Ga0501076_0182087
1381 Ga0501077_0002195
1382 Ga0501077_0002794
1383 Ga0501077_0006316
1384 Ga0501077_0008751
1385 Ga0501077_0017848
1386 Ga0501077_0254147
1387 Ga0501079_0001641
1388 Ga0501079_0003329
1389 Ga0501079_0004610
1390 Ga0501079_0014630
1391 Ga0501079_0032577
1392 Ga0501080_0003166
1393 Ga0501080_0026343
1394 Ga0501080_0027682
1395 Ga0501080_0201343
1396 Ga0501080_0314666
1397 Ga0501081_0001194
1398 Ga0501081_0027450
1399 Ga0501081_0028154
1400 Ga0501081_0076890
1401 Ga0501081_0230129
1402 Ga0501081_0321862
1403 Ga0501083_0002907
1404 Ga0501035_0006323
1405 Ga0501035_0016071
1406 Ga0501035_0017965
1407 Ga0501035_0069006
1408 Ga0501035_0441253
1409 Ga0501044_0122443
1410 Ga0501044_0427656
1411 Ga0501045_0000784
1412 Ga0501045_0001676
1413 Ga0501045_0007858
1414 Ga0501045_0160576
1415 nmdc:mga00v17_448297_c1
1416 nmdc:mga0yw44_22461_c1
1417 nmdc:mga05p37_172096_c1
1418 nmdc:mga09592_7067_c1
1419 nmdc:mga0qj67_24935_c1
1420 nmdc:mga0qj67_81299_c1
1421 nmdc:mga06r32_93487_c1
1422 nmdc:mga08y16_1379983_c1
1423 nmdc:mga08y16_68620_c1
1424 nmdc:mga0n895_270519_c1
1425 nmdc:mga0n895_391736_c1
1426 nmdc:mga0n895_9385_c1
1427 nmdc:mga0rr50_271289_c1
1428 nmdc:mga0rr50_275284_c1
1429 nmdc:mga0rr50_6260_c1
1430 nmdc:mga0rr50_62897_c1
1431 nmdc:mga08x19_36082_c1
1432 nmdc:mga08x19_52464_c1
1433 nmdc:mga08x19_64759_c1
1434 nmdc:mga0a205_129154_c1
1435 nmdc:mga0a205_294415_c1
1436 nmdc:mga0a205_48662_c1
1437 Ga0495601_0010791
1438 Ga0495601_0055221
1439 Ga0495601_0124934
1440 Ga0495612_0008646
1441 Ga0495595_0010409
1442 Ga0495595_0010825
1443 Ga0495595_0039080
1444 Ga0495619_0027625
1445 Ga0495619_0033979
1446 Ga0495619_0077742
1447 Ga0495619_0165134
1448 Ga0501084_0001989
1449 Ga0501084_0024246
1450 Ga0501084_0025078
1451 Ga0501084_0047299
1452 Ga0501084_0082522
1453 Ga0501084_0232568
1454 Ga0590071_037197
1455 Ga0501082_0002118
1456 Ga0501082_0011430
1457 Ga0501082_0015729
1458 Ga0501082_0068994
1459 Ga0530510_0010431
1460 Ga0530510_0020673
1461 Ga0530510_0036878
1462 Ga0530510_0119546

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

105

203

0.88

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

37

252

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.9006 52 221
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8753 56 221
3cjq-assembly1.cif.gz_A ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.8672 42 221
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8667 64 221
5eku-assembly1.cif.gz_B crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine 0.8558 97 166
ID Description Score Start End Superfamily
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9181 110 154 3.40.50.150
af_Q8IHP7_693_845_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8999 110 154 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8906 91 221 3.40.50.150
af_Q9FN34_163_370_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.881 57 221 3.40.50.150
af_Q2FXZ4_114_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8766 55 221 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A538IEE3-F1-model_v4 Methyltransferase 0.9269 59 222 GO:0008276
GO:0032259
AF-A0A7V9CRN4-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9253 2 222 GO:0005840
GO:0008276
GO:0032259
AF-A0A4R9VHA3-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9193 57 158 GO:0005840
GO:0008276
GO:0032259
AF-A0A7V9CRN4-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9173 2 222 GO:0005840
GO:0008276
GO:0032259
AF-A0A6J6P8C7-F1-model_v4 Unannotated protein 0.9106 41 222 GO:0008276
GO:0032259

Map